1OF5A

Crystal structure of mex67-mtr2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
221
structure length
154
Chain Sequence
QQFFFENDALGQSSTDFATNFLNLWDNNREQLLNLYSPQSQFSVSVDSTSIGQESINSIFKTLPKTKHHLQEQPNEYSMETISYPQINGFVITLHGFFEETSNNKLSKKSFDRTWVIVPMNNSVIIASDLLTVRAYSTGAWKTASIAIAQAAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear transport
molecule keywords MRNA EXPORT FACTOR MEX67
publication title Structural similarity in the absence of sequence homology of the messenger RNA export factors Mtr2 and p15.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 35
structure length 154
sequence length 221
ec nomenclature
pdb deposition date 2003-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1of5A00
6STDA 5AIGA 2RCDA 4R9KA 2YFJB 1OF5B 4WYKA 1O7WB 5DREA 1EG9B 3MG1A 1U5OA 4HKVB 3VSYA 1ISKA 3OXAA 2UX0A 3DMCA 4Q53A 4KVHA 1GY7A 2BNGA 3OWYA 3S5CA 5KP4A 2R4IA 2A15A 3CNXA 5D83A 3EN8A 2F98A 1SJWA 3G0KA 1ASKA 2Z7AA 2BMQB 2HMLB 4HM2B 1DMQA 5G2GA 2GBWB 3ECFA 2F99A 3RGRA 3Q90A 1OF5A 3EC9A 4LEHA 5IG5A 1QJGA 3KE7A 4L7KA 1OHOA 5IG0A 4LGQA 3E99A 3FLJA 3EBTA 3GWRA 3EX9A 3HZPA 4IIAA 3OV4A 4HM0B 3JUQA 1UUVB 2QIYA 1JB2A 3EQQB 1E3RA 4WWUC 1GYBA 3FF0A 1ZX2A 1GS3A 2IMJA 3B8LA 5IF6A 3OX9A 3ER7A 3MKIA 3G8ZA 2B1XB 3JUOA 3H3HA 4HZBB 3FH1A 5CLKA 1W02A 3VGNA 4CDLA 5AIHA 3G16A 8CHOA 3EF8A 5DRVA 2JQ5A 3ROBA 3UNLA 1GY5A 4R1KA 3F7XA 2B24B 3F9SA 4OUQA 1OCVA 4STDA 4XBTA 5AEWB 1AR0A 1ZO2A 5IEOA 1OHSA 3LZAA 4GB5A 3K0ZA 3I0YA 3CU3A 5IEPA 3RGAA 3F14A 1OGXA 3MG2A 1O7NB 5CF2A 3JUPA 4HZ9B 1OHPA 3LYGA 2YFIB 5BXQA 5KP3A 4FCJA 2XSOB 1CQSA 1OGZA 2W2CA 2HMKB 5AIFA 1OH0A 4HVNA 4HM6B 3GZYB 3BLZA 3T8UA 1OPYA 2GEXA 3FKAA 3GZBA 1JN5A 2GEYA 1JKGB 4H3UA 4K1UA 2GBXB 3T8NA 1W6YA 3H51A 3NM2A 3CPOA 2XRXB 1Q40A 3KZTA 3K7CA 2HMMB 3JUMA 5STDA 3UJMA 4WP5A 1O7PB 1NU3A 2HMJB 1HKXA 1OUNA 2I9WA 3M8CA 2STDA 1S5AA 5FW5A 3STDA 1GY6A 3WMDA 4OVMA 5CF1A 3HK4A 1UUWB 1E3VA 3DUKA 1JKGA 5BVBA 2INXA 3B4PA 3FF2A 3DZLA 3NUVA 5D81A 3GZXB 3KKGA 5AI1A 4X2OA 5TGNA 2F86B 3EBYA 4RZMA 4PEJA 3FZWA 3B7CA 5KP1A 3FSDA 1O7MB 4HM7B 1A2KA 1BUQA 4L8OA 5HGRA 3F8XA 1ULIB 3SEDA 1JN5B 3IPTA 3MYTA 1EA2A 2CKFB 5EVHA 4XDWA 1ULJB 1JB4A 3BB9A 4J9AA 1DMMA 4HM3B 4K1VA 2Z77A 5IENA 3GRDA 2BMOB 1Q40B 2K54A 2CHCA 2XSHB 4XBYA 4XM4A 3EJVA 2GXFA 1Q42A 5AIIA 1IDPA 3SOAA 1Z1SA 1W01A 5CXOA 1W00A 4MJDA 3F40A 3NHXA 4HJLB 3D9RA 3DM8A 5IERA 3NV0B 3NXJA 7STDA 1NWWA 3JUNA 3GZRA 4XBXA 1NDOB 3MG3A 3OWUA 3KSPA 1O7HB 3F8HA 1E97A 3HX8A 5D82A 3A76A 2HMOB 3NBRA 4XDVA 4N3VA 4X2HA 5JPPA 3B4OA 4U13A 3EN1B 3MHEA 4LMIA 1JB5A 3DXOA 4J8TA 4HM1B 1TP6A 1VZZA 1WQLB 5IG4A 3NV0A 3SOYA 3OWSA 4WYKB 4HM8B 3MSOA 4HM4B 4FCMA 2HMNB 2YFLB 5IG3A 4XB5A 1TUHA 2RGQA 2XR8B 3FGYA 1O7GB 4R9LA 2PZVA 2BMRB 5CK6A 2OWPA 4ORLA 5JPUA 5AEUB 1C7HA 2RFRA 4HM5B 1STDA 3F7SA 3EHCA 4I4KA 2Z76A 1K41A 2QGUA 3CNMA 1DMNA 1QMAA 4L8PA
chains in the Genus database with same CATH superfamily
1BIRA 6STDA 3X3ZA 5AYRB 2Z6BA 1K9M4 4FMDA 2L1SA 1GD3A 1RGLA 1YGWA 3LT9A 2QA43 1N5HA 1W6CA 1TTOA 1EQKA 4BU4A 2IUKA 3X41A 5AIGA 1CYVA 4HOHA 2W9PA 1I3IA 1IU7A 1YJ93 2RCDA 4JF8A 4R9KA 3CME3 3PYJA 5M19A 3CC43 2YFJB 1OF5B 3HI7A 3ZG0A 4N6V0 4WYKA 1MWUA 1SIHA 1FYSA 1O7WB 5DREA 2J8XB 1EG9B 2CW9A 1RGGA 1IVUA 3MG1A 1U5OA 2WOHA 4EV5A 1BRJA 4HKVB 1DE3A 3VSYA 1ISKA 6GSPA 3OXAA 1BSEA 1FGQA 2UX0A 1X1XA 4N6LA 3S29A 1KWIA 3DMCA 1K734 3NQZA 4Q53A 4KVHA 5RNTA 1GY7A 2XFSA 2Y74A 1LNHA 1JZOA 2BNGA 1U8CB 1WMOA 3OWYA 3S5CA 1I0XA 3SXXA 1M1K4 1STFI 5KP4A 3K5TA 2R4IA 4IT7A 4JRFA 5EQLA 3AGOA 3CCV3 3OW22 2CWTA 1HU9A 1RNBA 1RSNA 2A15A 4FMCA 1GD4A 1KC84 1BRSA 1UGIA 2L4VA 3DGOA 3CNXA 5D83A 1MWRA 1RGCA 3EN8A 2F98A 3QK9A 1C54A 1SPUA 4RNYA 1YI23 1SJWA 2HOHA 3G0KA 1IVXA 1ASKA 1X1YA 4MMYB 1JRQA 4NREA 3SX1A 3URPA 5M18A 2Z7AA 2BMQB 2HMLB 2IA7A 1BRHA 1FGRA 4HM2B 4N6UA 1DMQA 2ZA4A 1JBTA 1RTUA 5G2GA 1BNSA 2GBWB 3ECFA 1B2ZA 2F99A 3RGRA 2AADA 2D42A 3CCR3 1EKMA 3Q90A 1OF5A 2KF5A 1FZUA 3EC9A 4RBNA 4LEHA 5IG5A 2QEX3 1QJGA 3HIGA 2OTJ3 2PNCA 3KE7A 1TRPA 1T3BA 1RN4A 4L7KA 1OHOA 5IG0A 2CX1A 4LGQA 4BL3A 3CC73 3DGLA 1AVKA 3E99A 2BIRA 3FLJA 4LZIA 3X3YA 1W5ZA 3EBTA 3GWRA 1G0TA 3EX9A 3HZPA 4IIAA 1LXEA 4AEQA 3BNEA 1F8NA 2P0MA 1TIJA 3OV4A 1IVWA 4WHAA 1CH0A 1RJOA 3G713 3CC23 1A2VA 1LNIA 4HM0B 3JUQA 4LYLB 2W0QA 1UUVB 2KCDA 1JB2A 2E2TA 2QIYA 1AV4A 3EQQB 5FGOA 1E3RA 4WWUC 1GYBA 3FF0A 1FUTA 1I2EA 1RDSA 1RGFA 1BSAA 1NO3A 2K3DA 1DVDA 1TRQA 1BOXA 2H0GA 3J7Yd 1JBSA 1ZX2A 2IYJA 1GS3A 2W6JH 2IMJA 3B8LA 5JBSA 1DYUA 5IF6A 3OX9A 2OOVC 4FR9A 3DY5A 1KSIA 2P05A 3NX0A 3MPHA 4H61A 1W2ZA 3ER7A 3MKIA 3G8ZA 1MNLA 4AKYA 1Q814 2P09A 2B1XB 1FGOA 2XF3A 3JUOA 1A90A 1BRKA 2ZHXB 4FMAA 1UCLA 4G1MB 3H3HA 4HZBB 5GSPA 1K8A4 1GSPA 3FH1A 3PZWA 2BHMA 2CIUA 4RNZA 5CLKA 2OCTA 4BTWA 3WR2A 1IVVA 1W02A 1TFOA 3N8BA 2MC8A 3U97A 1UW1A 3VGNA 1N5PA 1EUIC 3CXC2 4CDLA 3GSPA 3N9HA 5AIHA 1IV7A 3PGBA 3G16A 1RCKA 1R4YA 4TX4A 3DGYA 1TFKA 8CHOA 3DGMA 3EF8A 1FA3A 5DRVA 1GOUA 2JQ5A 3UL5A 3ROBA 1LQMB 3UNLA 1D6ZA 1GY5A 1UI8A 4R1KA 3F7XA 2B24B 1CEWI 2XGLA 3F9SA 5ELUA 3MWZA 3D4AA 2H0IA 1B21A 1IT8A 1IK3A 3Q1CA 1JZDA 4BTYA 1FUWA 4OUQA 1PFPA 4KFDA 2KAAA 4BTXA 1GOVA 1OCVA 4STDA 5ELJA 1B3SA 3X42A 4XBTA 1GOYA 3EE1A 5BIRA 2Q07A 3LMLA 1VQ93 4FMBA 1TJDA 4KT3B 2FNQA 1BU4A 1WMNA 3HOHA 5AEWB 1AR0A 1W4NA 1ZO2A 5IEOA 1B2MA 1I70A 1SIIA 2XEPA 1OHSA 3LZAA 4GB5A 3K0ZA 1BSBA 3I0YA 2AAEA 3CU3A 5IEPA 2OTL3 1BNGA 1K28A 3RGAA 1GMQA 3F14A 1OGXA 3MG2A 1O7NB 2O3OA 4EXRA 5CF2A 3JUPA 1BGSA 2IUJA 3I553 4ZM8A 1W6GA 2CFDA 4KFEA 4EV2A 3N54B 1LVNA 2F5MA 1YVSA 3NM7A 3V92A 4HZ9B 1OHPA 3LTCA 3LYGA 2YFIB 3WHOA 2F56A 1BNEA 1QAFA 5KP3A 5BXQA 4FCJA 2XSOB 1CQSA 1OGZA 1RGAA 2W2CA 1FGMA 3RNTA 2HMKB 3KIIA 5AIFA 3WDGB 3WOEB 1VQ63 4KFFA 1FUSA 2FXTA 2WO0A 1OH0A 4HVNA 1BNFA 1VQQA 4HM6B 3GZYB 1YHQ3 1I8VA 3BLZA 4AKZA 4K90B 3AGNA 4KZ1A 3T8UA 4O8SA 2W56A 4ILFA 1OPYA 4BL2A 2GEXA 3FKAA 4HYZA 1US1A 3GZBA 1JN5A 1BVIA 1D6UA 1Y4KA 2GEYA 3LOYA 1V74A 1JNQA 1T2IA 1JKGB 2C11A 3NQYA 2W04A 4H3UA 4EW5A 4K1UA 1R4CA 1T5YA 2GBXB 4I5QA 1I0VA 3LXUX 1I2FA 1LOVA 1YNVX 3T8NA 2F4YA 2R41A 2ZDJA 1W6YA 1LQGC 1LOYA 1QALA 1UDII 1IQXA 3PCSA 1FGTA 1YVBI 2LYXA 3H51A 1LOWA 1V57A 1TU5A 1X1WA 3KSED 3NM2A 3CPOA 3EB8A 3CCS3 1WNHA 2ML5A 2XRXB 1S723 1Q40A 1RRHA 3KZTA 3AMOB 2CG1A 3K7CA 4N6MA 2HMMB 3JUMA 3JVCA 5STDA 3NBJA 3FG3A 1MGRA 3IMAB 5AYSC 3UJMA 1N9JA 1M9GA 4N6NB 1O7PB 4WP5A 1VQ53 2XGNA 1NU3A 4MMZB 1RMSA 3X40A 1ZS7A 1VQK3 3D79A 2HMJB 3IJEB 3G4S3 1HKXA 3BNDA 1MWTA 1GMRA 3D5IA 4WFOA 3K9MC 2IY2A 4K61A 3K63A 3BNBA 4MMXB 3DH2A 1PY3A 2F5WA 1OUNA 2I9WA 3M8CA 3WA3A 2KF6A 1RN7A 1WMPA 2STDA 1S5AA 4N6TA 1V58A 1ZGXA 5FW5A 4DKIA 3G6E3 1JJ22 1X1UA 3STDA 1GY6A 4LSOA 1G02A 3WMDA 4CJNA 4OVMA 1VQO3 1BRGA 1N8QA 5CF1A 3CCJ3 3HK4A 4GL6A 3ZFZA 1UUWB 1E3VA 3DUKA 1BNIA 1JKGA 4RNTA 5BVBA 1MOLA 2INXA 1RNTA 3B4PA 3KN4A 3FF2A 2KF3A 1RKYA 1OACA 3DZLA 3NUVA 2KF4A 1NNVA 5D81A 4EBGA 1YIT3 3GZXB 3KKGA 1BANA 5AI1A 1VQM3 4X2OA 5TGNA 1A2PA 1M1XB 3A5EA 2F86B 5LC6A 2V1LA 1FW7A 3EBYA 4RZMA 4PEJA 2CFKA 3FZWA 3B7CA 2Y73A 5KP1A 3QRDA 3I563 2JDIH 3FSDA 1O7MB 1UCJA 4HM7B 1A2KA 1RHLA 2P0XA 4IPBA 2BU4A 4L8OA 5HGRA 5BU4A 1BUQA 1IT7A 3BNCA 3FCSB 3CPW2 2O9UX 1ROAA 2W56B 3AMOA 3F8XA 2CH9A 1B2UA 1HZ1A 1Q7HA 1Q7Y4 1D6YA 1N9EA 1ULIB 2E2UA 3PCRA 1RGEA 3SEDA 2C4BA 1UGHI 3LH4A 1JN5B 3Q3FA 1NB3I 1AVLA 3IPTA 3Q2PA 4NPBA 2WGOA 3LTDA 3MYTA 1EA2A 5G1KA 1BSCA 2SARA 3LTBA 4EYCA 2CKFB 4R80A 5EVHA 4XDWA 2FGTA 3SVAA 1ULJB 1JB4A 3BB9A 1BAOA 1Q9EA 1NJI4 1A67A 4J9AA 5LC7A 1DMMA 2M7OA 5M1AA 4HM3B 4HBRA 4K1VA 1T2HA 3GAXA 5IW9A 2UUGC 2Z77A 5IENA 6RNTA 4OK0A 3GRDA 1IQ8A 2BMOB 4R4KA 1SQWA 1G96A 3BU4A 4L8PA 5G1LA 3CCU3 1BRNL 1Q40B 2K54A 2ZL8A 5EEOA 3KFQC 2CHCA 2XSHB 1VQL3 4XBYA 4XM4A 3EJVA 1GMPA 1RGKA 3UB1A 2GXFA 4FCZA 1Q42A 5AIIA 1B20A 1VQ83 4MEIA 1IDPA 4QWTA 3SOAA 1Z1SA 1W01A 4O3VA 1BNJA 4O2HA 4N6OB 1QVF2 5CXOA 1W00A 4MJDA 1ROVA 1RN1A 2BO9B 3F40A 1Q824 5A0OB 7RNTA 1UUGB 4CPKA 1KQS2 3NHXA 2RBIA 4HJLB 1AY7A 3D9RA 3O8YA 3TDGA 3DM8A 3NBBA 5IERA 3NV0B 2CWVA 2D1WA 3CCQ3 1BSDA 3NXJA 7STDA 1NWWA 1YIJ3 1BRIA 3JUNA 3S67A 3WOFB 3HIIA 3GZRA 4XBXA 3FG4A 2GSPA 1RGHA 1YJW3 1VQN3 1B2SA 2K0MA 1NDOB 3ALAA 1B2XA 3MG3A 3D5GA 3OWUA 3CCM3 3FG1A 2OQEC 1NB5I 1JV2B 2CX0A 1IYYA 1HYFA 4O02B 1DETA 3KSPA 1CYUA 1O7HB 1WTHA 3L0RA 3F8HA 3WODG 1SARA 3CMA3 1E97A 3HX8A 1YJN3 3PS8A 1VQP3 1I3FA 5D82A 2KRTA 3A76A 2GU1A 2HMOB 3DGNA 3V98A 3NBRA 4XDVA 3PXMA 4N3VA 2CG0A 2RNTA 4X2HA 5JPPA 1QVG2 3B4OA 4U13A 3EN1B 2XH9A 3CCE3 3MHEA 1RCLA 2CC3A 1RLSA 3SYUA 1PU4A 2RSXA 1N8R4 1MWSA 2OQEA 4LMIA 2W9QA 2CK3H 1L5GB 1BUJA 1JB5A 3WA2X 3LTAA 3DXOA 2ML6A 2CFWA 4EC6A 1UCIA 3VF1A 4J8TA 8RNTA 3X3XA 4HM1B 2CFGA 9RNTA 1BNRA 1TP6A 1VZZA 1W7CA 1WQLB 2UGIA 5IG4A 1VQ73 1M904 1IV9A 2C10A 2WGQA 1PYLA 3NV0A 5I97A 4GSPA 1W2B2 2SBLA 3SOYA 3OWSA 3ZG5A 1VQ43 3U1WA 4WYKB 2E2VA 4NHFA 1UI7A 4HM8B 3MSOA 4HM4B 3S28A 4BIRA 4FCMA 1B27A 1I2GA 2H0HA 1IQYA 2W03A 2HMNB 2YFLB 4J5KA 3V99A 5IG3A 1AQZA 1RRLA 1DVCA 2MF7A 4XB5A 2CWUA 1TUHA 1YGEA 3S27A 2RGQA 2XR8B 3FGYA 1O7GB 2WOFA 4R9LA 7GSPA 3CCL3 3CD63 1JBRA 2BT3A 2PZVA 2YX9A 3KCHA 2BMRB 5CK6A 2GU3A 3SLUA 3T0UA 1KD14 2KXGA 3AHWA 4GHOA 2OWPA 3D3LA 4ORLA 2P38A 5AEUB 5JPUA 2XFTA 1C7HA 2RFRA 4CCVA 1LOXA 4HM5B 3UL6A 5HOHA 3AHSA 1LRAA 4J5GA 1EEJA 1STDA 4HAAA 3F7SA 3EHCA 1QAKA 4I4KA 2CFLA 1Q864 3RDEA 2OOVA 2Z76A 1K41A 2LQVA 2QGUA 1UCKA 3BIRA 3CNMA 1DMNA 1QMAA 3LT8A 1J2BA 1MGWA
chains in the Genus database with same CATH topology
6STDA 3X3ZA 5AYRB 2Z6BA 1K9M4 4FMDA 1GD3A 3LT9A 2QA43 1N5HA 1W6CA 1EQKA 2IUKA 3X41A 5AIGA 1CYVA 2W9PA 1IU7A 1YJ93 2RCDA 4JF8A 4R9KA 3CME3 3PYJA 3CC43 2YFJB 1OF5B 3HI7A 4N6V0 4WYKA 1SIHA 1O7WB 5DREA 1EG9B 2CW9A 1IVUA 3MG1A 1U5OA 2WOHA 4EV5A 4HKVB 3VSYA 1ISKA 3OXAA 1FGQA 2UX0A 4N6LA 3S29A 1KWIA 3DMCA 1K734 3NQZA 4Q53A 4KVHA 1GY7A 2XFSA 2Y74A 1LNHA 2BNGA 1U8CB 1WMOA 3OWYA 3S5CA 3SXXA 1M1K4 1STFI 5KP4A 3K5TA 2R4IA 4IT7A 4JRFA 5EQLA 3CCV3 3OW22 2CWTA 1HU9A 2A15A 4FMCA 1GD4A 2L4VA 3DGOA 3CNXA 5D83A 3EN8A 2F98A 3QK9A 1SPUA 4RNYA 1YI23 1SJWA 3G0KA 1IVXA 1ASKA 4MMYB 1JRQA 4NREA 3SX1A 2Z7AA 2BMQB 2HMLB 2IA7A 1FGRA 4N6UA 4HM2B 1DMQA 5G2GA 2GBWB 3ECFA 2F99A 3RGRA 2D42A 3CCR3 1EKMA 3Q90A 1OF5A 3EC9A 4RBNA 4LEHA 5IG5A 2QEX3 1QJGA 3HIGA 2OTJ3 2PNCA 3KE7A 4L7KA 1OHOA 5IG0A 4LGQA 3CC73 3DGLA 1AVKA 3E99A 3FLJA 4LZIA 3X3YA 1W5ZA 3EBTA 3GWRA 3EX9A 3HZPA 4IIAA 1LXEA 4AEQA 3BNEA 1F8NA 2P0MA 1TIJA 3OV4A 1IVWA 4WHAA 3G713 1RJOA 3CC23 1A2VA 4HM0B 3JUQA 2W0QA 1UUVB 2KCDA 1JB2A 2E2TA 2QIYA 1AV4A 3EQQB 5FGOA 1E3RA 4WWUC 1GYBA 3FF0A 1NO3A 1DVDA 3J7Yd 1ZX2A 1GS3A 2W6JH 2IMJA 3B8LA 5JBSA 1DYUA 5IF6A 3OX9A 2OOVC 4FR9A 3DY5A 2P05A 3NX0A 3MPHA 4H61A 1W2ZA 3ER7A 3MKIA 3G8ZA 1MNLA 4AKYA 1Q814 2P09A 2B1XB 1FGOA 2XF3A 3JUOA 1A90A 4FMAA 4G1MB 3H3HA 4HZBB 1K8A4 3FH1A 3PZWA 2BHMA 2CIUA 4RNZA 5CLKA 2OCTA 4BTWA 1IVVA 1W02A 1TFOA 3N8BA 2MC8A 3U97A 1UW1A 3VGNA 1N5PA 3CXC2 4CDLA 3N9HA 5AIHA 1IV7A 3PGBA 3G16A 4TX4A 1TFKA 8CHOA 3DGMA 3EF8A 1FA3A 5DRVA 2JQ5A 3UL5A 3ROBA 3UNLA 1D6ZA 1GY5A 1UI8A 4R1KA 3F7XA 2B24B 1CEWI 2XGLA 3F9SA 5ELUA 3MWZA 1IK3A 1IT8A 3Q1CA 4BTYA 1FUWA 4OUQA 1PFPA 4KFDA 4BTXA 1OCVA 4STDA 5ELJA 3X42A 4XBTA 3EE1A 1VQ93 2Q07A 3LMLA 4FMBA 2FNQA 1WMNA 5AEWB 1AR0A 1W4NA 1ZO2A 5IEOA 1SIIA 2XEPA 1OHSA 3LZAA 4GB5A 3K0ZA 3I0YA 3CU3A 5IEPA 2OTL3 3RGAA 1K28A 3F14A 1OGXA 3MG2A 1O7NB 2O3OA 4EXRA 5CF2A 3JUPA 2IUJA 3I553 4ZM8A 1W6GA 2CFDA 4KFEA 4EV2A 3N54B 1LVNA 3NM7A 3V92A 4HZ9B 1OHPA 3LTCA 3LYGA 2YFIB 1QAFA 5BXQA 5KP3A 4FCJA 2XSOB 1CQSA 1OGZA 2W2CA 1FGMA 3WDGB 2HMKB 3KIIA 5AIFA 3WOEB 1VQ63 4KFFA 2FXTA 2WO0A 1OH0A 4HVNA 4HM6B 3GZYB 1YHQ3 3BLZA 4AKZA 4K90B 4KZ1A 3T8UA 4O8SA 2W56A 1OPYA 2GEXA 3FKAA 4HYZA 1US1A 3GZBA 1JN5A 1D6UA 1Y4KA 2GEYA 3LOYA 1V74A 1JNQA 1JKGB 2C11A 3NQYA 2W04A 4H3UA 4K1UA 1R4CA 1T5YA 2GBXB 3LXUX 3T8NA 2ZDJA 1W6YA 1QALA 1IQXA 3PCSA 1FGTA 1YVBI 2LYXA 3H51A 1TU5A 3NM2A 3KSED 3CPOA 3EB8A 3CCS3 1WNHA 2ML5A 2XRXB 1S723 1Q40A 1RRHA 3KZTA 3AMOB 2CG1A 3K7CA 4N6MA 2HMMB 3JUMA 3JVCA 5STDA 3NBJA 3FG3A 3IMAB 5AYSC 3UJMA 1N9JA 1M9GA 4N6NB 1O7PB 4WP5A 1VQ53 2XGNA 1NU3A 4MMZB 3X40A 1VQK3 2HMJB 3IJEB 3G4S3 1HKXA 3BNDA 4WFOA 3K9MC 4K61A 3K63A 3BNBA 4MMXB 3WA3A 1OUNA 2I9WA 3M8CA 1RN7A 1WMPA 2STDA 1S5AA 4N6TA 1JJ22 3G6E3 5FW5A 3STDA 1GY6A 4LSOA 3WMDA 4OVMA 1VQO3 1N8QA 5CF1A 3CCJ3 3HK4A 4GL6A 1UUWB 1E3VA 3DUKA 1JKGA 1KC84 5BVBA 1MOLA 2INXA 3B4PA 3KN4A 3FF2A 1RKYA 1OACA 3DZLA 3NUVA 5D81A 4EBGA 1YIT3 3GZXB 3KKGA 5AI1A 1VQM3 4X2OA 5TGNA 1M1XB 2F86B 5LC6A 2V1LA 3EBYA 4RZMA 4PEJA 2CFKA 3FZWA 3B7CA 2Y73A 5KP1A 3QRDA 3I563 2JDIH 3FSDA 1O7MB 4HM7B 1A2KA 2P0XA 4IPBA 4L8OA 5HGRA 1BUQA 1IT7A 3BNCA 3FCSB 3CPW2 2O9UX 1ROAA 2W56B 3AMOA 3F8XA 2CH9A 1Q7Y4 1D6YA 1N9EA 1ULIB 2E2UA 3PCRA 3SEDA 3LH4A 1JN5B 1NB3I 1AVLA 3IPTA 3Q2PA 2WGOA 3LTDA 3MYTA 1EA2A 3LTBA 4EYCA 2CKFB 4R80A 5EVHA 4XDWA 2FGTA 3SVAA 1ULJB 1JB4A 3BB9A 1NJI4 1A67A 4J9AA 5LC7A 1DMMA 2M7OA 4HM3B 4HBRA 4K1VA 3GAXA 5IW9A 2Z77A 5IENA 4OK0A 3GRDA 1IQ8A 2BMOB 4R4KA 1SQWA 1G96A 3CCU3 1Q40B 2K54A 2ZL8A 5EEOA 3KFQC 2CHCA 2XSHB 1VQL3 4XBYA 4XM4A 3EJVA 3UB1A 2GXFA 4FCZA 1Q42A 5AIIA 1VQ83 4MEIA 1IDPA 4QWTA 3SOAA 1Z1SA 1W01A 4O3VA 4O2HA 4N6OB 1QVF2 5CXOA 1W00A 4MJDA 1ROVA 2BO9B 3F40A 1Q824 5A0OB 1KQS2 3NHXA 4HJLB 3D9RA 3O8YA 3TDGA 3DM8A 3NBBA 5IERA 3NV0B 2CWVA 2D1WA 3CCQ3 3NXJA 7STDA 1YIJ3 1NWWA 3JUNA 3S67A 3WOFB 3HIIA 3GZRA 4XBXA 3FG4A 1YJW3 1VQN3 2K0MA 1NDOB 3ALAA 3MG3A 3OWUA 3CCM3 3FG1A 2OQEC 1NB5I 1JV2B 4O02B 3KSPA 1CYUA 1O7HB 1WTHA 3L0RA 3F8HA 3WODG 3CMA3 1E97A 3HX8A 1YJN3 3PS8A 1VQP3 5D82A 2KRTA 3A76A 2GU1A 2HMOB 3DGNA 3V98A 3NBRA 4XDVA 3PXMA 4N3VA 2CG0A 4X2HA 5JPPA 1QVG2 3B4OA 4U13A 3EN1B 2XH9A 3CCE3 3MHEA 2CC3A 1PU4A 1N8R4 2RSXA 2OQEA 4LMIA 2W9QA 2CK3H 1L5GB 1JB5A 3WA2X 3LTAA 3DXOA 2ML6A 2CFWA 4EC6A 3VF1A 4J8TA 3X3XA 4HM1B 2CFGA 1TP6A 1VZZA 1W7CA 1WQLB 5IG4A 1VQ73 1M904 1IV9A 2C10A 2WGQA 3NV0A 5I97A 1W2B2 2SBLA 3SOYA 3OWSA 1VQ43 3U1WA 4WYKB 2E2VA 4NHFA 1UI7A 4HM8B 3MSOA 4HM4B 3S28A 4FCMA 1IQYA 2W03A 2HMNB 2YFLB 3V99A 5IG3A 1RRLA 1DVCA 2MF7A 4XB5A 2CWUA 1TUHA 1YGEA 3S27A 2RGQA 2XR8B 3FGYA 1O7GB 2WOFA 4R9LA 3CCL3 3CD63 2BT3A 2PZVA 2YX9A 3T0UA 2BMRB 5CK6A 2GU3A 3SLUA 1KD14 2KXGA 2OWPA 3D3LA 4ORLA 2P38A 5AEUB 5JPUA 2XFTA 1C7HA 2RFRA 4CCVA 1LOXA 4HM5B 3UL6A 1STDA 3F7SA 3EHCA 1QAKA 4I4KA 2CFLA 1Q864 3RDEA 2OOVA 2Z76A 1K41A 2LQVA 2QGUA 3LT8A 3CNMA 1DMNA 1QMAA 4L8PA 1J2BA 1KSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6STD A;  5AIG A;  2RCD A;  4R9K A;  2YFJ B;  1OF5 B;  4WYK A;  1O7W B;  5DRE A;  1EG9 B;  3MG1 A;  1U5O A;  4HKV B;  3VSY A;  1ISK A;  3OXA A;  2UX0 A;  3DMC A;  4Q53 A;  4KVH A;  1GY7 A;  2BNG A;  3OWY A;  3S5C A;  5KP4 A;  2R4I A;  2A15 A;  3CNX A;  5D83 A;  3EN8 A;  2F98 A;  1SJW A;  3G0K A;  1ASK A;  2Z7A A;  2BMQ B;  2HML B;  4HM2 B;  1DMQ A;  5G2G A;  2GBW B;  3ECF A;  2F99 A;  3RGR A;  3Q90 A;  1OF5 A;  3EC9 A;  4LEH A;  5IG5 A;  1QJG A;  3KE7 A;  4L7K A;  1OHO A;  5IG0 A;  4LGQ A;  3E99 A;  3FLJ A;  3EBT A;  3GWR A;  3EX9 A;  3HZP A;  4IIA A;  3OV4 A;  4HM0 B;  3JUQ A;  1UUV B;  2QIY A;  1JB2 A;  3EQQ B;  1E3R A;  4WWU C;  1GYB A;  3FF0 A;  1ZX2 A;  1GS3 A;  2IMJ A;  3B8L A;  5IF6 A;  3OX9 A;  3ER7 A;  3MKI A;  3G8Z A;  2B1X B;  3JUO A;  3H3H A;  4HZB B;  3FH1 A;  5CLK A;  1W02 A;  3VGN A;  4CDL A;  5AIH A;  3G16 A;  8CHO A;  3EF8 A;  5DRV A;  2JQ5 A;  3ROB A;  3UNL A;  1GY5 A;  4R1K A;  3F7X A;  2B24 B;  3F9S A;  4OUQ A;  1OCV A;  4STD A;  4XBT A;  5AEW B;  1AR0 A;  1ZO2 A;  5IEO A;  1OHS A;  3LZA A;  4GB5 A;  3K0Z A;  3I0Y A;  3CU3 A;  5IEP A;  3RGA A;  3F14 A;  1OGX A;  3MG2 A;  1O7N B;  5CF2 A;  3JUP A;  4HZ9 B;  1OHP A;  3LYG A;  2YFI B;  5BXQ A;  5KP3 A;  4FCJ A;  2XSO B;  1CQS A;  1OGZ A;  2W2C A;  2HMK B;  5AIF A;  1OH0 A;  4HVN A;  4HM6 B;  3GZY B;  3BLZ A;  3T8U A;  1OPY A;  2GEX A;  3FKA A;  3GZB A;  1JN5 A;  2GEY A;  1JKG B;  4H3U A;  4K1U A;  2GBX B;  3T8N A;  1W6Y A;  3H51 A;  3NM2 A;  3CPO A;  2XRX B;  1Q40 A;  3KZT A;  3K7C A;  2HMM B;  3JUM A;  5STD A;  3UJM A;  4WP5 A;  1O7P B;  1NU3 A;  2HMJ B;  1HKX A;  1OUN A;  2I9W A;  3M8C A;  2STD A;  1S5A A;  5FW5 A;  3STD A;  1GY6 A;  3WMD A;  4OVM A;  5CF1 A;  3HK4 A;  1UUW B;  1E3V A;  3DUK A;  1JKG A;  5BVB A;  2INX A;  3B4P A;  3FF2 A;  3DZL A;  3NUV A;  5D81 A;  3GZX B;  3KKG A;  5AI1 A;  4X2O A;  5TGN A;  2F86 B;  3EBY A;  4RZM A;  4PEJ A;  3FZW A;  3B7C A;  5KP1 A;  3FSD A;  1O7M B;  4HM7 B;  1A2K A;  1BUQ A;  4L8O A;  5HGR A;  3F8X A;  1ULI B;  3SED A;  1JN5 B;  3IPT A;  3MYT A;  1EA2 A;  2CKF B;  5EVH A;  4XDW A;  1ULJ B;  1JB4 A;  3BB9 A;  4J9A A;  1DMM A;  4HM3 B;  4K1V A;  2Z77 A;  5IEN A;  3GRD A;  2BMO B;  1Q40 B;  2K54 A;  2CHC A;  2XSH B;  4XBY A;  4XM4 A;  3EJV A;  2GXF A;  1Q42 A;  5AII A;  1IDP A;  3SOA A;  1Z1S A;  1W01 A;  5CXO A;  1W00 A;  4MJD A;  3F40 A;  3NHX A;  4HJL B;  3D9R A;  3DM8 A;  5IER A;  3NV0 B;  3NXJ A;  7STD A;  1NWW A;  3JUN A;  3GZR A;  4XBX A;  1NDO B;  3MG3 A;  3OWU A;  3KSP A;  1O7H B;  3F8H A;  1E97 A;  3HX8 A;  5D82 A;  3A76 A;  2HMO B;  3NBR A;  4XDV A;  4N3V A;  4X2H A;  5JPP A;  3B4O A;  4U13 A;  3EN1 B;  3MHE A;  4LMI A;  1JB5 A;  3DXO A;  4J8T A;  4HM1 B;  1TP6 A;  1VZZ A;  1WQL B;  5IG4 A;  3NV0 A;  3SOY A;  3OWS A;  4WYK B;  4HM8 B;  3MSO A;  4HM4 B;  4FCM A;  2HMN B;  2YFL B;  5IG3 A;  4XB5 A;  1TUH A;  2RGQ A;  2XR8 B;  3FGY A;  1O7G B;  4R9L A;  2PZV A;  2BMR B;  5CK6 A;  2OWP A;  4ORL A;  5JPU A;  5AEU B;  1C7H A;  2RFR A;  4HM5 B;  1STD A;  3F7S A;  3EHC A;  4I4K A;  2Z76 A;  1K41 A;  2QGU A;  3CNM A;  1DMN A;  1QMA A;  4L8P A; 
#chains in the Genus database with same CATH topology
 1BIR A;  6STD A;  3X3Z A;  5AYR B;  2Z6B A;  1K9M 4;  4FMD A;  2L1S A;  1GD3 A;  1RGL A;  1YGW A;  3LT9 A;  2QA4 3;  1N5H A;  1W6C A;  1TTO A;  1EQK A;  4BU4 A;  2IUK A;  3X41 A;  5AIG A;  1CYV A;  4HOH A;  2W9P A;  1I3I A;  1IU7 A;  1YJ9 3;  2RCD A;  4JF8 A;  4R9K A;  3CME 3;  3PYJ A;  5M19 A;  3CC4 3;  2YFJ B;  1OF5 B;  3HI7 A;  3ZG0 A;  4N6V 0;  4WYK A;  1MWU A;  1SIH A;  1FYS A;  1O7W B;  5DRE A;  2J8X B;  1EG9 B;  2CW9 A;  1RGG A;  1IVU A;  3MG1 A;  1U5O A;  2WOH A;  4EV5 A;  1BRJ A;  4HKV B;  1DE3 A;  3VSY A;  1ISK A;  6GSP A;  3OXA A;  1BSE A;  1FGQ A;  2UX0 A;  1X1X A;  4N6L A;  3S29 A;  1KWI A;  3DMC A;  1K73 4;  3NQZ A;  4Q53 A;  4KVH A;  5RNT A;  1GY7 A;  2XFS A;  2Y74 A;  1LNH A;  1JZO A;  2BNG A;  1U8C B;  1WMO A;  3OWY A;  3S5C A;  1I0X A;  3SXX A;  1M1K 4;  1STF I;  5KP4 A;  3K5T A;  2R4I A;  4IT7 A;  4JRF A;  5EQL A;  3AGO A;  3CCV 3;  3OW2 2;  2CWT A;  1HU9 A;  1RNB A;  1RSN A;  2A15 A;  4FMC A;  1GD4 A;  1KC8 4;  1BRS A;  1UGI A;  2L4V A;  3DGO A;  3CNX A;  5D83 A;  1MWR A;  1RGC A;  3EN8 A;  2F98 A;  3QK9 A;  1C54 A;  1SPU A;  4RNY A;  1YI2 3;  1SJW A;  2HOH A;  3G0K A;  1IVX A;  1ASK A;  1X1Y A;  4MMY B;  1JRQ A;  4NRE A;  3SX1 A;  3URP A;  5M18 A;  2Z7A A;  2BMQ B;  2HML B;  2IA7 A;  1BRH A;  1FGR A;  4HM2 B;  4N6U A;  1DMQ A;  2ZA4 A;  1JBT A;  1RTU A;  5G2G A;  1BNS A;  2GBW B;  3ECF A;  1B2Z A;  2F99 A;  3RGR A;  2AAD A;  2D42 A;  3CCR 3;  1EKM A;  3Q90 A;  1OF5 A;  2KF5 A;  1FZU A;  3EC9 A;  4RBN A;  4LEH A;  5IG5 A;  2QEX 3;  1QJG A;  3HIG A;  2OTJ 3;  2PNC A;  3KE7 A;  1TRP A;  1T3B A;  1RN4 A;  4L7K A;  1OHO A;  5IG0 A;  2CX1 A;  4LGQ A;  4BL3 A;  3CC7 3;  3DGL A;  1AVK A;  3E99 A;  2BIR A;  3FLJ A;  4LZI A;  3X3Y A;  1W5Z A;  3EBT A;  3GWR A;  1G0T A;  3EX9 A;  3HZP A;  4IIA A;  1LXE A;  4AEQ A;  3BNE A;  1F8N A;  2P0M A;  1TIJ A;  3OV4 A;  1IVW A;  4WHA A;  1CH0 A;  1RJO A;  3G71 3;  3CC2 3;  1A2V A;  1LNI A;  4HM0 B;  3JUQ A;  4LYL B;  2W0Q A;  1UUV B;  2KCD A;  1JB2 A;  2E2T A;  2QIY A;  1AV4 A;  3EQQ B;  5FGO A;  1E3R A;  4WWU C;  1GYB A;  3FF0 A;  1FUT A;  1I2E A;  1RDS A;  1RGF A;  1BSA A;  1NO3 A;  2K3D A;  1DVD A;  1TRQ A;  1BOX A;  2H0G A;  3J7Y d;  1JBS A;  1ZX2 A;  2IYJ A;  1GS3 A;  2W6J H;  2IMJ A;  3B8L A;  5JBS A;  1DYU A;  5IF6 A;  3OX9 A;  2OOV C;  4FR9 A;  3DY5 A;  1KSI A;  2P05 A;  3NX0 A;  3MPH A;  4H61 A;  1W2Z A;  3ER7 A;  3MKI A;  3G8Z A;  1MNL A;  4AKY A;  1Q81 4;  2P09 A;  2B1X B;  1FGO A;  2XF3 A;  3JUO A;  1A90 A;  1BRK A;  2ZHX B;  4FMA A;  1UCL A;  4G1M B;  3H3H A;  4HZB B;  5GSP A;  1K8A 4;  1GSP A;  3FH1 A;  3PZW A;  2BHM A;  2CIU A;  4RNZ A;  5CLK A;  2OCT A;  4BTW A;  3WR2 A;  1IVV A;  1W02 A;  1TFO A;  3N8B A;  2MC8 A;  3U97 A;  1UW1 A;  3VGN A;  1N5P A;  1EUI C;  3CXC 2;  4CDL A;  3GSP A;  3N9H A;  5AIH A;  1IV7 A;  3PGB A;  3G16 A;  1RCK A;  1R4Y A;  4TX4 A;  3DGY A;  1TFK A;  8CHO A;  3DGM A;  3EF8 A;  1FA3 A;  5DRV A;  1GOU A;  2JQ5 A;  3UL5 A;  3ROB A;  1LQM B;  3UNL A;  1D6Z A;  1GY5 A;  1UI8 A;  4R1K A;  3F7X A;  2B24 B;  1CEW I;  2XGL A;  3F9S A;  5ELU A;  3MWZ A;  3D4A A;  2H0I A;  1B21 A;  1IT8 A;  1IK3 A;  3Q1C A;  1JZD A;  4BTY A;  1FUW A;  4OUQ A;  1PFP A;  4KFD A;  2KAA A;  4BTX A;  1GOV A;  1OCV A;  4STD A;  5ELJ A;  1B3S A;  3X42 A;  4XBT A;  1GOY A;  3EE1 A;  5BIR A;  2Q07 A;  3LML A;  1VQ9 3;  4FMB A;  1TJD A;  4KT3 B;  2FNQ A;  1BU4 A;  1WMN A;  3HOH A;  5AEW B;  1AR0 A;  1W4N A;  1ZO2 A;  5IEO A;  1B2M A;  1I70 A;  1SII A;  2XEP A;  1OHS A;  3LZA A;  4GB5 A;  3K0Z A;  1BSB A;  3I0Y A;  2AAE A;  3CU3 A;  5IEP A;  2OTL 3;  1BNG A;  1K28 A;  3RGA A;  1GMQ A;  3F14 A;  1OGX A;  3MG2 A;  1O7N B;  2O3O A;  4EXR A;  5CF2 A;  3JUP A;  1BGS A;  2IUJ A;  3I55 3;  4ZM8 A;  1W6G A;  2CFD A;  4KFE A;  4EV2 A;  3N54 B;  1LVN A;  2F5M A;  1YVS A;  3NM7 A;  3V92 A;  4HZ9 B;  1OHP A;  3LTC A;  3LYG A;  2YFI B;  3WHO A;  2F56 A;  1BNE A;  1QAF A;  5KP3 A;  5BXQ A;  4FCJ A;  2XSO B;  1CQS A;  1OGZ A;  1RGA A;  2W2C A;  1FGM A;  3RNT A;  2HMK B;  3KII A;  5AIF A;  3WDG B;  3WOE B;  1VQ6 3;  4KFF A;  1FUS A;  2FXT A;  2WO0 A;  1OH0 A;  4HVN A;  1BNF A;  1VQQ A;  4HM6 B;  3GZY B;  1YHQ 3;  1I8V A;  3BLZ A;  4AKZ A;  4K90 B;  3AGN A;  4KZ1 A;  3T8U A;  4O8S A;  2W56 A;  4ILF A;  1OPY A;  4BL2 A;  2GEX A;  3FKA A;  4HYZ A;  1US1 A;  3GZB A;  1JN5 A;  1BVI A;  1D6U A;  1Y4K A;  2GEY A;  3LOY A;  1V74 A;  1JNQ A;  1T2I A;  1JKG B;  2C11 A;  3NQY A;  2W04 A;  4H3U A;  4EW5 A;  4K1U A;  1R4C A;  1T5Y A;  2GBX B;  4I5Q A;  1I0V A;  3LXU X;  1I2F A;  1LOV A;  1YNV X;  3T8N A;  2F4Y A;  2R41 A;  2ZDJ A;  1W6Y A;  1LQG C;  1LOY A;  1QAL A;  1UDI I;  1IQX A;  3PCS A;  1FGT A;  1YVB I;  2LYX A;  3H51 A;  1LOW A;  1V57 A;  1TU5 A;  1X1W A;  3KSE D;  3NM2 A;  3CPO A;  3EB8 A;  3CCS 3;  1WNH A;  2ML5 A;  2XRX B;  1S72 3;  1Q40 A;  1RRH A;  3KZT A;  3AMO B;  2CG1 A;  3K7C A;  4N6M A;  2HMM B;  3JUM A;  3JVC A;  5STD A;  3NBJ A;  3FG3 A;  1MGR A;  3IMA B;  5AYS C;  3UJM A;  1N9J A;  1M9G A;  4N6N B;  1O7P B;  4WP5 A;  1VQ5 3;  2XGN A;  1NU3 A;  4MMZ B;  1RMS A;  3X40 A;  1ZS7 A;  1VQK 3;  3D79 A;  2HMJ B;  3IJE B;  3G4S 3;  1HKX A;  3BND A;  1MWT A;  1GMR A;  3D5I A;  4WFO A;  3K9M C;  2IY2 A;  4K61 A;  3K63 A;  3BNB A;  4MMX B;  3DH2 A;  1PY3 A;  2F5W A;  1OUN A;  2I9W A;  3M8C A;  3WA3 A;  2KF6 A;  1RN7 A;  1WMP A;  2STD A;  1S5A A;  4N6T A;  1V58 A;  1ZGX A;  5FW5 A;  4DKI A;  3G6E 3;  1JJ2 2;  1X1U A;  3STD A;  1GY6 A;  4LSO A;  1G02 A;  3WMD A;  4CJN A;  4OVM A;  1VQO 3;  1BRG A;  1N8Q A;  5CF1 A;  3CCJ 3;  3HK4 A;  4GL6 A;  3ZFZ A;  1UUW B;  1E3V A;  3DUK A;  1BNI A;  1JKG A;  4RNT A;  5BVB A;  1MOL A;  2INX A;  1RNT A;  3B4P A;  3KN4 A;  3FF2 A;  2KF3 A;  1RKY A;  1OAC A;  3DZL A;  3NUV A;  2KF4 A;  1NNV A;  5D81 A;  4EBG A;  1YIT 3;  3GZX B;  3KKG A;  1BAN A;  5AI1 A;  1VQM 3;  4X2O A;  5TGN A;  1A2P A;  1M1X B;  3A5E A;  2F86 B;  5LC6 A;  2V1L A;  1FW7 A;  3EBY A;  4RZM A;  4PEJ A;  2CFK A;  3FZW A;  3B7C A;  2Y73 A;  5KP1 A;  3QRD A;  3I56 3;  2JDI H;  3FSD A;  1O7M B;  1UCJ A;  4HM7 B;  1A2K A;  1RHL A;  2P0X A;  4IPB A;  2BU4 A;  4L8O A;  5HGR A;  5BU4 A;  1BUQ A;  1IT7 A;  3BNC A;  3FCS B;  3CPW 2;  2O9U X;  1ROA A;  2W56 B;  3AMO A;  3F8X A;  2CH9 A;  1B2U A;  1HZ1 A;  1Q7H A;  1Q7Y 4;  1D6Y A;  1N9E A;  1ULI B;  2E2U A;  3PCR A;  1RGE A;  3SED A;  2C4B A;  1UGH I;  3LH4 A;  1JN5 B;  3Q3F A;  1NB3 I;  1AVL A;  3IPT A;  3Q2P A;  4NPB A;  2WGO A;  3LTD A;  3MYT A;  1EA2 A;  5G1K A;  1BSC A;  2SAR A;  3LTB A;  4EYC A;  2CKF B;  4R80 A;  5EVH A;  4XDW A;  2FGT A;  3SVA A;  1ULJ B;  1JB4 A;  3BB9 A;  1BAO A;  1Q9E A;  1NJI 4;  1A67 A;  4J9A A;  5LC7 A;  1DMM A;  2M7O A;  5M1A A;  4HM3 B;  4HBR A;  4K1V A;  1T2H A;  3GAX A;  5IW9 A;  2UUG C;  2Z77 A;  5IEN A;  6RNT A;  4OK0 A;  3GRD A;  1IQ8 A;  2BMO B;  4R4K A;  1SQW A;  1G96 A;  3BU4 A;  4L8P A;  5G1L A;  3CCU 3;  1BRN L;  1Q40 B;  2K54 A;  2ZL8 A;  5EEO A;  3KFQ C;  2CHC A;  2XSH B;  1VQL 3;  4XBY A;  4XM4 A;  3EJV A;  1GMP A;  1RGK A;  3UB1 A;  2GXF A;  4FCZ A;  1Q42 A;  5AII A;  1B20 A;  1VQ8 3;  4MEI A;  1IDP A;  4QWT A;  3SOA A;  1Z1S A;  1W01 A;  4O3V A;  1BNJ A;  4O2H A;  4N6O B;  1QVF 2;  5CXO A;  1W00 A;  4MJD A;  1ROV A;  1RN1 A;  2BO9 B;  3F40 A;  1Q82 4;  5A0O B;  7RNT A;  1UUG B;  4CPK A;  1KQS 2;  3NHX A;  2RBI A;  4HJL B;  1AY7 A;  3D9R A;  3O8Y A;  3TDG A;  3DM8 A;  3NBB A;  5IER A;  3NV0 B;  2CWV A;  2D1W A;  3CCQ 3;  1BSD A;  3NXJ A;  7STD A;  1NWW A;  1YIJ 3;  1BRI A;  3JUN A;  3S67 A;  3WOF B;  3HII A;  3GZR A;  4XBX A;  3FG4 A;  2GSP A;  1RGH A;  1YJW 3;  1VQN 3;  1B2S A;  2K0M A;  1NDO B;  3ALA A;  1B2X A;  3MG3 A;  3D5G A;  3OWU A;  3CCM 3;  3FG1 A;  2OQE C;  1NB5 I;  1JV2 B;  2CX0 A;  1IYY A;  1HYF A;  4O02 B;  1DET A;  3KSP A;  1CYU A;  1O7H B;  1WTH A;  3L0R A;  3F8H A;  3WOD G;  1SAR A;  3CMA 3;  1E97 A;  3HX8 A;  1YJN 3;  3PS8 A;  1VQP 3;  1I3F A;  5D82 A;  2KRT A;  3A76 A;  2GU1 A;  2HMO B;  3DGN A;  3V98 A;  3NBR A;  4XDV A;  3PXM A;  4N3V A;  2CG0 A;  2RNT A;  4X2H A;  5JPP A;  1QVG 2;  3B4O A;  4U13 A;  3EN1 B;  2XH9 A;  3CCE 3;  3MHE A;  1RCL A;  2CC3 A;  1RLS A;  3SYU A;  1PU4 A;  2RSX A;  1N8R 4;  1MWS A;  2OQE A;  4LMI A;  2W9Q A;  2CK3 H;  1L5G B;  1BUJ A;  1JB5 A;  3WA2 X;  3LTA A;  3DXO A;  2ML6 A;  2CFW A;  4EC6 A;  1UCI A;  3VF1 A;  4J8T A;  8RNT A;  3X3X A;  4HM1 B;  2CFG A;  9RNT A;  1BNR A;  1TP6 A;  1VZZ A;  1W7C A;  1WQL B;  2UGI A;  5IG4 A;  1VQ7 3;  1M90 4;  1IV9 A;  2C10 A;  2WGQ A;  1PYL A;  3NV0 A;  5I97 A;  4GSP A;  1W2B 2;  2SBL A;  3SOY A;  3OWS A;  3ZG5 A;  1VQ4 3;  3U1W A;  4WYK B;  2E2V A;  4NHF A;  1UI7 A;  4HM8 B;  3MSO A;  4HM4 B;  3S28 A;  4BIR A;  4FCM A;  1B27 A;  1I2G A;  2H0H A;  1IQY A;  2W03 A;  2HMN B;  2YFL B;  4J5K A;  3V99 A;  5IG3 A;  1AQZ A;  1RRL A;  1DVC A;  2MF7 A;  4XB5 A;  2CWU A;  1TUH A;  1YGE A;  3S27 A;  2RGQ A;  2XR8 B;  3FGY A;  1O7G B;  2WOF A;  4R9L A;  7GSP A;  3CCL 3;  3CD6 3;  1JBR A;  2BT3 A;  2PZV A;  2YX9 A;  3KCH A;  2BMR B;  5CK6 A;  2GU3 A;  3SLU A;  3T0U A;  1KD1 4;  2KXG A;  3AHW A;  4GHO A;  2OWP A;  3D3L A;  4ORL A;  2P38 A;  5AEU B;  5JPU A;  2XFT A;  1C7H A;  2RFR A;  4CCV A;  1LOX A;  4HM5 B;  3UL6 A;  5HOH A;  3AHS A;  1LRA A;  4J5G A;  1EEJ A;  1STD A;  4HAA A;  3F7S A;  3EHC A;  1QAK A;  4I4K A;  2CFL A;  1Q86 4;  3RDE A;  2OOV A;  2Z76 A;  1K41 A;  2LQV A;  2QGU A;  1UCK A;  3BIR A;  3CNM A;  1DMN A;  1QMA A;  3LT8 A;  1J2B A;  1MGW A; 
#chains in the Genus database with same CATH homology
 6STD A;  3X3Z A;  5AYR B;  2Z6B A;  1K9M 4;  4FMD A;  1GD3 A;  3LT9 A;  2QA4 3;  1N5H A;  1W6C A;  1EQK A;  2IUK A;  3X41 A;  5AIG A;  1CYV A;  2W9P A;  1IU7 A;  1YJ9 3;  2RCD A;  4JF8 A;  4R9K A;  3CME 3;  3PYJ A;  3CC4 3;  2YFJ B;  1OF5 B;  3HI7 A;  4N6V 0;  4WYK A;  1SIH A;  1O7W B;  5DRE A;  1EG9 B;  2CW9 A;  1IVU A;  3MG1 A;  1U5O A;  2WOH A;  4EV5 A;  4HKV B;  3VSY A;  1ISK A;  3OXA A;  1FGQ A;  2UX0 A;  4N6L A;  3S29 A;  1KWI A;  3DMC A;  1K73 4;  3NQZ A;  4Q53 A;  4KVH A;  1GY7 A;  2XFS A;  2Y74 A;  1LNH A;  2BNG A;  1U8C B;  1WMO A;  3OWY A;  3S5C A;  3SXX A;  1M1K 4;  1STF I;  5KP4 A;  3K5T A;  2R4I A;  4IT7 A;  4JRF A;  5EQL A;  3CCV 3;  3OW2 2;  2CWT A;  1HU9 A;  2A15 A;  4FMC A;  1GD4 A;  2L4V A;  3DGO A;  3CNX A;  5D83 A;  3EN8 A;  2F98 A;  3QK9 A;  1SPU A;  4RNY A;  1YI2 3;  1SJW A;  3G0K A;  1IVX A;  1ASK A;  4MMY B;  1JRQ A;  4NRE A;  3SX1 A;  2Z7A A;  2BMQ B;  2HML B;  2IA7 A;  1FGR A;  4N6U A;  4HM2 B;  1DMQ A;  5G2G A;  2GBW B;  3ECF A;  2F99 A;  3RGR A;  2D42 A;  3CCR 3;  1EKM A;  3Q90 A;  1OF5 A;  3EC9 A;  4RBN A;  4LEH A;  5IG5 A;  2QEX 3;  1QJG A;  3HIG A;  2OTJ 3;  2PNC A;  3KE7 A;  4L7K A;  1OHO A;  5IG0 A;  4LGQ A;  3CC7 3;  3DGL A;  1AVK A;  3E99 A;  3FLJ A;  4LZI A;  3X3Y A;  1W5Z A;  3EBT A;  3GWR A;  3EX9 A;  3HZP A;  4IIA A;  1LXE A;  4AEQ A;  3BNE A;  1F8N A;  2P0M A;  1TIJ A;  3OV4 A;  1IVW A;  4WHA A;  3G71 3;  1RJO A;  3CC2 3;  1A2V A;  4HM0 B;  3JUQ A;  2W0Q A;  1UUV B;  2KCD A;  1JB2 A;  2E2T A;  2QIY A;  1AV4 A;  3EQQ B;  5FGO A;  1E3R A;  4WWU C;  1GYB A;  3FF0 A;  1NO3 A;  1DVD A;  3J7Y d;  1ZX2 A;  1GS3 A;  2W6J H;  2IMJ A;  3B8L A;  5JBS A;  1DYU A;  5IF6 A;  3OX9 A;  2OOV C;  4FR9 A;  3DY5 A;  2P05 A;  3NX0 A;  3MPH A;  4H61 A;  1W2Z A;  3ER7 A;  3MKI A;  3G8Z A;  1MNL A;  4AKY A;  1Q81 4;  2P09 A;  2B1X B;  1FGO A;  2XF3 A;  3JUO A;  1A90 A;  4FMA A;  4G1M B;  3H3H A;  4HZB B;  1K8A 4;  3FH1 A;  3PZW A;  2BHM A;  2CIU A;  4RNZ A;  5CLK A;  2OCT A;  4BTW A;  1IVV A;  1W02 A;  1TFO A;  3N8B A;  2MC8 A;  3U97 A;  1UW1 A;  3VGN A;  1N5P A;  3CXC 2;  4CDL A;  3N9H A;  5AIH A;  1IV7 A;  3PGB A;  3G16 A;  4TX4 A;  1TFK A;  8CHO A;  3DGM A;  3EF8 A;  1FA3 A;  5DRV A;  2JQ5 A;  3UL5 A;  3ROB A;  3UNL A;  1D6Z A;  1GY5 A;  1UI8 A;  4R1K A;  3F7X A;  2B24 B;  1CEW I;  2XGL A;  3F9S A;  5ELU A;  3MWZ A;  1IK3 A;  1IT8 A;  3Q1C A;  4BTY A;  1FUW A;  4OUQ A;  1PFP A;  4KFD A;  4BTX A;  1OCV A;  4STD A;  5ELJ A;  3X42 A;  4XBT A;  3EE1 A;  1VQ9 3;  2Q07 A;  3LML A;  4FMB A;  2FNQ A;  1WMN A;  5AEW B;  1AR0 A;  1W4N A;  1ZO2 A;  5IEO A;  1SII A;  2XEP A;  1OHS A;  3LZA A;  4GB5 A;  3K0Z A;  3I0Y A;  3CU3 A;  5IEP A;  2OTL 3;  3RGA A;  1K28 A;  3F14 A;  1OGX A;  3MG2 A;  1O7N B;  2O3O A;  4EXR A;  5CF2 A;  3JUP A;  2IUJ A;  3I55 3;  4ZM8 A;  1W6G A;  2CFD A;  4KFE A;  4EV2 A;  3N54 B;  1LVN A;  3NM7 A;  3V92 A;  4HZ9 B;  1OHP A;  3LTC A;  3LYG A;  2YFI B;  1QAF A;  5BXQ A;  5KP3 A;  4FCJ A;  2XSO B;  1CQS A;  1OGZ A;  2W2C A;  1FGM A;  3WDG B;  2HMK B;  3KII A;  5AIF A;  3WOE B;  1VQ6 3;  4KFF A;  2FXT A;  2WO0 A;  1OH0 A;  4HVN A;  4HM6 B;  3GZY B;  1YHQ 3;  3BLZ A;  4AKZ A;  4K90 B;  4KZ1 A;  3T8U A;  4O8S A;  2W56 A;  1OPY A;  2GEX A;  3FKA A;  4HYZ A;  1US1 A;  3GZB A;  1JN5 A;  1D6U A;  1Y4K A;  2GEY A;  3LOY A;  1V74 A;  1JNQ A;  1JKG B;  2C11 A;  3NQY A;  2W04 A;  4H3U A;  4K1U A;  1R4C A;  1T5Y A;  2GBX B;  3LXU X;  3T8N A;  2ZDJ A;  1W6Y A;  1QAL A;  1IQX A;  3PCS A;  1FGT A;  1YVB I;  2LYX A;  3H51 A;  1TU5 A;  3NM2 A;  3KSE D;  3CPO A;  3EB8 A;  3CCS 3;  1WNH A;  2ML5 A;  2XRX B;  1S72 3;  1Q40 A;  1RRH A;  3KZT A;  3AMO B;  2CG1 A;  3K7C A;  4N6M A;  2HMM B;  3JUM A;  3JVC A;  5STD A;  3NBJ A;  3FG3 A;  3IMA B;  5AYS C;  3UJM A;  1N9J A;  1M9G A;  4N6N B;  1O7P B;  4WP5 A;  1VQ5 3;  2XGN A;  1NU3 A;  4MMZ B;  3X40 A;  1VQK 3;  2HMJ B;  3IJE B;  3G4S 3;  1HKX A;  3BND A;  4WFO A;  3K9M C;  4K61 A;  3K63 A;  3BNB A;  4MMX B;  3WA3 A;  1OUN A;  2I9W A;  3M8C A;  1RN7 A;  1WMP A;  2STD A;  1S5A A;  4N6T A;  1JJ2 2;  3G6E 3;  5FW5 A;  3STD A;  1GY6 A;  4LSO A;  3WMD A;  4OVM A;  1VQO 3;  1N8Q A;  5CF1 A;  3CCJ 3;  3HK4 A;  4GL6 A;  1UUW B;  1E3V A;  3DUK A;  1JKG A;  1KC8 4;  5BVB A;  1MOL A;  2INX A;  3B4P A;  3KN4 A;  3FF2 A;  1RKY A;  1OAC A;  3DZL A;  3NUV A;  5D81 A;  4EBG A;  1YIT 3;  3GZX B;  3KKG A;  5AI1 A;  1VQM 3;  4X2O A;  5TGN A;  1M1X B;  2F86 B;  5LC6 A;  2V1L A;  3EBY A;  4RZM A;  4PEJ A;  2CFK A;  3FZW A;  3B7C A;  2Y73 A;  5KP1 A;  3QRD A;  3I56 3;  2JDI H;  3FSD A;  1O7M B;  4HM7 B;  1A2K A;  2P0X A;  4IPB A;  4L8O A;  5HGR A;  1BUQ A;  1IT7 A;  3BNC A;  3FCS B;  3CPW 2;  2O9U X;  1ROA A;  2W56 B;  3AMO A;  3F8X A;  2CH9 A;  1Q7Y 4;  1D6Y A;  1N9E A;  1ULI B;  2E2U A;  3PCR A;  3SED A;  3LH4 A;  1JN5 B;  1NB3 I;  1AVL A;  3IPT A;  3Q2P A;  2WGO A;  3LTD A;  3MYT A;  1EA2 A;  3LTB A;  4EYC A;  2CKF B;  4R80 A;  5EVH A;  4XDW A;  2FGT A;  3SVA A;  1ULJ B;  1JB4 A;  3BB9 A;  1NJI 4;  1A67 A;  4J9A A;  5LC7 A;  1DMM A;  2M7O A;  4HM3 B;  4HBR A;  4K1V A;  3GAX A;  5IW9 A;  2Z77 A;  5IEN A;  4OK0 A;  3GRD A;  1IQ8 A;  2BMO B;  4R4K A;  1SQW A;  1G96 A;  3CCU 3;  1Q40 B;  2K54 A;  2ZL8 A;  5EEO A;  3KFQ C;  2CHC A;  2XSH B;  1VQL 3;  4XBY A;  4XM4 A;  3EJV A;  3UB1 A;  2GXF A;  4FCZ A;  1Q42 A;  5AII A;  1VQ8 3;  4MEI A;  1IDP A;  4QWT A;  3SOA A;  1Z1S A;  1W01 A;  4O3V A;  4O2H A;  4N6O B;  1QVF 2;  5CXO A;  1W00 A;  4MJD A;  1ROV A;  2BO9 B;  3F40 A;  1Q82 4;  5A0O B;  1KQS 2;  3NHX A;  4HJL B;  3D9R A;  3O8Y A;  3TDG A;  3DM8 A;  3NBB A;  5IER A;  3NV0 B;  2CWV A;  2D1W A;  3CCQ 3;  3NXJ A;  7STD A;  1YIJ 3;  1NWW A;  3JUN A;  3S67 A;  3WOF B;  3HII A;  3GZR A;  4XBX A;  3FG4 A;  1YJW 3;  1VQN 3;  2K0M A;  1NDO B;  3ALA A;  3MG3 A;  3OWU A;  3CCM 3;  3FG1 A;  2OQE C;  1NB5 I;  1JV2 B;  4O02 B;  3KSP A;  1CYU A;  1O7H B;  1WTH A;  3L0R A;  3F8H A;  3WOD G;  3CMA 3;  1E97 A;  3HX8 A;  1YJN 3;  3PS8 A;  1VQP 3;  5D82 A;  2KRT A;  3A76 A;  2GU1 A;  2HMO B;  3DGN A;  3V98 A;  3NBR A;  4XDV A;  3PXM A;  4N3V A;  2CG0 A;  4X2H A;  5JPP A;  1QVG 2;  3B4O A;  4U13 A;  3EN1 B;  2XH9 A;  3CCE 3;  3MHE A;  2CC3 A;  1PU4 A;  1N8R 4;  2RSX A;  2OQE A;  4LMI A;  2W9Q A;  2CK3 H;  1L5G B;  1JB5 A;  3WA2 X;  3LTA A;  3DXO A;  2ML6 A;  2CFW A;  4EC6 A;  3VF1 A;  4J8T A;  3X3X A;  4HM1 B;  2CFG A;  1TP6 A;  1VZZ A;  1W7C A;  1WQL B;  5IG4 A;  1VQ7 3;  1M90 4;  1IV9 A;  2C10 A;  2WGQ A;  3NV0 A;  5I97 A;  1W2B 2;  2SBL A;  3SOY A;  3OWS A;  1VQ4 3;  3U1W A;  4WYK B;  2E2V A;  4NHF A;  1UI7 A;  4HM8 B;  3MSO A;  4HM4 B;  3S28 A;  4FCM A;  1IQY A;  2W03 A;  2HMN B;  2YFL B;  3V99 A;  5IG3 A;  1RRL A;  1DVC A;  2MF7 A;  4XB5 A;  2CWU A;  1TUH A;  1YGE A;  3S27 A;  2RGQ A;  2XR8 B;  3FGY A;  1O7G B;  2WOF A;  4R9L A;  3CCL 3;  3CD6 3;  2BT3 A;  2PZV A;  2YX9 A;  3T0U A;  2BMR B;  5CK6 A;  2GU3 A;  3SLU A;  1KD1 4;  2KXG A;  2OWP A;  3D3L A;  4ORL A;  2P38 A;  5AEU B;  5JPU A;  2XFT A;  1C7H A;  2RFR A;  4CCV A;  1LOX A;  4HM5 B;  3UL6 A;  1STD A;  3F7S A;  3EHC A;  1QAK A;  4I4K A;  2CFL A;  1Q86 4;  3RDE A;  2OOV A;  2Z76 A;  1K41 A;  2LQV A;  2QGU A;  3LT8 A;  3CNM A;  1DMN A;  1QMA A;  4L8P A;  1J2B A;  1KSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...