1OF5A

Crystal structure of mex67-mtr2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
221
structure length
154
Chain Sequence
b'QQFFFENDALGQSSTDFATNFLNLWDNNREQLLNLYSPQSQFSVSVDSTSIGQESINSIFKTLPKTKHHLQEQPNEYSMETISYPQINGFVITLHGFFEETSNNKLSKKSFDRTWVIVPMNNSVIIASDLLTVRAYSTGAWKTASIAIAQAAGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MRNA EXPORT FACTOR MEX67
publication title Structural similarity in the absence of sequence homology of the messenger RNA export factors Mtr2 and p15.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear transport
total genus 35
structure length 154
sequence length 221
ec nomenclature
pdb deposition date 2003-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1of5A00
5IG4A 4HZ9B 2B1XB 5DRVA 3MHEA 4HM0B 2JQ5A 3FKAA 4HKVB 4XB5A 3ER7A 1JN5B 1U5OA 3HZPA 4LEHA 4LGQA 2RCDA 1OGZA 5KP3A 2K54A 4ORLA 1OUNA 3F7XA 1SJWA 5BVBA 4HM6B 3G0KA 2I9WA 2Z76A 4I4KA 4WP5A 3FSDA 5BXQA 3STDA 4J8TA 1JN5A 1GY7A 5HGRA 3CPOA 3K7CA 2BMQB 1Q40A 4HM3B 5AIGA 2INXA 3MG3A 4LMIA 2CKFB 3UJMA 4WYKA 3F40A 4FCJA 1EA2A 3VSYA 3F9SA 4XBXA 3EC9A 2PZVA 1ULIB 3B4OA 3KKGA 3MSOA 3EN1B 3CNXA 2XSOB 1VZZA 4XDVA 3OWYA 3OX9A 3JUNA 5IF6A 3EN8A 4HM1B 5JPUA 3H51A 4MJDA 3F8XA 4OVMA 1S5AA 1UUVB 5DREA 1GS3A 4HM8B 7STDA 1JB2A 1O7GB 1IDPA 3GZRA 2HMJB 3DZLA 8CHOA 3FF2A 5CK6A 3NUVA 3GWRA 3G8ZA 3G16A 1OH0A 4RZMA 1QJGA 3SOAA 3SEDA 2IMJA 1GY6A 3RGAA 3I0YA 4X2HA 4HM2B 5STDA 3EHCA 1E3RA 3S5CA 1ULJB 4N3VA 3F8HA 1O7NB 3EX9A 1A2KA 3DXOA 3NHXA 3GZBA 3LYGA 4HZBB 3KZTA 1OGXA 4XM4A 4R9KA 4K1VA 3CU3A 2OWPA 2YFJB 3B4PA 3UNLA 2HMOB 3IPTA 4GB5A 2B24B 2UX0A 3JUOA 1NDOB 2STDA 3MKIA 4FCMA 1Q40B 1DMMA 3DMCA 4L8PA 3BB9A 3GZYB 4WYKB 3FGYA 2GXFA 3EF8A 1W00A 2BNGA 1ZX2A 4HM7B 3B8LA 2GEYA 2GEXA 2HMKB 3B7CA 5CF1A 5IG5A 3FZWA 2F98A 1OHOA 3SOYA 3JUQA 5CXOA 3BLZA 5CLKA 3MYTA 3JUPA 4L8OA 1W02A 1ASKA 1OF5A 1JB5A 1DMNA 5TGNA 5JPPA 1GY5A 2CHCA 5G2GA 5KP1A 3EBTA 4HJLB 2Z77A 4CDLA 2XR8B 5FW5A 5IG3A 3NXJA 4R9LA 3E99A 3NV0A 3NBRA 2HMMB 3GZXB 3OV4A 1EG9B 3HK4A 1QMAA 1W01A 5AI1A 4WWUC 1WQLB 1STDA 3NM2A 3KE7A 4PEJA 1E97A 3CNMA 3DUKA 5KP4A 4HM5B 5IEOA 2XSHB 5AEWB 5AIHA 4XBTA 3EJVA 3FF0A 2RFRA 4K1UA 3LZAA 3H3HA 1UUWB 4KVHA 4J9AA 4X2OA 3JUMA 2HMNB 1W6YA 2QGUA 3OXAA 3ECFA 1ISKA 1CQSA 3DM8A 5AEUB 2QIYA 1OF5B 1OPYA 1ZO2A 3RGRA 3ROBA 1K41A 2GBXB 2F99A 1NU3A 1JKGB 3EQQB 3FH1A 1GYBA 5D81A 3EBYA 1OHSA 3NV0B 5AIIA 2YFIB 4L7KA 1TUHA 1AR0A 3T8NA 4XDWA 1HKXA 1OHPA 4H3UA 3Q90A 3MG2A 2R4IA 3K0ZA 3OWSA 4HVNA 1E3VA 1O7WB 3KSPA 3GRDA 1DMQA 2YFLB 3A76A 5D83A 4Q53A 4R1KA 3F7SA 4XBYA 1NWWA 1O7PB 1JKGA 5CF2A 2XRXB 5IENA 3T8UA 3M8CA 2BMOB 5IG0A 2BMRB 3FLJA 1O7MB 2HMLB 5IERA 1Z1SA 4OUQA 4STDA 4IIAA 3D9RA 4HM4B 1O7HB 3MG1A 5AIFA 1Q42A 2GBWB 3WMDA 5IEPA 1BUQA 2F86B 3HX8A 5EVHA 2A15A 2W2CA 5D82A 2RGQA 1TP6A 1JB4A 3OWUA 4U13A 2Z7AA 3VGNA 6STDA 1C7HA 3F14A 1OCVA
chains in the Genus database with same CATH superfamily
5IG4A 1NJI4 1W5ZA 2BU4A 4HZ9B 4N6NB 1NB3I 1B27A 1AV4A 1W7CA 1IV9A 2B1XB 6GSPA 5DRVA 5RNTA 2O9UX 3MHEA 4HM0B 2JQ5A 3FKAA 3LTCA 4HKVB 4N6LA 1GD4A 4XB5A 5G1KA 3X42A 3ER7A 5A0OB 1JN5B 1Y4KA 1U5OA 1ZGXA 2OQEC 3HZPA 3DGYA 4LEHA 1GOYA 4LGQA 3ZG0A 2WOHA 2RCDA 1OGZA 1TFKA 5KP3A 1VQ73 2K54A 1FUWA 4ORLA 1BVIA 1OUNA 3F7XA 1JV2B 2W56A 1HU9A 1N9EA 1SJWA 4EYCA 2ZDJA 1CH0A 3HOHA 4BU4A 5BVBA 3LT9A 1EEJA 1WMPA 1TFOA 3NBJA 4J5KA 3ALAA 2KRTA 3CCJ3 1IQYA 4HM6B 4I5QA 3G0KA 2W9QA 2I9WA 1X1UA 1A2VA 2XH9A 3BNCA 4N6V0 4EV2A 2Z76A 4I4KA 2D1WA 5M18A 1IT7A 2KF5A 1D6YA 3I553 3PS8A 4WP5A 1BSEA 4AKYA 3FSDA 5BXQA 3STDA 1MWRA 1IT8A 4GSPA 1DVDA 4J8TA 1JN5A 5BU4A 1GY7A 1IU7A 2LYXA 3CPOA 3K7CA 5HGRA 1I2EA 3DH2A 1GOUA 3CD63 1IVUA 3GSPA 2BMQB 1DETA 1Q40A 4HM3B 1PU4A 1VQP3 2Y73A 1VQK3 5AIGA 3PXMA 2INXA 2FGTA 3LT8A 3MG3A 4LMIA 1STFI 1BNIA 2CKFB 1BRIA 2CK3H 1B2XA 2L4VA 4WYKA 3UJMA 4O8SA 3F40A 4FCJA 1EA2A 3VSYA 2W0QA 3D4AA 3F9SA 4XBXA 3EC9A 1B2UA 2PZVA 1ULIB 1Q814 1FYSA 3LTBA 3B4OA 3KKGA 2CX0A 3MSOA 3WOFB 1UGIA 3EN1B 3LH4A 3CNXA 1RCLA 3U97A 2XSOB 1VZZA 3U1WA 4XDVA 3NBBA 3OWYA 2WOFA 3OX9A 3JUNA 4O3VA 2ML6A 1B2ZA 3HI7A 5IF6A 3CCS3 1UI7A 3EN8A 4HM1B 1JBRA 5JPUA 3AMOB 3H51A 3K63A 4MJDA 1VQ93 1IV7A 1AQZA 1UCLA 3F8XA 4GHOA 4HOHA 4OVMA 2WGOA 1S5AA 1UUVB 5DREA 1GS3A 4HM8B 7STDA 1SIIA 4OK0A 1AY7A 1JB2A 1O7GB 1IDPA 1RGAA 2Q07A 3GZRA 2HMJB 3DZLA 1RLSA 8CHOA 3FF2A 3GAXA 5CK6A 3NUVA 3GWRA 2QA43 2MF7A 3N8BA 3G8ZA 2P0MA 1KWIA 1KSIA 1BRGA 1OH0A 3G16A 4R80A 3V98A 4ZM8A 3CCQ3 4HYZA 4RZMA 2W03A 1QJGA 2KF6A 3SOAA 1FZUA 1W4NA 3SEDA 2IMJA 1GY6A 3RGAA 3I0YA 4RBNA 4X2HA 3D3LA 3LTDA 4HM2B 1V57A 5STDA 1BUJA 2P38A 1T5YA 3EHCA 4HBRA 1E3RA 3S5CA 3CCE3 1ULJB 4N3VA 3F8HA 3S29A 3AGOA 3KN4A 3WR2A 1O7NB 3EX9A 6RNTA 3AMOA 1A2KA 4FMAA 3DXOA 3NHXA 3GZBA 1I3IA 1BSDA 2RSXA 3LYGA 3PCSA 3PGBA 4HZBB 3KZTA 3UL5A 1YNVX 1OGXA 1N9JA 3MPHA 1BNJA 1BNSA 2OOVC 3V92A 3WODG 2OQEA 1X1XA 3X41A 1Q7HA 1G96A 2GSPA 4XM4A 2L1SA 4R9KA 4K1VA 4R4KA 4AKZA 3CCM3 3CU3A 1J2BA 4O2HA 3KSED 4HAAA 1RKYA 2OWPA 2YFJB 2Y74A 3B4PA 1B20A 3IJEB 2HMOB 2WGQA 4ILFA 3IPTA 3UNLA 3PCRA 1IK3A 1JBSA 3MWZA 4FMCA 1UI8A 2B24B 4GB5A 1T2HA 2UX0A 2YX9A 1T2IA 1RGFA 2BO9B 3JUOA 1IVXA 1NDOB 1RN4A 2STDA 3LMLA 1RTUA 3MKIA 1A67A 1SPUA 1LRAA 4FCMA 1YJW3 1TTOA 3PZWA 1Q40B 1DMMA 3DMCA 1MOLA 4JRFA 1I0XA 1BOXA 5EEOA 3X3ZA 3FG4A 4NHFA 4L8PA 3BB9A 3WOEB 1LQGC 2CWVA 1K28A 3X3YA 1OACA 1SIHA 3GZYB 4WYKB 1FW7A 2KF3A 3FGYA 3K9MC 1RMSA 2V1LA 2GXFA 2FNQA 3EF8A 1GOVA 1W00A 1YHQ3 3SX1A 1HYFA 1AVKA 3G713 2BNGA 1ZX2A 2SARA 2CC3A 1G0TA 2C4BA 2CH9A 4RNZA 1A90A 2Z6BA 3BNEA 4HM7B 2CW9A 3Q1CA 3B8LA 2GEYA 2GEXA 7GSPA 2P09A 2HMKB 3B7CA 4N6TA 3LTAA 4EC6A 5CF1A 3HIIA 5IG5A 3OW22 2H0IA 1MWTA 3FZWA 1WMNA 2CFKA 1OHOA 1D6ZA 1F8NA 2F98A 3D79A 1HZ1A 2F5WA 3SOYA 1UUGB 3JUQA 4WFOA 5CXOA 2OTJ3 3BLZA 1WNHA 3L0RA 4N6UA 3EE1A 3BNDA 5CLKA 5IW9A 1G02A 1CYUA 3MYTA 2PNCA 1PFPA 3JUPA 1BSCA 4FMDA 1YGEA 1GMQA 4KT3B 4L8OA 1BNFA 2E2VA 1VQO3 1W02A 5FGOA 4CJNA 4EV5A 3RDEA 1UW1A 1ASKA 5M1AA 2J8XB 2O3OA 4IPBA 1RGKA 1B21A 2KAAA 1OF5A 1JB5A 4JF8A 1DMNA 5TGNA 1MGRA 3WDGB 3X40A 1M1XB 1EQKA 1L5GB 5JPPA 1GY5A 1FGQA 2CHCA 5G2GA 4DKIA 5KP1A 3CCV3 1C54A 1W2ZA 1IVWA 3EBTA 4BTWA 1JRQA 1FUTA 2M7OA 4HJLB 2Z77A 2C11A 1R4CA 1RSNA 4CDLA 1TU5A 2CG1A 4H61A 3DY5A 2XR8B 2P0XA 5FW5A 5IG3A 1CYVA 1MWSA 1BGSA 3URPA 2XGNA 3NXJA 3Q2PA 4FMBA 3KIIA 4R9LA 3E99A 3NV0A 1ZS7A 3K5TA 2IUKA 3KFQC 1NNVA 1MNLA 3N54B 3NBRA 5LC7A 8RNTA 3UB1A 2BT3A 2HMMB 3CME3 3GZXB 4RNYA 1UCKA 3OV4A 1EG9B 3S28A 3CCU3 1PYLA 2AAEA 1TRPA 3HK4A 1QMAA 2HOHA 3S67A 1KD14 1N5HA 1UDII 4FCZA 1W01A 1B3SA 2BHMA 1I2GA 2OOVA 2F56A 1RJOA 5AI1A 5AYRB 1BIRA 3D5GA 4WWUC 1WQLB 3ZFZA 3NQZA 4IT7A 1STDA 3NM2A 2KF4A 2CWUA 1JBTA 3KE7A 4PEJA 1E97A 2IUJA 3CNMA 5M19A 3ZG5A 1BAOA 3DUKA 2P05A 5KP4A 2AADA 4HM5B 5JBSA 1B2SA 9RNTA 2OTL3 5IEOA 1VQ53 2XSHB 5LC6A 5G1LA 1K8A4 2K3DA 3HIGA 1US1A 2E2UA 1TJDA 4QWTA 4XBTA 5AIHA 5AEWB 3A5EA 1GSPA 3FCSB 3EJVA 3FF0A 2RFRA 2R41A 4K1UA 4NREA 1EUIC 3LZAA 5EQLA 1TIJA 2H0HA 3H3HA 1GMPA 2RBIA 1UUWB 4EXRA 4KVHA 3LOYA 2ZL8A 2F4YA 2GU3A 3EB8A 4J9AA 4X2OA 1LNHA 1RRHA 4GL6A 3JUMA 1RGGA 2JDIH 2QEX3 1LXEA 2HMNB 4MEIA 2XEPA 3BIRA 3AHSA 1BRHA 1LOYA 1RDSA 4BIRA 3SLUA 1W6YA 2QGUA 1UGHI 1BRKA 1X1WA 2ZA4A 2RNTA 3OXAA 1VQ63 2W04A 3ECFA 4CPKA 2KCDA 4BTXA 5BIRA 1ISKA 1CQSA 1QVG2 3NM7A 3D5IA 3DM8A 1N5PA 5AEUB 1N8R4 1LVNA 2QIYA 1OF5B 1W6CA 2UUGC 4J5GA 2OCTA 4K90B 1OPYA 3FG1A 2MC8A 1ZO2A 4MMZB 2ML5A 1YI23 3RGRA 3WHOA 1R4YA 1SQWA 3CC43 4BTYA 2D42A 3ROBA 1M9GA 1K41A 2IY2A 1Q824 1SARA 2GBXB 1YVBI 5I97A 1ROAA 2F99A 1LOVA 1I70A 3N9HA 4TX4A 1NU3A 1V58A 1RGEA 1RGLA 4LZIA 1JKGB 1UCIA 1QALA 1U8CB 3EQQB 3FH1A 1VQQA 1EKMA 1GYBA 3DGNA 5D81A 3UL6A 3EBYA 2CFLA 3IMAB 3QK9A 3SYUA 4NPBA 1IQ8A 1OHSA 1QAKA 1RGHA 1RN7A 1KC84 3QRDA 3G4S3 3CC73 3NV0B 5AIIA 4G1MB 1BNRA 2YFIB 2CFGA 2LQVA 3V99A 1VQ83 4L7KA 1I2FA 1RRLA 1TUHA 1QAFA 2CIUA 3BU4A 1AR0A 3NX0A 1Q864 3T8NA 1BSBA 4XDWA 1LOWA 1N8QA 1HKXA 1OHPA 1RHLA 1YVSA 1IVVA 4N6MA 1JNQA 4H3UA 3Q90A 1FGMA 4MMXB 1PY3A 1BRSA 2IA7A 3MG2A 2R4IA 4LSOA 1DE3A 1LNIA 3K0ZA 3LXUX 3OWSA 4HVNA 3S27A 1E3VA 3SXXA 2SBLA 1O7WB 1I8VA 2XFSA 3BNBA 3GRDA 1DMQA 1JZOA 3KSPA 2YFLB 4WHAA 1K734 1QVF2 3A76A 5D83A 2GU1A 4Q53A 4R1KA 3F7SA 2H0GA 4XBYA 1CEWI 4AEQA 1FA3A 1NWWA 4MMYB 1FGTA 1LOXA 4FR9A 1YIJ3 1RNBA 1A2PA 3RNTA 4KFDA 2FXTA 4EBGA 1O7PB 3Q3FA 1JKGA 1YJN3 5CF2A 1FGOA 1UCJA 1WMOA 1MGWA 5AYSC 3TDGA 2C10A 2CFDA 3X3XA 2XRXB 5IENA 2BIRA 2W9PA 3T8UA 1Q7Y4 1Q9EA 1M1K4 1BU4A 3NQYA 3M8CA 3CMA3 2KXGA 2BMOB 4KFEA 2CG0A 3JVCA 3DGMA 5IG0A 4N6OB 1BNGA 3CC23 4BL2A 1TRQA 2BMRB 3FLJA 5ELJA 1O7MB 3G6E3 2W6JH 2HMLB 3CXC2 1W6GA 4LYLB 5IERA 2CWTA 1W2B2 1Z1SA 4OUQA 1D6UA 1KQS2 2F5MA 4STDA 4IIAA 2E2TA 3D9RA 1BSAA 1VQM3 1I0VA 3T0UA 2XGLA 4HM4B 1O7HB 1ROVA 3MG1A 5AIFA 1GMRA 1M904 2UGIA 4EW5A 1GD3A 2IYJA 3CCR3 2CX1A 3I563 3AHWA 1DVCA 2CFWA 3PYJA 1VQN3 1Q42A 3WA2X 1RGCA 2GBWB 2K0MA 3DGLA 3WMDA 3O8YA 1VQL3 5IEPA 1X1YA 4KFFA 1BRJA 3WA3A 1BANA 1BUQA 2F86B 1RNTA 3DGOA 1S723 5HOHA 2ZHXB 1YIT3 1T3BA 3HX8A 1BRNL 4K61A 3SVAA 3CCL3 5ELUA 4CCVA 2WO0A 1JJ22 5EVHA 2A15A 3KCHA 7RNTA 2W2CA 3VF1A 1YGWA 1NB5I 1IYYA 5D82A 2W56B 1FUSA 2RGQA 5GSPA 1BNEA 1TP6A 4KZ1A 2XFTA 1DYUA 3CPW2 1YJ93 1I3FA 1VQ43 2XF3A 1JB4A 1FGRA 1NO3A 1LQMB 4RNTA 3J7Yd 1RN1A 3FG3A 1JZDA 3OWUA 4O02B 2Z7AA 1WTHA 4U13A 1MWUA 3VGNA 6STDA 3AGNA 1C7HA 1IQXA 1AVLA 3F14A 1K9M4 1V74A 1B2MA 1RCKA 1OCVA 4BL3A
chains in the Genus database with same CATH topology
5IG4A 1NJI4 1W5ZA 4N6NB 4HZ9B 1NB3I 1AV4A 1W7CA 1IV9A 2B1XB 5DRVA 2O9UX 3MHEA 4HM0B 2JQ5A 3FKAA 3LTCA 4HKVB 4N6LA 1GD4A 4XB5A 3X42A 5A0OB 3ER7A 1JN5B 1Y4KA 1U5OA 3HZPA 2OQEC 4LEHA 4LGQA 2WOHA 2RCDA 1OGZA 1TFKA 5KP3A 1VQ73 2K54A 1FUWA 4ORLA 1OUNA 3F7XA 1JV2B 2W56A 1HU9A 1N9EA 1SJWA 4EYCA 2ZDJA 5BVBA 3LT9A 1WMPA 1TFOA 3NBJA 3ALAA 2KRTA 3CCJ3 1IQYA 4HM6B 3G0KA 2W9QA 2I9WA 2XH9A 1A2VA 3BNCA 4N6V0 4EV2A 2Z76A 4I4KA 2D1WA 1IT7A 1D6YA 3I553 3PS8A 4WP5A 4AKYA 3FSDA 5BXQA 3STDA 1IT8A 1DVDA 4J8TA 1JN5A 1GY7A 1IU7A 2LYXA 3CPOA 3K7CA 5HGRA 3CD63 1IVUA 2BMQB 1Q40A 4HM3B 1PU4A 1VQP3 2Y73A 1VQK3 5AIGA 3PXMA 2INXA 2FGTA 3LT8A 3MG3A 4LMIA 1STFI 2CKFB 2CK3H 2L4VA 4WYKA 3UJMA 4O8SA 3F40A 4FCJA 1EA2A 3VSYA 2W0QA 3F9SA 4XBXA 3EC9A 2PZVA 1ULIB 1Q814 3LTBA 3B4OA 3KKGA 3MSOA 3WOFB 3LH4A 3EN1B 3CNXA 3U97A 2XSOB 1VZZA 3U1WA 4XDVA 3NBBA 3OWYA 2WOFA 3OX9A 3JUNA 4O3VA 2ML6A 3HI7A 5IF6A 3CCS3 1UI7A 3EN8A 4HM1B 5JPUA 3AMOB 3H51A 3K63A 4MJDA 1VQ93 1IV7A 3F8XA 4OVMA 2WGOA 1S5AA 1UUVB 5DREA 1GS3A 4HM8B 7STDA 1SIIA 4OK0A 1JB2A 1O7GB 1IDPA 2Q07A 3GZRA 2HMJB 3DZLA 8CHOA 3FF2A 3GAXA 5CK6A 3NUVA 3GWRA 2QA43 2MF7A 3N8BA 3G8ZA 2P0MA 1KWIA 1KSIA 1OH0A 3G16A 4R80A 3V98A 4ZM8A 3CCQ3 4HYZA 4RZMA 2W03A 1QJGA 3SOAA 1W4NA 3SEDA 2IMJA 1GY6A 3RGAA 3I0YA 4RBNA 4X2HA 3D3LA 3LTDA 4HM2B 5STDA 2P38A 1T5YA 3EHCA 4HBRA 1E3RA 3S5CA 3CCE3 1ULJB 4N3VA 3F8HA 3S29A 3KN4A 1O7NB 3EX9A 3AMOA 1A2KA 4FMAA 3DXOA 3NHXA 3GZBA 2RSXA 3LYGA 3PCSA 3PGBA 4HZBB 3KZTA 3UL5A 1OGXA 1N9JA 3MPHA 2OOVC 3V92A 3WODG 2OQEA 3X41A 1G96A 4XM4A 4R9KA 4K1VA 4R4KA 4AKZA 3CCM3 3CU3A 1J2BA 4O2HA 3KSED 1RKYA 2YFJB 3B4PA 2OWPA 2Y74A 3IJEB 3UNLA 2HMOB 2WGQA 1IK3A 3IPTA 3PCRA 3MWZA 4FMCA 1UI8A 2B24B 4GB5A 2UX0A 2YX9A 3JUOA 2BO9B 1IVXA 1NDOB 2STDA 3LMLA 1A67A 3MKIA 1SPUA 4FCMA 1YJW3 3PZWA 1Q40B 1DMMA 3DMCA 1MOLA 4JRFA 5EEOA 3X3ZA 3FG4A 4NHFA 4L8PA 3BB9A 3WOEB 2CWVA 1K28A 3X3YA 1OACA 1SIHA 3GZYB 4WYKB 3FGYA 3K9MC 2V1LA 2GXFA 2FNQA 3EF8A 1W00A 1YHQ3 3SX1A 1AVKA 3G713 2BNGA 1ZX2A 2CC3A 2CH9A 4RNZA 1A90A 2Z6BA 3BNEA 4HM7B 2CW9A 3Q1CA 3B8LA 2GEYA 2GEXA 2P09A 2HMKB 3B7CA 4N6TA 3LTAA 4EC6A 5CF1A 3HIIA 5IG5A 3OW22 3FZWA 1WMNA 2CFKA 1OHOA 1D6ZA 1F8NA 2F98A 3SOYA 3JUQA 4WFOA 5CXOA 2OTJ3 3BLZA 1WNHA 3L0RA 4N6UA 3EE1A 3BNDA 5CLKA 5IW9A 1CYUA 3MYTA 2PNCA 1PFPA 3JUPA 4FMDA 1YGEA 4L8OA 2E2VA 1VQO3 1W02A 5FGOA 4EV5A 3RDEA 1UW1A 1ASKA 2O3OA 4IPBA 1OF5A 1JB5A 4JF8A 1DMNA 5TGNA 3WDGB 3X40A 1EQKA 1M1XB 1L5GB 5JPPA 1GY5A 1FGQA 2CHCA 5G2GA 5KP1A 3CCV3 1W2ZA 1IVWA 3EBTA 4BTWA 1JRQA 2M7OA 4HJLB 2Z77A 2C11A 1R4CA 4CDLA 1TU5A 2CG1A 4H61A 3DY5A 2XR8B 2P0XA 5FW5A 5IG3A 1CYVA 2XGNA 3NXJA 3Q2PA 4FMBA 3KIIA 4R9LA 3E99A 3NV0A 3K5TA 2IUKA 3KFQC 3N54B 1MNLA 5LC7A 3NBRA 3UB1A 2BT3A 2HMMB 3CME3 3GZXB 4RNYA 3S28A 3OV4A 1EG9B 3CCU3 3HK4A 1QMAA 3S67A 1KD14 1N5HA 4FCZA 1W01A 2BHMA 2OOVA 1RJOA 5AI1A 5AYRB 4WWUC 1WQLB 3NQZA 4IT7A 1STDA 3NM2A 2CWUA 3KE7A 4PEJA 1E97A 2IUJA 3CNMA 3DUKA 2P05A 5KP4A 4HM5B 5JBSA 2OTL3 5IEOA 1VQ53 2XSHB 5LC6A 1K8A4 3HIGA 1US1A 2E2UA 4QWTA 4XBTA 5AIHA 5AEWB 3FCSB 3EJVA 3FF0A 2RFRA 4K1UA 4NREA 3LZAA 5EQLA 1TIJA 3H3HA 1UUWB 4EXRA 4KVHA 3LOYA 2ZL8A 2GU3A 3EB8A 4J9AA 4X2OA 1LNHA 1RRHA 4GL6A 3JUMA 2JDIH 2QEX3 1LXEA 2HMNB 4MEIA 2XEPA 3SLUA 1W6YA 2QGUA 3OXAA 1VQ63 2W04A 3ECFA 2KCDA 4BTXA 1ISKA 1CQSA 1QVG2 3NM7A 3DM8A 1N5PA 5AEUB 1N8R4 1LVNA 2QIYA 1OF5B 1W6CA 2OCTA 4K90B 1OPYA 3FG1A 2MC8A 1ZO2A 4MMZB 2ML5A 1YI23 3RGRA 1SQWA 3CC43 4BTYA 2D42A 3ROBA 1M9GA 1K41A 1Q824 2GBXB 1YVBI 5I97A 1ROAA 2F99A 3N9HA 4TX4A 1NU3A 4LZIA 1JKGB 1QALA 1U8CB 3EQQB 3FH1A 1EKMA 1GYBA 3DGNA 5D81A 3UL6A 3EBYA 2CFLA 3IMAB 3QK9A 1IQ8A 1OHSA 1QAKA 1RN7A 1KC84 3QRDA 3G4S3 3CC73 3NV0B 5AIIA 4G1MB 2YFIB 2CFGA 2LQVA 3V99A 1VQ83 4L7KA 1RRLA 1TUHA 1QAFA 2CIUA 1AR0A 3NX0A 1Q864 3T8NA 4XDWA 1N8QA 1HKXA 1OHPA 4N6MA 1IVVA 1JNQA 4H3UA 3Q90A 1FGMA 4MMXB 3MG2A 2IA7A 2R4IA 4LSOA 3K0ZA 3LXUX 3OWSA 4HVNA 3S27A 1E3VA 3SXXA 2SBLA 1O7WB 2XFSA 3BNBA 3GRDA 3KSPA 1DMQA 4WHAA 1QVF2 2YFLB 1K734 3A76A 5D83A 2GU1A 4Q53A 4R1KA 3F7SA 4XBYA 1CEWI 4AEQA 1FA3A 1NWWA 4MMYB 1FGTA 1LOXA 4FR9A 1YIJ3 4KFDA 2FXTA 4EBGA 1O7PB 1JKGA 1YJN3 5CF2A 1FGOA 1WMOA 5AYSC 3TDGA 3X3XA 2C10A 2CFDA 2XRXB 5IENA 2W9PA 1Q7Y4 3T8UA 1M1K4 3NQYA 3M8CA 3CMA3 2KXGA 2BMOB 4KFEA 2CG0A 3JVCA 3DGMA 5IG0A 4N6OB 3CC23 2BMRB 3FLJA 5ELJA 1O7MB 3G6E3 2W6JH 2HMLB 3CXC2 1W6GA 5IERA 2CWTA 1W2B2 1Z1SA 4OUQA 1D6UA 1KQS2 4STDA 4IIAA 2E2TA 3D9RA 1VQM3 3T0UA 2XGLA 4HM4B 1O7HB 1ROVA 3MG1A 5AIFA 1M904 1GD3A 3CCR3 3I563 1DVCA 2CFWA 3PYJA 1VQN3 1Q42A 3WA2X 2GBWB 2K0MA 3DGLA 3WMDA 3O8YA 1VQL3 5IEPA 4KFFA 3WA3A 1BUQA 2F86B 3DGOA 1S723 1YIT3 3HX8A 4K61A 3SVAA 3CCL3 5ELUA 4CCVA 2WO0A 1JJ22 5EVHA 2A15A 2W2CA 3VF1A 1NB5I 5D82A 2W56B 2RGQA 1TP6A 4KZ1A 2XFTA 1DYUA 3CPW2 1YJ93 1VQ43 2XF3A 1JB4A 1FGRA 1NO3A 3J7Yd 3FG3A 3OWUA 4O02B 2Z7AA 1WTHA 4U13A 3VGNA 6STDA 1K9M4 1C7HA 1IQXA 1AVLA 3F14A 1V74A 1OCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IG4 A;  4HZ9 B;  2B1X B;  5DRV A;  3MHE A;  4HM0 B;  2JQ5 A;  3FKA A;  4HKV B;  4XB5 A;  3ER7 A;  1JN5 B;  1U5O A;  3HZP A;  4LEH A;  4LGQ A;  2RCD A;  1OGZ A;  5KP3 A;  2K54 A;  4ORL A;  1OUN A;  3F7X A;  1SJW A;  5BVB A;  4HM6 B;  3G0K A;  2I9W A;  2Z76 A;  4I4K A;  4WP5 A;  3FSD A;  5BXQ A;  3STD A;  4J8T A;  1JN5 A;  1GY7 A;  5HGR A;  3CPO A;  3K7C A;  2BMQ B;  1Q40 A;  4HM3 B;  5AIG A;  2INX A;  3MG3 A;  4LMI A;  2CKF B;  3UJM A;  4WYK A;  3F40 A;  4FCJ A;  1EA2 A;  3VSY A;  3F9S A;  4XBX A;  3EC9 A;  2PZV A;  1ULI B;  3B4O A;  3KKG A;  3MSO A;  3EN1 B;  3CNX A;  2XSO B;  1VZZ A;  4XDV A;  3OWY A;  3OX9 A;  3JUN A;  5IF6 A;  3EN8 A;  4HM1 B;  5JPU A;  3H51 A;  4MJD A;  3F8X A;  4OVM A;  1S5A A;  1UUV B;  5DRE A;  1GS3 A;  4HM8 B;  7STD A;  1JB2 A;  1O7G B;  1IDP A;  3GZR A;  2HMJ B;  3DZL A;  8CHO A;  3FF2 A;  5CK6 A;  3NUV A;  3GWR A;  3G8Z A;  3G16 A;  1OH0 A;  4RZM A;  1QJG A;  3SOA A;  3SED A;  2IMJ A;  1GY6 A;  3RGA A;  3I0Y A;  4X2H A;  4HM2 B;  5STD A;  3EHC A;  1E3R A;  3S5C A;  1ULJ B;  4N3V A;  3F8H A;  1O7N B;  3EX9 A;  1A2K A;  3DXO A;  3NHX A;  3GZB A;  3LYG A;  4HZB B;  3KZT A;  1OGX A;  4XM4 A;  4R9K A;  4K1V A;  3CU3 A;  2OWP A;  2YFJ B;  3B4P A;  3UNL A;  2HMO B;  3IPT A;  4GB5 A;  2B24 B;  2UX0 A;  3JUO A;  1NDO B;  2STD A;  3MKI A;  4FCM A;  1Q40 B;  1DMM A;  3DMC A;  4L8P A;  3BB9 A;  3GZY B;  4WYK B;  3FGY A;  2GXF A;  3EF8 A;  1W00 A;  2BNG A;  1ZX2 A;  4HM7 B;  3B8L A;  2GEY A;  2GEX A;  2HMK B;  3B7C A;  5CF1 A;  5IG5 A;  3FZW A;  2F98 A;  1OHO A;  3SOY A;  3JUQ A;  5CXO A;  3BLZ A;  5CLK A;  3MYT A;  3JUP A;  4L8O A;  1W02 A;  1ASK A;  1OF5 A;  1JB5 A;  1DMN A;  5TGN A;  5JPP A;  1GY5 A;  2CHC A;  5G2G A;  5KP1 A;  3EBT A;  4HJL B;  2Z77 A;  4CDL A;  2XR8 B;  5FW5 A;  5IG3 A;  3NXJ A;  4R9L A;  3E99 A;  3NV0 A;  3NBR A;  2HMM B;  3GZX B;  3OV4 A;  1EG9 B;  3HK4 A;  1QMA A;  1W01 A;  5AI1 A;  4WWU C;  1WQL B;  1STD A;  3NM2 A;  3KE7 A;  4PEJ A;  1E97 A;  3CNM A;  3DUK A;  5KP4 A;  4HM5 B;  5IEO A;  2XSH B;  5AEW B;  5AIH A;  4XBT A;  3EJV A;  3FF0 A;  2RFR A;  4K1U A;  3LZA A;  3H3H A;  1UUW B;  4KVH A;  4J9A A;  4X2O A;  3JUM A;  2HMN B;  1W6Y A;  2QGU A;  3OXA A;  3ECF A;  1ISK A;  1CQS A;  3DM8 A;  5AEU B;  2QIY A;  1OF5 B;  1OPY A;  1ZO2 A;  3RGR A;  3ROB A;  1K41 A;  2GBX B;  2F99 A;  1NU3 A;  1JKG B;  3EQQ B;  3FH1 A;  1GYB A;  5D81 A;  3EBY A;  1OHS A;  3NV0 B;  5AII A;  2YFI B;  4L7K A;  1TUH A;  1AR0 A;  3T8N A;  4XDW A;  1HKX A;  1OHP A;  4H3U A;  3Q90 A;  3MG2 A;  2R4I A;  3K0Z A;  3OWS A;  4HVN A;  1E3V A;  1O7W B;  3KSP A;  3GRD A;  1DMQ A;  2YFL B;  3A76 A;  5D83 A;  4Q53 A;  4R1K A;  3F7S A;  4XBY A;  1NWW A;  1O7P B;  1JKG A;  5CF2 A;  2XRX B;  5IEN A;  3T8U A;  3M8C A;  2BMO B;  5IG0 A;  2BMR B;  3FLJ A;  1O7M B;  2HML B;  5IER A;  1Z1S A;  4OUQ A;  4STD A;  4IIA A;  3D9R A;  4HM4 B;  1O7H B;  3MG1 A;  5AIF A;  1Q42 A;  2GBW B;  3WMD A;  5IEP A;  1BUQ A;  2F86 B;  3HX8 A;  5EVH A;  2A15 A;  2W2C A;  5D82 A;  2RGQ A;  1TP6 A;  1JB4 A;  3OWU A;  4U13 A;  2Z7A A;  3VGN A;  6STD A;  1C7H A;  3F14 A;  1OCV A; 
#chains in the Genus database with same CATH topology
 5IG4 A;  1NJI 4;  1W5Z A;  2BU4 A;  4HZ9 B;  4N6N B;  1NB3 I;  1B27 A;  1AV4 A;  1W7C A;  1IV9 A;  2B1X B;  6GSP A;  5DRV A;  5RNT A;  2O9U X;  3MHE A;  4HM0 B;  2JQ5 A;  3FKA A;  3LTC A;  4HKV B;  4N6L A;  1GD4 A;  4XB5 A;  5G1K A;  3X42 A;  3ER7 A;  5A0O B;  1JN5 B;  1Y4K A;  1U5O A;  1ZGX A;  2OQE C;  3HZP A;  3DGY A;  4LEH A;  1GOY A;  4LGQ A;  3ZG0 A;  2WOH A;  2RCD A;  1OGZ A;  1TFK A;  5KP3 A;  1VQ7 3;  2K54 A;  1FUW A;  4ORL A;  1BVI A;  1OUN A;  3F7X A;  1JV2 B;  2W56 A;  1HU9 A;  1N9E A;  1SJW A;  4EYC A;  2ZDJ A;  1CH0 A;  3HOH A;  4BU4 A;  5BVB A;  3LT9 A;  1EEJ A;  1WMP A;  1TFO A;  3NBJ A;  4J5K A;  3ALA A;  2KRT A;  3CCJ 3;  1IQY A;  4HM6 B;  4I5Q A;  3G0K A;  2W9Q A;  2I9W A;  1X1U A;  1A2V A;  2XH9 A;  3BNC A;  4N6V 0;  4EV2 A;  2Z76 A;  4I4K A;  2D1W A;  5M18 A;  1IT7 A;  2KF5 A;  1D6Y A;  3I55 3;  3PS8 A;  4WP5 A;  1BSE A;  4AKY A;  3FSD A;  5BXQ A;  3STD A;  1MWR A;  1IT8 A;  4GSP A;  1DVD A;  4J8T A;  1JN5 A;  5BU4 A;  1GY7 A;  1IU7 A;  2LYX A;  3CPO A;  3K7C A;  5HGR A;  1I2E A;  3DH2 A;  1GOU A;  3CD6 3;  1IVU A;  3GSP A;  2BMQ B;  1DET A;  1Q40 A;  4HM3 B;  1PU4 A;  1VQP 3;  2Y73 A;  1VQK 3;  5AIG A;  3PXM A;  2INX A;  2FGT A;  3LT8 A;  3MG3 A;  4LMI A;  1STF I;  1BNI A;  2CKF B;  1BRI A;  2CK3 H;  1B2X A;  2L4V A;  4WYK A;  3UJM A;  4O8S A;  3F40 A;  4FCJ A;  1EA2 A;  3VSY A;  2W0Q A;  3D4A A;  3F9S A;  4XBX A;  3EC9 A;  1B2U A;  2PZV A;  1ULI B;  1Q81 4;  1FYS A;  3LTB A;  3B4O A;  3KKG A;  2CX0 A;  3MSO A;  3WOF B;  1UGI A;  3EN1 B;  3LH4 A;  3CNX A;  1RCL A;  3U97 A;  2XSO B;  1VZZ A;  3U1W A;  4XDV A;  3NBB A;  3OWY A;  2WOF A;  3OX9 A;  3JUN A;  4O3V A;  2ML6 A;  1B2Z A;  3HI7 A;  5IF6 A;  3CCS 3;  1UI7 A;  3EN8 A;  4HM1 B;  1JBR A;  5JPU A;  3AMO B;  3H51 A;  3K63 A;  4MJD A;  1VQ9 3;  1IV7 A;  1AQZ A;  1UCL A;  3F8X A;  4GHO A;  4HOH A;  4OVM A;  2WGO A;  1S5A A;  1UUV B;  5DRE A;  1GS3 A;  4HM8 B;  7STD A;  1SII A;  4OK0 A;  1AY7 A;  1JB2 A;  1O7G B;  1IDP A;  1RGA A;  2Q07 A;  3GZR A;  2HMJ B;  3DZL A;  1RLS A;  8CHO A;  3FF2 A;  3GAX A;  5CK6 A;  3NUV A;  3GWR A;  2QA4 3;  2MF7 A;  3N8B A;  3G8Z A;  2P0M A;  1KWI A;  1KSI A;  1BRG A;  1OH0 A;  3G16 A;  4R80 A;  3V98 A;  4ZM8 A;  3CCQ 3;  4HYZ A;  4RZM A;  2W03 A;  1QJG A;  2KF6 A;  3SOA A;  1FZU A;  1W4N A;  3SED A;  2IMJ A;  1GY6 A;  3RGA A;  3I0Y A;  4RBN A;  4X2H A;  3D3L A;  3LTD A;  4HM2 B;  1V57 A;  5STD A;  1BUJ A;  2P38 A;  1T5Y A;  3EHC A;  4HBR A;  1E3R A;  3S5C A;  3CCE 3;  1ULJ B;  4N3V A;  3F8H A;  3S29 A;  3AGO A;  3KN4 A;  3WR2 A;  1O7N B;  3EX9 A;  6RNT A;  3AMO A;  1A2K A;  4FMA A;  3DXO A;  3NHX A;  3GZB A;  1I3I A;  1BSD A;  2RSX A;  3LYG A;  3PCS A;  3PGB A;  4HZB B;  3KZT A;  3UL5 A;  1YNV X;  1OGX A;  1N9J A;  3MPH A;  1BNJ A;  1BNS A;  2OOV C;  3V92 A;  3WOD G;  2OQE A;  1X1X A;  3X41 A;  1Q7H A;  1G96 A;  2GSP A;  4XM4 A;  2L1S A;  4R9K A;  4K1V A;  4R4K A;  4AKZ A;  3CCM 3;  3CU3 A;  1J2B A;  4O2H A;  3KSE D;  4HAA A;  1RKY A;  2OWP A;  2YFJ B;  2Y74 A;  3B4P A;  1B20 A;  3IJE B;  2HMO B;  2WGQ A;  4ILF A;  3IPT A;  3UNL A;  3PCR A;  1IK3 A;  1JBS A;  3MWZ A;  4FMC A;  1UI8 A;  2B24 B;  4GB5 A;  1T2H A;  2UX0 A;  2YX9 A;  1T2I A;  1RGF A;  2BO9 B;  3JUO A;  1IVX A;  1NDO B;  1RN4 A;  2STD A;  3LML A;  1RTU A;  3MKI A;  1A67 A;  1SPU A;  1LRA A;  4FCM A;  1YJW 3;  1TTO A;  3PZW A;  1Q40 B;  1DMM A;  3DMC A;  1MOL A;  4JRF A;  1I0X A;  1BOX A;  5EEO A;  3X3Z A;  3FG4 A;  4NHF A;  4L8P A;  3BB9 A;  3WOE B;  1LQG C;  2CWV A;  1K28 A;  3X3Y A;  1OAC A;  1SIH A;  3GZY B;  4WYK B;  1FW7 A;  2KF3 A;  3FGY A;  3K9M C;  1RMS A;  2V1L A;  2GXF A;  2FNQ A;  3EF8 A;  1GOV A;  1W00 A;  1YHQ 3;  3SX1 A;  1HYF A;  1AVK A;  3G71 3;  2BNG A;  1ZX2 A;  2SAR A;  2CC3 A;  1G0T A;  2C4B A;  2CH9 A;  4RNZ A;  1A90 A;  2Z6B A;  3BNE A;  4HM7 B;  2CW9 A;  3Q1C A;  3B8L A;  2GEY A;  2GEX A;  7GSP A;  2P09 A;  2HMK B;  3B7C A;  4N6T A;  3LTA A;  4EC6 A;  5CF1 A;  3HII A;  5IG5 A;  3OW2 2;  2H0I A;  1MWT A;  3FZW A;  1WMN A;  2CFK A;  1OHO A;  1D6Z A;  1F8N A;  2F98 A;  3D79 A;  1HZ1 A;  2F5W A;  3SOY A;  1UUG B;  3JUQ A;  4WFO A;  5CXO A;  2OTJ 3;  3BLZ A;  1WNH A;  3L0R A;  4N6U A;  3EE1 A;  3BND A;  5CLK A;  5IW9 A;  1G02 A;  1CYU A;  3MYT A;  2PNC A;  1PFP A;  3JUP A;  1BSC A;  4FMD A;  1YGE A;  1GMQ A;  4KT3 B;  4L8O A;  1BNF A;  2E2V A;  1VQO 3;  1W02 A;  5FGO A;  4CJN A;  4EV5 A;  3RDE A;  1UW1 A;  1ASK A;  5M1A A;  2J8X B;  2O3O A;  4IPB A;  1RGK A;  1B21 A;  2KAA A;  1OF5 A;  1JB5 A;  4JF8 A;  1DMN A;  5TGN A;  1MGR A;  3WDG B;  3X40 A;  1M1X B;  1EQK A;  1L5G B;  5JPP A;  1GY5 A;  1FGQ A;  2CHC A;  5G2G A;  4DKI A;  5KP1 A;  3CCV 3;  1C54 A;  1W2Z A;  1IVW A;  3EBT A;  4BTW A;  1JRQ A;  1FUT A;  2M7O A;  4HJL B;  2Z77 A;  2C11 A;  1R4C A;  1RSN A;  4CDL A;  1TU5 A;  2CG1 A;  4H61 A;  3DY5 A;  2XR8 B;  2P0X A;  5FW5 A;  5IG3 A;  1CYV A;  1MWS A;  1BGS A;  3URP A;  2XGN A;  3NXJ A;  3Q2P A;  4FMB A;  3KII A;  4R9L A;  3E99 A;  3NV0 A;  1ZS7 A;  3K5T A;  2IUK A;  3KFQ C;  1NNV A;  1MNL A;  3N54 B;  3NBR A;  5LC7 A;  8RNT A;  3UB1 A;  2BT3 A;  2HMM B;  3CME 3;  3GZX B;  4RNY A;  1UCK A;  3OV4 A;  1EG9 B;  3S28 A;  3CCU 3;  1PYL A;  2AAE A;  1TRP A;  3HK4 A;  1QMA A;  2HOH A;  3S67 A;  1KD1 4;  1N5H A;  1UDI I;  4FCZ A;  1W01 A;  1B3S A;  2BHM A;  1I2G A;  2OOV A;  2F56 A;  1RJO A;  5AI1 A;  5AYR B;  1BIR A;  3D5G A;  4WWU C;  1WQL B;  3ZFZ A;  3NQZ A;  4IT7 A;  1STD A;  3NM2 A;  2KF4 A;  2CWU A;  1JBT A;  3KE7 A;  4PEJ A;  1E97 A;  2IUJ A;  3CNM A;  5M19 A;  3ZG5 A;  1BAO A;  3DUK A;  2P05 A;  5KP4 A;  2AAD A;  4HM5 B;  5JBS A;  1B2S A;  9RNT A;  2OTL 3;  5IEO A;  1VQ5 3;  2XSH B;  5LC6 A;  5G1L A;  1K8A 4;  2K3D A;  3HIG A;  1US1 A;  2E2U A;  1TJD A;  4QWT A;  4XBT A;  5AIH A;  5AEW B;  3A5E A;  1GSP A;  3FCS B;  3EJV A;  3FF0 A;  2RFR A;  2R41 A;  4K1U A;  4NRE A;  1EUI C;  3LZA A;  5EQL A;  1TIJ A;  2H0H A;  3H3H A;  1GMP A;  2RBI A;  1UUW B;  4EXR A;  4KVH A;  3LOY A;  2ZL8 A;  2F4Y A;  2GU3 A;  3EB8 A;  4J9A A;  4X2O A;  1LNH A;  1RRH A;  4GL6 A;  3JUM A;  1RGG A;  2JDI H;  2QEX 3;  1LXE A;  2HMN B;  4MEI A;  2XEP A;  3BIR A;  3AHS A;  1BRH A;  1LOY A;  1RDS A;  4BIR A;  3SLU A;  1W6Y A;  2QGU A;  1UGH I;  1BRK A;  1X1W A;  2ZA4 A;  2RNT A;  3OXA A;  1VQ6 3;  2W04 A;  3ECF A;  4CPK A;  2KCD A;  4BTX A;  5BIR A;  1ISK A;  1CQS A;  1QVG 2;  3NM7 A;  3D5I A;  3DM8 A;  1N5P A;  5AEU B;  1N8R 4;  1LVN A;  2QIY A;  1OF5 B;  1W6C A;  2UUG C;  4J5G A;  2OCT A;  4K90 B;  1OPY A;  3FG1 A;  2MC8 A;  1ZO2 A;  4MMZ B;  2ML5 A;  1YI2 3;  3RGR A;  3WHO A;  1R4Y A;  1SQW A;  3CC4 3;  4BTY A;  2D42 A;  3ROB A;  1M9G A;  1K41 A;  2IY2 A;  1Q82 4;  1SAR A;  2GBX B;  1YVB I;  5I97 A;  1ROA A;  2F99 A;  1LOV A;  1I70 A;  3N9H A;  4TX4 A;  1NU3 A;  1V58 A;  1RGE A;  1RGL A;  4LZI A;  1JKG B;  1UCI A;  1QAL A;  1U8C B;  3EQQ B;  3FH1 A;  1VQQ A;  1EKM A;  1GYB A;  3DGN A;  5D81 A;  3UL6 A;  3EBY A;  2CFL A;  3IMA B;  3QK9 A;  3SYU A;  4NPB A;  1IQ8 A;  1OHS A;  1QAK A;  1RGH A;  1RN7 A;  1KC8 4;  3QRD A;  3G4S 3;  3CC7 3;  3NV0 B;  5AII A;  4G1M B;  1BNR A;  2YFI B;  2CFG A;  2LQV A;  3V99 A;  1VQ8 3;  4L7K A;  1I2F A;  1RRL A;  1TUH A;  1QAF A;  2CIU A;  3BU4 A;  1AR0 A;  3NX0 A;  1Q86 4;  3T8N A;  1BSB A;  4XDW A;  1LOW A;  1N8Q A;  1HKX A;  1OHP A;  1RHL A;  1YVS A;  1IVV A;  4N6M A;  1JNQ A;  4H3U A;  3Q90 A;  1FGM A;  4MMX B;  1PY3 A;  1BRS A;  2IA7 A;  3MG2 A;  2R4I A;  4LSO A;  1DE3 A;  1LNI A;  3K0Z A;  3LXU X;  3OWS A;  4HVN A;  3S27 A;  1E3V A;  3SXX A;  2SBL A;  1O7W B;  1I8V A;  2XFS A;  3BNB A;  3GRD A;  1DMQ A;  1JZO A;  3KSP A;  2YFL B;  4WHA A;  1K73 4;  1QVF 2;  3A76 A;  5D83 A;  2GU1 A;  4Q53 A;  4R1K A;  3F7S A;  2H0G A;  4XBY A;  1CEW I;  4AEQ A;  1FA3 A;  1NWW A;  4MMY B;  1FGT A;  1LOX A;  4FR9 A;  1YIJ 3;  1RNB A;  1A2P A;  3RNT A;  4KFD A;  2FXT A;  4EBG A;  1O7P B;  3Q3F A;  1JKG A;  1YJN 3;  5CF2 A;  1FGO A;  1UCJ A;  1WMO A;  1MGW A;  5AYS C;  3TDG A;  2C10 A;  2CFD A;  3X3X A;  2XRX B;  5IEN A;  2BIR A;  2W9P A;  3T8U A;  1Q7Y 4;  1Q9E A;  1M1K 4;  1BU4 A;  3NQY A;  3M8C A;  3CMA 3;  2KXG A;  2BMO B;  4KFE A;  2CG0 A;  3JVC A;  3DGM A;  5IG0 A;  4N6O B;  1BNG A;  3CC2 3;  4BL2 A;  1TRQ A;  2BMR B;  3FLJ A;  5ELJ A;  1O7M B;  3G6E 3;  2W6J H;  2HML B;  3CXC 2;  1W6G A;  4LYL B;  5IER A;  2CWT A;  1W2B 2;  1Z1S A;  4OUQ A;  1D6U A;  1KQS 2;  2F5M A;  4STD A;  4IIA A;  2E2T A;  3D9R A;  1BSA A;  1VQM 3;  1I0V A;  3T0U A;  2XGL A;  4HM4 B;  1O7H B;  1ROV A;  3MG1 A;  5AIF A;  1GMR A;  1M90 4;  2UGI A;  4EW5 A;  1GD3 A;  2IYJ A;  3CCR 3;  2CX1 A;  3I56 3;  3AHW A;  1DVC A;  2CFW A;  3PYJ A;  1VQN 3;  1Q42 A;  3WA2 X;  1RGC A;  2GBW B;  2K0M A;  3DGL A;  3WMD A;  3O8Y A;  1VQL 3;  5IEP A;  1X1Y A;  4KFF A;  1BRJ A;  3WA3 A;  1BAN A;  1BUQ A;  2F86 B;  1RNT A;  3DGO A;  1S72 3;  5HOH A;  2ZHX B;  1YIT 3;  1T3B A;  3HX8 A;  1BRN L;  4K61 A;  3SVA A;  3CCL 3;  5ELU A;  4CCV A;  2WO0 A;  1JJ2 2;  5EVH A;  2A15 A;  3KCH A;  7RNT A;  2W2C A;  3VF1 A;  1YGW A;  1NB5 I;  1IYY A;  5D82 A;  2W56 B;  1FUS A;  2RGQ A;  5GSP A;  1BNE A;  1TP6 A;  4KZ1 A;  2XFT A;  1DYU A;  3CPW 2;  1YJ9 3;  1I3F A;  1VQ4 3;  2XF3 A;  1JB4 A;  1FGR A;  1NO3 A;  1LQM B;  4RNT A;  3J7Y d;  1RN1 A;  3FG3 A;  1JZD A;  3OWU A;  4O02 B;  2Z7A A;  1WTH A;  4U13 A;  1MWU A;  3VGN A;  6STD A;  3AGN A;  1C7H A;  1IQX A;  1AVL A;  3F14 A;  1K9M 4;  1V74 A;  1B2M A;  1RCK A;  1OCV A;  4BL3 A; 
#chains in the Genus database with same CATH homology
 5IG4 A;  1NJI 4;  1W5Z A;  4N6N B;  4HZ9 B;  1NB3 I;  1AV4 A;  1W7C A;  1IV9 A;  2B1X B;  5DRV A;  2O9U X;  3MHE A;  4HM0 B;  2JQ5 A;  3FKA A;  3LTC A;  4HKV B;  4N6L A;  1GD4 A;  4XB5 A;  3X42 A;  5A0O B;  3ER7 A;  1JN5 B;  1Y4K A;  1U5O A;  3HZP A;  2OQE C;  4LEH A;  4LGQ A;  2WOH A;  2RCD A;  1OGZ A;  1TFK A;  5KP3 A;  1VQ7 3;  2K54 A;  1FUW A;  4ORL A;  1OUN A;  3F7X A;  1JV2 B;  2W56 A;  1HU9 A;  1N9E A;  1SJW A;  4EYC A;  2ZDJ A;  5BVB A;  3LT9 A;  1WMP A;  1TFO A;  3NBJ A;  3ALA A;  2KRT A;  3CCJ 3;  1IQY A;  4HM6 B;  3G0K A;  2W9Q A;  2I9W A;  2XH9 A;  1A2V A;  3BNC A;  4N6V 0;  4EV2 A;  2Z76 A;  4I4K A;  2D1W A;  1IT7 A;  1D6Y A;  3I55 3;  3PS8 A;  4WP5 A;  4AKY A;  3FSD A;  5BXQ A;  3STD A;  1IT8 A;  1DVD A;  4J8T A;  1JN5 A;  1GY7 A;  1IU7 A;  2LYX A;  3CPO A;  3K7C A;  5HGR A;  3CD6 3;  1IVU A;  2BMQ B;  1Q40 A;  4HM3 B;  1PU4 A;  1VQP 3;  2Y73 A;  1VQK 3;  5AIG A;  3PXM A;  2INX A;  2FGT A;  3LT8 A;  3MG3 A;  4LMI A;  1STF I;  2CKF B;  2CK3 H;  2L4V A;  4WYK A;  3UJM A;  4O8S A;  3F40 A;  4FCJ A;  1EA2 A;  3VSY A;  2W0Q A;  3F9S A;  4XBX A;  3EC9 A;  2PZV A;  1ULI B;  1Q81 4;  3LTB A;  3B4O A;  3KKG A;  3MSO A;  3WOF B;  3LH4 A;  3EN1 B;  3CNX A;  3U97 A;  2XSO B;  1VZZ A;  3U1W A;  4XDV A;  3NBB A;  3OWY A;  2WOF A;  3OX9 A;  3JUN A;  4O3V A;  2ML6 A;  3HI7 A;  5IF6 A;  3CCS 3;  1UI7 A;  3EN8 A;  4HM1 B;  5JPU A;  3AMO B;  3H51 A;  3K63 A;  4MJD A;  1VQ9 3;  1IV7 A;  3F8X A;  4OVM A;  2WGO A;  1S5A A;  1UUV B;  5DRE A;  1GS3 A;  4HM8 B;  7STD A;  1SII A;  4OK0 A;  1JB2 A;  1O7G B;  1IDP A;  2Q07 A;  3GZR A;  2HMJ B;  3DZL A;  8CHO A;  3FF2 A;  3GAX A;  5CK6 A;  3NUV A;  3GWR A;  2QA4 3;  2MF7 A;  3N8B A;  3G8Z A;  2P0M A;  1KWI A;  1KSI A;  1OH0 A;  3G16 A;  4R80 A;  3V98 A;  4ZM8 A;  3CCQ 3;  4HYZ A;  4RZM A;  2W03 A;  1QJG A;  3SOA A;  1W4N A;  3SED A;  2IMJ A;  1GY6 A;  3RGA A;  3I0Y A;  4RBN A;  4X2H A;  3D3L A;  3LTD A;  4HM2 B;  5STD A;  2P38 A;  1T5Y A;  3EHC A;  4HBR A;  1E3R A;  3S5C A;  3CCE 3;  1ULJ B;  4N3V A;  3F8H A;  3S29 A;  3KN4 A;  1O7N B;  3EX9 A;  3AMO A;  1A2K A;  4FMA A;  3DXO A;  3NHX A;  3GZB A;  2RSX A;  3LYG A;  3PCS A;  3PGB A;  4HZB B;  3KZT A;  3UL5 A;  1OGX A;  1N9J A;  3MPH A;  2OOV C;  3V92 A;  3WOD G;  2OQE A;  3X41 A;  1G96 A;  4XM4 A;  4R9K A;  4K1V A;  4R4K A;  4AKZ A;  3CCM 3;  3CU3 A;  1J2B A;  4O2H A;  3KSE D;  1RKY A;  2YFJ B;  3B4P A;  2OWP A;  2Y74 A;  3IJE B;  3UNL A;  2HMO B;  2WGQ A;  1IK3 A;  3IPT A;  3PCR A;  3MWZ A;  4FMC A;  1UI8 A;  2B24 B;  4GB5 A;  2UX0 A;  2YX9 A;  3JUO A;  2BO9 B;  1IVX A;  1NDO B;  2STD A;  3LML A;  1A67 A;  3MKI A;  1SPU A;  4FCM A;  1YJW 3;  3PZW A;  1Q40 B;  1DMM A;  3DMC A;  1MOL A;  4JRF A;  5EEO A;  3X3Z A;  3FG4 A;  4NHF A;  4L8P A;  3BB9 A;  3WOE B;  2CWV A;  1K28 A;  3X3Y A;  1OAC A;  1SIH A;  3GZY B;  4WYK B;  3FGY A;  3K9M C;  2V1L A;  2GXF A;  2FNQ A;  3EF8 A;  1W00 A;  1YHQ 3;  3SX1 A;  1AVK A;  3G71 3;  2BNG A;  1ZX2 A;  2CC3 A;  2CH9 A;  4RNZ A;  1A90 A;  2Z6B A;  3BNE A;  4HM7 B;  2CW9 A;  3Q1C A;  3B8L A;  2GEY A;  2GEX A;  2P09 A;  2HMK B;  3B7C A;  4N6T A;  3LTA A;  4EC6 A;  5CF1 A;  3HII A;  5IG5 A;  3OW2 2;  3FZW A;  1WMN A;  2CFK A;  1OHO A;  1D6Z A;  1F8N A;  2F98 A;  3SOY A;  3JUQ A;  4WFO A;  5CXO A;  2OTJ 3;  3BLZ A;  1WNH A;  3L0R A;  4N6U A;  3EE1 A;  3BND A;  5CLK A;  5IW9 A;  1CYU A;  3MYT A;  2PNC A;  1PFP A;  3JUP A;  4FMD A;  1YGE A;  4L8O A;  2E2V A;  1VQO 3;  1W02 A;  5FGO A;  4EV5 A;  3RDE A;  1UW1 A;  1ASK A;  2O3O A;  4IPB A;  1OF5 A;  1JB5 A;  4JF8 A;  1DMN A;  5TGN A;  3WDG B;  3X40 A;  1EQK A;  1M1X B;  1L5G B;  5JPP A;  1GY5 A;  1FGQ A;  2CHC A;  5G2G A;  5KP1 A;  3CCV 3;  1W2Z A;  1IVW A;  3EBT A;  4BTW A;  1JRQ A;  2M7O A;  4HJL B;  2Z77 A;  2C11 A;  1R4C A;  4CDL A;  1TU5 A;  2CG1 A;  4H61 A;  3DY5 A;  2XR8 B;  2P0X A;  5FW5 A;  5IG3 A;  1CYV A;  2XGN A;  3NXJ A;  3Q2P A;  4FMB A;  3KII A;  4R9L A;  3E99 A;  3NV0 A;  3K5T A;  2IUK A;  3KFQ C;  3N54 B;  1MNL A;  5LC7 A;  3NBR A;  3UB1 A;  2BT3 A;  2HMM B;  3CME 3;  3GZX B;  4RNY A;  3S28 A;  3OV4 A;  1EG9 B;  3CCU 3;  3HK4 A;  1QMA A;  3S67 A;  1KD1 4;  1N5H A;  4FCZ A;  1W01 A;  2BHM A;  2OOV A;  1RJO A;  5AI1 A;  5AYR B;  4WWU C;  1WQL B;  3NQZ A;  4IT7 A;  1STD A;  3NM2 A;  2CWU A;  3KE7 A;  4PEJ A;  1E97 A;  2IUJ A;  3CNM A;  3DUK A;  2P05 A;  5KP4 A;  4HM5 B;  5JBS A;  2OTL 3;  5IEO A;  1VQ5 3;  2XSH B;  5LC6 A;  1K8A 4;  3HIG A;  1US1 A;  2E2U A;  4QWT A;  4XBT A;  5AIH A;  5AEW B;  3FCS B;  3EJV A;  3FF0 A;  2RFR A;  4K1U A;  4NRE A;  3LZA A;  5EQL A;  1TIJ A;  3H3H A;  1UUW B;  4EXR A;  4KVH A;  3LOY A;  2ZL8 A;  2GU3 A;  3EB8 A;  4J9A A;  4X2O A;  1LNH A;  1RRH A;  4GL6 A;  3JUM A;  2JDI H;  2QEX 3;  1LXE A;  2HMN B;  4MEI A;  2XEP A;  3SLU A;  1W6Y A;  2QGU A;  3OXA A;  1VQ6 3;  2W04 A;  3ECF A;  2KCD A;  4BTX A;  1ISK A;  1CQS A;  1QVG 2;  3NM7 A;  3DM8 A;  1N5P A;  5AEU B;  1N8R 4;  1LVN A;  2QIY A;  1OF5 B;  1W6C A;  2OCT A;  4K90 B;  1OPY A;  3FG1 A;  2MC8 A;  1ZO2 A;  4MMZ B;  2ML5 A;  1YI2 3;  3RGR A;  1SQW A;  3CC4 3;  4BTY A;  2D42 A;  3ROB A;  1M9G A;  1K41 A;  1Q82 4;  2GBX B;  1YVB I;  5I97 A;  1ROA A;  2F99 A;  3N9H A;  4TX4 A;  1NU3 A;  4LZI A;  1JKG B;  1QAL A;  1U8C B;  3EQQ B;  3FH1 A;  1EKM A;  1GYB A;  3DGN A;  5D81 A;  3UL6 A;  3EBY A;  2CFL A;  3IMA B;  3QK9 A;  1IQ8 A;  1OHS A;  1QAK A;  1RN7 A;  1KC8 4;  3QRD A;  3G4S 3;  3CC7 3;  3NV0 B;  5AII A;  4G1M B;  2YFI B;  2CFG A;  2LQV A;  3V99 A;  1VQ8 3;  4L7K A;  1RRL A;  1TUH A;  1QAF A;  2CIU A;  1AR0 A;  3NX0 A;  1Q86 4;  3T8N A;  4XDW A;  1N8Q A;  1HKX A;  1OHP A;  4N6M A;  1IVV A;  1JNQ A;  4H3U A;  3Q90 A;  1FGM A;  4MMX B;  3MG2 A;  2IA7 A;  2R4I A;  4LSO A;  3K0Z A;  3LXU X;  3OWS A;  4HVN A;  3S27 A;  1E3V A;  3SXX A;  2SBL A;  1O7W B;  2XFS A;  3BNB A;  3GRD A;  3KSP A;  1DMQ A;  4WHA A;  1QVF 2;  2YFL B;  1K73 4;  3A76 A;  5D83 A;  2GU1 A;  4Q53 A;  4R1K A;  3F7S A;  4XBY A;  1CEW I;  4AEQ A;  1FA3 A;  1NWW A;  4MMY B;  1FGT A;  1LOX A;  4FR9 A;  1YIJ 3;  4KFD A;  2FXT A;  4EBG A;  1O7P B;  1JKG A;  1YJN 3;  5CF2 A;  1FGO A;  1WMO A;  5AYS C;  3TDG A;  3X3X A;  2C10 A;  2CFD A;  2XRX B;  5IEN A;  2W9P A;  1Q7Y 4;  3T8U A;  1M1K 4;  3NQY A;  3M8C A;  3CMA 3;  2KXG A;  2BMO B;  4KFE A;  2CG0 A;  3JVC A;  3DGM A;  5IG0 A;  4N6O B;  3CC2 3;  2BMR B;  3FLJ A;  5ELJ A;  1O7M B;  3G6E 3;  2W6J H;  2HML B;  3CXC 2;  1W6G A;  5IER A;  2CWT A;  1W2B 2;  1Z1S A;  4OUQ A;  1D6U A;  1KQS 2;  4STD A;  4IIA A;  2E2T A;  3D9R A;  1VQM 3;  3T0U A;  2XGL A;  4HM4 B;  1O7H B;  1ROV A;  3MG1 A;  5AIF A;  1M90 4;  1GD3 A;  3CCR 3;  3I56 3;  1DVC A;  2CFW A;  3PYJ A;  1VQN 3;  1Q42 A;  3WA2 X;  2GBW B;  2K0M A;  3DGL A;  3WMD A;  3O8Y A;  1VQL 3;  5IEP A;  4KFF A;  3WA3 A;  1BUQ A;  2F86 B;  3DGO A;  1S72 3;  1YIT 3;  3HX8 A;  4K61 A;  3SVA A;  3CCL 3;  5ELU A;  4CCV A;  2WO0 A;  1JJ2 2;  5EVH A;  2A15 A;  2W2C A;  3VF1 A;  1NB5 I;  5D82 A;  2W56 B;  2RGQ A;  1TP6 A;  4KZ1 A;  2XFT A;  1DYU A;  3CPW 2;  1YJ9 3;  1VQ4 3;  2XF3 A;  1JB4 A;  1FGR A;  1NO3 A;  3J7Y d;  3FG3 A;  3OWU A;  4O02 B;  2Z7A A;  1WTH A;  4U13 A;  3VGN A;  6STD A;  1K9M 4;  1C7H A;  1IQX A;  1AVL A;  3F14 A;  1V74 A;  1OCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...