1OF5A

Crystal structure of mex67-mtr2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
221
structure length
154
Chain Sequence
QQFFFENDALGQSSTDFATNFLNLWDNNREQLLNLYSPQSQFSVSVDSTSIGQESINSIFKTLPKTKHHLQEQPNEYSMETISYPQINGFVITLHGFFEETSNNKLSKKSFDRTWVIVPMNNSVIIASDLLTVRAYSTGAWKTASIAIAQAAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural similarity in the absence of sequence homology of the messenger RNA export factors Mtr2 and p15.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear transport
molecule keywords MRNA EXPORT FACTOR MEX67
total genus 35
structure length 154
sequence length 221
ec nomenclature
pdb deposition date 2003-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1of5A00
4HM1B 3DM8A 6STDA 5IF6A 1ASKA 1E3RA 2IMJA 4WYKA 3WMDA 1HKXA 3NBRA 3OX9A 2BMOB 1OCVA 4WP5A 2QIYA 5AIGA 5KP1A 3FGYA 1ZO2A 4STDA 3S5CA 4LMIA 5IEOA 5STDA 3OWUA 3CU3A 4XBYA 2Z76A 4XDWA 2I9WA 3A76A 1IDPA 3ER7A 3UJMA 3JUPA 3EX9A 5AEUB 4I4KA 3ECFA 3KZTA 3KKGA 3CNXA 5DRVA 3UNLA 5JPPA 1VZZA 2CHCA 3EN8A 3Q90A 2Z7AA 3F7SA 3LZAA 4HM7B 5HGRA 5IG5A 1OHSA 2GXFA 5G2GA 1JN5A 4ORLA 1O7WB 1UUVB 1E3VA 5AI1A 1JKGA 5DREA 3F7XA 3F8XA 1O7HB 3SEDA 4FCMA 3EBYA 4FCJA 4WYKB 4J9AA 2HMMB 3GRDA 5IERA 3BLZA 5CF1A 4K1VA 4R9KA 3RGAA 3OV4A 3EQQB 1O7PB 3JUNA 4HM6B 4XDVA 3ROBA 5IG4A 4XBTA 2RFRA 3GZYB 3T8UA 2HMOB 2BMRB 5AIFA 3DMCA 3MKIA 3FKAA 4HVNA 3NUVA 1Q40B 1JB2A 3D9RA 3EC9A 3DUKA 3E99A 1Q40A 3B8LA 1GYBA 2PZVA 4HM3B 1W01A 2XR8B 2A15A 3B4PA 1JB4A 3NXJA 1Q42A 1OF5B 3BB9A 4X2OA 2RGQA 2JQ5A 2UX0A 1OPYA 4WWUC 5D81A 5IG0A 1ULJB 5D82A 1JN5B 1OUNA 4OVMA 3RGRA 2F86B 2Z77A 1OH0A 3G0KA 1C7HA 3G8ZA 5BVBA 2BMQB 1S5AA 4U13A 1UUWB 3KSPA 1O7GB 3VSYA 3GZXB 2XRXB 2YFLB 2OWPA 3GWRA 3K0ZA 3FF0A 1GY7A 1GS3A 3K7CA 1DMQA 2GEXA 1TP6A 1W6YA 3NV0B 3F8HA 4HJLB 4HM4B 4L7KA 1NU3A 2HMNB 4XBXA 3VGNA 2BNGA 4L8OA 2RCDA 4HM2B 1O7NB 2YFIB 3M8CA 4HM0B 5CLKA 3B4OA 3JUMA 4HM8B 1EA2A 2HMLB 2CKFB 1TUHA 2YFJB 1O7MB 3SOYA 5AEWB 5BXQA 1SJWA 4IIAA 1OF5A 3GZRA 3F14A 3EJVA 4RZMA 1AR0A 1NWWA 3NM2A 1K41A 3GZBA 1W02A 1E97A 3JUQA 3MHEA 1OHPA 5IEPA 3B7CA 3F9SA 3STDA 1ISKA 1JB5A 2GEYA 3EHCA 5JPUA 4H3UA 3FLJA 4L8PA 3MSOA 5FW5A 4LEHA 4R9LA 1ZX2A 2HMKB 4OUQA 3JUOA 2GBWB 3MG1A 4LGQA 4MJDA 4XB5A 1WQLB 3MG3A 3CPOA 5KP3A 3F40A 1JKGB 2HMJB 4HKVB 1DMNA 3OWYA 1OGZA 1BUQA 4R1KA 2B1XB 4HZ9B 5TGNA 5CXOA 3FH1A 3KE7A 3OWSA 4GB5A 2QGUA 3EN1B 4HZBB 1QMAA 4CDLA 7STDA 1ULIB 3HX8A 4K1UA 2W2CA 5AIIA 4N3VA 2XSOB 5CK6A 1EG9B 2K54A 1OGXA 1U5OA 5IENA 5IG3A 2B24B 1OHOA 3FZWA 1W00A 2XSHB 3MYTA 3SOAA 3FSDA 3HZPA 5AIHA 3DXOA 1STDA 3NHXA 4XM4A 1GY6A 1NDOB 5CF2A 2F98A 1DMMA 1QJGA 2STDA 3EBTA 4PEJA 4Q53A 3G16A 3EF8A 3IPTA 5KP4A 3MG2A 4J8TA 2F99A 2GBXB 5EVHA 3HK4A 4KVHA 3LYGA 1CQSA 2R4IA 2INXA 3FF2A 1A2KA 4HM5B 3H51A 3CNMA 3NV0A 1Z1SA 4X2HA 3DZLA 3OXAA 3H3HA 3T8NA 8CHOA 1GY5A 5D83A 3I0YA
chains in the Genus database with same CATH superfamily
1DVCA 3DM8A 3WOEB 3S27A 1E3RA 2IMJA 1T5YA 4NPBA 1RGFA 1HKXA 1ZS7A 4RNYA 4WYKA 3UL5A 2W9PA 1B2XA 2OQEA 4LMIA 5IEOA 5STDA 1FA3A 3CC43 1RGLA 1YHQ3 1SIIA 1IDPA 1IVUA 2WOFA 3UJMA 3KZTA 3UNLA 7GSPA 3EN8A 2Q07A 1NB5I 4BIRA 1N5HA 1TIJA 5IG5A 4N6V0 1X1YA 1BNJA 4MEIA 2P0MA 1FGTA 3U1WA 3RNTA 3NQYA 3F8XA 1KC84 3WHOA 2OTL3 2XEPA 1BRJA 1VQQA 4K61A 4O2HA 4WYKB 4J9AA 2E2UA 2HMMB 3LH4A 3GRDA 5CF1A 3OV4A 3EQQB 3DY5A 3CCQ3 2KCDA 2MF7A 5ELJA 2W56B 5M18A 1K8A4 3FKAA 1PY3A 1HYFA 5GSPA 3CME3 1Q40B 1JB2A 2CG0A 1AVKA 3D9RA 2W9QA 1VQ53 4Q53A 2PZVA 3CC23 3CCJ3 2A15A 1RGCA 3B4PA 1Q42A 5IG0A 3A5EA 1LRAA 4WWUC 1BIRA 3LTAA 1FGMA 2E2TA 3RGRA 1A2PA 1GOUA 4QWTA 3CMA3 1C7HA 5BVBA 1CYVA 1NB3I 1UUWB 2BU4A 1O7GB 1RNTA 2UGIA 1IT7A 1MWUA 2OWPA 3K0ZA 3FF0A 1DVDA 1TFKA 3K5TA 1DMQA 1EQKA 1TP6A 1EUIC 3NV0B 3ALAA 5FGOA 1RTUA 4L7KA 4IT7A 4BU4A 3Q1CA 3Q2PA 5LC7A 1I2EA 1IV7A 2RCDA 1O7NB 3AMOB 5CLKA 3B4OA 2Z6BA 2C10A 5EQLA 2CKFB 4I5QA 1VQO3 1RGEA 1UCKA 1SJWA 1RCLA 3GZRA 3F14A 4R80A 1S723 4RZMA 1RGKA 1AR0A 1D6ZA 3TDGA 3GZBA 1ZGXA 4KFFA 5IEPA 3F9SA 1ISKA 1QALA 2ML6A 1UGHI 3FLJA 5I97A 2F5MA 1TJDA 4R9LA 3S28A 3LT8A 1BRHA 1WMNA 4XB5A 7RNTA 2K0MA 4LGQA 4MJDA 3PYJA 1WQLB 3MG3A 3CPOA 1VQ63 3N54B 1Q7HA 1TRQA 1A2VA 2HMJB 4HKVB 3BIRA 1PU4A 3QRDA 3ZFZA 2B1XB 2F4YA 3FH1A 1IVVA 2FNQA 2QGUA 2XGNA 1QMAA 2H0IA 1W2B2 5AIIA 3QK9A 4J5KA 4FR9A 1BSCA 1U5OA 5IENA 3PZWA 2GU1A 3FZWA 2W56A 3N8BA 3CCE3 3GAXA 1VQL3 1STDA 1WTHA 4XM4A 2F98A 3EBTA 4PEJA 2SBLA 1YIT3 4JRFA 1B2SA 2KXGA 2RBIA 2W04A 1I2FA 3MPHA 1DYUA 1JZOA 4HM5B 4AKYA 1LOVA 3SXXA 1QVG2 1B2MA 1GY5A 1FUWA 2ZHXB 3OW22 1BRIA 1IYYA 3SLUA 2BO9B 3WMDA 1YJN3 1SIHA 1GMQA 1OCVA 2QIYA 2XF3A 3S67A 3FGYA 1ZO2A 5A0OB 3S5CA 5EEOA 1RN4A 1BRSA 4XDWA 2P09A 2CFLA 3X3ZA 3JUPA 3VF1A 5AEUB 3KKGA 1BRKA 2CHCA 1IV9A 4HM7B 1BNIA 2GXFA 1B3SA 5G2GA 1JN5A 4ORLA 2LQVA 1UUVB 1LOWA 2W6JH 3KN4A 4N6NB 3PXMA 3SEDA 1IVWA 3LOYA 4HBRA 3SX1A 2KF3A 4K1VA 1M904 4XDVA 4GHOA 5LC6A 3ROBA 1W4NA 1CH0A 2KF5A 1RRHA 2RFRA 3GZYB 3T8UA 5AIFA 1YJ93 2XFSA 5BU4A 3DMCA 4BTYA 3I563 1G0TA 3NUVA 1LOYA 3DUKA 1Q40A 3B8LA 3KFQC 1W01A 2XR8B 2KF4A 5HOHA 2UX0A 1BSEA 1YVBI 1JN5B 4N6MA 3CPW2 1BNFA 2Z77A 3HIIA 1BANA 5M19A 1OH0A 1UCIA 2Y74A 1Q824 2IA7A 2CFGA 3NBJA 1LXEA 2UUGC 3WDGB 3VSYA 3X40A 1GY7A 3K7CA 3EE1A 2D1WA 3PCSA 1RLSA 4N6LA 4HM4B 1NU3A 1WNHA 1YVSA 3AHSA 2H0HA 1BRNL 2BNGA 4L8OA 3LXUX 5BIRA 1EKMA 2CH9A 3AMOA 3M8CA 4HM0B 1WMPA 1RGHA 2CK3H 1IK3A 2YFJB 1O7MB 1IVXA 1LOXA 1YGEA 2H0GA 1SARA 4IIAA 1MWSA 1L5GB 5AEWB 1RNBA 3EJVA 3NM2A 1NWWA 1MOLA 3G4S3 4FMDA 4CJNA 1OHPA 1BU4A 3B7CA 1JBSA 3STDA 2BIRA 4WHAA 4HOHA 2BT3A 4BL2A 3N9HA 5G1LA 3X3YA 1BUJA 2CX0A 2ZA4A 4LEHA 1JV2B 4WFOA 1FYSA 2MC8A 3CD63 2HMKB 3X42A 5IF6A 2PNCA 5AYSC 2CWTA 1VQN3 4BTWA 2ML5A 1VQ43 3OWYA 2P38A 1GD3A 1OGZA 3HIGA 1K734 1BUQA 2D42A 1DE3A 1U8CB 1N9JA 4GB5A 3EN1B 7STDA 3LTCA 1ULIB 3HX8A 1LNIA 2W2CA 4K1UA 3LTDA 3DGOA 3KCHA 1TU5A 1I3IA 1OHOA 1BOXA 1W00A 1RGGA 2XSHB 3FSDA 3HZPA 4ZM8A 3DXOA 5CF2A 3NHXA 1GY6A 2CFKA 2STDA 1AY7A 1I8VA 1KSIA 1RDSA 4O02B 2AADA 2O9UX 2F99A 2GBXB 4N6OB 4KVHA 1UW1A 3LYGA 1N5PA 5EVHA 1T3BA 1CQSA 1LVNA 2R4IA 3SVAA 1GOYA 3CC73 3DGNA 4FMBA 3D4AA 1JNQA 3IMAB 1TRPA 1IQ8A 4X2HA 3DZLA 3FG1A 8CHOA 1IU7A 2FGTA 4HJLB 3S29A 5D83A 2RNTA 3U97A 6STDA 1ASKA 2BHMA 1NO3A 2LYXA 2R41A 3BNBA 5AIGA 1I0XA 3X41A 1MWRA 5BXQA 1MGRA 1UI8A 3PS8A 3T0UA 8RNTA 3CU3A 4XBYA 2Z76A 3D3LA 4OK0A 1X1XA 3DGMA 3A76A 1K28A 3ER7A 3J7Yd 4AEQA 1V74A 4I4KA 5JPPA 1KD14 1B2UA 4NREA 1VZZA 3Q90A 2Z7AA 3F7SA 2L1SA 5HGRA 1OHSA 1I70A 1W6CA 3ZG0A 2QEX3 1E3VA 2W0QA 1JKGA 2IY2A 3F7XA 1VQK3 1PFPA 3AGOA 3EBYA 1FZUA 1RHLA 1AV4A 2KF6A 5IERA 1A90A 4R9KA 3LTBA 4HM6B 1UDII 1O7PB 3JUNA 1W7CA 2XFTA 1R4YA 2HMOB 2F5WA 3DGYA 4LYLB 2FXTA 2L4VA 4HVNA 4HM3B 1D6UA 1GMRA 3WA3A 4EC6A 1RMSA 3CCS3 1IT8A 3NXJA 2CX1A 1JB4A 3CCV3 1M1XB 1WMOA 2RGQA 1OPYA 1RJOA 1X1WA 1ULJB 1KQS2 1HU9A 1OUNA 2F86B 2CIUA 3Q3FA 4HAAA 3G8ZA 2GU3A 1N9EA 3CCL3 4U13A 3KSPA 1JRQA 3SYUA 1VQM3 3G6E3 2YX9A 1GS3A 3BU4A 1GMPA 1MWTA 3BNCA 3LMLA 1N8QA 1W6YA 4EV5A 1NJI4 2QA43 2C4BA 1UI7A 2OCTA 2Y73A 4HM2B 4EXRA 3JUMA 1BSBA 4FMCA 1TUHA 2ZDJA 2IUJA 3SOYA 3KIIA 2P05A 1BRGA 3AHWA 3JVCA 2M7OA 4O3VA 3FG4A 1US1A 1K41A 1X1UA 3MHEA 5M1AA 1A67A 1IQYA 5JBSA 1W5ZA 2P0XA 3LT9A 1I0VA 1FGOA 1B20A 5FW5A 4G1MB 1RN1A 3AGNA 1ZX2A 3BNEA 4OUQA 3JUOA 2GBWB 5KP3A 4LZIA 2IYJA 1JKGB 1K9M4 1QAKA 3IJEB 1DMNA 3K63A 4CCVA 1BSDA 1SQWA 1N8R4 1BGSA 5CXOA 3KE7A 1NNVA 4N6TA 2SARA 4CDLA 1JBRA 2WGOA 4ILFA 1BNSA 1I3FA 1V58A 3NBBA 5CK6A 3URPA 3HOHA 1KWIA 5IG3A 2CWVA 1W6GA 4R4KA 3SOAA 4BL3A 1QVF2 3D79A 5KP4A 3EF8A 3O8YA 4H61A 1BNEA 3MG2A 4J8TA 1BVIA 1I2GA 1UCJA 3CXC2 4MMXB 3FF2A 3K9MC 3H51A 4NHFA 1Z1SA 3OXAA 2E2VA 3T8NA 1MNLA 1GOVA 2OQEC 3I0YA 3PCRA 4HM1B 1VQ93 3WODG 1C54A 1ROAA 4IPBA 1RRLA 4EBGA 3NBRA 3OX9A 1B2ZA 1FUTA 2BMOB 4WP5A 5KP1A 1Q864 3MWZA 4STDA 2XH9A 1HZ1A 3UL6A 1YGWA 3OWUA 3X3XA 4LSOA 2I9WA 3WOFB 3FCSB 3WR2A 3EX9A 1W2ZA 3ECFA 2O3OA 3CNXA 5DRVA 1G02A 1J2BA 1BAOA 3LZAA 1Y4KA 1YIJ3 2CC3A 1O7WB 1FUSA 1RGAA 5AI1A 1CYUA 5DREA 2WOHA 3WA2X 1O7HB 1MGWA 2V1LA 3PGBA 4FCMA 1SPUA 4FCJA 1B27A 1GD4A 2AAEA 2RSXA 2W03A 4J5GA 3D5GA 3BLZA 4O8SA 1BNRA 3RGAA 1UCLA 2ZL8A 2HOHA 1ROVA 4XBTA 4KFDA 4MMYB 2BMRB 1D6YA 3MKIA 4K90B 3EC9A 3KSED 3E99A 2J8XB 4AKZA 1CEWI 1GYBA 3I553 1JJ22 1EEJA 3EB8A 4CPKA 3BB9A 1OF5B 1JZDA 4X2OA 5D81A 2JQ5A 2F56A 4TX4A 3CCM3 4DKIA 5D82A 1G96A 4OVMA 1RN7A 1F8NA 2WO0A 3G0KA 2BMQB 1S5AA 3L0RA 3V99A 3GZXB 2XRXB 2YFLB 3NX0A 2CG1A 4KFEA 5ELUA 1M1K4 3GWRA 4FMAA 3V98A 1R4CA 3G713 1UGIA 2GEXA 1VQ73 1LNHA 3F8HA 4XBXA 2HMNB 3V92A 3VGNA 5IG4A 2YFIB 1FGQA 4N6UA 1AVLA 4EYCA 3GSPA 4HM8B 1EA2A 1Q9EA 1UUGB 2CWUA 2HMLB 6RNTA 6GSPA 4GL6A 2K3DA 1OF5A 1IQXA 1V57A 2GSPA 2IUKA 1YNVX 3FG3A 1W02A 1E97A 2KAAA 3JUQA 4FCZA 1BSAA 2CFWA 1OACA 2OOVA 4RBNA 1YI23 1Q7Y4 1BNGA 1JB5A 3DH2A 3HI7A 2GEYA 3EHCA 1M9GA 1GSPA 4H3UA 1STFI 4GSPA 1RCKA 3MSOA 4L8PA 5JPUA 5RNTA 2CFDA 3CCU3 1PYLA 1VQ83 3NM7A 3RDEA 5IW9A 3MG1A 1TFOA 1DETA 3F40A 3BNDA 1RKYA 1JBTA 2OTJ3 1FGRA 2XGLA 4KT3B 4R1KA 1T2HA 2CW9A 4HZ9B 5TGNA 3OWSA 2OOVC 4HYZA 4HZBB 4RNZA 4RNTA 1VQP3 4N3VA 1LQGC 2XSOB 1EG9B 5G1KA 2K54A 1OGXA 5AYRB 3ZG5A 1TTOA 2C11A 3CCR3 2B24B 3MYTA 4MMZB 5AIHA 4EV2A 1RSNA 3NQZA 1QAFA 3UB1A 1NDOB 1DMMA 1QJGA 1AQZA 3G16A 3IPTA 1B21A 1LQMB 4EW5A 3HK4A 4KZ1A 1FW7A 9RNTA 2INXA 2KRTA 1YJW3 1T2IA 4BTXA 1A2KA 2WGQA 2JDIH 1Q814 3CNMA 3DGLA 3NV0A 3H3HA 3D5IA 4JF8A
chains in the Genus database with same CATH topology
1DVCA 3DM8A 3WOEB 3S27A 1E3RA 2IMJA 1T5YA 4WYKA 3UL5A 1HKXA 4RNYA 5IF6A 2W9PA 2OQEA 4LMIA 5IEOA 5STDA 1FA3A 3CC43 1YHQ3 1SIIA 1IDPA 1IVUA 2WOFA 3UJMA 3KZTA 3UNLA 3EN8A 2Q07A 1NB5I 1N5HA 1TIJA 5IG5A 4N6V0 4MEIA 2P0MA 1FGTA 3U1WA 3NQYA 3F8XA 1KC84 2OTL3 2XEPA 4K61A 4O2HA 4WYKB 4J9AA 2E2UA 2HMMB 3LH4A 3GRDA 5CF1A 3OV4A 3EQQB 3DY5A 3CCQ3 2KCDA 2MF7A 5ELJA 2W56B 1K8A4 3FKAA 3CME3 1Q40B 1JB2A 2CG0A 1AVKA 3D9RA 2W9QA 1VQ53 4Q53A 2PZVA 3CC23 3CCJ3 2A15A 3B4PA 1Q42A 5IG0A 4WWUC 3LTAA 1FGMA 2E2TA 3RGRA 4QWTA 3CMA3 1C7HA 5BVBA 1CYVA 1NB3I 1UUWB 1O7GB 1IT7A 2OWPA 1DVDA 3K0ZA 3FF0A 1TFKA 3K5TA 1DMQA 1EQKA 1TP6A 3NV0B 3ALAA 5FGOA 4L7KA 4IT7A 3Q1CA 3Q2PA 5LC7A 3AMOB 1IV7A 2RCDA 1O7NB 5CLKA 3B4OA 2Z6BA 2C10A 5EQLA 2CKFB 1VQO3 1SJWA 3GZRA 4R80A 3F14A 1S723 4RZMA 1AR0A 1D6ZA 3TDGA 3GZBA 4KFFA 5IEPA 3F9SA 1ISKA 1QALA 2ML6A 3FLJA 5I97A 4R9LA 3S28A 3LT8A 1WMNA 4XB5A 2K0MA 4LGQA 4MJDA 3PYJA 1WQLB 3MG3A 3CPOA 1VQ63 3N54B 2HMJB 1A2VA 4HKVB 1PU4A 3QRDA 2B1XB 3FH1A 1IVVA 2FNQA 2QGUA 2XGNA 1QMAA 1W2B2 5AIIA 3QK9A 4FR9A 1U5OA 5IENA 3PZWA 2GU1A 3FZWA 2W56A 3N8BA 3CCE3 3GAXA 1VQL3 1STDA 1WTHA 4XM4A 2F98A 3EBTA 4PEJA 2SBLA 1YIT3 4JRFA 2KXGA 2W04A 3MPHA 1DYUA 4HM5B 4AKYA 3SXXA 1QVG2 1FUWA 1GY5A 3OW22 3SLUA 2BO9B 3WMDA 1YJN3 1SIHA 1OCVA 2QIYA 2XF3A 3S67A 3FGYA 1ZO2A 5A0OB 3S5CA 5EEOA 4XDWA 2P09A 2CFLA 3X3ZA 3JUPA 3VF1A 5AEUB 3KKGA 2CHCA 1IV9A 4HM7B 2GXFA 5G2GA 1JN5A 4ORLA 2LQVA 1UUVB 2W6JH 3KN4A 4N6NB 3PXMA 3SEDA 1IVWA 3LOYA 4HBRA 3SX1A 4K1VA 1M904 4XDVA 5LC6A 3ROBA 1W4NA 1RRHA 2RFRA 3GZYB 3T8UA 5AIFA 1YJ93 2XFSA 3DMCA 4BTYA 3I563 3NUVA 3DUKA 1Q40A 3B8LA 3KFQC 1W01A 2XR8B 2UX0A 1YVBI 1JN5B 4N6MA 3CPW2 2Z77A 3HIIA 1OH0A 2Y74A 1Q824 2IA7A 2CFGA 3NBJA 1LXEA 3WDGB 3VSYA 3X40A 1GY7A 3K7CA 3EE1A 2D1WA 3PCSA 4N6LA 4HM4B 1NU3A 1WNHA 2BNGA 4L8OA 3LXUX 1EKMA 2CH9A 3AMOA 3M8CA 4HM0B 1WMPA 2CK3H 1IK3A 2YFJB 1O7MB 1IVXA 1LOXA 1YGEA 4IIAA 1L5GB 5AEWB 5BXQA 3EJVA 3NM2A 1NWWA 1MOLA 3G4S3 4FMDA 1OHPA 3B7CA 3STDA 4WHAA 2BT3A 3N9HA 3X3YA 4LEHA 4WFOA 2MC8A 1JV2B 3CD63 2HMKB 3X42A 2PNCA 5AYSC 2CWTA 1VQN3 4BTWA 2ML5A 1VQ43 3OWYA 2P38A 1GD3A 1OGZA 3HIGA 1K734 1BUQA 2D42A 1U8CB 1N9JA 4GB5A 3EN1B 7STDA 3LTCA 1ULIB 3HX8A 4K1UA 2W2CA 3LTDA 3DGOA 1TU5A 1OHOA 1W00A 2XSHB 4ZM8A 3FSDA 3HZPA 5CF2A 3DXOA 3NHXA 1GY6A 2CFKA 2STDA 1KSIA 4O02B 4N6OB 2O9UX 2F99A 2GBXB 5EVHA 4KVHA 1UW1A 3LYGA 1N5PA 1CQSA 1LVNA 2R4IA 3CC73 3DGNA 4FMBA 1JNQA 3IMAB 1IQ8A 4X2HA 3DZLA 3FG1A 8CHOA 1IU7A 2FGTA 4HJLB 3S29A 5D83A 3U97A 6STDA 1ASKA 2BHMA 1NO3A 2LYXA 5AIGA 3BNBA 3X41A 1UI8A 3PS8A 3T0UA 3CU3A 4XBYA 2Z76A 3D3LA 4OK0A 3DGMA 3A76A 1K28A 3ER7A 3J7Yd 4AEQA 1V74A 4I4KA 5JPPA 1KD14 4NREA 1VZZA 3Q90A 2Z7AA 3F7SA 5HGRA 1OHSA 1W6CA 2QEX3 1E3VA 2W0QA 1JKGA 3F7XA 1VQK3 1PFPA 3EBYA 1AV4A 5IERA 1A90A 4R9KA 3LTBA 4HM6B 1O7PB 3JUNA 1W7CA 2XFTA 2HMOB 2FXTA 2L4VA 4HVNA 4HM3B 1D6UA 3WA3A 4EC6A 3CCS3 1IT8A 3NXJA 3CCV3 1JB4A 1M1XB 1WMOA 2RGQA 1OPYA 1RJOA 1ULJB 1KQS2 1HU9A 1OUNA 2F86B 2CIUA 3G8ZA 2GU3A 1N9EA 3CCL3 4U13A 3KSPA 1JRQA 1VQM3 3G6E3 2YX9A 1GS3A 3LMLA 3BNCA 4EV5A 1N8QA 1W6YA 1NJI4 2QA43 1UI7A 2OCTA 2Y73A 4HM2B 4EXRA 3JUMA 4FMCA 1TUHA 2ZDJA 2IUJA 3SOYA 3KIIA 2P05A 3JVCA 2M7OA 4O3VA 3FG4A 1US1A 1K41A 3MHEA 1A67A 1IQYA 5JBSA 1W5ZA 2P0XA 3LT9A 1FGOA 5FW5A 4G1MB 1ZX2A 3BNEA 4OUQA 3JUOA 2GBWB 5KP3A 4LZIA 1JKGB 1K9M4 1QAKA 3IJEB 1DMNA 3K63A 4CCVA 1SQWA 1N8R4 5CXOA 3KE7A 4N6TA 4CDLA 2WGOA 3NBBA 5CK6A 1KWIA 5IG3A 2CWVA 1W6GA 4R4KA 3SOAA 1QVF2 5KP4A 3EF8A 3O8YA 4H61A 3MG2A 4J8TA 3CXC2 4MMXB 3FF2A 3K9MC 3H51A 4NHFA 1Z1SA 3OXAA 2E2VA 3T8NA 1MNLA 2OQEC 3I0YA 3PCRA 4HM1B 1VQ93 3WODG 1ROAA 4IPBA 1RRLA 4EBGA 3NBRA 3OX9A 2BMOB 4WP5A 5KP1A 1Q864 3MWZA 4STDA 2XH9A 3UL6A 3OWUA 3X3XA 4LSOA 2I9WA 3WOFB 3FCSB 3EX9A 1W2ZA 3ECFA 2O3OA 3CNXA 5DRVA 1J2BA 3LZAA 1Y4KA 1YIJ3 2CC3A 1O7WB 5AI1A 1CYUA 5DREA 2WOHA 3WA2X 1O7HB 2V1LA 3PGBA 4FCMA 1SPUA 4FCJA 1GD4A 2RSXA 2W03A 3BLZA 4O8SA 3RGAA 2ZL8A 1ROVA 4XBTA 4KFDA 2BMRB 1D6YA 3MKIA 4K90B 3EC9A 3KSED 3E99A 4AKZA 1JJ22 1CEWI 1GYBA 3I553 3EB8A 3BB9A 1OF5B 4X2OA 5D81A 2JQ5A 4TX4A 3CCM3 5D82A 1G96A 4OVMA 1RN7A 1F8NA 2WO0A 3G0KA 2BMQB 1S5AA 3L0RA 3V99A 3GZXB 2XRXB 2YFLB 3NX0A 2CG1A 4KFEA 5ELUA 1M1K4 3GWRA 4FMAA 3V98A 1R4CA 3G713 2GEXA 1VQ73 1LNHA 3F8HA 4XBXA 2HMNB 3V92A 3VGNA 5IG4A 2YFIB 1FGQA 4N6UA 1AVLA 4EYCA 4HM8B 1EA2A 2CWUA 2HMLB 4GL6A 1OF5A 1IQXA 2IUKA 3FG3A 1W02A 1E97A 3JUQA 4FCZA 2CFWA 2OOVA 1OACA 1YI23 4RBNA 1Q7Y4 1JB5A 3HI7A 2GEYA 3EHCA 1M9GA 4H3UA 4MMYB 1STFI 3SVAA 4L8PA 3MSOA 5JPUA 2CFDA 3CCU3 1VQ83 3NM7A 3RDEA 5IW9A 3MG1A 1TFOA 3F40A 3BNDA 1RKYA 2OTJ3 1FGRA 2XGLA 4R1KA 2CW9A 4HZ9B 5TGNA 3OWSA 2OOVC 4HYZA 4HZBB 4RNZA 1VQP3 4N3VA 2XSOB 5AYRB 1EG9B 2K54A 1OGXA 3CCR3 2C11A 2B24B 3MYTA 4MMZB 5AIHA 4EV2A 3NQZA 1QAFA 3UB1A 1NDOB 1DMMA 1QJGA 3G16A 3IPTA 3HK4A 4KZ1A 2INXA 2KRTA 1YJW3 4BTXA 1A2KA 2WGQA 2JDIH 1Q814 3CNMA 3DGLA 3NV0A 3H3HA 4JF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM1 B;  3DM8 A;  6STD A;  5IF6 A;  1ASK A;  1E3R A;  2IMJ A;  4WYK A;  3WMD A;  1HKX A;  3NBR A;  3OX9 A;  2BMO B;  1OCV A;  4WP5 A;  2QIY A;  5AIG A;  5KP1 A;  3FGY A;  1ZO2 A;  4STD A;  3S5C A;  4LMI A;  5IEO A;  5STD A;  3OWU A;  3CU3 A;  4XBY A;  2Z76 A;  4XDW A;  2I9W A;  3A76 A;  1IDP A;  3ER7 A;  3UJM A;  3JUP A;  3EX9 A;  5AEU B;  4I4K A;  3ECF A;  3KZT A;  3KKG A;  3CNX A;  5DRV A;  3UNL A;  5JPP A;  1VZZ A;  2CHC A;  3EN8 A;  3Q90 A;  2Z7A A;  3F7S A;  3LZA A;  4HM7 B;  5HGR A;  5IG5 A;  1OHS A;  2GXF A;  5G2G A;  1JN5 A;  4ORL A;  1O7W B;  1UUV B;  1E3V A;  5AI1 A;  1JKG A;  5DRE A;  3F7X A;  3F8X A;  1O7H B;  3SED A;  4FCM A;  3EBY A;  4FCJ A;  4WYK B;  4J9A A;  2HMM B;  3GRD A;  5IER A;  3BLZ A;  5CF1 A;  4K1V A;  4R9K A;  3RGA A;  3OV4 A;  3EQQ B;  1O7P B;  3JUN A;  4HM6 B;  4XDV A;  3ROB A;  5IG4 A;  4XBT A;  2RFR A;  3GZY B;  3T8U A;  2HMO B;  2BMR B;  5AIF A;  3DMC A;  3MKI A;  3FKA A;  4HVN A;  3NUV A;  1Q40 B;  1JB2 A;  3D9R A;  3EC9 A;  3DUK A;  3E99 A;  1Q40 A;  3B8L A;  1GYB A;  2PZV A;  4HM3 B;  1W01 A;  2XR8 B;  2A15 A;  3B4P A;  1JB4 A;  3NXJ A;  1Q42 A;  1OF5 B;  3BB9 A;  4X2O A;  2RGQ A;  2JQ5 A;  2UX0 A;  1OPY A;  4WWU C;  5D81 A;  5IG0 A;  1ULJ B;  5D82 A;  1JN5 B;  1OUN A;  4OVM A;  3RGR A;  2F86 B;  2Z77 A;  1OH0 A;  3G0K A;  1C7H A;  3G8Z A;  5BVB A;  2BMQ B;  1S5A A;  4U13 A;  1UUW B;  3KSP A;  1O7G B;  3VSY A;  3GZX B;  2XRX B;  2YFL B;  2OWP A;  3GWR A;  3K0Z A;  3FF0 A;  1GY7 A;  1GS3 A;  3K7C A;  1DMQ A;  2GEX A;  1TP6 A;  1W6Y A;  3NV0 B;  3F8H A;  4HJL B;  4HM4 B;  4L7K A;  1NU3 A;  2HMN B;  4XBX A;  3VGN A;  2BNG A;  4L8O A;  2RCD A;  4HM2 B;  1O7N B;  2YFI B;  3M8C A;  4HM0 B;  5CLK A;  3B4O A;  3JUM A;  4HM8 B;  1EA2 A;  2HML B;  2CKF B;  1TUH A;  2YFJ B;  1O7M B;  3SOY A;  5AEW B;  5BXQ A;  1SJW A;  4IIA A;  1OF5 A;  3GZR A;  3F14 A;  3EJV A;  4RZM A;  1AR0 A;  1NWW A;  3NM2 A;  1K41 A;  3GZB A;  1W02 A;  1E97 A;  3JUQ A;  3MHE A;  1OHP A;  5IEP A;  3B7C A;  3F9S A;  3STD A;  1ISK A;  1JB5 A;  2GEY A;  3EHC A;  5JPU A;  4H3U A;  3FLJ A;  4L8P A;  3MSO A;  5FW5 A;  4LEH A;  4R9L A;  1ZX2 A;  2HMK B;  4OUQ A;  3JUO A;  2GBW B;  3MG1 A;  4LGQ A;  4MJD A;  4XB5 A;  1WQL B;  3MG3 A;  3CPO A;  5KP3 A;  3F40 A;  1JKG B;  2HMJ B;  4HKV B;  1DMN A;  3OWY A;  1OGZ A;  1BUQ A;  4R1K A;  2B1X B;  4HZ9 B;  5TGN A;  5CXO A;  3FH1 A;  3KE7 A;  3OWS A;  4GB5 A;  2QGU A;  3EN1 B;  4HZB B;  1QMA A;  4CDL A;  7STD A;  1ULI B;  3HX8 A;  4K1U A;  2W2C A;  5AII A;  4N3V A;  2XSO B;  5CK6 A;  1EG9 B;  2K54 A;  1OGX A;  1U5O A;  5IEN A;  5IG3 A;  2B24 B;  1OHO A;  3FZW A;  1W00 A;  2XSH B;  3MYT A;  3SOA A;  3FSD A;  3HZP A;  5AIH A;  3DXO A;  1STD A;  3NHX A;  4XM4 A;  1GY6 A;  1NDO B;  5CF2 A;  2F98 A;  1DMM A;  1QJG A;  2STD A;  3EBT A;  4PEJ A;  4Q53 A;  3G16 A;  3EF8 A;  3IPT A;  5KP4 A;  3MG2 A;  4J8T A;  2F99 A;  2GBX B;  5EVH A;  3HK4 A;  4KVH A;  3LYG A;  1CQS A;  2R4I A;  2INX A;  3FF2 A;  1A2K A;  4HM5 B;  3H51 A;  3CNM A;  3NV0 A;  1Z1S A;  4X2H A;  3DZL A;  3OXA A;  3H3H A;  3T8N A;  8CHO A;  1GY5 A;  5D83 A;  3I0Y A; 
#chains in the Genus database with same CATH topology
 1DVC A;  3DM8 A;  3WOE B;  3S27 A;  1E3R A;  2IMJ A;  1T5Y A;  4NPB A;  1RGF A;  1HKX A;  1ZS7 A;  4RNY A;  4WYK A;  3UL5 A;  2W9P A;  1B2X A;  2OQE A;  4LMI A;  5IEO A;  5STD A;  1FA3 A;  3CC4 3;  1RGL A;  1YHQ 3;  1SII A;  1IDP A;  1IVU A;  2WOF A;  3UJM A;  3KZT A;  3UNL A;  7GSP A;  3EN8 A;  2Q07 A;  1NB5 I;  4BIR A;  1N5H A;  1TIJ A;  5IG5 A;  4N6V 0;  1X1Y A;  1BNJ A;  4MEI A;  2P0M A;  1FGT A;  3U1W A;  3RNT A;  3NQY A;  3F8X A;  1KC8 4;  3WHO A;  2OTL 3;  2XEP A;  1BRJ A;  1VQQ A;  4K61 A;  4O2H A;  4WYK B;  4J9A A;  2E2U A;  2HMM B;  3LH4 A;  3GRD A;  5CF1 A;  3OV4 A;  3EQQ B;  3DY5 A;  3CCQ 3;  2KCD A;  2MF7 A;  5ELJ A;  2W56 B;  5M18 A;  1K8A 4;  3FKA A;  1PY3 A;  1HYF A;  5GSP A;  3CME 3;  1Q40 B;  1JB2 A;  2CG0 A;  1AVK A;  3D9R A;  2W9Q A;  1VQ5 3;  4Q53 A;  2PZV A;  3CC2 3;  3CCJ 3;  2A15 A;  1RGC A;  3B4P A;  1Q42 A;  5IG0 A;  3A5E A;  1LRA A;  4WWU C;  1BIR A;  3LTA A;  1FGM A;  2E2T A;  3RGR A;  1A2P A;  1GOU A;  4QWT A;  3CMA 3;  1C7H A;  5BVB A;  1CYV A;  1NB3 I;  1UUW B;  2BU4 A;  1O7G B;  1RNT A;  2UGI A;  1IT7 A;  1MWU A;  2OWP A;  3K0Z A;  3FF0 A;  1DVD A;  1TFK A;  3K5T A;  1DMQ A;  1EQK A;  1TP6 A;  1EUI C;  3NV0 B;  3ALA A;  5FGO A;  1RTU A;  4L7K A;  4IT7 A;  4BU4 A;  3Q1C A;  3Q2P A;  5LC7 A;  1I2E A;  1IV7 A;  2RCD A;  1O7N B;  3AMO B;  5CLK A;  3B4O A;  2Z6B A;  2C10 A;  5EQL A;  2CKF B;  4I5Q A;  1VQO 3;  1RGE A;  1UCK A;  1SJW A;  1RCL A;  3GZR A;  3F14 A;  4R80 A;  1S72 3;  4RZM A;  1RGK A;  1AR0 A;  1D6Z A;  3TDG A;  3GZB A;  1ZGX A;  4KFF A;  5IEP A;  3F9S A;  1ISK A;  1QAL A;  2ML6 A;  1UGH I;  3FLJ A;  5I97 A;  2F5M A;  1TJD A;  4R9L A;  3S28 A;  3LT8 A;  1BRH A;  1WMN A;  4XB5 A;  7RNT A;  2K0M A;  4LGQ A;  4MJD A;  3PYJ A;  1WQL B;  3MG3 A;  3CPO A;  1VQ6 3;  3N54 B;  1Q7H A;  1TRQ A;  1A2V A;  2HMJ B;  4HKV B;  3BIR A;  1PU4 A;  3QRD A;  3ZFZ A;  2B1X B;  2F4Y A;  3FH1 A;  1IVV A;  2FNQ A;  2QGU A;  2XGN A;  1QMA A;  2H0I A;  1W2B 2;  5AII A;  3QK9 A;  4J5K A;  4FR9 A;  1BSC A;  1U5O A;  5IEN A;  3PZW A;  2GU1 A;  3FZW A;  2W56 A;  3N8B A;  3CCE 3;  3GAX A;  1VQL 3;  1STD A;  1WTH A;  4XM4 A;  2F98 A;  3EBT A;  4PEJ A;  2SBL A;  1YIT 3;  4JRF A;  1B2S A;  2KXG A;  2RBI A;  2W04 A;  1I2F A;  3MPH A;  1DYU A;  1JZO A;  4HM5 B;  4AKY A;  1LOV A;  3SXX A;  1QVG 2;  1B2M A;  1GY5 A;  1FUW A;  2ZHX B;  3OW2 2;  1BRI A;  1IYY A;  3SLU A;  2BO9 B;  3WMD A;  1YJN 3;  1SIH A;  1GMQ A;  1OCV A;  2QIY A;  2XF3 A;  3S67 A;  3FGY A;  1ZO2 A;  5A0O B;  3S5C A;  5EEO A;  1RN4 A;  1BRS A;  4XDW A;  2P09 A;  2CFL A;  3X3Z A;  3JUP A;  3VF1 A;  5AEU B;  3KKG A;  1BRK A;  2CHC A;  1IV9 A;  4HM7 B;  1BNI A;  2GXF A;  1B3S A;  5G2G A;  1JN5 A;  4ORL A;  2LQV A;  1UUV B;  1LOW A;  2W6J H;  3KN4 A;  4N6N B;  3PXM A;  3SED A;  1IVW A;  3LOY A;  4HBR A;  3SX1 A;  2KF3 A;  4K1V A;  1M90 4;  4XDV A;  4GHO A;  5LC6 A;  3ROB A;  1W4N A;  1CH0 A;  2KF5 A;  1RRH A;  2RFR A;  3GZY B;  3T8U A;  5AIF A;  1YJ9 3;  2XFS A;  5BU4 A;  3DMC A;  4BTY A;  3I56 3;  1G0T A;  3NUV A;  1LOY A;  3DUK A;  1Q40 A;  3B8L A;  3KFQ C;  1W01 A;  2XR8 B;  2KF4 A;  5HOH A;  2UX0 A;  1BSE A;  1YVB I;  1JN5 B;  4N6M A;  3CPW 2;  1BNF A;  2Z77 A;  3HII A;  1BAN A;  5M19 A;  1OH0 A;  1UCI A;  2Y74 A;  1Q82 4;  2IA7 A;  2CFG A;  3NBJ A;  1LXE A;  2UUG C;  3WDG B;  3VSY A;  3X40 A;  1GY7 A;  3K7C A;  3EE1 A;  2D1W A;  3PCS A;  1RLS A;  4N6L A;  4HM4 B;  1NU3 A;  1WNH A;  1YVS A;  3AHS A;  2H0H A;  1BRN L;  2BNG A;  4L8O A;  3LXU X;  5BIR A;  1EKM A;  2CH9 A;  3AMO A;  3M8C A;  4HM0 B;  1WMP A;  1RGH A;  2CK3 H;  1IK3 A;  2YFJ B;  1O7M B;  1IVX A;  1LOX A;  1YGE A;  2H0G A;  1SAR A;  4IIA A;  1MWS A;  1L5G B;  5AEW B;  1RNB A;  3EJV A;  3NM2 A;  1NWW A;  1MOL A;  3G4S 3;  4FMD A;  4CJN A;  1OHP A;  1BU4 A;  3B7C A;  1JBS A;  3STD A;  2BIR A;  4WHA A;  4HOH A;  2BT3 A;  4BL2 A;  3N9H A;  5G1L A;  3X3Y A;  1BUJ A;  2CX0 A;  2ZA4 A;  4LEH A;  1JV2 B;  4WFO A;  1FYS A;  2MC8 A;  3CD6 3;  2HMK B;  3X42 A;  5IF6 A;  2PNC A;  5AYS C;  2CWT A;  1VQN 3;  4BTW A;  2ML5 A;  1VQ4 3;  3OWY A;  2P38 A;  1GD3 A;  1OGZ A;  3HIG A;  1K73 4;  1BUQ A;  2D42 A;  1DE3 A;  1U8C B;  1N9J A;  4GB5 A;  3EN1 B;  7STD A;  3LTC A;  1ULI B;  3HX8 A;  1LNI A;  2W2C A;  4K1U A;  3LTD A;  3DGO A;  3KCH A;  1TU5 A;  1I3I A;  1OHO A;  1BOX A;  1W00 A;  1RGG A;  2XSH B;  3FSD A;  3HZP A;  4ZM8 A;  3DXO A;  5CF2 A;  3NHX A;  1GY6 A;  2CFK A;  2STD A;  1AY7 A;  1I8V A;  1KSI A;  1RDS A;  4O02 B;  2AAD A;  2O9U X;  2F99 A;  2GBX B;  4N6O B;  4KVH A;  1UW1 A;  3LYG A;  1N5P A;  5EVH A;  1T3B A;  1CQS A;  1LVN A;  2R4I A;  3SVA A;  1GOY A;  3CC7 3;  3DGN A;  4FMB A;  3D4A A;  1JNQ A;  3IMA B;  1TRP A;  1IQ8 A;  4X2H A;  3DZL A;  3FG1 A;  8CHO A;  1IU7 A;  2FGT A;  4HJL B;  3S29 A;  5D83 A;  2RNT A;  3U97 A;  6STD A;  1ASK A;  2BHM A;  1NO3 A;  2LYX A;  2R41 A;  3BNB A;  5AIG A;  1I0X A;  3X41 A;  1MWR A;  5BXQ A;  1MGR A;  1UI8 A;  3PS8 A;  3T0U A;  8RNT A;  3CU3 A;  4XBY A;  2Z76 A;  3D3L A;  4OK0 A;  1X1X A;  3DGM A;  3A76 A;  1K28 A;  3ER7 A;  3J7Y d;  4AEQ A;  1V74 A;  4I4K A;  5JPP A;  1KD1 4;  1B2U A;  4NRE A;  1VZZ A;  3Q90 A;  2Z7A A;  3F7S A;  2L1S A;  5HGR A;  1OHS A;  1I70 A;  1W6C A;  3ZG0 A;  2QEX 3;  1E3V A;  2W0Q A;  1JKG A;  2IY2 A;  3F7X A;  1VQK 3;  1PFP A;  3AGO A;  3EBY A;  1FZU A;  1RHL A;  1AV4 A;  2KF6 A;  5IER A;  1A90 A;  4R9K A;  3LTB A;  4HM6 B;  1UDI I;  1O7P B;  3JUN A;  1W7C A;  2XFT A;  1R4Y A;  2HMO B;  2F5W A;  3DGY A;  4LYL B;  2FXT A;  2L4V A;  4HVN A;  4HM3 B;  1D6U A;  1GMR A;  3WA3 A;  4EC6 A;  1RMS A;  3CCS 3;  1IT8 A;  3NXJ A;  2CX1 A;  1JB4 A;  3CCV 3;  1M1X B;  1WMO A;  2RGQ A;  1OPY A;  1RJO A;  1X1W A;  1ULJ B;  1KQS 2;  1HU9 A;  1OUN A;  2F86 B;  2CIU A;  3Q3F A;  4HAA A;  3G8Z A;  2GU3 A;  1N9E A;  3CCL 3;  4U13 A;  3KSP A;  1JRQ A;  3SYU A;  1VQM 3;  3G6E 3;  2YX9 A;  1GS3 A;  3BU4 A;  1GMP A;  1MWT A;  3BNC A;  3LML A;  1N8Q A;  1W6Y A;  4EV5 A;  1NJI 4;  2QA4 3;  2C4B A;  1UI7 A;  2OCT A;  2Y73 A;  4HM2 B;  4EXR A;  3JUM A;  1BSB A;  4FMC A;  1TUH A;  2ZDJ A;  2IUJ A;  3SOY A;  3KII A;  2P05 A;  1BRG A;  3AHW A;  3JVC A;  2M7O A;  4O3V A;  3FG4 A;  1US1 A;  1K41 A;  1X1U A;  3MHE A;  5M1A A;  1A67 A;  1IQY A;  5JBS A;  1W5Z A;  2P0X A;  3LT9 A;  1I0V A;  1FGO A;  1B20 A;  5FW5 A;  4G1M B;  1RN1 A;  3AGN A;  1ZX2 A;  3BNE A;  4OUQ A;  3JUO A;  2GBW B;  5KP3 A;  4LZI A;  2IYJ A;  1JKG B;  1K9M 4;  1QAK A;  3IJE B;  1DMN A;  3K63 A;  4CCV A;  1BSD A;  1SQW A;  1N8R 4;  1BGS A;  5CXO A;  3KE7 A;  1NNV A;  4N6T A;  2SAR A;  4CDL A;  1JBR A;  2WGO A;  4ILF A;  1BNS A;  1I3F A;  1V58 A;  3NBB A;  5CK6 A;  3URP A;  3HOH A;  1KWI A;  5IG3 A;  2CWV A;  1W6G A;  4R4K A;  3SOA A;  4BL3 A;  1QVF 2;  3D79 A;  5KP4 A;  3EF8 A;  3O8Y A;  4H61 A;  1BNE A;  3MG2 A;  4J8T A;  1BVI A;  1I2G A;  1UCJ A;  3CXC 2;  4MMX B;  3FF2 A;  3K9M C;  3H51 A;  4NHF A;  1Z1S A;  3OXA A;  2E2V A;  3T8N A;  1MNL A;  1GOV A;  2OQE C;  3I0Y A;  3PCR A;  4HM1 B;  1VQ9 3;  3WOD G;  1C54 A;  1ROA A;  4IPB A;  1RRL A;  4EBG A;  3NBR A;  3OX9 A;  1B2Z A;  1FUT A;  2BMO B;  4WP5 A;  5KP1 A;  1Q86 4;  3MWZ A;  4STD A;  2XH9 A;  1HZ1 A;  3UL6 A;  1YGW A;  3OWU A;  3X3X A;  4LSO A;  2I9W A;  3WOF B;  3FCS B;  3WR2 A;  3EX9 A;  1W2Z A;  3ECF A;  2O3O A;  3CNX A;  5DRV A;  1G02 A;  1J2B A;  1BAO A;  3LZA A;  1Y4K A;  1YIJ 3;  2CC3 A;  1O7W B;  1FUS A;  1RGA A;  5AI1 A;  1CYU A;  5DRE A;  2WOH A;  3WA2 X;  1O7H B;  1MGW A;  2V1L A;  3PGB A;  4FCM A;  1SPU A;  4FCJ A;  1B27 A;  1GD4 A;  2AAE A;  2RSX A;  2W03 A;  4J5G A;  3D5G A;  3BLZ A;  4O8S A;  1BNR A;  3RGA A;  1UCL A;  2ZL8 A;  2HOH A;  1ROV A;  4XBT A;  4KFD A;  4MMY B;  2BMR B;  1D6Y A;  3MKI A;  4K90 B;  3EC9 A;  3KSE D;  3E99 A;  2J8X B;  4AKZ A;  1CEW I;  1GYB A;  3I55 3;  1JJ2 2;  1EEJ A;  3EB8 A;  4CPK A;  3BB9 A;  1OF5 B;  1JZD A;  4X2O A;  5D81 A;  2JQ5 A;  2F56 A;  4TX4 A;  3CCM 3;  4DKI A;  5D82 A;  1G96 A;  4OVM A;  1RN7 A;  1F8N A;  2WO0 A;  3G0K A;  2BMQ B;  1S5A A;  3L0R A;  3V99 A;  3GZX B;  2XRX B;  2YFL B;  3NX0 A;  2CG1 A;  4KFE A;  5ELU A;  1M1K 4;  3GWR A;  4FMA A;  3V98 A;  1R4C A;  3G71 3;  1UGI A;  2GEX A;  1VQ7 3;  1LNH A;  3F8H A;  4XBX A;  2HMN B;  3V92 A;  3VGN A;  5IG4 A;  2YFI B;  1FGQ A;  4N6U A;  1AVL A;  4EYC A;  3GSP A;  4HM8 B;  1EA2 A;  1Q9E A;  1UUG B;  2CWU A;  2HML B;  6RNT A;  6GSP A;  4GL6 A;  2K3D A;  1OF5 A;  1IQX A;  1V57 A;  2GSP A;  2IUK A;  1YNV X;  3FG3 A;  1W02 A;  1E97 A;  2KAA A;  3JUQ A;  4FCZ A;  1BSA A;  2CFW A;  1OAC A;  2OOV A;  4RBN A;  1YI2 3;  1Q7Y 4;  1BNG A;  1JB5 A;  3DH2 A;  3HI7 A;  2GEY A;  3EHC A;  1M9G A;  1GSP A;  4H3U A;  1STF I;  4GSP A;  1RCK A;  3MSO A;  4L8P A;  5JPU A;  5RNT A;  2CFD A;  3CCU 3;  1PYL A;  1VQ8 3;  3NM7 A;  3RDE A;  5IW9 A;  3MG1 A;  1TFO A;  1DET A;  3F40 A;  3BND A;  1RKY A;  1JBT A;  2OTJ 3;  1FGR A;  2XGL A;  4KT3 B;  4R1K A;  1T2H A;  2CW9 A;  4HZ9 B;  5TGN A;  3OWS A;  2OOV C;  4HYZ A;  4HZB B;  4RNZ A;  4RNT A;  1VQP 3;  4N3V A;  1LQG C;  2XSO B;  1EG9 B;  5G1K A;  2K54 A;  1OGX A;  5AYR B;  3ZG5 A;  1TTO A;  2C11 A;  3CCR 3;  2B24 B;  3MYT A;  4MMZ B;  5AIH A;  4EV2 A;  1RSN A;  3NQZ A;  1QAF A;  3UB1 A;  1NDO B;  1DMM A;  1QJG A;  1AQZ A;  3G16 A;  3IPT A;  1B21 A;  1LQM B;  4EW5 A;  3HK4 A;  4KZ1 A;  1FW7 A;  9RNT A;  2INX A;  2KRT A;  1YJW 3;  1T2I A;  4BTX A;  1A2K A;  2WGQ A;  2JDI H;  1Q81 4;  3CNM A;  3DGL A;  3NV0 A;  3H3H A;  3D5I A;  4JF8 A; 
#chains in the Genus database with same CATH homology
 1DVC A;  3DM8 A;  3WOE B;  3S27 A;  1E3R A;  2IMJ A;  1T5Y A;  4WYK A;  3UL5 A;  1HKX A;  4RNY A;  5IF6 A;  2W9P A;  2OQE A;  4LMI A;  5IEO A;  5STD A;  1FA3 A;  3CC4 3;  1YHQ 3;  1SII A;  1IDP A;  1IVU A;  2WOF A;  3UJM A;  3KZT A;  3UNL A;  3EN8 A;  2Q07 A;  1NB5 I;  1N5H A;  1TIJ A;  5IG5 A;  4N6V 0;  4MEI A;  2P0M A;  1FGT A;  3U1W A;  3NQY A;  3F8X A;  1KC8 4;  2OTL 3;  2XEP A;  4K61 A;  4O2H A;  4WYK B;  4J9A A;  2E2U A;  2HMM B;  3LH4 A;  3GRD A;  5CF1 A;  3OV4 A;  3EQQ B;  3DY5 A;  3CCQ 3;  2KCD A;  2MF7 A;  5ELJ A;  2W56 B;  1K8A 4;  3FKA A;  3CME 3;  1Q40 B;  1JB2 A;  2CG0 A;  1AVK A;  3D9R A;  2W9Q A;  1VQ5 3;  4Q53 A;  2PZV A;  3CC2 3;  3CCJ 3;  2A15 A;  3B4P A;  1Q42 A;  5IG0 A;  4WWU C;  3LTA A;  1FGM A;  2E2T A;  3RGR A;  4QWT A;  3CMA 3;  1C7H A;  5BVB A;  1CYV A;  1NB3 I;  1UUW B;  1O7G B;  1IT7 A;  2OWP A;  1DVD A;  3K0Z A;  3FF0 A;  1TFK A;  3K5T A;  1DMQ A;  1EQK A;  1TP6 A;  3NV0 B;  3ALA A;  5FGO A;  4L7K A;  4IT7 A;  3Q1C A;  3Q2P A;  5LC7 A;  3AMO B;  1IV7 A;  2RCD A;  1O7N B;  5CLK A;  3B4O A;  2Z6B A;  2C10 A;  5EQL A;  2CKF B;  1VQO 3;  1SJW A;  3GZR A;  4R80 A;  3F14 A;  1S72 3;  4RZM A;  1AR0 A;  1D6Z A;  3TDG A;  3GZB A;  4KFF A;  5IEP A;  3F9S A;  1ISK A;  1QAL A;  2ML6 A;  3FLJ A;  5I97 A;  4R9L A;  3S28 A;  3LT8 A;  1WMN A;  4XB5 A;  2K0M A;  4LGQ A;  4MJD A;  3PYJ A;  1WQL B;  3MG3 A;  3CPO A;  1VQ6 3;  3N54 B;  2HMJ B;  1A2V A;  4HKV B;  1PU4 A;  3QRD A;  2B1X B;  3FH1 A;  1IVV A;  2FNQ A;  2QGU A;  2XGN A;  1QMA A;  1W2B 2;  5AII A;  3QK9 A;  4FR9 A;  1U5O A;  5IEN A;  3PZW A;  2GU1 A;  3FZW A;  2W56 A;  3N8B A;  3CCE 3;  3GAX A;  1VQL 3;  1STD A;  1WTH A;  4XM4 A;  2F98 A;  3EBT A;  4PEJ A;  2SBL A;  1YIT 3;  4JRF A;  2KXG A;  2W04 A;  3MPH A;  1DYU A;  4HM5 B;  4AKY A;  3SXX A;  1QVG 2;  1FUW A;  1GY5 A;  3OW2 2;  3SLU A;  2BO9 B;  3WMD A;  1YJN 3;  1SIH A;  1OCV A;  2QIY A;  2XF3 A;  3S67 A;  3FGY A;  1ZO2 A;  5A0O B;  3S5C A;  5EEO A;  4XDW A;  2P09 A;  2CFL A;  3X3Z A;  3JUP A;  3VF1 A;  5AEU B;  3KKG A;  2CHC A;  1IV9 A;  4HM7 B;  2GXF A;  5G2G A;  1JN5 A;  4ORL A;  2LQV A;  1UUV B;  2W6J H;  3KN4 A;  4N6N B;  3PXM A;  3SED A;  1IVW A;  3LOY A;  4HBR A;  3SX1 A;  4K1V A;  1M90 4;  4XDV A;  5LC6 A;  3ROB A;  1W4N A;  1RRH A;  2RFR A;  3GZY B;  3T8U A;  5AIF A;  1YJ9 3;  2XFS A;  3DMC A;  4BTY A;  3I56 3;  3NUV A;  3DUK A;  1Q40 A;  3B8L A;  3KFQ C;  1W01 A;  2XR8 B;  2UX0 A;  1YVB I;  1JN5 B;  4N6M A;  3CPW 2;  2Z77 A;  3HII A;  1OH0 A;  2Y74 A;  1Q82 4;  2IA7 A;  2CFG A;  3NBJ A;  1LXE A;  3WDG B;  3VSY A;  3X40 A;  1GY7 A;  3K7C A;  3EE1 A;  2D1W A;  3PCS A;  4N6L A;  4HM4 B;  1NU3 A;  1WNH A;  2BNG A;  4L8O A;  3LXU X;  1EKM A;  2CH9 A;  3AMO A;  3M8C A;  4HM0 B;  1WMP A;  2CK3 H;  1IK3 A;  2YFJ B;  1O7M B;  1IVX A;  1LOX A;  1YGE A;  4IIA A;  1L5G B;  5AEW B;  5BXQ A;  3EJV A;  3NM2 A;  1NWW A;  1MOL A;  3G4S 3;  4FMD A;  1OHP A;  3B7C A;  3STD A;  4WHA A;  2BT3 A;  3N9H A;  3X3Y A;  4LEH A;  4WFO A;  2MC8 A;  1JV2 B;  3CD6 3;  2HMK B;  3X42 A;  2PNC A;  5AYS C;  2CWT A;  1VQN 3;  4BTW A;  2ML5 A;  1VQ4 3;  3OWY A;  2P38 A;  1GD3 A;  1OGZ A;  3HIG A;  1K73 4;  1BUQ A;  2D42 A;  1U8C B;  1N9J A;  4GB5 A;  3EN1 B;  7STD A;  3LTC A;  1ULI B;  3HX8 A;  4K1U A;  2W2C A;  3LTD A;  3DGO A;  1TU5 A;  1OHO A;  1W00 A;  2XSH B;  4ZM8 A;  3FSD A;  3HZP A;  5CF2 A;  3DXO A;  3NHX A;  1GY6 A;  2CFK A;  2STD A;  1KSI A;  4O02 B;  4N6O B;  2O9U X;  2F99 A;  2GBX B;  5EVH A;  4KVH A;  1UW1 A;  3LYG A;  1N5P A;  1CQS A;  1LVN A;  2R4I A;  3CC7 3;  3DGN A;  4FMB A;  1JNQ A;  3IMA B;  1IQ8 A;  4X2H A;  3DZL A;  3FG1 A;  8CHO A;  1IU7 A;  2FGT A;  4HJL B;  3S29 A;  5D83 A;  3U97 A;  6STD A;  1ASK A;  2BHM A;  1NO3 A;  2LYX A;  5AIG A;  3BNB A;  3X41 A;  1UI8 A;  3PS8 A;  3T0U A;  3CU3 A;  4XBY A;  2Z76 A;  3D3L A;  4OK0 A;  3DGM A;  3A76 A;  1K28 A;  3ER7 A;  3J7Y d;  4AEQ A;  1V74 A;  4I4K A;  5JPP A;  1KD1 4;  4NRE A;  1VZZ A;  3Q90 A;  2Z7A A;  3F7S A;  5HGR A;  1OHS A;  1W6C A;  2QEX 3;  1E3V A;  2W0Q A;  1JKG A;  3F7X A;  1VQK 3;  1PFP A;  3EBY A;  1AV4 A;  5IER A;  1A90 A;  4R9K A;  3LTB A;  4HM6 B;  1O7P B;  3JUN A;  1W7C A;  2XFT A;  2HMO B;  2FXT A;  2L4V A;  4HVN A;  4HM3 B;  1D6U A;  3WA3 A;  4EC6 A;  3CCS 3;  1IT8 A;  3NXJ A;  3CCV 3;  1JB4 A;  1M1X B;  1WMO A;  2RGQ A;  1OPY A;  1RJO A;  1ULJ B;  1KQS 2;  1HU9 A;  1OUN A;  2F86 B;  2CIU A;  3G8Z A;  2GU3 A;  1N9E A;  3CCL 3;  4U13 A;  3KSP A;  1JRQ A;  1VQM 3;  3G6E 3;  2YX9 A;  1GS3 A;  3LML A;  3BNC A;  4EV5 A;  1N8Q A;  1W6Y A;  1NJI 4;  2QA4 3;  1UI7 A;  2OCT A;  2Y73 A;  4HM2 B;  4EXR A;  3JUM A;  4FMC A;  1TUH A;  2ZDJ A;  2IUJ A;  3SOY A;  3KII A;  2P05 A;  3JVC A;  2M7O A;  4O3V A;  3FG4 A;  1US1 A;  1K41 A;  3MHE A;  1A67 A;  1IQY A;  5JBS A;  1W5Z A;  2P0X A;  3LT9 A;  1FGO A;  5FW5 A;  4G1M B;  1ZX2 A;  3BNE A;  4OUQ A;  3JUO A;  2GBW B;  5KP3 A;  4LZI A;  1JKG B;  1K9M 4;  1QAK A;  3IJE B;  1DMN A;  3K63 A;  4CCV A;  1SQW A;  1N8R 4;  5CXO A;  3KE7 A;  4N6T A;  4CDL A;  2WGO A;  3NBB A;  5CK6 A;  1KWI A;  5IG3 A;  2CWV A;  1W6G A;  4R4K A;  3SOA A;  1QVF 2;  5KP4 A;  3EF8 A;  3O8Y A;  4H61 A;  3MG2 A;  4J8T A;  3CXC 2;  4MMX B;  3FF2 A;  3K9M C;  3H51 A;  4NHF A;  1Z1S A;  3OXA A;  2E2V A;  3T8N A;  1MNL A;  2OQE C;  3I0Y A;  3PCR A;  4HM1 B;  1VQ9 3;  3WOD G;  1ROA A;  4IPB A;  1RRL A;  4EBG A;  3NBR A;  3OX9 A;  2BMO B;  4WP5 A;  5KP1 A;  1Q86 4;  3MWZ A;  4STD A;  2XH9 A;  3UL6 A;  3OWU A;  3X3X A;  4LSO A;  2I9W A;  3WOF B;  3FCS B;  3EX9 A;  1W2Z A;  3ECF A;  2O3O A;  3CNX A;  5DRV A;  1J2B A;  3LZA A;  1Y4K A;  1YIJ 3;  2CC3 A;  1O7W B;  5AI1 A;  1CYU A;  5DRE A;  2WOH A;  3WA2 X;  1O7H B;  2V1L A;  3PGB A;  4FCM A;  1SPU A;  4FCJ A;  1GD4 A;  2RSX A;  2W03 A;  3BLZ A;  4O8S A;  3RGA A;  2ZL8 A;  1ROV A;  4XBT A;  4KFD A;  2BMR B;  1D6Y A;  3MKI A;  4K90 B;  3EC9 A;  3KSE D;  3E99 A;  4AKZ A;  1JJ2 2;  1CEW I;  1GYB A;  3I55 3;  3EB8 A;  3BB9 A;  1OF5 B;  4X2O A;  5D81 A;  2JQ5 A;  4TX4 A;  3CCM 3;  5D82 A;  1G96 A;  4OVM A;  1RN7 A;  1F8N A;  2WO0 A;  3G0K A;  2BMQ B;  1S5A A;  3L0R A;  3V99 A;  3GZX B;  2XRX B;  2YFL B;  3NX0 A;  2CG1 A;  4KFE A;  5ELU A;  1M1K 4;  3GWR A;  4FMA A;  3V98 A;  1R4C A;  3G71 3;  2GEX A;  1VQ7 3;  1LNH A;  3F8H A;  4XBX A;  2HMN B;  3V92 A;  3VGN A;  5IG4 A;  2YFI B;  1FGQ A;  4N6U A;  1AVL A;  4EYC A;  4HM8 B;  1EA2 A;  2CWU A;  2HML B;  4GL6 A;  1OF5 A;  1IQX A;  2IUK A;  3FG3 A;  1W02 A;  1E97 A;  3JUQ A;  4FCZ A;  2CFW A;  2OOV A;  1OAC A;  1YI2 3;  4RBN A;  1Q7Y 4;  1JB5 A;  3HI7 A;  2GEY A;  3EHC A;  1M9G A;  4H3U A;  4MMY B;  1STF I;  3SVA A;  4L8P A;  3MSO A;  5JPU A;  2CFD A;  3CCU 3;  1VQ8 3;  3NM7 A;  3RDE A;  5IW9 A;  3MG1 A;  1TFO A;  3F40 A;  3BND A;  1RKY A;  2OTJ 3;  1FGR A;  2XGL A;  4R1K A;  2CW9 A;  4HZ9 B;  5TGN A;  3OWS A;  2OOV C;  4HYZ A;  4HZB B;  4RNZ A;  1VQP 3;  4N3V A;  2XSO B;  5AYR B;  1EG9 B;  2K54 A;  1OGX A;  3CCR 3;  2C11 A;  2B24 B;  3MYT A;  4MMZ B;  5AIH A;  4EV2 A;  3NQZ A;  1QAF A;  3UB1 A;  1NDO B;  1DMM A;  1QJG A;  3G16 A;  3IPT A;  3HK4 A;  4KZ1 A;  2INX A;  2KRT A;  1YJW 3;  4BTX A;  1A2K A;  2WGQ A;  2JDI H;  1Q81 4;  3CNM A;  3DGL A;  3NV0 A;  3H3H A;  4JF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...