4ILFA

Crystal structure of dsbc r125a from salmonella enterica serovar typhimurium
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
b'AMDPEFMDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPAQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbC
publication title Crystal structure of the periplasmic disulfide-bond isomerase DsbC from Salmonella enterica serovar Typhimurium and the mechanistic implications.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 4ilfA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ilfA02
4ZILA 1C72A 12GSA 3HJPA 4JBBA 1WMJA 2O87A 5J4UA 4GF0A 1EV4A 1ERWA 1XXUA 4KB3A 3ERWA 3A2XA 3ZFBA 1V2AA 2CT6A 2TRXA 2MMNA 5DAKA 3GRXA 1FVJA 2C0FA 4N30A 2H1DA 1R26A 1QMVA 2DJ0A 1XOAA 4F0BA 4FYUA 3VI7A 3QMXA 5CAXA 1MD3A 2I1UA 2J23A 19GSA 2O8VB 3M8NA 5F07A 3ZMKA 1XIYA 5ECLB 6GSWA 3HVVA 4LMWA 1KTEA 3QFBC 1T1VA 5IO2A 2YJHA 2CZ3A 1AUCA 5GAND 1QFNA 4OCFA 2GTUA 2QSIA 1PX7A 4MK3A 2V6KA 2Z9SA 4GTUA 4EDYA 1ERVA 2C3TA 3I9V2 1GSUA 4X1UA 1K0AA 5JWQB 4POMA 3G7IA 1A2JA 2N5FA 1ZYEA 2WB9A 1A2MA 3MDKA 2B3SA 4RQXA 3UARA 5HFIA 1ACVA 2FGXA 4OO4A 3IAS2 2I4AA 3TB2A 1XW6A 3GSSA 1WJKA 5JWRB 5DAKB 1VGLA 3TJJA 3Q6OA 2C1YA 1UA5A 1NHYA 4K0GA 1GTIA 1R5PA 3G7YA 3IK7A 3OR5A 4KCAA 3WGXA 1TRSA 4O92A 4JU5A 5EPFA 2L6DA 1Z5YE 1TRWA 1EWXA 3GKNA 1VRSD 1B48A 3TRPA 2AJQB 3ERFA 5J9CA 5GSSA 1U3IA 4MH3A 2F8AA 3GX8A 1YKCA 1XWGA 1XVQA 5INYA 3EYTA 1JLVA 5F05A 4ECCA 3ZYWA 1V58A 2B7JA 4PNFA 5D9WA 3ED3A 1R7HA 1GH2A 4EDZA 1ON4A 4MPFA 1J08A 5G5EA 1M99A 5L71A 2F9SA 1GUHA 1A8LA 2DJKA 2EIQA 1UN2A 4O7HA 1K0DA 4IN0A 1TP9A 3EU3A 3VURA 3QCPA 2RUFA 2VIMA 4F0CA 5LNKe 1SD9A 4HU9A 4ILFA 1O7UA 2FY6A 5E4WA 1OKDA 2J9HA 3M9KA 5IPGA 5FT3A 4IHUA 2DJ2A 3HJMA 4GCIA 3GURA 4MJCA 1J0FA 1GUMA 1W4VA 2V6OA 3C8EA 4OO5A 6GSXA 5IOWA 2IMIA 1T00A 4LMVA 5D73A 3A2WA 3R2QA 2IMFA 2P5QA 2V1MA 4KDXA 3HYPA 2LV3A 4TW5A 3IXRA 1MD4A 5AISA 1SKSB 4BPYA 3KMNA 1MDKA 2DJ3A 1BAYA 2K9FA 2V32A 4O5RA 4ZBBA 3APSA 2H74A 10GSA 3US3A 2LRTA 2KUCA 3D4TA 2B6MA 2WJUA 1HNAA 4MJAA 1H75A 3LWAA 3CSIA 3N9JA 4WBRD 2NBSA 2A2RA 1XVWA 4JE1A 2DJ1A 1F6MC 1JLWA 2LJAA 3EINA 2XPEA 3UL3A 1VF3A 3WYWA 3F6FA 1MTCA 1KBNA 3Q18A 1O8WA 5D9TA 4EKZA 5ELAA 1SYRA 4Q5NA 3KH9A 2K6VA 1DE1A 4PXOA 2ON7A 4OFNA 3C73A 2F51A 1ZL9A 3P7XA 3HD5A 3RAZA 1U6TA 1GSDA 5A5KA 3ZLPA 4PURA 1XFLA 2GZZA 1E2YA 3F4RA 3LXZA 4CDOA 2CQ9A 5ECPB 2LJRA 3QDNA 1GL8A 3ZIVA 5C04A 1LJRA 2OBIA 3I6AA 2GZYA 1M2DA 5HR1A 4WKWA 2AAWA 1O73A 5H5RA 2F3MA 1ZGNA 4MCUA 1CQGA 4POLA 3DIEA 4IW9A 3GHAA 4TXOA 4OD7A 2XBQA 4XS1A 1R4WA 2HE3A 1PX6A 3GTUA 4BVYA 2ZUPA 2KOKA 4MDCA 3F4TA 1OC8A 3HJOA 2H19A 4K0NA 5DVBA 2PWJA 3QAWA 1YF0A 4MLYA 1PRXA 1TTZA 3FR6A 2CZ2A 1R5AA 5ECNB 4ML1A 3VPQA 1YDKA 3Q74A 4MF7A 3TCOA 1M9AA 4GSNA 2JACA 4LL1B 1TJDA 3D0ZA 1A8YA 2ALBA 4WETA 3F4SA 4N10A 3VLNA 2NTOA 1OVNA 2PGTA 2IWTA 3ZVJD 1BQ7A 1PN9A 3GIXA 1GSQA 3FZ9A 1PL2A 5D96A 2TIRA 2VM2A 3FZ5A 4OFMA 2C0GA 2GQKA 18GSA 1ERTA 3LXTA 1FOVA 1PSQA 1EGOA 5KN1A 3P90A 3IE3A 1O8XA 2CX4A 3O76A 3BCKA 5CREA 3E0UA 5H5SA 1QGVA 2R6KA 3C1RA 3HZ8A 5KEJA 5DJMA 1TK0B 3L9VA 2HI7A 4ZB6A 2WRTA 2I3YA 3I43A 2H1AA 2FA4A 3D6IA 1TU8A 4KX4A 1DSBA 3DXBA 1YJ6A 2DBCA 1BX9A 4TXOB 3IPZA 2X8CA 4RUVA 3GTUB 1JZOA 1G0TA 2FWGA 4WXTA 2FCHA 2B5XA 4I2UA 4FYCA 4KSOA 2K18A 1SENA 4IS0A 1EP7A 3WT1A 2VLTA 2H0IA 2C4JA 3PINA 1AAZA 3KD0A 2REMA 4L0UA 1HYUA 2C3QA 4ECIA 3ZRDA 1LBKA 3RHCA 3MSZA 1BYEA 3IBHA 1QQ2A 3UIWA 3ZL5A 4IELA 1A0FA 3FW2A 2ON5A 4HU7A 5CRGA 5IQYA 3GA4A 4KCEA 2L57A 3ZREA 1G7EA 2VCTA 1MEKA 2E2MA 4ZL7A 1GTUA 5AIXA 4J56E 4IJIA 1AQVA 4ID0A 1BG5A 4JRRA 1T4ZA 2NPBA 4GWRA 3A2VA 4V1Ap 5B8BA 5HQPA 3D5JA 3HDCA 4K8MA 4KW6A 2PUKC 3FR9A 4JEDA 2CAIA 2JSZA 3SWLA 4IQ1A 4MABA 3IC4A 1ZZYA 1F3AA 2H72A 3CMIA 3LQ7A 1VF4A 2H73A 5IM9A 4LL4B 1SU9A 1K3YA 4MF5A 3TKQA 4YQVA 1FG4A 1Z9HA 2OADA 3G9BA 3FZAA 2MMOA 5COHA 1Q4JA 1M9BA 4TOPA 1N8JA 2LTKA 2C0EA 2PPTA 2LRNA 3CSJA 4YQMA 3TRQA 4X43A 3TRXA 1OYJA 4XTSA 2IPAA 5J9BA 2YPMA 5A4VA 2IJYA 2MYGA 4DSRA 2IMKA 3ERGA 4MF6A 4K2DA 5FHIA 3KCMA 4ZXGA 2O89A 3EE2A 1WPIA 2EIRA 2BJXA 5IPHA 3Q19A 2RM5A 1SK2A 1YKAA 1UC7A 2OE1A 1XWKA 4QQ7A 3GX0A 3BOAA 5IOXA 1YY7A 3ZFLA 2HYXA 4L8EA 2YZUA 3D22A 2K8SA 2VCWA 1KNGA 4HI7A 3MAKA 2KLXA 2DIZA 4V2MA 3GKMA 3RHBA 1CQHA 3QAVA 4KA0A 4N0ZA 4AGSA 5CNWA 2ZCTA 4ZL8A 1USBA 5IMAA 4DEJA 3WGDA 3D4MA 4I2TA 1MDIA 3DVWA 3EVIA 3FR3A 2VM1A 4IBPA 1QK8A 1ML6A 1JZWA 3M3MA 3DMLA 4N11A 1WIKA 3W8JA 5CYYA 5IIZA 3U5RE 2AYTA 1YZXA 2VD1A 2H1GA 5CRDA 1SYXA 5ECHB 3TOUA 2OBKA 1T8EB 1OAZA 3EC3A 2LS5A 2C3NA 2D2ZA 4NV2A 3ZIJA 1X9MB 3HKRA 4QL7A 3MNGA 2QC7A 4KDUA 4D73A 2L5OA 3ZITA 2JSYA 2RIIA 1FO5A 3UVTA 3F63A 1XOBA 4G9HA 2R2JA 5DALA 3QFAC 2YCDA 4YAVA 4HZ2A 2V41A 2DMMA 2JL4A 3KGKA 4MZCA 1GRXA 1H4OA 1PL1A 2A2SA 4MPGA 1DBYA 2IMDA 4G10A 3P2AA 2X99A 1BJXA 5DJLA 2FUG2 2L59A 4ULXA 2H6ZA 2HRNA 3HA9A 2YV7A 2TRCP 4JR4A 3F9UA 5HFGA 1FHEA 5IMFA 2MZCA 5AN1A 5E59A 2OACA 1A24A 3L0HA 5ECMB 3L78A 3L9SA 1AQXA 3LORA 3D21A 3F6DA 2MMZA 2CVKA 5F0GA 4HJMA 3PH9A 4OMVA 4K7NA 4RI6A 1HD2A 3UJ1A 3FZ4A 2H0HA 2L4QA 3WGEA 4N0VA 1ZMAA 4V1Ag 1SJ6A 4FH8A 3SBCA 3GH6A 3ZMLA 3EWLA 2V2GA 2H01A 2VLUA 2B5EA 2OA7A 4D73B 1K0BA 22GSA 5IMVA 1A23A 3WT2A 4NWYA 4AJ7A 2YWOA 3H93A 1SKWB 3GL5A 5DALB 5ECOB 3NZNA 3FY7A 5B8AA 4KAEA 1TXXA 3GUSA 2QGVA 1XBSA 3FRCA 1TU7A 4PGTA 3O3TA 3RPPA 2GZPA 1QUWA 2VL2A 3GFKA 4F82A 1YQ1A 3NIVA 2FNOA 1SL2B 3CTGA 3WD6A 5CRHA 4HQSA 1QXHA 1LU4A 3CRTA 3APQA 3J7Yk 1TOFA 4OFTA 1AW9A 2CVDA 3W8SA 4J57E 2DJJA 4MMMA 4IP6A 3CTFA 5EY6A 1OE7A 4L5OA 2VO4A 4MZBA 8GSSA 4YAPA 4KNDA 4EC0A 5F06A 2JZRA 5CO3A 2H30A 5ECKB 4BWSA 4TR1A 3C7MA 3M0FA 1F3BA 3HXSA 4YQUA 2N5BA 5G30A 4MJEA 1GUKA 3TJGA 2EC4A 1GLQA 2A4VA 2YWIA 4K9ZA 2AV4A 2VCXA 3RDWA 1B9YC 3GKKA 5GSTA 4LA1A 6GSVA 3UVHA 1ZOFA 6GSUA 2R5GA 3DEXA 1A2LA 1F37A 2JADA 1OC9A 2PU9C 4KSMA 2GT5A 5F8BA 3VPTA 4GSTA 5D93A 1DE2A 5DCGA 2QKEA 1OKTA 2DMLA 2E7PA 3KIJA 5B7CA 5ELGA 3QOUA 1TKDB 1YF1A 2HLSA 2HZEA 2VAFA 1S3AA 2GT6A 5JCUA 4NHWA 2F8FA 4DSSA 4FIWA 5J3RA 1B4QA 4NMUA 4QL9A 2VLVA 1GTBA 1EP8A 2VCQA 1K0CA 1NW2A 4H86A 5LD0A 3JCML 3A5WA 5HR2A 3TKSA 3KTLA 6GSSA 3DWVA 4HZ4A 3FEUA 5ECIB 2C8UA 2WS2A 3GNJA 1RK4A 4KGIA 4TR1B 2FLSA 4WEYA 4WR4A 2IFQA 4XIHA 4F9ZA 4TR0A 17GSA 2R3XA 5C00A 3DD3A 3GH9A 5DQYA 1THOA 3L4NA 4G2EA 2LUSA 3E3EA 3PR8A 1I9DA 3VWUA 2L5LA 2OE3A 1XCCA 4IKHA 4K7OA 1OC9B 2B5YA 4RI7A 4TKYA 3UAPA 2IN3A 4KDYA 2NDOA 3KXOA 3KJYA 3FHKA 2PN8A 4TXVA 1AC1A 4IGJA 3QPMA 5ECSA 5IMZA 4WR5A 3UMAA 4NXIA 3G7JA 4CHSA 1V40A 2LNTA 4WF5A 5G2ZA 2GSQA 3KP9A 2B1LA 3UBKA 2HZEB 3N5OA 5HR3A 4L5LA 2K8VA 4AF2A 4TVEA 1ILOA 3FYGA 3HVSA 1PQNA 1TI3A 1F2EA 1GSSA 3F8UA 4DSSB 3GMFA 1TK8B 2RLIA 1TDIA 4KH7A 1HNCA 2HFDA 5ECRB 2LJKA 4AJ6A 1THXA 3IRAA 3DYRA 2NVLA 2L4CA 4F03A 2HXKA 4GLTA 1PKZA 3GSTA 4J2FA 3VI5A 1SL1B 3CBUA 3RBTA 4ZBAA 4PUAA 4G19A 3QR6A 5FWGA 2O7KA 1Z7RA 3HY2A 3H4KA 2IFQB 2LKUA 5IO0A 3DVXA 4PQ1A 2C80A 2X8GA 1W89A 4EF0A 5EVOA 3BJ5A 3IV4A 1PKWA 1OE8A 4YH2A 3GKXA 4EO3A 2H66A 4XRDA 5H5QA 4K7IA 1XPVA 2DSAA 1IYIA 4MP4A 4V2LA 2E0QA 1Y25A 3CSHA 5HFKA 4MJBA 3DGQA 4K6XA 1TRUA 1BEDA 2JZSA 2KP1A 2GGTA 4WBJA 2CVBA 1T4YA 2O85A 3CXGA 3IA1A 2VCVA 3LSZA 4TN8A 4GQFA 5DDLA 2X8HA 2OKAA 5G1LA 3C71A 2R4VA 3TKRA 2YWNA 2EIOA 1KEBA 2H71A 1K0OA 2H76A 3KMOA 1M0UA 4ZB9A 2H75A 2GS3A 1GNWA 4ML6A 1GNEA 1U88A 1Z6NA 1GULA 3MWHA 2LEGA 4HUAA 5ENUA 1NM3A 4V2NA 1X9SB 2KHPA 2P31A 2XC2A 1K3LA 1I5GA 2B7KA 2GSSA 1EOHA 3F0IA 3UBLA 3HVXA 4ECBA 3M1GA 1FB0A 5ID2A 2IY2A 4XRAA 1K0MA 1N2AA 4OWYA 4PNGA 11GSA 1O81A 5KN2A 3P8WA 1M2AA 5DCHA 4NPBA 4K1FA 2BTOT 1G7OA 3NOFA 2CA8A 2I9HA 1SK1A 4POKA 4E8EA 2VL3A 3TKPA 4ZL9A 4JZQA 1EV9A 4ACSA 4EUYA 3H1NA 4EVMA 3VK9A 2IIYA 2H0GA 1K3OA 9GSSA 1SJZA 1HNBA 1X9WB 3ISOA 1V98A 4XS6A 5KN0A 4HQZA 1ZYQB 2YN1A 3I69A 1X0RA 2HRFA 5J5NA 3VFIA 1PD21 3KZQA 1Z6MA 2PVOC 2H1BA 2VL9A 2GLRA 1EOGA 6GSYA 4FYBA 5D9XA 2M46A 4XCSA 3EURA 2HT9A 2YNXA 2C0DA 5JCGA 3RPNA 2R37A 5AGYA 2H6XA 2GVPA 4Z7XA 5ID2B 1AXDA 1ZCPA 3IOSA 4Q5RA 1WP0A 1XWAA 2FWEA 4MZWA 4XHMA 2HNLA 3W6GA 1WOUA 4MA9A 4P3YB 3DKSA 3LG6A 2YV9A 2H8LA 2IYJA 5HR0A 5IMCA 4BVXA 4ISDA 3ZVJA 2WGRA 1MDJA 4BWQA 2LQOA 4RQRA 2HZFA 4EXJA 4KE3A 4Q5QA 1DUGA 1J9BA 3K8NA 5G1KA 3ME8A 1O85A 5DQSA 2AHEA 3BD2A 1FB6A 1PMTA 1G6WA 2AB6A 1SL0B 4TRXA 2IL3A 4F2IA 13GSA 4NV5A 1EZKA 5KN3A 4GQCA 4NAXA 4PQIA 4DVCA 1XW5A 3BBYA 5EL8A 2DIYA 2RUEA 5AIVA 2YP6A 2CAQA 1M2BA 1RW1A 4BL7A 3A3TA 4NHZA 5B6NA 2DC5A 2MMAA 3HZ4A 3V1WA 1X5DA 3L9UA 1K0NA 2LQQA 1S3DA 3APOA 3IAM2 5D9VA 1FVKA 2OE0A 2VD0A 4HDEA 4I5QA 2I81A 1GTAA 3GN3A 2PERA 2P5RA 5CP1A 5ECQB 1TRVA 3U6VA 1A0RP 2YZHA 5ABRA 1F9MA 1PGTA 2FA8A 1PA3A 2L6CA 1M7TA 3IR4A 3TJKA 1URMA 3KM6A 2WDUA 1TI1A 3TJFA 4FO5A 3FKFA 3KP8A 3F3QA 2VUPA 3CYNA 4TR4A 3TGZA 4PX1A 4AJ8A 20GSA 1GWCA 2ZNMA 2XHFA 5GAPD 2KP2A 5IMDA 3O6TA 1JZRA 3VWWA 3LFLA 2LNSA 2XPDA 1GSEA 2GQLA 1ERUA 2JU5A 4XS4A 1G6YA 3S9FA 4O32A 4JR6A 2BMXA 2WFCA 1SK0A 2CX3A 2LRCA 1TK5B 1UVZA 2MBTA 2YANA 4I8BA 5A4WA 4X0XA 2E2GA 3M9JA 1IYHA 1AIUA 1Q98A 3GV1A 2CV4A 2YJ7A 4OCEA 2M72A 4DSQA 1VF1A 1ST9A 2B1KA 3QAGA 5G31A 1U87A 5B6MA 2WULA 2GSRA 2M80A 2RM6A 4ECJA 3F3RA 4POBA 3AY8A 3ME7A 4IQAA 3TOTA 16GSA 1EEMA 3UOMA 4I6XA 1V57A 1OC3A 1WRYA 2P0GA 1FAAA 3KTBA 3UEMA 3HCZA 2H70A 3TUEA 3LYPA 1TW9A 2G2QA 1B4PA 2MBSA 4I97A 4Q5FA 2VL2C 5JWOB 2FD3A 4ZB8A 2X64A 2HSHA 4IJ3A 4ZIJA 4BA7A 4GRFA 2LSTA 4HEA2 1XWBA 1SJIA 3H79A 2ES7A 3E9JB 3IHQA 1B9XC 3LGCA 1GSYA 3EMXA 4HS1A 6GSTA 1O6JA 5DBQA 4XS4B 1JHBA 4LLRA 2PVQA 1WWJA 1X5EA 2DLXA 2GQMA 1T3BA 2GDRA 1U3AA 1Z7PA 4WF4A 3C1SA 3ZZXA 4L0WA 2WCIA 3PGTA 3ZTLA 1JFUA 4E8HA 4GSSA 4HOJA 2PMTA 5CRWA 1T7PB 14GSA 2YWMA 4PUFC 2FHEA 3GL3A 5G5FA 3DRNA 2VOCA 1EEJA 1V9WA 1GP1A 1NSWA 1GSFA 2IMEA 3VWVA 1AQWA 2VCZA 1NHOA 1WE0A 2HSYA 2JZTA 3BCIA 3FK8A 1SKRB 1B8XA 4EE0A 2XBIA 1HQOA 3TKSE 2PBJA 4IVFA 1SD8A 2G0FA 2GSTA 1S3CA 4IP1A 3CRUA 3J7Yb 2AUVA 1XW9A 2FWHA 2H6YA 1Z3EA 3EU4A 2YOIA 3VWXA 2N5AA 3LYKA 5GZZB 1EGRA 3KEBA 7GSSA 3HHVA 1X5CA 1GLPA 5LCZA 4HJ2A 3IDVA 3KH7A 4GXZA 2FWFA 1ABAA 3H8QA 3IK9A 3LEFA 2WZ9A 4EL1A 4PQHA 5A4UA 4MH2A 3QD9A 5JCWA 1RQMA 1YEXA 3TKSC 4ZBDA 2OJLA 1XWCA 1VF2A 3LJRA 1JZDA 1FW1A 1E6BA 1XZOA 4CW9A 1YEPA 3EMPA 5D8IA 3TDGA 5J41A 3GYKA 4TR3A 4KUNA 3TJBA 1Y6EA
chains in the Genus database with same CATH superfamily
4ZILA 3N9HA 1C72A 12GSA 3HJPA 4JBBA 1WMJA 2O87A 5J4UA 4GF0A 1EV4A 3S5CA 1ERWA 1XXUA 3F9SA 4KB3A 3ERWA 3A2XA 3ZFBA 1QMAA 1V2AA 2CT6A 2TRXA 1RGFA 2MMNA 5DAKA 3GRXA 3X40A 3HVNA 3R3EA 1FVJA 2C0FA 4I4KA 2KAAA 1AY7A 4N30A 5LC7A 4R9LA 2H1DA 1BSBA 1I2GA 4XB5A 1R26A 1IQYA 1QMVA 2DJ0A 1XOAA 4F0BA 4FYUA 3VI7A 3QMXA 3Q90A 5AIHA 2X49A 1T5YA 5CAXA 4FQUA 1MD3A 2I1UA 2J23A 1RTUA 19GSA 2O8VB 3M8NA 5F07A 3ZMKA 1XIYA 1CQSA 1C7HA 5ECLB 6GSWA 1FGQA 3HVVA 2GXFA 4BTYA 4LMWA 4FCZA 1A2VA 1KTEA 3QFBC 1T1VA 5IO2A 1PFPA 2YJHA 3JUNA 4X4JA 2W6JH 2CZ3A 1ASKA 3VGNA 1AUCA 5GAND 3UB1A 3MYTA 5CF1A 1QFNA 4OCFA 4DKIA 2GTUA 2QSIA 4HZBB 2L1SA 1PX7A 5IEOA 5IG0A 4MK3A 4ZM8A 2V6KA 2Z9SA 4GTUA 1DE3A 4EDYA 1ERVA 2C3TA 3I9V2 2GEXA 2XR8B 1GSUA 4X1UA 1K0AA 5JWQB 4POMA 3G7IA 2CH9A 1O7NB 1A2JA 2N5FA 1ZYEA 2WB9A 1A2MA 3MDKA 1LOWA 1TTOA 2B3SA 4RQXA 3UARA 5HFIA 1ACVA 3FF0A 2ML6A 3BNEA 2FGXA 1MWSA 5D82A 2I4AA 3IAS2 4OO4A 3TB2A 1XW6A 5BMUA 3GSSA 1WJKA 1VQK3 3Q1CA 1NJI4 2D1WA 5JWRB 5DAKB 2CKFB 1VGLA 3F8XA 3TJJA 1TP6A 3Q6OA 2C1YA 1UA5A 1NHYA 2HMOB 2F56A 2W56A 2CFWA 1ZGXA 4K0GA 1GTIA 5KOWA 1R5PA 4XDWA 3G7YA 2XF3A 3IK7A 3LXUX 3OR5A 4KCAA 3WGXA 1TRSA 1W7CA 4O92A 3AGOA 1RGKA 1HZ1A 4JU5A 4EW5A 3CCE3 3FG1A 3F7XA 5EPFA 2L6DA 4O8SA 4MJDA 1Z5YE 4OUQA 1EWXA 1TRWA 1VRSD 3GKNA 1B48A 3TRPA 2AJQB 3ERFA 5J9CA 2C4BA 2CW9A 5GSSA 1U3IA 4MH3A 4K61A 5IEPA 2F8AA 3GX8A 1YKCA 1XWGA 1XVQA 5INYA 2BIRA 1W00A 3BNBA 4USSA 3EYTA 1JLVA 5F05A 1I3IA 4ECCA 3ZYWA 4HM1B 1V58A 2B7JA 4PNFA 5D9WA 1C54A 1R7HA 3ED3A 3FZWA 5CLKA 1GH2A 4EDZA 2JQ5A 1ON4A 1RN7A 4MPFA 1J08A 5G5EA 1M99A 5L71A 2F9SA 3S29A 2DKHA 1GUHA 1A8LA 2DJKA 2EIQA 1UN2A 4O7HA 1K0DA 4IN0A 1TP9A 3EU3A 3PYJA 3VURA 3QCPA 3N54B 2RUFA 1YVSA 2VIMA 4F0CA 4Z2TA 5LNKe 1VQN3 1SD9A 4HU9A 4ILFA 4QWTA 3PXMA 1O7UA 2FY6A 5E4WA 1BNJA 1OKDA 1OHPA 1MGWA 2J9HA 3M9KA 1T2IA 5M19A 5IPGA 5FT3A 4IHUA 4BL3A 2DJ2A 3HJMA 6STDA 4GCIA 3GURA 4MJCA 1J0FA 2HRKA 1PYLA 1GUMA 1W4VA 2V6OA 1RGEA 3LZAA 3C8EA 4OO5A 6GSXA 1RJOA 1BUQA 2W56B 5IOWA 4XBYA 2IMIA 2ZDJA 1N8QA 3F8HA 1ISKA 1T00A 4LMVA 5D73A 3A2WA 3R2QA 1A2PA 2IMFA 1PY3A 2P5QA 1JBSA 2YFIB 1RGAA 2V1MA 4KDXA 2MF7A 3HYPA 4NHFA 2LV3A 4TW5A 3IXRA 1MD4A 5AISA 1SKSB 1UI7A 4GB5A 4H61A 4BPYA 1J2BA 3KMNA 1VQ53 1MDKA 2DJ3A 3GZBA 1BAYA 2K9FA 1YJN3 2V32A 4O5RA 4ZBBA 3OWYA 4NREA 3APSA 4JRFA 2H74A 10GSA 4RZMA 3US3A 2LRTA 2KUCA 3D4TA 2B6MA 3LT9A 2WJUA 1HNAA 4MJAA 1MWTA 5KP3A 1H75A 3FSDA 3LWAA 3CSIA 3N9JA 3FMWA 3CCU3 2UGIA 4WBRD 2NBSA 3SEDA 2A2RA 1XVWA 4JE1A 2DJ1A 1KC84 1F6MC 1JLWA 2LJAA 3EINA 2XPEA 1GMQA 2BU4A 3UL3A 5AEUB 1VF3A 1UGIA 3F6FA 3WYWA 1MTCA 1KBNA 3Q18A 1O8WA 1R4CA 3LTAA 5D9TA 1HYFA 4EV5A 3CD63 4EKZA 5ELAA 1BVIA 1SYRA 3RGRA 4Q5NA 3KH9A 2K6VA 1DE1A 3WA2X 1Q864 1QVF2 4PXOA 2ON7A 1N5PA 3CNMA 2CWVA 4OFNA 3C73A 2F51A 1IDPA 4KVHA 1ZL9A 1M1K4 3FH1A 3P7XA 3HD5A 3RAZA 1U6TA 1GSDA 5A5KA 3T0UA 3ZLPA 4PURA 1ULJB 1XFLA 2GZZA 1Q40A 1Q7HA 5FW5A 1E2YA 3F4RA 3T8NA 3LXZA 4CDOA 2CQ9A 5ECPB 2LJRA 3QDNA 1GL8A 3ZIVA 1WQLB 5C04A 1LJRA 5BIRA 3EQQB 2R0PA 4TX4A 1AR0A 3FG4A 2OBIA 3I553 3I6AA 3IC8A 4O02B 2GZYA 5BRTA 3HOHA 1M2DA 5HR1A 1K28A 3S67A 4WKWA 2AAWA 3T8UA 3FKAA 1O73A 5H5RA 2F3MA 1ZGNA 4KF9A 4MCUA 1CQGA 4POLA 3DIEA 3GHAA 4IW9A 4TXOA 4OD7A 2XBQA 4XS1A 1R4WA 2HE3A 1PX6A 3GTUA 4BVYA 2XSHB 2ZUPA 2KOKA 2GBWB 3F4TA 4MDCA 1OC8A 3HJOA 2F5WA 2H19A 4K0NA 1OF5A 5DVBA 2PWJA 3QAWA 3EHCA 1JB2A 2RGQA 1YF0A 4MLYA 3OW22 1KQS2 1PRXA 1B3SA 1TTZA 4RNYA 3FR6A 2CZ2A 3JVCA 2PZVA 2V1LA 2WOFA 1R5AA 5ECNB 2ZHXB 1JB4A 4ML1A 3VPQA 1YDKA 3Q74A 4MF7A 3TCOA 1M9AA 1STFI 4GSNA 2JACA 4LL1B 1TJDA 3OXAA 3VSYA 3D0ZA 4PEJA 1A8YA 2ALBA 2BO9B 1X1UA 1VQL3 3F4SA 4N10A 4WETA 2SBLA 3VLNA 1RLSA 2NTOA 1OVNA 2PGTA 2IWTA 2E2TA 3ZVJD 1JN5A 4O5QA 1BQ7A 1PN9A 3GIXA 1GSQA 2KRTA 3FZ9A 1PL2A 5D96A 2TIRA 2VM2A 1BNFA 1VQ93 3NQYA 3FZ5A 5JPUA 4FMDA 4OFMA 2C0GA 2GQKA 18GSA 3EJVA 1ERTA 3LXTA 1FOVA 4FMBA 1PSQA 1D6ZA 5KN1A 1EGOA 1Q40B 3A76A 3P90A 5AYRB 3IE3A 1RHLA 1O8XA 2CX4A 3O76A 3KIIA 3BCKA 5CREA 3E0UA 5H5SA 1QGVA 2KF4A 2R6KA 1FUSA 3C1RA 3RNTA 3HZ8A 5KEJA 5DJMA 1TK0B 3L9VA 2HI7A 4ZB6A 2WRTA 2I3YA 3I43A 4U13A 1GY5A 2F5MA 2H1AA 2FA4A 4O3VA 3RGAA 1TU8A 3D6IA 1RKYA 4KX4A 1DSBA 3DXBA 1YJ6A 2DBCA 1BX9A 4TXOB 3IPZA 2X8CA 4RUVA 3D9RA 3GTUB 1G0TA 1JZOA 2Y73A 4L8OA 2FWGA 4BVYB 4WXTA 2FCHA 2B5XA 4I2UA 2SARA 4FYCA 3LTCA 3Q2PA 4KSOA 1NO3A 2W04A 2K18A 3D79A 1GMPA 4K2XA 1BRJA 1LOVA 1SENA 1OF5B 1EP7A 4IS0A 3WT1A 5RNTA 2VLTA 2H0IA 2C4JA 3PINA 1AAZA 2RSXA 3KD0A 4LMIA 2REMA 4L0UA 1HYUA 2C3QA 4ECIA 3D3LA 2B1XB 3B7CA 1AV4A 3ZRDA 1LBKA 3RHCA 3MSZA 2UUGC 1ZYPA 1N5HA 3V98A 1BYEA 3IBHA 1QQ2A 3UIWA 3ZL5A 4IELA 1A0FA 3FW2A 3CQFA 2ON5A 4WHAA 4HU7A 3KFQC 4KZ1A 1ZO2A 1UCIA 5CRGA 4R1KA 5IQYA 3WR2A 2D42A 4AEQA 1JN5B 3GA4A 4KCEA 2L57A 3ZREA 4HM2B 1G7EA 4N6UA 1GSPA 1W2ZA 2VCTA 1MEKA 1BNIA 2E2MA 4ZL7A 3F7SA 1GTUA 3EC9A 5AIXA 2RNTA 4J56E 1W2B2 1BRIA 1DMNA 1UUWB 4IJIA 1AQVA 4ID0A 3DGLA 1BG5A 3WHOA 4JRRA 5D83A 4CDLA 1T4ZA 2NPBA 4GWRA 2RFRA 3A2VA 1X1WA 4MMZB 4V1Ap 5B8BA 2XSOB 5HQPA 3D5JA 3HDCA 4K8MA 4KW6A 2PUKC 1A2KA 3FR9A 4JEDA 4YKFA 2CAIA 1GMRA 1X1XA 3DGMA 2JSZA 3SWLA 4IQ1A 4MABA 2OTJ3 3IC4A 1ZZYA 1I0VA 1F3AA 2H72A 3CMIA 3LQ7A 1VF4A 3ZG0A 2H73A 5IM9A 2HMJB 2O9UX 2OOVC 1SU9A 2HMKB 1K3YA 4LL4B 4MF5A 3TKQA 3EE1A 4YQVA 1FG4A 1Z9HA 2OADA 1BNSA 3G9BA 3FZAA 1IT7A 2MMOA 4BIRA 1M904 4HM5B 1LNHA 2CWUA 1MWRA 5COHA 4FMCA 1Q4JA 1M9BA 5A0OB 2BHMA 4TOPA 1N8JA 2LTKA 2C0EA 2PPTA 1UW1A 2LRNA 1W01A 3HK4A 3CSJA 4YQMA 3TRQA 4X43A 3TRXA 1LQMB 4IT7A 1OYJA 4XTSA 2IPAA 1VQ73 2CFDA 4J5KA 5J9BA 2YPMA 5A4VA 2IJYA 2MYGA 4DSRA 2IMKA 3ERGA 4MF6A 1N9JA 4K2DA 1XG8A 5FHIA 3KCMA 3X3YA 4ZXGA 3LMLA 2O89A 1OCVA 3EE2A 4PTSA 1WPIA 1JBTA 2EIRA 2BJXA 5IPHA 1YGEA 3Q19A 4LYLB 2RM5A 3CCQ3 1SK2A 1YKAA 1UC7A 4K1UA 3CMA3 2OE1A 1XWKA 4QQ7A 3GX0A 1RDSA 3BOAA 5IOXA 1YY7A 3ZFLA 2HYXA 2CX0A 4L8EA 4CPKA 3JUMA 1I2FA 2YZUA 3D22A 2K8SA 3GZYB 2VCWA 1OGXA 1NDOB 1DETA 3F40A 1TFKA 1KNGA 4HI7A 3MAKA 2KLXA 3AGNA 1A67A 2QGUA 2DIZA 3MG3A 4V2MA 4O2HA 1GYBA 3GKMA 3RHBA 1FGTA 1CQHA 3QAVA 1W02A 3LYGA 4KA0A 2MC8A 4N0ZA 4AGSA 4HKVB 5CNWA 3SYUA 1YVBI 2ZCTA 4ZL8A 1USBA 5IMAA 1V74A 4EXRA 4DEJA 3IPTA 3WGDA 4J5GA 1RGLA 2KF3A 3D4MA 4I2TA 1MDIA 4HJLB 3DVWA 3EVIA 3FR3A 2VM1A 4IBPA 1QK8A 1ML6A 1AQZA 1JZWA 3MPHA 3M3MA 3DMLA 4N11A 1WIKA 3W8JA 5CYYA 5IIZA 3J7Yd 3MIXA 4L7KA 3U5RE 3PPUA 2AYTA 1YZXA 3CC43 4JF8A 2VD1A 2H1GA 5CRDA 1SYXA 4LZIA 5ECHB 3NQZA 3TOUA 4MMXB 2OBKA 5FGOA 1T8EB 1LQGC 1E3RA 1OAZA 4WP5A 1B21A 3EC3A 2LS5A 2C3NA 2D2ZA 4NV2A 3ZIJA 1X9MB 3HKRA 4QL7A 2F99A 1YJ93 3MNGA 5AIFA 3F14A 3K7CA 1JKGA 2QC7A 4KDUA 4OVMA 4BL2A 1O7GB 5CF2A 2W9QA 2L5OA 3ZITA 4D73A 2JSYA 2RIIA 1FO5A 3UVTA 7RNTA 3F63A 1EUIC 3MKIA 1XOBA 3MG2A 1TFOA 4G9HA 1LNIA 1O7HB 2R2JA 5DALA 3QFAC 2YCDA 4YAVA 4HZ2A 2V41A 2DMMA 2JL4A 3KGKA 4MZCA 1GRXA 1H4OA 6GSPA 4G1MB 1PL1A 2A2SA 4MPGA 1DBYA 2IMDA 4G10A 3P2AA 2X99A 3EN8A 1BJXA 5DJLA 2QA1A 3U1WA 2FUG2 2HRAA 2L59A 4ULXA 2H6ZA 2HRNA 3HA9A 1FUWA 2CFKA 2YV7A 2XRXB 2TRCP 4JR4A 3F9UA 5HFGA 1W6YA 3RDEA 1FHEA 1G02A 5IMFA 3PGBA 3AHWA 2MZCA 1UGHI 2F98A 2OACA 5AN1A 5E59A 1OACA 1A24A 3L0HA 4WWUC 1DVCA 4Z2RA 5ECMB 5IERA 5AIGA 3ALAA 4EYCA 3L78A 1Q7Y4 3L9SA 1AQXA 3LORA 3D21A 2Z7AA 3F6DA 4HAAA 2CC3A 2MMZA 5DRVA 2Q07A 1N8R4 2CVKA 5F0GA 3KCHA 1IU7A 4HJMA 3PH9A 4EBGA 4OMVA 3DM8A 4K7NA 4RI6A 1HD2A 3UJ1A 3FZ4A 2H0HA 2Z6BA 1EA2A 1CH0A 2L4QA 3WGEA 3A5EA 4N0VA 1ZMAA 4V1Ag 1SJ6A 4FH8A 3SBCA 3GH6A 3ZMLA 3EWLA 2V2GA 2H01A 2VLUA 1JKGB 3LT8A 5EVHA 1RRHA 2B5EA 2OA7A 4D73B 1KSIA 3SVAA 1OH0A 1K0BA 22GSA 5IMVA 1A23A 1IT8A 3WT2A 4NWYA 3OX9A 4AJ7A 2YWOA 3H93A 3EBTA 1SKWB 1BRHA 2STDA 3GL5A 4CY6A 5DALB 4HVNA 5ECOB 1BANA 3NZNA 3FY7A 3GAXA 1SIIA 5B8AA 1YNVX 3B4OA 2CHCA 2WO0A 4KAEA 1TXXA 3GUSA 2IMJA 2QGVA 2ZL8A 1XBSA 2RCDA 5HOHA 3FRCA 1TU7A 4PGTA 3O3TA 3RPPA 3G0KA 2PNCA 2GZPA 1QUWA 2VL2A 3GFKA 4F82A 1YQ1A 3NIVA 2FNOA 1CEWI 2OQEA 1EG9B 2XGNA 1BRNL 1SL2B 3CTGA 3K0ZA 3WD6A 1DMQA 1BGSA 3CC73 5CRHA 4HQSA 1QXHA 1LU4A 3CRTA 3APQA 1YHQ3 3J7Yk 1QAFA 1TOFA 4OFTA 1S723 4HM7B 1AW9A 2CVDA 3W8SA 2JDIH 3NHXA 3I563 4J57E 2DJJA 4MMMA 4IP6A 2Z77A 3CTFA 5EY6A 1OE7A 4L5OA 2VO4A 1BSCA 3I0YA 4MZBA 2K3DA 1IVWA 4BU4A 8GSSA 4YAPA 1UCJA 5HGRA 4HZ9B 4KNDA 4EC0A 1WNHA 5F06A 2JZRA 5CO3A 2H30A 1GY6A 1OPYA 5ECKB 4BWSA 3UJMA 5BU4A 4TR1A 1W6GA 1PU4A 2WGQA 1BRGA 3DUKA 1AVKA 3C7MA 3D5IA 2A15A 3M0FA 2P0XA 1E97A 1F3BA 3HXSA 1JJ22 4YQUA 2N5BA 5G30A 1MOLA 1K41A 2K54A 2WGOA 1RGHA 1AVLA 4MJEA 1GUKA 3TJGA 2EC4A 1GLQA 2I9WA 1PFOA 2A4VA 2YWIA 1Z1SA 4K9ZA 2AV4A 4IPBA 2VCXA 3RDWA 1B9YC 3GKKA 3KN4A 3KE7A 4HM3B 5GSTA 4LA1A 6GSVA 3UVHA 1ZOFA 6GSUA 1NB3I 2GU3A 2R5GA 3DEXA 1A2LA 1OGZA 2XEPA 1UUGB 1F37A 2JADA 1OC9A 1BRSA 2PU9C 3EX9A 3PS8A 1N9EA 4EIQA 4KSMA 9RNTA 3UNLA 1IVXA 1NNVA 5CK6A 2GT5A 5F8BA 3DZLA 3VPTA 4GSTA 5D93A 1DE2A 1US1A 5DCGA 3GZRA 4WYKA 2KCDA 1Q9EA 2QKEA 1OKTA 2DMLA 2R0CA 2E7PA 3KIJA 5B7CA 5ELGA 3QOUA 1TKDB 1YF1A 4AKZA 2HLSA 2HZEA 1FZUA 2VAFA 3G16A 3CXC2 1S3AA 2GT6A 5JCUA 4NHWA 8RNTA 5D81A 5BVBA 2F8FA 4DSSA 4FIWA 5J3RA 3M8CA 1B4QA 1IVVA 2ML5A 2R0GA 4NMUA 4QL9A 2VLVA 1GTBA 1EP8A 1M1XB 2VCQA 4XM4A 1K0CA 1IVUA 1BSAA 1NW2A 4H86A 2FNQA 5LD0A 3JCML 3A5WA 5HR2A 1KD14 3TKSA 1LXEA 3KTLA 6GSSA 1M9GA 3DWVA 3BU4A 4HZ4A 4MMYB 3FEUA 1FOHA 5ECIB 2C8UA 2WS2A 3GNJA 1RK4A 4KGIA 2P0MA 4TR1B 2FLSA 4WEYA 4WR4A 1ROVA 2IFQA 3KSED 4R9KA 4XIHA 4F9ZA 4TR0A 17GSA 2R3XA 5C00A 1QAKA 3DD3A 3NV0A 3GH9A 5AEWB 5DQYA 1THOA 3L4NA 4G2EA 3X41A 2E2VA 2LUSA 3E3EA 1UCLA 3PR8A 3HI7A 1TRQA 2BMQB 1I9DA 2GU1A 1VQO3 3VWUA 2L5LA 2OE3A 5DREA 1RSNA 1W4NA 1XCCA 4IKHA 2IA7A 4K7OA 1OC9B 2B5YA 4RI7A 4TKYA 3UAPA 2IN3A 4KDYA 2E2UA 2NDOA 3KXOA 2RBIA 3GZXB 2PN8A 3FHKA 3KJYA 4TXVA 1AC1A 2BMOB 5ELJA 4IGJA 3QPMA 5ECSA 5IG3A 1A90A 5IMZA 2KF6A 4WR5A 3UMAA 4NXIA 3G7JA 4CHSA 1V40A 2HMLB 2LNTA 4WF5A 5G2ZA 1QJGA 2P05A 2GSQA 4WYKB 5KP1A 3KP9A 3BB9A 2B1LA 2KXGA 3UBKA 2HZEB 3N5OA 5HR3A 4L5LA 2K8VA 4AF2A 3CCL3 1VQP3 4TVEA 1ILOA 3FYGA 1VQ43 3HVSA 1PQNA 1X1YA 1TI3A 1F2EA 1GSSA 3F8UA 4DSSB 3GMFA 4GHOA 1RNBA 1TK8B 1D6UA 2RLIA 1TDIA 4KH7A 3AHSA 1HNCA 2HFDA 1GOYA 5ECRB 2LJKA 1E3VA 4AJ6A 1THXA 3IRAA 3DYRA 1RRLA 2NVLA 1O7WB 2L4CA 4F03A 2HXKA 2IUKA 2OTL3 4GLTA 1PKZA 3GSTA 1DMMA 4OK0A 1VQ83 3Q3FA 1LRAA 2F4YA 4J2FA 3VI5A 1SL1B 2UX0A 3CBUA 3RBTA 2A2PA 4ZBAA 4PUAA 4G19A 3QR6A 5FWGA 1LVNA 5GSPA 1Z7RA 3GWRA 2O7KA 3H4KA 3HY2A 2IFQB 3UL5A 2CG1A 2LKUA 2YX9A 5IO0A 3DVXA 4PQ1A 2QEX3 2YFJB 2C80A 1RMSA 3PCSA 1M3IA 2X8GA 1WMNA 1W89A 4EF0A 2XH9A 4XBXA 5EVOA 1MNLA 3NV0B 4N3VA 3BJ5A 3IV4A 1VQM3 4HSCX 1FGOA 1PKWA 1K734 1BUJA 1OE8A 3ZFZA 4YH2A 1RN1A 3EN1B 3GKXA 1I70A 4EO3A 3IMAB 2H66A 4XRDA 2LQVA 5H5QA 4K7IA 1CYUA 4RNTA 3LTDA 1XPVA 1MWUA 1B2XA 2DSAA 4GL6A 1IYIA 4FMAA 4MP4A 4KFDA 1QALA 1GOVA 3L0RA 2E0QA 4V2LA 1Y25A 3CSHA 5HFKA 5CXOA 4MJBA 1ZYNA 3DGQA 5AI1A 1ULIB 4K6XA 1ROAA 2BMRB 1TRUA 1Q42A 1BEDA 3NBJA 1JBRA 2JZSA 2KP1A 2CX1A 5JPPA 2GGTA 4WBJA 2XGLA 3QRDA 2WOHA 2CVBA 1T4YA 1NWWA 1B2ZA 1BIRA 3ER7A 2O85A 2C11A 3CXGA 2KF5A 3IA1A 2VCVA 3LSZA 4TN8A 2W0QA 1LOXA 4GQFA 4G0LA 5DDLA 2X8HA 2OKAA 5G1LA 3C71A 2R4VA 3TKRA 3G4S3 1JNQA 3G713 2GBXB 3JUPA 1YJW3 4K90B 3WODG 2YWNA 2EIOA 1KEBA 1QVG2 2H71A 1K0OA 3AMOA 2H76A 3KMOA 3DH2A 1M0UA 4EIPA 4ZB9A 2H75A 2GS3A 3EBYA 1GNWA 4ML6A 1GNEA 1BOXA 1U88A 1SJWA 3CPOA 1Z6NA 1GULA 3IHGA 3MWHA 1O7MB 2LEGA 4HUAA 8CHOA 5ENUA 3OV4A 3O8YA 1NM3A 4V2NA 1X9SB 2KHPA 3EPTA 4EV2A 4STDA 2W2CA 3BNCA 2CFLA 2P31A 1D6YA 2XC2A 1K3LA 1I5GA 2BT3A 2B7KA 2GSSA 1EOHA 3F0IA 3KSPA 3A5IA 3UBLA 3HVXA 3SLUA 4ECBA 3M1GA 1FB0A 1B2UA 3HIIA 3CCV3 5ID2A 2IY2A 3QK9A 1K0MA 4XRAA 1N2AA 4OWYA 4PNGA 4N6LA 11GSA 1O81A 1NB5I 3DGNA 5KN2A 3P8WA 1M2AA 5DCHA 4NPBA 4K1FA 2BTOT 1G7OA 3NOFA 2CA8A 2I9HA 4EC6A 3H51A 1SK1A 4POKA 5KOXA 4E8EA 1MGRA 2VL3A 1BSEA 3TKPA 4ZL9A 4JZQA 3LW9A 1EV9A 4ACSA 4EUYA 3H1NA 3JUOA 4EVMA 3LTBA 1RNTA 4XDVA 3VK9A 1WMOA 1G96A 2IIYA 2H0GA 3ROBA 1K3OA 9GSSA 1SJZA 1HNBA 1X9WB 3ISOA 4RBNA 1V98A 4XS6A 5KN0A 4HQZA 1ZYQB 2YN1A 3I69A 4Z2UA 1X0RA 4N6V0 2HRFA 5J5NA 4CCVA 1HU9A 5AYSC 3VFIA 1PD21 3KZQA 3NBRA 2HSMA 4LGQA 1Z6MA 1IQ8A 1GS3A 2PVOC 2OCTA 1TRPA 1GY7A 3SOAA 2AAEA 2QIYA 2H1BA 3AMOB 3V92A 1VQQA 2VL9A 3D4AA 2GLRA 1EOGA 6GSYA 1TUHA 4FYBA 3VF1A 2XFSA 1BU4A 4J9AA 4X2HA 1IQXA 5D9XA 4LSOA 1B2SA 2OWPA 3URPA 2GEYA 2M46A 4XCSA 3EURA 2HT9A 2YNXA 3H3HA 2C0DA 5JCGA 3RPNA 1DVDA 3G6E3 4KT3B 1O7PB 3FG3A 4N6TA 2R37A 1TU5A 3LH4A 5AGYA 2H6XA 3PCRA 2GVPA 1BSDA 3IJEB 4Z7XA 3DXOA 5ID2B 2DKIA 1AXDA 1ZCPA 3IOSA 4Q5RA 1WP0A 1XWAA 2FWEA 2CIUA 4G0IA 3FGYA 1YIT3 4MZWA 4XHMA 2HNLA 3W6GA 1WOUA 3UL6A 4MA9A 3KKGA 4P3YB 4Q53A 3DKSA 3LG6A 2YV9A 3FCSB 2H8LA 1ZS7A 4HM8B 2IYJA 4R4KA 5HR0A 5IMCA 4BVXA 1SARA 4ISDA 3ZVJA 2B24B 1FGRA 2WGRA 1MDJA 4BWQA 1EKMA 1BNRA 2LQOA 3NBBA 3CCS3 5ELUA 4L8PA 3D5GA 1BAOA 4RQRA 2HZFA 3DMCA 4EXJA 3MWZA 1PN0A 4KE3A 2C10A 4LEHA 1U8CB 4O5UA 3SX1A 1WTHA 4Q5QA 1DUGA 1J9BA 3K8NA 3HX8A 4HM0B 5G1KA 3ME8A 1O85A 5DQSA 3B8LA 2AHEA 1U5OA 3BD2A 2F86B 1OHOA 1Q824 2CG0A 1FB6A 3DGOA 1PMTA 1G6WA 2AB6A 2Y74A 1IK3A 1SL0B 1KWIA 4TRXA 2IL3A 4F2IA 4HM4B 13GSA 1JB5A 1R4YA 4NV5A 1EZKA 5KN3A 3B4PA 1GD3A 1IYYA 4GQCA 4A5PA 4WFOA 4NAXA 3K63A 4PQIA 4DVCA 1XW5A 3BBYA 5EL8A 3EF8A 4KFEA 2DIYA 2RUEA 5AIVA 2YP6A 2CAQA 1M2BA 1RW1A 4BL7A 3A3TA 4NHZA 5B6NA 2DC5A 2MMAA 3HZ4A 3V1WA 3FLJA 1X5DA 3L9UA 1K0NA 1ZX2A 1JRQA 3CU3A 1I2EA 4K1VA 2LQQA 1S3DA 3WMDA 1JV2B 3APOA 3IAM2 4IIAA 5D9VA 1FVKA 2OE0A 2LYXA 2VD0A 4HDEA 1K8A4 3X3ZA 2GSPA 4I5QA 2I81A 1GTAA 3GN3A 2PERA 1B27A 2P5RA 5CP1A 2P09A 5ECQB 3WOEB 1TRVA 3U6VA 1EQKA 1A0RP 2YZHA 5ABRA 1K9M4 1FYSA 1Y4KA 3ECFA 1F9MA 1PGTA 2FA8A 4FCJA 1PA3A 2L6CA 1M7TA 3IR4A 3TJKA 1URMA 4BVXB 1LOYA 3KM6A 2WDUA 1TI1A 1RGGA 1I8VA 7STDA 3TJFA 4FO5A 1RN4A 3WOFB 3FKFA 4X2OA 4HYZA 3EB8A 3KP8A 5IG4A 3F3QA 3BIRA 2VUPA 3CYNA 4TR4A 3MYDA 3TGZA 4PX1A 4AJ8A 1W6CA 3MHEA 20GSA 1GWCA 2ZNMA 2XHFA 5GAPD 2KP2A 5IMDA 3O6TA 1JZRA 3VWWA 3STDA 3PZWA 5IENA 3LFLA 2LNSA 4J8TA 2XPDA 1GSEA 1L5GB 2GQLA 1ERUA 2JU5A 4XS4A 3K9MC 3DGYA 1G6YA 3S9FA 3G8ZA 3OWUA 3CCR3 2P38A 4BIKA 4O32A 4JR6A 4BL7B 2BMXA 2WFCA 1SK0A 2A4HA 4N6NB 2CX3A 2LRCA 1TK5B 1UVZA 2MBTA 1NU3A 2CWTA 2YANA 4I8BA 5A4WA 4X0XA 2E2GA 3M9JA 5KP4A 1IYHA 1AIUA 1Q98A 3GV1A 2CV4A 4MEIA 2YJ7A 4OCEA 3V99A 2M72A 3WDGB 4DSQA 1VF1A 1GOUA 1ST9A 2B1KA 2FXTA 3QAGA 2QA2A 5G31A 1U87A 5B6MA 2R4IA 2WULA 4R80A 2GSRA 2M80A 2RM6A 4ECJA 5M18A 3F3RA 4POBA 1TIJA 3AY8A 3ME7A 1F8NA 4IQAA 3TOTA 16GSA 3DY5A 4N6OB 2QA43 5I97A 4BTXA 1RCLA 1EEMA 3UOMA 4I6XA 1V57A 5EQLA 1OC3A 1WRYA 2P0GA 1FAAA 3OWSA 1OUNA 1Q814 3KTBA 3UEMA 3HCZA 3N8BA 2J8XB 2H70A 3TUEA 5G2GA 4XBTA 3LYPA 1TW9A 2G2QA 1B4PA 2MBSA 1BNGA 4I97A 4Q5FA 2OOVA 2YFLB 2VL2C 2W9PA 5JWOB 5STDA 3SOYA 4MNNA 2R41A 2FD3A 4ZB8A 2OQEC 1S3RA 2X64A 2HSHA 4IJ3A 4ZIJA 3X42A 4BA7A 4GRFA 3BNDA 1FUTA 2LSTA 4HEA2 1XWBA 3JUQA 3NX0A 1SJIA 3H79A 3CC23 2ES7A 3E9JB 3S28A 6RNTA 3IHQA 1B9XC 3KZTA 1VZZA 2AADA 1HKXA 2HMNB 3LGCA 1YIJ3 4CY8A 3CCM3 1GSYA 3EMXA 4HS1A 6GSTA 1O6JA 5DBQA 1SPUA 4XS4B 3CNXA 1JHBA 4LLRA 2PVQA 1WWJA 2HOHA 3ZG5A 3CCJ3 1X5EA 1OHSA 2DLXA 2GQMA 4HBRA 2O3OA 1T3BA 2GDRA 2FGTA 1FW7A 1U3AA 3NM2A 1Z7PA 4WF4A 1STDA 3GRDA 3C1SA 3ZZXA 4L0WA 1GD4A 5IW9A 2WCIA 3PGTA 1YGWA 1SQWA 2INXA 1SIHA 3ZTLA 1JFUA 4E8HA 1BNEA 4GSSA 4HOJA 2PMTA 3CME3 5CRWA 4CJNA 1T7PB 14GSA 1FGMA 5JBSA 2YWMA 4PUFC 1S5AA 2FHEA 3GL3A 5G5FA 3DRNA 3U97A 2VOCA 1EEJA 1V9WA 1GP1A 1NSWA 3S27A 1DYUA 1BRKA 1T2HA 5M1AA 3GSPA 1GSFA 2IMEA 3VWVA 1AQWA 1IV7A 1B20A 2VCZA 1NHOA 1UCKA 1WE0A 2HSYA 2JZTA 2M7OA 3BCIA 3FK8A 3E99A 1SKRB 1B2MA 1B8XA 4EE0A 2XBIA 1HQOA 3TKSE 1UUVB 2BNGA 5AIIA 2PBJA 2Z76A 4IVFA 1SD8A 2HMMB 2L4VA 2UZ8A 2G0FA 2GSTA 3CPW2 1S3CA 4IP1A 4YKGA 3HIGA 2ZA4A 4FCMA 3CRUA 7GSPA 3J7Yb 2AUVA 1UDII 1XW9A 2FWHA 2H6YA 1Z3EA 3X3XA 3BLZA 3EU4A 4K5SA 4HOHA 4H3UA 2N5AA 1W5ZA 5TGNA 2YOIA 3LYKA 3VWXA 5GZZB 1I0XA 1CYVA 1EGRA 3KEBA 2X4AA 5IG5A 7GSSA 3HHVA 1X5CA 1GLPA 2IUJA 5EEOA 2W03A 4ICYA 5LCZA 3HZPA 4HJ2A 3IDVA 3MSOA 1M3JA 3KH7A 4GXZA 4GSPA 2FWFA 4N6MA 1IV9A 4FR9A 4RNZA 4AKYA 1ABAA 3H8QA 3IK9A 3LEFA 2WZ9A 4EL1A 1I3FA 1YI23 4G0KA 4PQHA 3NXJA 1RCKA 5A4UA 3LOYA 5BXQA 3QD9A 4MH2A 5JCWA 1RQMA 1YEXA 4HM6B 3TKSC 1FA3A 4K5RA 4ZBDA 2OJLA 1XWCA 3MG1A 3FF2A 1VF2A 2XFTA 3LJRA 1UI8A 1JZDA 4ORLA 1FW1A 1E6BA 1RGCA 1WMPA 1XZOA 4CW9A 3TDGA 1YEPA 3EMPA 5D8IA 3K5TA 1VQ63 4BTWA 4KFFA 5J41A 3GYKA 5IF6A 4TR3A 4KUNA 3TJBA 2CK3H 3SXXA 2CFGA 3NM7A 5LC6A 2K0MA 3WA3A 1Y6EA 3NUVA
chains in the Genus database with same CATH topology
4ZILA 1C72A 12GSA 3HJPA 4JBBA 1WMJA 2O87A 5J4UA 4GF0A 1EV4A 1ERWA 1XXUA 4KB3A 3ERWA 3A2XA 3ZFBA 1V2AA 2CT6A 2TRXA 2MMNA 5DAKA 3GRXA 3R3EA 1FVJA 2C0FA 4N30A 2H1DA 1R26A 1QMVA 2DJ0A 1XOAA 4F0BA 4FYUA 3VI7A 3QMXA 2X49A 5CAXA 4FQUA 1MD3A 2I1UA 2J23A 19GSA 2O8VB 3M8NA 5F07A 3ZMKA 1XIYA 5ECLB 6GSWA 3HVVA 4LMWA 1KTEA 3QFBC 1T1VA 5IO2A 2YJHA 4X4JA 2CZ3A 1AUCA 5GAND 1QFNA 4OCFA 2GTUA 2QSIA 1PX7A 4MK3A 2V6KA 2Z9SA 4GTUA 4EDYA 1ERVA 2C3TA 3I9V2 1GSUA 4X1UA 1K0AA 5JWQB 4POMA 3G7IA 1A2JA 2N5FA 1ZYEA 2WB9A 1A2MA 3MDKA 2B3SA 4RQXA 3UARA 5HFIA 1ACVA 2FGXA 4OO4A 3IAS2 2I4AA 3TB2A 1XW6A 5BMUA 3GSSA 1WJKA 5JWRB 5DAKB 1VGLA 3TJJA 3Q6OA 2C1YA 1UA5A 1NHYA 4K0GA 1GTIA 5KOWA 1R5PA 3G7YA 3IK7A 3OR5A 4KCAA 3WGXA 1TRSA 4O92A 4JU5A 5EPFA 2L6DA 1Z5YE 1TRWA 1EWXA 3GKNA 1VRSD 1B48A 3TRPA 2AJQB 3ERFA 5J9CA 5GSSA 1U3IA 4MH3A 2F8AA 3GX8A 1YKCA 1XWGA 1XVQA 5INYA 4USSA 3EYTA 1JLVA 5F05A 4ECCA 3ZYWA 1V58A 2B7JA 4PNFA 5D9WA 3ED3A 1R7HA 1GH2A 4EDZA 1ON4A 4MPFA 1J08A 5G5EA 1M99A 5L71A 2F9SA 2DKHA 1GUHA 1A8LA 2DJKA 2EIQA 1UN2A 4O7HA 1K0DA 4IN0A 1TP9A 3EU3A 3VURA 3QCPA 2RUFA 2VIMA 4F0CA 4Z2TA 5LNKe 1SD9A 4HU9A 4ILFA 1O7UA 2FY6A 5E4WA 1OKDA 2J9HA 3M9KA 5IPGA 5FT3A 4IHUA 2DJ2A 3HJMA 4GCIA 3GURA 4MJCA 1J0FA 2HRKA 1GUMA 1W4VA 2V6OA 3C8EA 4OO5A 6GSXA 5IOWA 2IMIA 1T00A 4LMVA 5D73A 3A2WA 3R2QA 2IMFA 2P5QA 2V1MA 4KDXA 3HYPA 2LV3A 4TW5A 3IXRA 1MD4A 5AISA 1SKSB 4BPYA 3KMNA 1MDKA 2DJ3A 1BAYA 2K9FA 2V32A 4O5RA 4ZBBA 3APSA 2H74A 10GSA 3US3A 2LRTA 2KUCA 3D4TA 2B6MA 2WJUA 1HNAA 4MJAA 1H75A 3LWAA 3CSIA 3N9JA 3FMWA 4WBRD 2NBSA 2A2RA 1XVWA 4JE1A 2DJ1A 1F6MC 1JLWA 2LJAA 3EINA 2XPEA 3UL3A 1VF3A 3WYWA 3F6FA 1MTCA 1KBNA 3Q18A 1O8WA 5D9TA 4EKZA 5ELAA 1SYRA 4Q5NA 3KH9A 2K6VA 1DE1A 4PXOA 2ON7A 4OFNA 3C73A 2F51A 1ZL9A 3P7XA 3HD5A 3RAZA 1U6TA 1GSDA 5A5KA 3ZLPA 4PURA 1XFLA 2GZZA 1E2YA 3F4RA 3LXZA 4CDOA 2CQ9A 5ECPB 2LJRA 3QDNA 1GL8A 3ZIVA 5C04A 1LJRA 2R0PA 2OBIA 3I6AA 3IC8A 2GZYA 5BRTA 1M2DA 5HR1A 4WKWA 2AAWA 1O73A 5H5RA 2F3MA 1ZGNA 4KF9A 4MCUA 1CQGA 4POLA 3DIEA 4IW9A 3GHAA 4TXOA 4OD7A 2XBQA 4XS1A 1R4WA 2HE3A 1PX6A 3GTUA 4BVYA 2ZUPA 2KOKA 4MDCA 3F4TA 1OC8A 3HJOA 2H19A 4K0NA 5DVBA 2PWJA 3QAWA 1YF0A 4MLYA 1PRXA 1TTZA 3FR6A 2CZ2A 1R5AA 5ECNB 4ML1A 3VPQA 1YDKA 3Q74A 4MF7A 3TCOA 1M9AA 4GSNA 2JACA 4LL1B 1TJDA 3D0ZA 1A8YA 2ALBA 4WETA 3F4SA 4N10A 3VLNA 2NTOA 1OVNA 2PGTA 2IWTA 3ZVJD 4O5QA 1BQ7A 1PN9A 3GIXA 1GSQA 3FZ9A 1PL2A 5D96A 2TIRA 2VM2A 3FZ5A 4OFMA 2C0GA 2GQKA 18GSA 1ERTA 3LXTA 1FOVA 1PSQA 1EGOA 5KN1A 3P90A 3IE3A 1O8XA 2CX4A 3O76A 3BCKA 5CREA 3E0UA 5H5SA 1QGVA 2R6KA 3C1RA 3HZ8A 5KEJA 5DJMA 1TK0B 3L9VA 2HI7A 4ZB6A 2WRTA 2I3YA 3I43A 2H1AA 2FA4A 3D6IA 1TU8A 4KX4A 1DSBA 3DXBA 1YJ6A 2DBCA 1BX9A 4TXOB 3IPZA 2X8CA 4RUVA 3GTUB 1JZOA 1G0TA 2FWGA 4BVYB 4WXTA 2FCHA 2B5XA 4I2UA 4FYCA 4KSOA 2K18A 4K2XA 1SENA 4IS0A 1EP7A 3WT1A 2VLTA 2H0IA 2C4JA 3PINA 1AAZA 3KD0A 2REMA 4L0UA 1HYUA 2C3QA 4ECIA 3ZRDA 1LBKA 3RHCA 3MSZA 1ZYPA 1BYEA 3IBHA 1QQ2A 3UIWA 3ZL5A 4IELA 1A0FA 3FW2A 2ON5A 4HU7A 5CRGA 5IQYA 3GA4A 4KCEA 2L57A 3ZREA 1G7EA 2VCTA 1MEKA 2E2MA 4ZL7A 1GTUA 5AIXA 4J56E 4IJIA 1AQVA 4ID0A 1BG5A 4JRRA 1T4ZA 2NPBA 4GWRA 3A2VA 4V1Ap 5B8BA 5HQPA 3D5JA 3HDCA 4K8MA 4KW6A 2PUKC 3FR9A 4JEDA 4YKFA 2CAIA 2JSZA 3SWLA 4IQ1A 4MABA 3IC4A 1ZZYA 1F3AA 2H72A 3CMIA 3LQ7A 1VF4A 2H73A 5IM9A 4LL4B 1SU9A 1K3YA 4MF5A 3TKQA 4YQVA 1FG4A 1Z9HA 2OADA 3G9BA 3FZAA 2MMOA 5COHA 1Q4JA 1M9BA 4TOPA 1N8JA 2LTKA 2C0EA 2PPTA 2LRNA 3CSJA 4YQMA 3TRQA 4X43A 3TRXA 1OYJA 4XTSA 2IPAA 5J9BA 2YPMA 5A4VA 2IJYA 2MYGA 4DSRA 2IMKA 3ERGA 4MF6A 4K2DA 5FHIA 3KCMA 4ZXGA 2O89A 3EE2A 4PTSA 1WPIA 2EIRA 2BJXA 5IPHA 3Q19A 2RM5A 1SK2A 1YKAA 1UC7A 2OE1A 1XWKA 4QQ7A 3GX0A 3BOAA 5IOXA 1YY7A 3ZFLA 2HYXA 4L8EA 2YZUA 3D22A 2K8SA 2VCWA 1KNGA 4HI7A 3MAKA 2KLXA 2DIZA 4V2MA 3GKMA 3RHBA 1CQHA 3QAVA 4KA0A 4N0ZA 4AGSA 5CNWA 2ZCTA 4ZL8A 1USBA 5IMAA 4DEJA 3WGDA 3D4MA 4I2TA 1MDIA 3DVWA 3EVIA 3FR3A 2VM1A 4IBPA 1QK8A 1ML6A 1JZWA 3M3MA 3DMLA 4N11A 1WIKA 3W8JA 5CYYA 5IIZA 3MIXA 3U5RE 3PPUA 2AYTA 1YZXA 2VD1A 2H1GA 5CRDA 1SYXA 5ECHB 3TOUA 2OBKA 1T8EB 1OAZA 3EC3A 2LS5A 2C3NA 2D2ZA 4NV2A 3ZIJA 1X9MB 3HKRA 4QL7A 3MNGA 2QC7A 4KDUA 4D73A 2L5OA 3ZITA 2JSYA 2RIIA 1FO5A 3UVTA 3F63A 1XOBA 4G9HA 2R2JA 5DALA 3QFAC 2YCDA 4YAVA 4HZ2A 2V41A 2DMMA 2JL4A 3KGKA 4MZCA 1GRXA 1H4OA 1PL1A 2A2SA 4MPGA 1DBYA 2IMDA 4G10A 3P2AA 2X99A 1BJXA 5DJLA 2QA1A 2FUG2 2L59A 2HRAA 4ULXA 2H6ZA 2HRNA 3HA9A 2YV7A 2TRCP 4JR4A 3F9UA 5HFGA 1FHEA 5IMFA 2MZCA 5AN1A 5E59A 2OACA 1A24A 3L0HA 4Z2RA 5ECMB 3L78A 3L9SA 1AQXA 3LORA 3D21A 3F6DA 2MMZA 2CVKA 5F0GA 4HJMA 3PH9A 4OMVA 4K7NA 4RI6A 1HD2A 3UJ1A 3FZ4A 2H0HA 2L4QA 3WGEA 4N0VA 1ZMAA 4V1Ag 1SJ6A 4FH8A 3SBCA 3GH6A 3ZMLA 3EWLA 2V2GA 2H01A 2VLUA 2B5EA 2OA7A 4D73B 1K0BA 22GSA 5IMVA 1A23A 3WT2A 4NWYA 4AJ7A 2YWOA 3H93A 1SKWB 3GL5A 4CY6A 5DALB 5ECOB 3NZNA 3FY7A 5B8AA 4KAEA 1TXXA 3GUSA 2QGVA 1XBSA 3FRCA 1TU7A 4PGTA 3O3TA 3RPPA 2GZPA 1QUWA 2VL2A 3GFKA 4F82A 1YQ1A 3NIVA 2FNOA 1SL2B 3CTGA 3WD6A 5CRHA 4HQSA 1QXHA 1LU4A 3CRTA 3APQA 3J7Yk 1TOFA 4OFTA 1AW9A 2CVDA 3W8SA 4J57E 2DJJA 4MMMA 4IP6A 3CTFA 5EY6A 1OE7A 4L5OA 2VO4A 4MZBA 8GSSA 4YAPA 4KNDA 4EC0A 5F06A 2JZRA 5CO3A 2H30A 5ECKB 4BWSA 4TR1A 3C7MA 3M0FA 1F3BA 3HXSA 4YQUA 2N5BA 5G30A 4MJEA 1GUKA 3TJGA 2EC4A 1GLQA 2A4VA 2YWIA 4K9ZA 2AV4A 2VCXA 3RDWA 1B9YC 3GKKA 5GSTA 4LA1A 6GSVA 3UVHA 1ZOFA 6GSUA 2R5GA 3DEXA 1A2LA 1F37A 2JADA 1OC9A 2PU9C 4EIQA 4KSMA 2GT5A 5F8BA 3VPTA 4GSTA 5D93A 1DE2A 5DCGA 2QKEA 1OKTA 2DMLA 2R0CA 2E7PA 3KIJA 5B7CA 5ELGA 3QOUA 1TKDB 1YF1A 2HLSA 2HZEA 2VAFA 1S3AA 2GT6A 5JCUA 4NHWA 2F8FA 4DSSA 4FIWA 5J3RA 1B4QA 2R0GA 4NMUA 4QL9A 2VLVA 1GTBA 1EP8A 2VCQA 1K0CA 1NW2A 4H86A 5LD0A 3JCML 3A5WA 5HR2A 3TKSA 3KTLA 6GSSA 3DWVA 4HZ4A 3FEUA 1FOHA 5ECIB 2C8UA 2WS2A 3GNJA 1RK4A 4KGIA 4TR1B 2FLSA 4WEYA 4WR4A 2IFQA 4XIHA 4F9ZA 4TR0A 17GSA 2R3XA 5C00A 3DD3A 3GH9A 5DQYA 1THOA 3L4NA 4G2EA 2LUSA 3E3EA 3PR8A 1I9DA 3VWUA 2L5LA 2OE3A 1XCCA 4IKHA 4K7OA 1OC9B 2B5YA 4RI7A 4TKYA 3UAPA 2IN3A 4KDYA 2NDOA 3KXOA 3KJYA 3FHKA 2PN8A 4TXVA 1AC1A 4IGJA 3QPMA 5ECSA 5IMZA 4WR5A 3UMAA 4NXIA 3G7JA 4CHSA 1V40A 2LNTA 4WF5A 5G2ZA 2GSQA 3KP9A 2B1LA 3UBKA 2HZEB 3N5OA 5HR3A 4L5LA 2K8VA 4AF2A 4TVEA 1ILOA 3FYGA 3HVSA 1PQNA 1TI3A 1F2EA 1GSSA 3F8UA 4DSSB 3GMFA 1TK8B 2RLIA 1TDIA 4KH7A 1HNCA 2HFDA 5ECRB 2LJKA 4AJ6A 1THXA 3IRAA 3DYRA 2NVLA 2L4CA 4F03A 2HXKA 4GLTA 1PKZA 3GSTA 4J2FA 3VI5A 1SL1B 3CBUA 3RBTA 2A2PA 4ZBAA 4PUAA 4G19A 3QR6A 5FWGA 2O7KA 1Z7RA 3HY2A 3H4KA 2IFQB 2LKUA 5IO0A 3DVXA 4PQ1A 2C80A 2X8GA 1W89A 4EF0A 5EVOA 3BJ5A 3IV4A 1PKWA 1OE8A 4YH2A 3GKXA 4EO3A 2H66A 4XRDA 5H5QA 4K7IA 1XPVA 2DSAA 1IYIA 4MP4A 4V2LA 2E0QA 1Y25A 3CSHA 5HFKA 4MJBA 1ZYNA 3DGQA 4K6XA 1TRUA 1BEDA 2JZSA 2KP1A 2GGTA 4WBJA 2CVBA 1T4YA 2O85A 3CXGA 3IA1A 2VCVA 3LSZA 4TN8A 4GQFA 4G0LA 5DDLA 2X8HA 2OKAA 5G1LA 3C71A 2R4VA 3TKRA 2YWNA 2EIOA 1KEBA 2H71A 1K0OA 2H76A 3KMOA 1M0UA 4EIPA 4ZB9A 2H75A 2GS3A 1GNWA 4ML6A 1GNEA 1U88A 1Z6NA 1GULA 3IHGA 3MWHA 2LEGA 4HUAA 5ENUA 1NM3A 4V2NA 1X9SB 2KHPA 3EPTA 2P31A 2XC2A 1K3LA 1I5GA 2B7KA 2GSSA 1EOHA 3F0IA 3A5IA 3UBLA 3HVXA 4ECBA 3M1GA 1FB0A 5ID2A 2IY2A 4XRAA 1K0MA 1N2AA 4OWYA 4PNGA 11GSA 1O81A 5KN2A 3P8WA 1M2AA 5DCHA 4NPBA 4K1FA 2BTOT 1G7OA 3NOFA 2CA8A 2I9HA 1SK1A 4POKA 5KOXA 4E8EA 2VL3A 3TKPA 4ZL9A 4JZQA 3LW9A 1EV9A 4ACSA 4EUYA 3H1NA 4EVMA 3VK9A 2IIYA 2H0GA 1K3OA 9GSSA 1SJZA 1HNBA 1X9WB 3ISOA 1V98A 4XS6A 5KN0A 4HQZA 1ZYQB 2YN1A 3I69A 4Z2UA 1X0RA 2HRFA 5J5NA 3VFIA 1PD21 3KZQA 2HSMA 1Z6MA 2PVOC 2H1BA 2VL9A 2GLRA 1EOGA 6GSYA 4FYBA 5D9XA 2M46A 4XCSA 3EURA 2HT9A 2YNXA 2C0DA 5JCGA 3RPNA 2R37A 5AGYA 2H6XA 2GVPA 4Z7XA 5ID2B 2DKIA 1AXDA 1ZCPA 3IOSA 4Q5RA 1WP0A 1XWAA 2FWEA 4G0IA 4MZWA 4XHMA 2HNLA 3W6GA 1WOUA 4MA9A 4P3YB 3DKSA 3LG6A 2YV9A 2H8LA 2IYJA 5HR0A 5IMCA 4BVXA 4ISDA 3ZVJA 2WGRA 1MDJA 4BWQA 2LQOA 4RQRA 2HZFA 4EXJA 1PN0A 4KE3A 4O5UA 4Q5QA 1DUGA 1J9BA 3K8NA 5G1KA 3ME8A 1O85A 5DQSA 2AHEA 3BD2A 1FB6A 1PMTA 1G6WA 2AB6A 1SL0B 4TRXA 2IL3A 4F2IA 13GSA 4NV5A 1EZKA 5KN3A 4GQCA 4A5PA 4NAXA 4PQIA 4DVCA 1XW5A 3BBYA 5EL8A 2DIYA 2RUEA 5AIVA 2YP6A 2CAQA 1M2BA 1RW1A 4BL7A 3A3TA 4NHZA 5B6NA 2DC5A 2MMAA 3HZ4A 3V1WA 1X5DA 3L9UA 1K0NA 2LQQA 1S3DA 3APOA 3IAM2 5D9VA 1FVKA 2OE0A 2VD0A 4HDEA 4I5QA 2I81A 1GTAA 3GN3A 2PERA 2P5RA 5CP1A 5ECQB 1TRVA 3U6VA 1A0RP 2YZHA 5ABRA 1F9MA 1PGTA 2FA8A 1PA3A 2L6CA 1M7TA 3IR4A 3TJKA 1URMA 4BVXB 3KM6A 2WDUA 1TI1A 3TJFA 4FO5A 3FKFA 3KP8A 3F3QA 2VUPA 3CYNA 4TR4A 3MYDA 3TGZA 4PX1A 4AJ8A 20GSA 1GWCA 2ZNMA 2XHFA 5GAPD 2KP2A 5IMDA 3O6TA 1JZRA 3VWWA 3LFLA 2LNSA 2XPDA 1GSEA 2GQLA 1ERUA 2JU5A 4XS4A 1G6YA 3S9FA 4O32A 4JR6A 4BL7B 2BMXA 2WFCA 1SK0A 2A4HA 2CX3A 2LRCA 1TK5B 1UVZA 2MBTA 2YANA 4I8BA 5A4WA 4X0XA 2E2GA 3M9JA 1IYHA 1AIUA 1Q98A 3GV1A 2CV4A 2YJ7A 4OCEA 2M72A 4DSQA 1VF1A 1ST9A 2B1KA 3QAGA 5G31A 2QA2A 1U87A 5B6MA 2WULA 2GSRA 2RM6A 2M80A 4ECJA 3F3RA 4POBA 3AY8A 3ME7A 4IQAA 3TOTA 16GSA 1EEMA 3UOMA 4I6XA 1V57A 1OC3A 1WRYA 2P0GA 1FAAA 3KTBA 3UEMA 3HCZA 2H70A 3TUEA 3LYPA 1TW9A 2G2QA 1B4PA 2MBSA 4I97A 4Q5FA 2VL2C 5JWOB 4MNNA 2FD3A 4ZB8A 2X64A 2HSHA 4IJ3A 4ZIJA 4BA7A 4GRFA 2LSTA 4HEA2 1XWBA 1SJIA 3H79A 2ES7A 3E9JB 3IHQA 1B9XC 3LGCA 4CY8A 1GSYA 3EMXA 4HS1A 6GSTA 1O6JA 5DBQA 4XS4B 1JHBA 4LLRA 2PVQA 1WWJA 1X5EA 2DLXA 2GQMA 1T3BA 2GDRA 1U3AA 1Z7PA 4WF4A 3C1SA 3ZZXA 4L0WA 2WCIA 3PGTA 3ZTLA 1JFUA 4E8HA 4GSSA 4HOJA 2PMTA 5CRWA 1T7PB 14GSA 2YWMA 4PUFC 2FHEA 3GL3A 5G5FA 3DRNA 2VOCA 1EEJA 1V9WA 1GP1A 1NSWA 1GSFA 2IMEA 3VWVA 1AQWA 2VCZA 1NHOA 1WE0A 2HSYA 2JZTA 3BCIA 3FK8A 1SKRB 1B8XA 4EE0A 2XBIA 1HQOA 3TKSE 2PBJA 4IVFA 1SD8A 2UZ8A 2G0FA 2GSTA 1S3CA 4IP1A 4YKGA 3CRUA 3J7Yb 2AUVA 1XW9A 2FWHA 2H6YA 1Z3EA 4K5SA 3EU4A 2YOIA 3VWXA 2N5AA 3LYKA 5GZZB 1EGRA 3KEBA 2X4AA 7GSSA 3HHVA 1X5CA 1GLPA 4ICYA 5LCZA 4HJ2A 3IDVA 3KH7A 4GXZA 2FWFA 1ABAA 3H8QA 3IK9A 3LEFA 2WZ9A 4EL1A 4G0KA 4PQHA 5A4UA 4MH2A 3QD9A 5JCWA 1RQMA 1YEXA 3TKSC 4K5RA 4ZBDA 2OJLA 1XWCA 1VF2A 3LJRA 1JZDA 1FW1A 1E6BA 1XZOA 4CW9A 1YEPA 3EMPA 5D8IA 3TDGA 5J41A 3GYKA 4TR3A 4KUNA 3TJBA 1Y6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZIL A;  1C72 A;  12GS A;  3HJP A;  4JBB A;  1WMJ A;  2O87 A;  5J4U A;  4GF0 A;  1EV4 A;  1ERW A;  1XXU A;  4KB3 A;  3ERW A;  3A2X A;  3ZFB A;  1V2A A;  2CT6 A;  2TRX A;  2MMN A;  5DAK A;  3GRX A;  1FVJ A;  2C0F A;  4N30 A;  2H1D A;  1R26 A;  1QMV A;  2DJ0 A;  1XOA A;  4F0B A;  4FYU A;  3VI7 A;  3QMX A;  5CAX A;  1MD3 A;  2I1U A;  2J23 A;  19GS A;  2O8V B;  3M8N A;  5F07 A;  3ZMK A;  1XIY A;  5ECL B;  6GSW A;  3HVV A;  4LMW A;  1KTE A;  3QFB C;  1T1V A;  5IO2 A;  2YJH A;  2CZ3 A;  1AUC A;  5GAN D;  1QFN A;  4OCF A;  2GTU A;  2QSI A;  1PX7 A;  4MK3 A;  2V6K A;  2Z9S A;  4GTU A;  4EDY A;  1ERV A;  2C3T A;  3I9V 2;  1GSU A;  4X1U A;  1K0A A;  5JWQ B;  4POM A;  3G7I A;  1A2J A;  2N5F A;  1ZYE A;  2WB9 A;  1A2M A;  3MDK A;  2B3S A;  4RQX A;  3UAR A;  5HFI A;  1ACV A;  2FGX A;  4OO4 A;  3IAS 2;  2I4A A;  3TB2 A;  1XW6 A;  3GSS A;  1WJK A;  5JWR B;  5DAK B;  1VGL A;  3TJJ A;  3Q6O A;  2C1Y A;  1UA5 A;  1NHY A;  4K0G A;  1GTI A;  1R5P A;  3G7Y A;  3IK7 A;  3OR5 A;  4KCA A;  3WGX A;  1TRS A;  4O92 A;  4JU5 A;  5EPF A;  2L6D A;  1Z5Y E;  1TRW A;  1EWX A;  3GKN A;  1VRS D;  1B48 A;  3TRP A;  2AJQ B;  3ERF A;  5J9C A;  5GSS A;  1U3I A;  4MH3 A;  2F8A A;  3GX8 A;  1YKC A;  1XWG A;  1XVQ A;  5INY A;  3EYT A;  1JLV A;  5F05 A;  4ECC A;  3ZYW A;  1V58 A;  2B7J A;  4PNF A;  5D9W A;  3ED3 A;  1R7H A;  1GH2 A;  4EDZ A;  1ON4 A;  4MPF A;  1J08 A;  5G5E A;  1M99 A;  5L71 A;  2F9S A;  1GUH A;  1A8L A;  2DJK A;  2EIQ A;  1UN2 A;  4O7H A;  1K0D A;  4IN0 A;  1TP9 A;  3EU3 A;  3VUR A;  3QCP A;  2RUF A;  2VIM A;  4F0C A;  5LNK e;  1SD9 A;  4HU9 A;  4ILF A;  1O7U A;  2FY6 A;  5E4W A;  1OKD A;  2J9H A;  3M9K A;  5IPG A;  5FT3 A;  4IHU A;  2DJ2 A;  3HJM A;  4GCI A;  3GUR A;  4MJC A;  1J0F A;  1GUM A;  1W4V A;  2V6O A;  3C8E A;  4OO5 A;  6GSX A;  5IOW A;  2IMI A;  1T00 A;  4LMV A;  5D73 A;  3A2W A;  3R2Q A;  2IMF A;  2P5Q A;  2V1M A;  4KDX A;  3HYP A;  2LV3 A;  4TW5 A;  3IXR A;  1MD4 A;  5AIS A;  1SKS B;  4BPY A;  3KMN A;  1MDK A;  2DJ3 A;  1BAY A;  2K9F A;  2V32 A;  4O5R A;  4ZBB A;  3APS A;  2H74 A;  10GS A;  3US3 A;  2LRT A;  2KUC A;  3D4T A;  2B6M A;  2WJU A;  1HNA A;  4MJA A;  1H75 A;  3LWA A;  3CSI A;  3N9J A;  4WBR D;  2NBS A;  2A2R A;  1XVW A;  4JE1 A;  2DJ1 A;  1F6M C;  1JLW A;  2LJA A;  3EIN A;  2XPE A;  3UL3 A;  1VF3 A;  3WYW A;  3F6F A;  1MTC A;  1KBN A;  3Q18 A;  1O8W A;  5D9T A;  4EKZ A;  5ELA A;  1SYR A;  4Q5N A;  3KH9 A;  2K6V A;  1DE1 A;  4PXO A;  2ON7 A;  4OFN A;  3C73 A;  2F51 A;  1ZL9 A;  3P7X A;  3HD5 A;  3RAZ A;  1U6T A;  1GSD A;  5A5K A;  3ZLP A;  4PUR A;  1XFL A;  2GZZ A;  1E2Y A;  3F4R A;  3LXZ A;  4CDO A;  2CQ9 A;  5ECP B;  2LJR A;  3QDN A;  1GL8 A;  3ZIV A;  5C04 A;  1LJR A;  2OBI A;  3I6A A;  2GZY A;  1M2D A;  5HR1 A;  4WKW A;  2AAW A;  1O73 A;  5H5R A;  2F3M A;  1ZGN A;  4MCU A;  1CQG A;  4POL A;  3DIE A;  4IW9 A;  3GHA A;  4TXO A;  4OD7 A;  2XBQ A;  4XS1 A;  1R4W A;  2HE3 A;  1PX6 A;  3GTU A;  4BVY A;  2ZUP A;  2KOK A;  4MDC A;  3F4T A;  1OC8 A;  3HJO A;  2H19 A;  4K0N A;  5DVB A;  2PWJ A;  3QAW A;  1YF0 A;  4MLY A;  1PRX A;  1TTZ A;  3FR6 A;  2CZ2 A;  1R5A A;  5ECN B;  4ML1 A;  3VPQ A;  1YDK A;  3Q74 A;  4MF7 A;  3TCO A;  1M9A A;  4GSN A;  2JAC A;  4LL1 B;  1TJD A;  3D0Z A;  1A8Y A;  2ALB A;  4WET A;  3F4S A;  4N10 A;  3VLN A;  2NTO A;  1OVN A;  2PGT A;  2IWT A;  3ZVJ D;  1BQ7 A;  1PN9 A;  3GIX A;  1GSQ A;  3FZ9 A;  1PL2 A;  5D96 A;  2TIR A;  2VM2 A;  3FZ5 A;  4OFM A;  2C0G A;  2GQK A;  18GS A;  1ERT A;  3LXT A;  1FOV A;  1PSQ A;  1EGO A;  5KN1 A;  3P90 A;  3IE3 A;  1O8X A;  2CX4 A;  3O76 A;  3BCK A;  5CRE A;  3E0U A;  5H5S A;  1QGV A;  2R6K A;  3C1R A;  3HZ8 A;  5KEJ A;  5DJM A;  1TK0 B;  3L9V A;  2HI7 A;  4ZB6 A;  2WRT A;  2I3Y A;  3I43 A;  2H1A A;  2FA4 A;  3D6I A;  1TU8 A;  4KX4 A;  1DSB A;  3DXB A;  1YJ6 A;  2DBC A;  1BX9 A;  4TXO B;  3IPZ A;  2X8C A;  4RUV A;  3GTU B;  1JZO A;  1G0T A;  2FWG A;  4WXT A;  2FCH A;  2B5X A;  4I2U A;  4FYC A;  4KSO A;  2K18 A;  1SEN A;  4IS0 A;  1EP7 A;  3WT1 A;  2VLT A;  2H0I A;  2C4J A;  3PIN A;  1AAZ A;  3KD0 A;  2REM A;  4L0U A;  1HYU A;  2C3Q A;  4ECI A;  3ZRD A;  1LBK A;  3RHC A;  3MSZ A;  1BYE A;  3IBH A;  1QQ2 A;  3UIW A;  3ZL5 A;  4IEL A;  1A0F A;  3FW2 A;  2ON5 A;  4HU7 A;  5CRG A;  5IQY A;  3GA4 A;  4KCE A;  2L57 A;  3ZRE A;  1G7E A;  2VCT A;  1MEK A;  2E2M A;  4ZL7 A;  1GTU A;  5AIX A;  4J56 E;  4IJI A;  1AQV A;  4ID0 A;  1BG5 A;  4JRR A;  1T4Z A;  2NPB A;  4GWR A;  3A2V A;  4V1A p;  5B8B A;  5HQP A;  3D5J A;  3HDC A;  4K8M A;  4KW6 A;  2PUK C;  3FR9 A;  4JED A;  2CAI A;  2JSZ A;  3SWL A;  4IQ1 A;  4MAB A;  3IC4 A;  1ZZY A;  1F3A A;  2H72 A;  3CMI A;  3LQ7 A;  1VF4 A;  2H73 A;  5IM9 A;  4LL4 B;  1SU9 A;  1K3Y A;  4MF5 A;  3TKQ A;  4YQV A;  1FG4 A;  1Z9H A;  2OAD A;  3G9B A;  3FZA A;  2MMO A;  5COH A;  1Q4J A;  1M9B A;  4TOP A;  1N8J A;  2LTK A;  2C0E A;  2PPT A;  2LRN A;  3CSJ A;  4YQM A;  3TRQ A;  4X43 A;  3TRX A;  1OYJ A;  4XTS A;  2IPA A;  5J9B A;  2YPM A;  5A4V A;  2IJY A;  2MYG A;  4DSR A;  2IMK A;  3ERG A;  4MF6 A;  4K2D A;  5FHI A;  3KCM A;  4ZXG A;  2O89 A;  3EE2 A;  1WPI A;  2EIR A;  2BJX A;  5IPH A;  3Q19 A;  2RM5 A;  1SK2 A;  1YKA A;  1UC7 A;  2OE1 A;  1XWK A;  4QQ7 A;  3GX0 A;  3BOA A;  5IOX A;  1YY7 A;  3ZFL A;  2HYX A;  4L8E A;  2YZU A;  3D22 A;  2K8S A;  2VCW A;  1KNG A;  4HI7 A;  3MAK A;  2KLX A;  2DIZ A;  4V2M A;  3GKM A;  3RHB A;  1CQH A;  3QAV A;  4KA0 A;  4N0Z A;  4AGS A;  5CNW A;  2ZCT A;  4ZL8 A;  1USB A;  5IMA A;  4DEJ A;  3WGD A;  3D4M A;  4I2T A;  1MDI A;  3DVW A;  3EVI A;  3FR3 A;  2VM1 A;  4IBP A;  1QK8 A;  1ML6 A;  1JZW A;  3M3M A;  3DML A;  4N11 A;  1WIK A;  3W8J A;  5CYY A;  5IIZ A;  3U5R E;  2AYT A;  1YZX A;  2VD1 A;  2H1G A;  5CRD A;  1SYX A;  5ECH B;  3TOU A;  2OBK A;  1T8E B;  1OAZ A;  3EC3 A;  2LS5 A;  2C3N A;  2D2Z A;  4NV2 A;  3ZIJ A;  1X9M B;  3HKR A;  4QL7 A;  3MNG A;  2QC7 A;  4KDU A;  4D73 A;  2L5O A;  3ZIT A;  2JSY A;  2RII A;  1FO5 A;  3UVT A;  3F63 A;  1XOB A;  4G9H A;  2R2J A;  5DAL A;  3QFA C;  2YCD A;  4YAV A;  4HZ2 A;  2V41 A;  2DMM A;  2JL4 A;  3KGK A;  4MZC A;  1GRX A;  1H4O A;  1PL1 A;  2A2S A;  4MPG A;  1DBY A;  2IMD A;  4G10 A;  3P2A A;  2X99 A;  1BJX A;  5DJL A;  2FUG 2;  2L59 A;  4ULX A;  2H6Z A;  2HRN A;  3HA9 A;  2YV7 A;  2TRC P;  4JR4 A;  3F9U A;  5HFG A;  1FHE A;  5IMF A;  2MZC A;  5AN1 A;  5E59 A;  2OAC A;  1A24 A;  3L0H A;  5ECM B;  3L78 A;  3L9S A;  1AQX A;  3LOR A;  3D21 A;  3F6D A;  2MMZ A;  2CVK A;  5F0G A;  4HJM A;  3PH9 A;  4OMV A;  4K7N A;  4RI6 A;  1HD2 A;  3UJ1 A;  3FZ4 A;  2H0H A;  2L4Q A;  3WGE A;  4N0V A;  1ZMA A;  4V1A g;  1SJ6 A;  4FH8 A;  3SBC A;  3GH6 A;  3ZML A;  3EWL A;  2V2G A;  2H01 A;  2VLU A;  2B5E A;  2OA7 A;  4D73 B;  1K0B A;  22GS A;  5IMV A;  1A23 A;  3WT2 A;  4NWY A;  4AJ7 A;  2YWO A;  3H93 A;  1SKW B;  3GL5 A;  5DAL B;  5ECO B;  3NZN A;  3FY7 A;  5B8A A;  4KAE A;  1TXX A;  3GUS A;  2QGV A;  1XBS A;  3FRC A;  1TU7 A;  4PGT A;  3O3T A;  3RPP A;  2GZP A;  1QUW A;  2VL2 A;  3GFK A;  4F82 A;  1YQ1 A;  3NIV A;  2FNO A;  1SL2 B;  3CTG A;  3WD6 A;  5CRH A;  4HQS A;  1QXH A;  1LU4 A;  3CRT A;  3APQ A;  3J7Y k;  1TOF A;  4OFT A;  1AW9 A;  2CVD A;  3W8S A;  4J57 E;  2DJJ A;  4MMM A;  4IP6 A;  3CTF A;  5EY6 A;  1OE7 A;  4L5O A;  2VO4 A;  4MZB A;  8GSS A;  4YAP A;  4KND A;  4EC0 A;  5F06 A;  2JZR A;  5CO3 A;  2H30 A;  5ECK B;  4BWS A;  4TR1 A;  3C7M A;  3M0F A;  1F3B A;  3HXS A;  4YQU A;  2N5B A;  5G30 A;  4MJE A;  1GUK A;  3TJG A;  2EC4 A;  1GLQ A;  2A4V A;  2YWI A;  4K9Z A;  2AV4 A;  2VCX A;  3RDW A;  1B9Y C;  3GKK A;  5GST A;  4LA1 A;  6GSV A;  3UVH A;  1ZOF A;  6GSU A;  2R5G A;  3DEX A;  1A2L A;  1F37 A;  2JAD A;  1OC9 A;  2PU9 C;  4KSM A;  2GT5 A;  5F8B A;  3VPT A;  4GST A;  5D93 A;  1DE2 A;  5DCG A;  2QKE A;  1OKT A;  2DML A;  2E7P A;  3KIJ A;  5B7C A;  5ELG A;  3QOU A;  1TKD B;  1YF1 A;  2HLS A;  2HZE A;  2VAF A;  1S3A A;  2GT6 A;  5JCU A;  4NHW A;  2F8F A;  4DSS A;  4FIW A;  5J3R A;  1B4Q A;  4NMU A;  4QL9 A;  2VLV A;  1GTB A;  1EP8 A;  2VCQ A;  1K0C A;  1NW2 A;  4H86 A;  5LD0 A;  3JCM L;  3A5W A;  5HR2 A;  3TKS A;  3KTL A;  6GSS A;  3DWV A;  4HZ4 A;  3FEU A;  5ECI B;  2C8U A;  2WS2 A;  3GNJ A;  1RK4 A;  4KGI A;  4TR1 B;  2FLS A;  4WEY A;  4WR4 A;  2IFQ A;  4XIH A;  4F9Z A;  4TR0 A;  17GS A;  2R3X A;  5C00 A;  3DD3 A;  3GH9 A;  5DQY A;  1THO A;  3L4N A;  4G2E A;  2LUS A;  3E3E A;  3PR8 A;  1I9D A;  3VWU A;  2L5L A;  2OE3 A;  1XCC A;  4IKH A;  4K7O A;  1OC9 B;  2B5Y A;  4RI7 A;  4TKY A;  3UAP A;  2IN3 A;  4KDY A;  2NDO A;  3KXO A;  3KJY A;  3FHK A;  2PN8 A;  4TXV A;  1AC1 A;  4IGJ A;  3QPM A;  5ECS A;  5IMZ A;  4WR5 A;  3UMA A;  4NXI A;  3G7J A;  4CHS A;  1V40 A;  2LNT A;  4WF5 A;  5G2Z A;  2GSQ A;  3KP9 A;  2B1L A;  3UBK A;  2HZE B;  3N5O A;  5HR3 A;  4L5L A;  2K8V A;  4AF2 A;  4TVE A;  1ILO A;  3FYG A;  3HVS A;  1PQN A;  1TI3 A;  1F2E A;  1GSS A;  3F8U A;  4DSS B;  3GMF A;  1TK8 B;  2RLI A;  1TDI A;  4KH7 A;  1HNC A;  2HFD A;  5ECR B;  2LJK A;  4AJ6 A;  1THX A;  3IRA A;  3DYR A;  2NVL A;  2L4C A;  4F03 A;  2HXK A;  4GLT A;  1PKZ A;  3GST A;  4J2F A;  3VI5 A;  1SL1 B;  3CBU A;  3RBT A;  4ZBA A;  4PUA A;  4G19 A;  3QR6 A;  5FWG A;  2O7K A;  1Z7R A;  3HY2 A;  3H4K A;  2IFQ B;  2LKU A;  5IO0 A;  3DVX A;  4PQ1 A;  2C80 A;  2X8G A;  1W89 A;  4EF0 A;  5EVO A;  3BJ5 A;  3IV4 A;  1PKW A;  1OE8 A;  4YH2 A;  3GKX A;  4EO3 A;  2H66 A;  4XRD A;  5H5Q A;  4K7I A;  1XPV A;  2DSA A;  1IYI A;  4MP4 A;  4V2L A;  2E0Q A;  1Y25 A;  3CSH A;  5HFK A;  4MJB A;  3DGQ A;  4K6X A;  1TRU A;  1BED A;  2JZS A;  2KP1 A;  2GGT A;  4WBJ A;  2CVB A;  1T4Y A;  2O85 A;  3CXG A;  3IA1 A;  2VCV A;  3LSZ A;  4TN8 A;  4GQF A;  5DDL A;  2X8H A;  2OKA A;  5G1L A;  3C71 A;  2R4V A;  3TKR A;  2YWN A;  2EIO A;  1KEB A;  2H71 A;  1K0O A;  2H76 A;  3KMO A;  1M0U A;  4ZB9 A;  2H75 A;  2GS3 A;  1GNW A;  4ML6 A;  1GNE A;  1U88 A;  1Z6N A;  1GUL A;  3MWH A;  2LEG A;  4HUA A;  5ENU A;  1NM3 A;  4V2N A;  1X9S B;  2KHP A;  2P31 A;  2XC2 A;  1K3L A;  1I5G A;  2B7K A;  2GSS A;  1EOH A;  3F0I A;  3UBL A;  3HVX A;  4ECB A;  3M1G A;  1FB0 A;  5ID2 A;  2IY2 A;  4XRA A;  1K0M A;  1N2A A;  4OWY A;  4PNG A;  11GS A;  1O81 A;  5KN2 A;  3P8W A;  1M2A A;  5DCH A;  4NPB A;  4K1F A;  2BTO T;  1G7O A;  3NOF A;  2CA8 A;  2I9H A;  1SK1 A;  4POK A;  4E8E A;  2VL3 A;  3TKP A;  4ZL9 A;  4JZQ A;  1EV9 A;  4ACS A;  4EUY A;  3H1N A;  4EVM A;  3VK9 A;  2IIY A;  2H0G A;  1K3O A;  9GSS A;  1SJZ A;  1HNB A;  1X9W B;  3ISO A;  1V98 A;  4XS6 A;  5KN0 A;  4HQZ A;  1ZYQ B;  2YN1 A;  3I69 A;  1X0R A;  2HRF A;  5J5N A;  3VFI A;  1PD2 1;  3KZQ A;  1Z6M A;  2PVO C;  2H1B A;  2VL9 A;  2GLR A;  1EOG A;  6GSY A;  4FYB A;  5D9X A;  2M46 A;  4XCS A;  3EUR A;  2HT9 A;  2YNX A;  2C0D A;  5JCG A;  3RPN A;  2R37 A;  5AGY A;  2H6X A;  2GVP A;  4Z7X A;  5ID2 B;  1AXD A;  1ZCP A;  3IOS A;  4Q5R A;  1WP0 A;  1XWA A;  2FWE A;  4MZW A;  4XHM A;  2HNL A;  3W6G A;  1WOU A;  4MA9 A;  4P3Y B;  3DKS A;  3LG6 A;  2YV9 A;  2H8L A;  2IYJ A;  5HR0 A;  5IMC A;  4BVX A;  4ISD A;  3ZVJ A;  2WGR A;  1MDJ A;  4BWQ A;  2LQO A;  4RQR A;  2HZF A;  4EXJ A;  4KE3 A;  4Q5Q A;  1DUG A;  1J9B A;  3K8N A;  5G1K A;  3ME8 A;  1O85 A;  5DQS A;  2AHE A;  3BD2 A;  1FB6 A;  1PMT A;  1G6W A;  2AB6 A;  1SL0 B;  4TRX A;  2IL3 A;  4F2I A;  13GS A;  4NV5 A;  1EZK A;  5KN3 A;  4GQC A;  4NAX A;  4PQI A;  4DVC A;  1XW5 A;  3BBY A;  5EL8 A;  2DIY A;  2RUE A;  5AIV A;  2YP6 A;  2CAQ A;  1M2B A;  1RW1 A;  4BL7 A;  3A3T A;  4NHZ A;  5B6N A;  2DC5 A;  2MMA A;  3HZ4 A;  3V1W A;  1X5D A;  3L9U A;  1K0N A;  2LQQ A;  1S3D A;  3APO A;  3IAM 2;  5D9V A;  1FVK A;  2OE0 A;  2VD0 A;  4HDE A;  4I5Q A;  2I81 A;  1GTA A;  3GN3 A;  2PER A;  2P5R A;  5CP1 A;  5ECQ B;  1TRV A;  3U6V A;  1A0R P;  2YZH A;  5ABR A;  1F9M A;  1PGT A;  2FA8 A;  1PA3 A;  2L6C A;  1M7T A;  3IR4 A;  3TJK A;  1URM A;  3KM6 A;  2WDU A;  1TI1 A;  3TJF A;  4FO5 A;  3FKF A;  3KP8 A;  3F3Q A;  2VUP A;  3CYN A;  4TR4 A;  3TGZ A;  4PX1 A;  4AJ8 A;  20GS A;  1GWC A;  2ZNM A;  2XHF A;  5GAP D;  2KP2 A;  5IMD A;  3O6T A;  1JZR A;  3VWW A;  3LFL A;  2LNS A;  2XPD A;  1GSE A;  2GQL A;  1ERU A;  2JU5 A;  4XS4 A;  1G6Y A;  3S9F A;  4O32 A;  4JR6 A;  2BMX A;  2WFC A;  1SK0 A;  2CX3 A;  2LRC A;  1TK5 B;  1UVZ A;  2MBT A;  2YAN A;  4I8B A;  5A4W A;  4X0X A;  2E2G A;  3M9J A;  1IYH A;  1AIU A;  1Q98 A;  3GV1 A;  2CV4 A;  2YJ7 A;  4OCE A;  2M72 A;  4DSQ A;  1VF1 A;  1ST9 A;  2B1K A;  3QAG A;  5G31 A;  1U87 A;  5B6M A;  2WUL A;  2GSR A;  2M80 A;  2RM6 A;  4ECJ A;  3F3R A;  4POB A;  3AY8 A;  3ME7 A;  4IQA A;  3TOT A;  16GS A;  1EEM A;  3UOM A;  4I6X A;  1V57 A;  1OC3 A;  1WRY A;  2P0G A;  1FAA A;  3KTB A;  3UEM A;  3HCZ A;  2H70 A;  3TUE A;  3LYP A;  1TW9 A;  2G2Q A;  1B4P A;  2MBS A;  4I97 A;  4Q5F A;  2VL2 C;  5JWO B;  2FD3 A;  4ZB8 A;  2X64 A;  2HSH A;  4IJ3 A;  4ZIJ A;  4BA7 A;  4GRF A;  2LST A;  4HEA 2;  1XWB A;  1SJI A;  3H79 A;  2ES7 A;  3E9J B;  3IHQ A;  1B9X C;  3LGC A;  1GSY A;  3EMX A;  4HS1 A;  6GST A;  1O6J A;  5DBQ A;  4XS4 B;  1JHB A;  4LLR A;  2PVQ A;  1WWJ A;  1X5E A;  2DLX A;  2GQM A;  1T3B A;  2GDR A;  1U3A A;  1Z7P A;  4WF4 A;  3C1S A;  3ZZX A;  4L0W A;  2WCI A;  3PGT A;  3ZTL A;  1JFU A;  4E8H A;  4GSS A;  4HOJ A;  2PMT A;  5CRW A;  1T7P B;  14GS A;  2YWM A;  4PUF C;  2FHE A;  3GL3 A;  5G5F A;  3DRN A;  2VOC A;  1EEJ A;  1V9W A;  1GP1 A;  1NSW A;  1GSF A;  2IME A;  3VWV A;  1AQW A;  2VCZ A;  1NHO A;  1WE0 A;  2HSY A;  2JZT A;  3BCI A;  3FK8 A;  1SKR B;  1B8X A;  4EE0 A;  2XBI A;  1HQO A;  3TKS E;  2PBJ A;  4IVF A;  1SD8 A;  2G0F A;  2GST A;  1S3C A;  4IP1 A;  3CRU A;  3J7Y b;  2AUV A;  1XW9 A;  2FWH A;  2H6Y A;  1Z3E A;  3EU4 A;  2YOI A;  3VWX A;  2N5A A;  3LYK A;  5GZZ B;  1EGR A;  3KEB A;  7GSS A;  3HHV A;  1X5C A;  1GLP A;  5LCZ A;  4HJ2 A;  3IDV A;  3KH7 A;  4GXZ A;  2FWF A;  1ABA A;  3H8Q A;  3IK9 A;  3LEF A;  2WZ9 A;  4EL1 A;  4PQH A;  5A4U A;  4MH2 A;  3QD9 A;  5JCW A;  1RQM A;  1YEX A;  3TKS C;  4ZBD A;  2OJL A;  1XWC A;  1VF2 A;  3LJR A;  1JZD A;  1FW1 A;  1E6B A;  1XZO A;  4CW9 A;  1YEP A;  3EMP A;  5D8I A;  3TDG A;  5J41 A;  3GYK A;  4TR3 A;  4KUN A;  3TJB A;  1Y6E A; 
#chains in the Genus database with same CATH topology
 4ZIL A;  3N9H A;  1C72 A;  12GS A;  3HJP A;  4JBB A;  1WMJ A;  2O87 A;  5J4U A;  4GF0 A;  1EV4 A;  3S5C A;  1ERW A;  1XXU A;  3F9S A;  4KB3 A;  3ERW A;  3A2X A;  3ZFB A;  1QMA A;  1V2A A;  2CT6 A;  2TRX A;  1RGF A;  2MMN A;  5DAK A;  3GRX A;  3X40 A;  3HVN A;  3R3E A;  1FVJ A;  2C0F A;  4I4K A;  2KAA A;  1AY7 A;  4N30 A;  5LC7 A;  4R9L A;  2H1D A;  1BSB A;  1I2G A;  4XB5 A;  1R26 A;  1IQY A;  1QMV A;  2DJ0 A;  1XOA A;  4F0B A;  4FYU A;  3VI7 A;  3QMX A;  3Q90 A;  5AIH A;  2X49 A;  1T5Y A;  5CAX A;  4FQU A;  1MD3 A;  2I1U A;  2J23 A;  1RTU A;  19GS A;  2O8V B;  3M8N A;  5F07 A;  3ZMK A;  1XIY A;  1CQS A;  1C7H A;  5ECL B;  6GSW A;  1FGQ A;  3HVV A;  2GXF A;  4BTY A;  4LMW A;  4FCZ A;  1A2V A;  1KTE A;  3QFB C;  1T1V A;  5IO2 A;  1PFP A;  2YJH A;  3JUN A;  4X4J A;  2W6J H;  2CZ3 A;  1ASK A;  3VGN A;  1AUC A;  5GAN D;  3UB1 A;  3MYT A;  5CF1 A;  1QFN A;  4OCF A;  4DKI A;  2GTU A;  2QSI A;  4HZB B;  2L1S A;  1PX7 A;  5IEO A;  5IG0 A;  4MK3 A;  4ZM8 A;  2V6K A;  2Z9S A;  4GTU A;  1DE3 A;  4EDY A;  1ERV A;  2C3T A;  3I9V 2;  2GEX A;  2XR8 B;  1GSU A;  4X1U A;  1K0A A;  5JWQ B;  4POM A;  3G7I A;  2CH9 A;  1O7N B;  1A2J A;  2N5F A;  1ZYE A;  2WB9 A;  1A2M A;  3MDK A;  1LOW A;  1TTO A;  2B3S A;  4RQX A;  3UAR A;  5HFI A;  1ACV A;  3FF0 A;  2ML6 A;  3BNE A;  2FGX A;  1MWS A;  5D82 A;  2I4A A;  3IAS 2;  4OO4 A;  3TB2 A;  1XW6 A;  5BMU A;  3GSS A;  1WJK A;  1VQK 3;  3Q1C A;  1NJI 4;  2D1W A;  5JWR B;  5DAK B;  2CKF B;  1VGL A;  3F8X A;  3TJJ A;  1TP6 A;  3Q6O A;  2C1Y A;  1UA5 A;  1NHY A;  2HMO B;  2F56 A;  2W56 A;  2CFW A;  1ZGX A;  4K0G A;  1GTI A;  5KOW A;  1R5P A;  4XDW A;  3G7Y A;  2XF3 A;  3IK7 A;  3LXU X;  3OR5 A;  4KCA A;  3WGX A;  1TRS A;  1W7C A;  4O92 A;  3AGO A;  1RGK A;  1HZ1 A;  4JU5 A;  4EW5 A;  3CCE 3;  3FG1 A;  3F7X A;  5EPF A;  2L6D A;  4O8S A;  4MJD A;  1Z5Y E;  4OUQ A;  1EWX A;  1TRW A;  1VRS D;  3GKN A;  1B48 A;  3TRP A;  2AJQ B;  3ERF A;  5J9C A;  2C4B A;  2CW9 A;  5GSS A;  1U3I A;  4MH3 A;  4K61 A;  5IEP A;  2F8A A;  3GX8 A;  1YKC A;  1XWG A;  1XVQ A;  5INY A;  2BIR A;  1W00 A;  3BNB A;  4USS A;  3EYT A;  1JLV A;  5F05 A;  1I3I A;  4ECC A;  3ZYW A;  4HM1 B;  1V58 A;  2B7J A;  4PNF A;  5D9W A;  1C54 A;  1R7H A;  3ED3 A;  3FZW A;  5CLK A;  1GH2 A;  4EDZ A;  2JQ5 A;  1ON4 A;  1RN7 A;  4MPF A;  1J08 A;  5G5E A;  1M99 A;  5L71 A;  2F9S A;  3S29 A;  2DKH A;  1GUH A;  1A8L A;  2DJK A;  2EIQ A;  1UN2 A;  4O7H A;  1K0D A;  4IN0 A;  1TP9 A;  3EU3 A;  3PYJ A;  3VUR A;  3QCP A;  3N54 B;  2RUF A;  1YVS A;  2VIM A;  4F0C A;  4Z2T A;  5LNK e;  1VQN 3;  1SD9 A;  4HU9 A;  4ILF A;  4QWT A;  3PXM A;  1O7U A;  2FY6 A;  5E4W A;  1BNJ A;  1OKD A;  1OHP A;  1MGW A;  2J9H A;  3M9K A;  1T2I A;  5M19 A;  5IPG A;  5FT3 A;  4IHU A;  4BL3 A;  2DJ2 A;  3HJM A;  6STD A;  4GCI A;  3GUR A;  4MJC A;  1J0F A;  2HRK A;  1PYL A;  1GUM A;  1W4V A;  2V6O A;  1RGE A;  3LZA A;  3C8E A;  4OO5 A;  6GSX A;  1RJO A;  1BUQ A;  2W56 B;  5IOW A;  4XBY A;  2IMI A;  2ZDJ A;  1N8Q A;  3F8H A;  1ISK A;  1T00 A;  4LMV A;  5D73 A;  3A2W A;  3R2Q A;  1A2P A;  2IMF A;  1PY3 A;  2P5Q A;  1JBS A;  2YFI B;  1RGA A;  2V1M A;  4KDX A;  2MF7 A;  3HYP A;  4NHF A;  2LV3 A;  4TW5 A;  3IXR A;  1MD4 A;  5AIS A;  1SKS B;  1UI7 A;  4GB5 A;  4H61 A;  4BPY A;  1J2B A;  3KMN A;  1VQ5 3;  1MDK A;  2DJ3 A;  3GZB A;  1BAY A;  2K9F A;  1YJN 3;  2V32 A;  4O5R A;  4ZBB A;  3OWY A;  4NRE A;  3APS A;  4JRF A;  2H74 A;  10GS A;  4RZM A;  3US3 A;  2LRT A;  2KUC A;  3D4T A;  2B6M A;  3LT9 A;  2WJU A;  1HNA A;  4MJA A;  1MWT A;  5KP3 A;  1H75 A;  3FSD A;  3LWA A;  3CSI A;  3N9J A;  3FMW A;  3CCU 3;  2UGI A;  4WBR D;  2NBS A;  3SED A;  2A2R A;  1XVW A;  4JE1 A;  2DJ1 A;  1KC8 4;  1F6M C;  1JLW A;  2LJA A;  3EIN A;  2XPE A;  1GMQ A;  2BU4 A;  3UL3 A;  5AEU B;  1VF3 A;  1UGI A;  3F6F A;  3WYW A;  1MTC A;  1KBN A;  3Q18 A;  1O8W A;  1R4C A;  3LTA A;  5D9T A;  1HYF A;  4EV5 A;  3CD6 3;  4EKZ A;  5ELA A;  1BVI A;  1SYR A;  3RGR A;  4Q5N A;  3KH9 A;  2K6V A;  1DE1 A;  3WA2 X;  1Q86 4;  1QVF 2;  4PXO A;  2ON7 A;  1N5P A;  3CNM A;  2CWV A;  4OFN A;  3C73 A;  2F51 A;  1IDP A;  4KVH A;  1ZL9 A;  1M1K 4;  3FH1 A;  3P7X A;  3HD5 A;  3RAZ A;  1U6T A;  1GSD A;  5A5K A;  3T0U A;  3ZLP A;  4PUR A;  1ULJ B;  1XFL A;  2GZZ A;  1Q40 A;  1Q7H A;  5FW5 A;  1E2Y A;  3F4R A;  3T8N A;  3LXZ A;  4CDO A;  2CQ9 A;  5ECP B;  2LJR A;  3QDN A;  1GL8 A;  3ZIV A;  1WQL B;  5C04 A;  1LJR A;  5BIR A;  3EQQ B;  2R0P A;  4TX4 A;  1AR0 A;  3FG4 A;  2OBI A;  3I55 3;  3I6A A;  3IC8 A;  4O02 B;  2GZY A;  5BRT A;  3HOH A;  1M2D A;  5HR1 A;  1K28 A;  3S67 A;  4WKW A;  2AAW A;  3T8U A;  3FKA A;  1O73 A;  5H5R A;  2F3M A;  1ZGN A;  4KF9 A;  4MCU A;  1CQG A;  4POL A;  3DIE A;  3GHA A;  4IW9 A;  4TXO A;  4OD7 A;  2XBQ A;  4XS1 A;  1R4W A;  2HE3 A;  1PX6 A;  3GTU A;  4BVY A;  2XSH B;  2ZUP A;  2KOK A;  2GBW B;  3F4T A;  4MDC A;  1OC8 A;  3HJO A;  2F5W A;  2H19 A;  4K0N A;  1OF5 A;  5DVB A;  2PWJ A;  3QAW A;  3EHC A;  1JB2 A;  2RGQ A;  1YF0 A;  4MLY A;  3OW2 2;  1KQS 2;  1PRX A;  1B3S A;  1TTZ A;  4RNY A;  3FR6 A;  2CZ2 A;  3JVC A;  2PZV A;  2V1L A;  2WOF A;  1R5A A;  5ECN B;  2ZHX B;  1JB4 A;  4ML1 A;  3VPQ A;  1YDK A;  3Q74 A;  4MF7 A;  3TCO A;  1M9A A;  1STF I;  4GSN A;  2JAC A;  4LL1 B;  1TJD A;  3OXA A;  3VSY A;  3D0Z A;  4PEJ A;  1A8Y A;  2ALB A;  2BO9 B;  1X1U A;  1VQL 3;  3F4S A;  4N10 A;  4WET A;  2SBL A;  3VLN A;  1RLS A;  2NTO A;  1OVN A;  2PGT A;  2IWT A;  2E2T A;  3ZVJ D;  1JN5 A;  4O5Q A;  1BQ7 A;  1PN9 A;  3GIX A;  1GSQ A;  2KRT A;  3FZ9 A;  1PL2 A;  5D96 A;  2TIR A;  2VM2 A;  1BNF A;  1VQ9 3;  3NQY A;  3FZ5 A;  5JPU A;  4FMD A;  4OFM A;  2C0G A;  2GQK A;  18GS A;  3EJV A;  1ERT A;  3LXT A;  1FOV A;  4FMB A;  1PSQ A;  1D6Z A;  5KN1 A;  1EGO A;  1Q40 B;  3A76 A;  3P90 A;  5AYR B;  3IE3 A;  1RHL A;  1O8X A;  2CX4 A;  3O76 A;  3KII A;  3BCK A;  5CRE A;  3E0U A;  5H5S A;  1QGV A;  2KF4 A;  2R6K A;  1FUS A;  3C1R A;  3RNT A;  3HZ8 A;  5KEJ A;  5DJM A;  1TK0 B;  3L9V A;  2HI7 A;  4ZB6 A;  2WRT A;  2I3Y A;  3I43 A;  4U13 A;  1GY5 A;  2F5M A;  2H1A A;  2FA4 A;  4O3V A;  3RGA A;  1TU8 A;  3D6I A;  1RKY A;  4KX4 A;  1DSB A;  3DXB A;  1YJ6 A;  2DBC A;  1BX9 A;  4TXO B;  3IPZ A;  2X8C A;  4RUV A;  3D9R A;  3GTU B;  1G0T A;  1JZO A;  2Y73 A;  4L8O A;  2FWG A;  4BVY B;  4WXT A;  2FCH A;  2B5X A;  4I2U A;  2SAR A;  4FYC A;  3LTC A;  3Q2P A;  4KSO A;  1NO3 A;  2W04 A;  2K18 A;  3D79 A;  1GMP A;  4K2X A;  1BRJ A;  1LOV A;  1SEN A;  1OF5 B;  1EP7 A;  4IS0 A;  3WT1 A;  5RNT A;  2VLT A;  2H0I A;  2C4J A;  3PIN A;  1AAZ A;  2RSX A;  3KD0 A;  4LMI A;  2REM A;  4L0U A;  1HYU A;  2C3Q A;  4ECI A;  3D3L A;  2B1X B;  3B7C A;  1AV4 A;  3ZRD A;  1LBK A;  3RHC A;  3MSZ A;  2UUG C;  1ZYP A;  1N5H A;  3V98 A;  1BYE A;  3IBH A;  1QQ2 A;  3UIW A;  3ZL5 A;  4IEL A;  1A0F A;  3FW2 A;  3CQF A;  2ON5 A;  4WHA A;  4HU7 A;  3KFQ C;  4KZ1 A;  1ZO2 A;  1UCI A;  5CRG A;  4R1K A;  5IQY A;  3WR2 A;  2D42 A;  4AEQ A;  1JN5 B;  3GA4 A;  4KCE A;  2L57 A;  3ZRE A;  4HM2 B;  1G7E A;  4N6U A;  1GSP A;  1W2Z A;  2VCT A;  1MEK A;  1BNI A;  2E2M A;  4ZL7 A;  3F7S A;  1GTU A;  3EC9 A;  5AIX A;  2RNT A;  4J56 E;  1W2B 2;  1BRI A;  1DMN A;  1UUW B;  4IJI A;  1AQV A;  4ID0 A;  3DGL A;  1BG5 A;  3WHO A;  4JRR A;  5D83 A;  4CDL A;  1T4Z A;  2NPB A;  4GWR A;  2RFR A;  3A2V A;  1X1W A;  4MMZ B;  4V1A p;  5B8B A;  2XSO B;  5HQP A;  3D5J A;  3HDC A;  4K8M A;  4KW6 A;  2PUK C;  1A2K A;  3FR9 A;  4JED A;  4YKF A;  2CAI A;  1GMR A;  1X1X A;  3DGM A;  2JSZ A;  3SWL A;  4IQ1 A;  4MAB A;  2OTJ 3;  3IC4 A;  1ZZY A;  1I0V A;  1F3A A;  2H72 A;  3CMI A;  3LQ7 A;  1VF4 A;  3ZG0 A;  2H73 A;  5IM9 A;  2HMJ B;  2O9U X;  2OOV C;  1SU9 A;  2HMK B;  1K3Y A;  4LL4 B;  4MF5 A;  3TKQ A;  3EE1 A;  4YQV A;  1FG4 A;  1Z9H A;  2OAD A;  1BNS A;  3G9B A;  3FZA A;  1IT7 A;  2MMO A;  4BIR A;  1M90 4;  4HM5 B;  1LNH A;  2CWU A;  1MWR A;  5COH A;  4FMC A;  1Q4J A;  1M9B A;  5A0O B;  2BHM A;  4TOP A;  1N8J A;  2LTK A;  2C0E A;  2PPT A;  1UW1 A;  2LRN A;  1W01 A;  3HK4 A;  3CSJ A;  4YQM A;  3TRQ A;  4X43 A;  3TRX A;  1LQM B;  4IT7 A;  1OYJ A;  4XTS A;  2IPA A;  1VQ7 3;  2CFD A;  4J5K A;  5J9B A;  2YPM A;  5A4V A;  2IJY A;  2MYG A;  4DSR A;  2IMK A;  3ERG A;  4MF6 A;  1N9J A;  4K2D A;  1XG8 A;  5FHI A;  3KCM A;  3X3Y A;  4ZXG A;  3LML A;  2O89 A;  1OCV A;  3EE2 A;  4PTS A;  1WPI A;  1JBT A;  2EIR A;  2BJX A;  5IPH A;  1YGE A;  3Q19 A;  4LYL B;  2RM5 A;  3CCQ 3;  1SK2 A;  1YKA A;  1UC7 A;  4K1U A;  3CMA 3;  2OE1 A;  1XWK A;  4QQ7 A;  3GX0 A;  1RDS A;  3BOA A;  5IOX A;  1YY7 A;  3ZFL A;  2HYX A;  2CX0 A;  4L8E A;  4CPK A;  3JUM A;  1I2F A;  2YZU A;  3D22 A;  2K8S A;  3GZY B;  2VCW A;  1OGX A;  1NDO B;  1DET A;  3F40 A;  1TFK A;  1KNG A;  4HI7 A;  3MAK A;  2KLX A;  3AGN A;  1A67 A;  2QGU A;  2DIZ A;  3MG3 A;  4V2M A;  4O2H A;  1GYB A;  3GKM A;  3RHB A;  1FGT A;  1CQH A;  3QAV A;  1W02 A;  3LYG A;  4KA0 A;  2MC8 A;  4N0Z A;  4AGS A;  4HKV B;  5CNW A;  3SYU A;  1YVB I;  2ZCT A;  4ZL8 A;  1USB A;  5IMA A;  1V74 A;  4EXR A;  4DEJ A;  3IPT A;  3WGD A;  4J5G A;  1RGL A;  2KF3 A;  3D4M A;  4I2T A;  1MDI A;  4HJL B;  3DVW A;  3EVI A;  3FR3 A;  2VM1 A;  4IBP A;  1QK8 A;  1ML6 A;  1AQZ A;  1JZW A;  3MPH A;  3M3M A;  3DML A;  4N11 A;  1WIK A;  3W8J A;  5CYY A;  5IIZ A;  3J7Y d;  3MIX A;  4L7K A;  3U5R E;  3PPU A;  2AYT A;  1YZX A;  3CC4 3;  4JF8 A;  2VD1 A;  2H1G A;  5CRD A;  1SYX A;  4LZI A;  5ECH B;  3NQZ A;  3TOU A;  4MMX B;  2OBK A;  5FGO A;  1T8E B;  1LQG C;  1E3R A;  1OAZ A;  4WP5 A;  1B21 A;  3EC3 A;  2LS5 A;  2C3N A;  2D2Z A;  4NV2 A;  3ZIJ A;  1X9M B;  3HKR A;  4QL7 A;  2F99 A;  1YJ9 3;  3MNG A;  5AIF A;  3F14 A;  3K7C A;  1JKG A;  2QC7 A;  4KDU A;  4OVM A;  4BL2 A;  1O7G B;  5CF2 A;  2W9Q A;  2L5O A;  3ZIT A;  4D73 A;  2JSY A;  2RII A;  1FO5 A;  3UVT A;  7RNT A;  3F63 A;  1EUI C;  3MKI A;  1XOB A;  3MG2 A;  1TFO A;  4G9H A;  1LNI A;  1O7H B;  2R2J A;  5DAL A;  3QFA C;  2YCD A;  4YAV A;  4HZ2 A;  2V41 A;  2DMM A;  2JL4 A;  3KGK A;  4MZC A;  1GRX A;  1H4O A;  6GSP A;  4G1M B;  1PL1 A;  2A2S A;  4MPG A;  1DBY A;  2IMD A;  4G10 A;  3P2A A;  2X99 A;  3EN8 A;  1BJX A;  5DJL A;  2QA1 A;  3U1W A;  2FUG 2;  2HRA A;  2L59 A;  4ULX A;  2H6Z A;  2HRN A;  3HA9 A;  1FUW A;  2CFK A;  2YV7 A;  2XRX B;  2TRC P;  4JR4 A;  3F9U A;  5HFG A;  1W6Y A;  3RDE A;  1FHE A;  1G02 A;  5IMF A;  3PGB A;  3AHW A;  2MZC A;  1UGH I;  2F98 A;  2OAC A;  5AN1 A;  5E59 A;  1OAC A;  1A24 A;  3L0H A;  4WWU C;  1DVC A;  4Z2R A;  5ECM B;  5IER A;  5AIG A;  3ALA A;  4EYC A;  3L78 A;  1Q7Y 4;  3L9S A;  1AQX A;  3LOR A;  3D21 A;  2Z7A A;  3F6D A;  4HAA A;  2CC3 A;  2MMZ A;  5DRV A;  2Q07 A;  1N8R 4;  2CVK A;  5F0G A;  3KCH A;  1IU7 A;  4HJM A;  3PH9 A;  4EBG A;  4OMV A;  3DM8 A;  4K7N A;  4RI6 A;  1HD2 A;  3UJ1 A;  3FZ4 A;  2H0H A;  2Z6B A;  1EA2 A;  1CH0 A;  2L4Q A;  3WGE A;  3A5E A;  4N0V A;  1ZMA A;  4V1A g;  1SJ6 A;  4FH8 A;  3SBC A;  3GH6 A;  3ZML A;  3EWL A;  2V2G A;  2H01 A;  2VLU A;  1JKG B;  3LT8 A;  5EVH A;  1RRH A;  2B5E A;  2OA7 A;  4D73 B;  1KSI A;  3SVA A;  1OH0 A;  1K0B A;  22GS A;  5IMV A;  1A23 A;  1IT8 A;  3WT2 A;  4NWY A;  3OX9 A;  4AJ7 A;  2YWO A;  3H93 A;  3EBT A;  1SKW B;  1BRH A;  2STD A;  3GL5 A;  4CY6 A;  5DAL B;  4HVN A;  5ECO B;  1BAN A;  3NZN A;  3FY7 A;  3GAX A;  1SII A;  5B8A A;  1YNV X;  3B4O A;  2CHC A;  2WO0 A;  4KAE A;  1TXX A;  3GUS A;  2IMJ A;  2QGV A;  2ZL8 A;  1XBS A;  2RCD A;  5HOH A;  3FRC A;  1TU7 A;  4PGT A;  3O3T A;  3RPP A;  3G0K A;  2PNC A;  2GZP A;  1QUW A;  2VL2 A;  3GFK A;  4F82 A;  1YQ1 A;  3NIV A;  2FNO A;  1CEW I;  2OQE A;  1EG9 B;  2XGN A;  1BRN L;  1SL2 B;  3CTG A;  3K0Z A;  3WD6 A;  1DMQ A;  1BGS A;  3CC7 3;  5CRH A;  4HQS A;  1QXH A;  1LU4 A;  3CRT A;  3APQ A;  1YHQ 3;  3J7Y k;  1QAF A;  1TOF A;  4OFT A;  1S72 3;  4HM7 B;  1AW9 A;  2CVD A;  3W8S A;  2JDI H;  3NHX A;  3I56 3;  4J57 E;  2DJJ A;  4MMM A;  4IP6 A;  2Z77 A;  3CTF A;  5EY6 A;  1OE7 A;  4L5O A;  2VO4 A;  1BSC A;  3I0Y A;  4MZB A;  2K3D A;  1IVW A;  4BU4 A;  8GSS A;  4YAP A;  1UCJ A;  5HGR A;  4HZ9 B;  4KND A;  4EC0 A;  1WNH A;  5F06 A;  2JZR A;  5CO3 A;  2H30 A;  1GY6 A;  1OPY A;  5ECK B;  4BWS A;  3UJM A;  5BU4 A;  4TR1 A;  1W6G A;  1PU4 A;  2WGQ A;  1BRG A;  3DUK A;  1AVK A;  3C7M A;  3D5I A;  2A15 A;  3M0F A;  2P0X A;  1E97 A;  1F3B A;  3HXS A;  1JJ2 2;  4YQU A;  2N5B A;  5G30 A;  1MOL A;  1K41 A;  2K54 A;  2WGO A;  1RGH A;  1AVL A;  4MJE A;  1GUK A;  3TJG A;  2EC4 A;  1GLQ A;  2I9W A;  1PFO A;  2A4V A;  2YWI A;  1Z1S A;  4K9Z A;  2AV4 A;  4IPB A;  2VCX A;  3RDW A;  1B9Y C;  3GKK A;  3KN4 A;  3KE7 A;  4HM3 B;  5GST A;  4LA1 A;  6GSV A;  3UVH A;  1ZOF A;  6GSU A;  1NB3 I;  2GU3 A;  2R5G A;  3DEX A;  1A2L A;  1OGZ A;  2XEP A;  1UUG B;  1F37 A;  2JAD A;  1OC9 A;  1BRS A;  2PU9 C;  3EX9 A;  3PS8 A;  1N9E A;  4EIQ A;  4KSM A;  9RNT A;  3UNL A;  1IVX A;  1NNV A;  5CK6 A;  2GT5 A;  5F8B A;  3DZL A;  3VPT A;  4GST A;  5D93 A;  1DE2 A;  1US1 A;  5DCG A;  3GZR A;  4WYK A;  2KCD A;  1Q9E A;  2QKE A;  1OKT A;  2DML A;  2R0C A;  2E7P A;  3KIJ A;  5B7C A;  5ELG A;  3QOU A;  1TKD B;  1YF1 A;  4AKZ A;  2HLS A;  2HZE A;  1FZU A;  2VAF A;  3G16 A;  3CXC 2;  1S3A A;  2GT6 A;  5JCU A;  4NHW A;  8RNT A;  5D81 A;  5BVB A;  2F8F A;  4DSS A;  4FIW A;  5J3R A;  3M8C A;  1B4Q A;  1IVV A;  2ML5 A;  2R0G A;  4NMU A;  4QL9 A;  2VLV A;  1GTB A;  1EP8 A;  1M1X B;  2VCQ A;  4XM4 A;  1K0C A;  1IVU A;  1BSA A;  1NW2 A;  4H86 A;  2FNQ A;  5LD0 A;  3JCM L;  3A5W A;  5HR2 A;  1KD1 4;  3TKS A;  1LXE A;  3KTL A;  6GSS A;  1M9G A;  3DWV A;  3BU4 A;  4HZ4 A;  4MMY B;  3FEU A;  1FOH A;  5ECI B;  2C8U A;  2WS2 A;  3GNJ A;  1RK4 A;  4KGI A;  2P0M A;  4TR1 B;  2FLS A;  4WEY A;  4WR4 A;  1ROV A;  2IFQ A;  3KSE D;  4R9K A;  4XIH A;  4F9Z A;  4TR0 A;  17GS A;  2R3X A;  5C00 A;  1QAK A;  3DD3 A;  3NV0 A;  3GH9 A;  5AEW B;  5DQY A;  1THO A;  3L4N A;  4G2E A;  3X41 A;  2E2V A;  2LUS A;  3E3E A;  1UCL A;  3PR8 A;  3HI7 A;  1TRQ A;  2BMQ B;  1I9D A;  2GU1 A;  1VQO 3;  3VWU A;  2L5L A;  2OE3 A;  5DRE A;  1RSN A;  1W4N A;  1XCC A;  4IKH A;  2IA7 A;  4K7O A;  1OC9 B;  2B5Y A;  4RI7 A;  4TKY A;  3UAP A;  2IN3 A;  4KDY A;  2E2U A;  2NDO A;  3KXO A;  2RBI A;  3GZX B;  2PN8 A;  3FHK A;  3KJY A;  4TXV A;  1AC1 A;  2BMO B;  5ELJ A;  4IGJ A;  3QPM A;  5ECS A;  5IG3 A;  1A90 A;  5IMZ A;  2KF6 A;  4WR5 A;  3UMA A;  4NXI A;  3G7J A;  4CHS A;  1V40 A;  2HML B;  2LNT A;  4WF5 A;  5G2Z A;  1QJG A;  2P05 A;  2GSQ A;  4WYK B;  5KP1 A;  3KP9 A;  3BB9 A;  2B1L A;  2KXG A;  3UBK A;  2HZE B;  3N5O A;  5HR3 A;  4L5L A;  2K8V A;  4AF2 A;  3CCL 3;  1VQP 3;  4TVE A;  1ILO A;  3FYG A;  1VQ4 3;  3HVS A;  1PQN A;  1X1Y A;  1TI3 A;  1F2E A;  1GSS A;  3F8U A;  4DSS B;  3GMF A;  4GHO A;  1RNB A;  1TK8 B;  1D6U A;  2RLI A;  1TDI A;  4KH7 A;  3AHS A;  1HNC A;  2HFD A;  1GOY A;  5ECR B;  2LJK A;  1E3V A;  4AJ6 A;  1THX A;  3IRA A;  3DYR A;  1RRL A;  2NVL A;  1O7W B;  2L4C A;  4F03 A;  2HXK A;  2IUK A;  2OTL 3;  4GLT A;  1PKZ A;  3GST A;  1DMM A;  4OK0 A;  1VQ8 3;  3Q3F A;  1LRA A;  2F4Y A;  4J2F A;  3VI5 A;  1SL1 B;  2UX0 A;  3CBU A;  3RBT A;  2A2P A;  4ZBA A;  4PUA A;  4G19 A;  3QR6 A;  5FWG A;  1LVN A;  5GSP A;  1Z7R A;  3GWR A;  2O7K A;  3H4K A;  3HY2 A;  2IFQ B;  3UL5 A;  2CG1 A;  2LKU A;  2YX9 A;  5IO0 A;  3DVX A;  4PQ1 A;  2QEX 3;  2YFJ B;  2C80 A;  1RMS A;  3PCS A;  1M3I A;  2X8G A;  1WMN A;  1W89 A;  4EF0 A;  2XH9 A;  4XBX A;  5EVO A;  1MNL A;  3NV0 B;  4N3V A;  3BJ5 A;  3IV4 A;  1VQM 3;  4HSC X;  1FGO A;  1PKW A;  1K73 4;  1BUJ A;  1OE8 A;  3ZFZ A;  4YH2 A;  1RN1 A;  3EN1 B;  3GKX A;  1I70 A;  4EO3 A;  3IMA B;  2H66 A;  4XRD A;  2LQV A;  5H5Q A;  4K7I A;  1CYU A;  4RNT A;  3LTD A;  1XPV A;  1MWU A;  1B2X A;  2DSA A;  4GL6 A;  1IYI A;  4FMA A;  4MP4 A;  4KFD A;  1QAL A;  1GOV A;  3L0R A;  2E0Q A;  4V2L A;  1Y25 A;  3CSH A;  5HFK A;  5CXO A;  4MJB A;  1ZYN A;  3DGQ A;  5AI1 A;  1ULI B;  4K6X A;  1ROA A;  2BMR B;  1TRU A;  1Q42 A;  1BED A;  3NBJ A;  1JBR A;  2JZS A;  2KP1 A;  2CX1 A;  5JPP A;  2GGT A;  4WBJ A;  2XGL A;  3QRD A;  2WOH A;  2CVB A;  1T4Y A;  1NWW A;  1B2Z A;  1BIR A;  3ER7 A;  2O85 A;  2C11 A;  3CXG A;  2KF5 A;  3IA1 A;  2VCV A;  3LSZ A;  4TN8 A;  2W0Q A;  1LOX A;  4GQF A;  4G0L A;  5DDL A;  2X8H A;  2OKA A;  5G1L A;  3C71 A;  2R4V A;  3TKR A;  3G4S 3;  1JNQ A;  3G71 3;  2GBX B;  3JUP A;  1YJW 3;  4K90 B;  3WOD G;  2YWN A;  2EIO A;  1KEB A;  1QVG 2;  2H71 A;  1K0O A;  3AMO A;  2H76 A;  3KMO A;  3DH2 A;  1M0U A;  4EIP A;  4ZB9 A;  2H75 A;  2GS3 A;  3EBY A;  1GNW A;  4ML6 A;  1GNE A;  1BOX A;  1U88 A;  1SJW A;  3CPO A;  1Z6N A;  1GUL A;  3IHG A;  3MWH A;  1O7M B;  2LEG A;  4HUA A;  8CHO A;  5ENU A;  3OV4 A;  3O8Y A;  1NM3 A;  4V2N A;  1X9S B;  2KHP A;  3EPT A;  4EV2 A;  4STD A;  2W2C A;  3BNC A;  2CFL A;  2P31 A;  1D6Y A;  2XC2 A;  1K3L A;  1I5G A;  2BT3 A;  2B7K A;  2GSS A;  1EOH A;  3F0I A;  3KSP A;  3A5I A;  3UBL A;  3HVX A;  3SLU A;  4ECB A;  3M1G A;  1FB0 A;  1B2U A;  3HII A;  3CCV 3;  5ID2 A;  2IY2 A;  3QK9 A;  1K0M A;  4XRA A;  1N2A A;  4OWY A;  4PNG A;  4N6L A;  11GS A;  1O81 A;  1NB5 I;  3DGN A;  5KN2 A;  3P8W A;  1M2A A;  5DCH A;  4NPB A;  4K1F A;  2BTO T;  1G7O A;  3NOF A;  2CA8 A;  2I9H A;  4EC6 A;  3H51 A;  1SK1 A;  4POK A;  5KOX A;  4E8E A;  1MGR A;  2VL3 A;  1BSE A;  3TKP A;  4ZL9 A;  4JZQ A;  3LW9 A;  1EV9 A;  4ACS A;  4EUY A;  3H1N A;  3JUO A;  4EVM A;  3LTB A;  1RNT A;  4XDV A;  3VK9 A;  1WMO A;  1G96 A;  2IIY A;  2H0G A;  3ROB A;  1K3O A;  9GSS A;  1SJZ A;  1HNB A;  1X9W B;  3ISO A;  4RBN A;  1V98 A;  4XS6 A;  5KN0 A;  4HQZ A;  1ZYQ B;  2YN1 A;  3I69 A;  4Z2U A;  1X0R A;  4N6V 0;  2HRF A;  5J5N A;  4CCV A;  1HU9 A;  5AYS C;  3VFI A;  1PD2 1;  3KZQ A;  3NBR A;  2HSM A;  4LGQ A;  1Z6M A;  1IQ8 A;  1GS3 A;  2PVO C;  2OCT A;  1TRP A;  1GY7 A;  3SOA A;  2AAE A;  2QIY A;  2H1B A;  3AMO B;  3V92 A;  1VQQ A;  2VL9 A;  3D4A A;  2GLR A;  1EOG A;  6GSY A;  1TUH A;  4FYB A;  3VF1 A;  2XFS A;  1BU4 A;  4J9A A;  4X2H A;  1IQX A;  5D9X A;  4LSO A;  1B2S A;  2OWP A;  3URP A;  2GEY A;  2M46 A;  4XCS A;  3EUR A;  2HT9 A;  2YNX A;  3H3H A;  2C0D A;  5JCG A;  3RPN A;  1DVD A;  3G6E 3;  4KT3 B;  1O7P B;  3FG3 A;  4N6T A;  2R37 A;  1TU5 A;  3LH4 A;  5AGY A;  2H6X A;  3PCR A;  2GVP A;  1BSD A;  3IJE B;  4Z7X A;  3DXO A;  5ID2 B;  2DKI A;  1AXD A;  1ZCP A;  3IOS A;  4Q5R A;  1WP0 A;  1XWA A;  2FWE A;  2CIU A;  4G0I A;  3FGY A;  1YIT 3;  4MZW A;  4XHM A;  2HNL A;  3W6G A;  1WOU A;  3UL6 A;  4MA9 A;  3KKG A;  4P3Y B;  4Q53 A;  3DKS A;  3LG6 A;  2YV9 A;  3FCS B;  2H8L A;  1ZS7 A;  4HM8 B;  2IYJ A;  4R4K A;  5HR0 A;  5IMC A;  4BVX A;  1SAR A;  4ISD A;  3ZVJ A;  2B24 B;  1FGR A;  2WGR A;  1MDJ A;  4BWQ A;  1EKM A;  1BNR A;  2LQO A;  3NBB A;  3CCS 3;  5ELU A;  4L8P A;  3D5G A;  1BAO A;  4RQR A;  2HZF A;  3DMC A;  4EXJ A;  3MWZ A;  1PN0 A;  4KE3 A;  2C10 A;  4LEH A;  1U8C B;  4O5U A;  3SX1 A;  1WTH A;  4Q5Q A;  1DUG A;  1J9B A;  3K8N A;  3HX8 A;  4HM0 B;  5G1K A;  3ME8 A;  1O85 A;  5DQS A;  3B8L A;  2AHE A;  1U5O A;  3BD2 A;  2F86 B;  1OHO A;  1Q82 4;  2CG0 A;  1FB6 A;  3DGO A;  1PMT A;  1G6W A;  2AB6 A;  2Y74 A;  1IK3 A;  1SL0 B;  1KWI A;  4TRX A;  2IL3 A;  4F2I A;  4HM4 B;  13GS A;  1JB5 A;  1R4Y A;  4NV5 A;  1EZK A;  5KN3 A;  3B4P A;  1GD3 A;  1IYY A;  4GQC A;  4A5P A;  4WFO A;  4NAX A;  3K63 A;  4PQI A;  4DVC A;  1XW5 A;  3BBY A;  5EL8 A;  3EF8 A;  4KFE A;  2DIY A;  2RUE A;  5AIV A;  2YP6 A;  2CAQ A;  1M2B A;  1RW1 A;  4BL7 A;  3A3T A;  4NHZ A;  5B6N A;  2DC5 A;  2MMA A;  3HZ4 A;  3V1W A;  3FLJ A;  1X5D A;  3L9U A;  1K0N A;  1ZX2 A;  1JRQ A;  3CU3 A;  1I2E A;  4K1V A;  2LQQ A;  1S3D A;  3WMD A;  1JV2 B;  3APO A;  3IAM 2;  4IIA A;  5D9V A;  1FVK A;  2OE0 A;  2LYX A;  2VD0 A;  4HDE A;  1K8A 4;  3X3Z A;  2GSP A;  4I5Q A;  2I81 A;  1GTA A;  3GN3 A;  2PER A;  1B27 A;  2P5R A;  5CP1 A;  2P09 A;  5ECQ B;  3WOE B;  1TRV A;  3U6V A;  1EQK A;  1A0R P;  2YZH A;  5ABR A;  1K9M 4;  1FYS A;  1Y4K A;  3ECF A;  1F9M A;  1PGT A;  2FA8 A;  4FCJ A;  1PA3 A;  2L6C A;  1M7T A;  3IR4 A;  3TJK A;  1URM A;  4BVX B;  1LOY A;  3KM6 A;  2WDU A;  1TI1 A;  1RGG A;  1I8V A;  7STD A;  3TJF A;  4FO5 A;  1RN4 A;  3WOF B;  3FKF A;  4X2O A;  4HYZ A;  3EB8 A;  3KP8 A;  5IG4 A;  3F3Q A;  3BIR A;  2VUP A;  3CYN A;  4TR4 A;  3MYD A;  3TGZ A;  4PX1 A;  4AJ8 A;  1W6C A;  3MHE A;  20GS A;  1GWC A;  2ZNM A;  2XHF A;  5GAP D;  2KP2 A;  5IMD A;  3O6T A;  1JZR A;  3VWW A;  3STD A;  3PZW A;  5IEN A;  3LFL A;  2LNS A;  4J8T A;  2XPD A;  1GSE A;  1L5G B;  2GQL A;  1ERU A;  2JU5 A;  4XS4 A;  3K9M C;  3DGY A;  1G6Y A;  3S9F A;  3G8Z A;  3OWU A;  3CCR 3;  2P38 A;  4BIK A;  4O32 A;  4JR6 A;  4BL7 B;  2BMX A;  2WFC A;  1SK0 A;  2A4H A;  4N6N B;  2CX3 A;  2LRC A;  1TK5 B;  1UVZ A;  2MBT A;  1NU3 A;  2CWT A;  2YAN A;  4I8B A;  5A4W A;  4X0X A;  2E2G A;  3M9J A;  5KP4 A;  1IYH A;  1AIU A;  1Q98 A;  3GV1 A;  2CV4 A;  4MEI A;  2YJ7 A;  4OCE A;  3V99 A;  2M72 A;  3WDG B;  4DSQ A;  1VF1 A;  1GOU A;  1ST9 A;  2B1K A;  2FXT A;  3QAG A;  2QA2 A;  5G31 A;  1U87 A;  5B6M A;  2R4I A;  2WUL A;  4R80 A;  2GSR A;  2M80 A;  2RM6 A;  4ECJ A;  5M18 A;  3F3R A;  4POB A;  1TIJ A;  3AY8 A;  3ME7 A;  1F8N A;  4IQA A;  3TOT A;  16GS A;  3DY5 A;  4N6O B;  2QA4 3;  5I97 A;  4BTX A;  1RCL A;  1EEM A;  3UOM A;  4I6X A;  1V57 A;  5EQL A;  1OC3 A;  1WRY A;  2P0G A;  1FAA A;  3OWS A;  1OUN A;  1Q81 4;  3KTB A;  3UEM A;  3HCZ A;  3N8B A;  2J8X B;  2H70 A;  3TUE A;  5G2G A;  4XBT A;  3LYP A;  1TW9 A;  2G2Q A;  1B4P A;  2MBS A;  1BNG A;  4I97 A;  4Q5F A;  2OOV A;  2YFL B;  2VL2 C;  2W9P A;  5JWO B;  5STD A;  3SOY A;  4MNN A;  2R41 A;  2FD3 A;  4ZB8 A;  2OQE C;  1S3R A;  2X64 A;  2HSH A;  4IJ3 A;  4ZIJ A;  3X42 A;  4BA7 A;  4GRF A;  3BND A;  1FUT A;  2LST A;  4HEA 2;  1XWB A;  3JUQ A;  3NX0 A;  1SJI A;  3H79 A;  3CC2 3;  2ES7 A;  3E9J B;  3S28 A;  6RNT A;  3IHQ A;  1B9X C;  3KZT A;  1VZZ A;  2AAD A;  1HKX A;  2HMN B;  3LGC A;  1YIJ 3;  4CY8 A;  3CCM 3;  1GSY A;  3EMX A;  4HS1 A;  6GST A;  1O6J A;  5DBQ A;  1SPU A;  4XS4 B;  3CNX A;  1JHB A;  4LLR A;  2PVQ A;  1WWJ A;  2HOH A;  3ZG5 A;  3CCJ 3;  1X5E A;  1OHS A;  2DLX A;  2GQM A;  4HBR A;  2O3O A;  1T3B A;  2GDR A;  2FGT A;  1FW7 A;  1U3A A;  3NM2 A;  1Z7P A;  4WF4 A;  1STD A;  3GRD A;  3C1S A;  3ZZX A;  4L0W A;  1GD4 A;  5IW9 A;  2WCI A;  3PGT A;  1YGW A;  1SQW A;  2INX A;  1SIH A;  3ZTL A;  1JFU A;  4E8H A;  1BNE A;  4GSS A;  4HOJ A;  2PMT A;  3CME 3;  5CRW A;  4CJN A;  1T7P B;  14GS A;  1FGM A;  5JBS A;  2YWM A;  4PUF C;  1S5A A;  2FHE A;  3GL3 A;  5G5F A;  3DRN A;  3U97 A;  2VOC A;  1EEJ A;  1V9W A;  1GP1 A;  1NSW A;  3S27 A;  1DYU A;  1BRK A;  1T2H A;  5M1A A;  3GSP A;  1GSF A;  2IME A;  3VWV A;  1AQW A;  1IV7 A;  1B20 A;  2VCZ A;  1NHO A;  1UCK A;  1WE0 A;  2HSY A;  2JZT A;  2M7O A;  3BCI A;  3FK8 A;  3E99 A;  1SKR B;  1B2M A;  1B8X A;  4EE0 A;  2XBI A;  1HQO A;  3TKS E;  1UUV B;  2BNG A;  5AII A;  2PBJ A;  2Z76 A;  4IVF A;  1SD8 A;  2HMM B;  2L4V A;  2UZ8 A;  2G0F A;  2GST A;  3CPW 2;  1S3C A;  4IP1 A;  4YKG A;  3HIG A;  2ZA4 A;  4FCM A;  3CRU A;  7GSP A;  3J7Y b;  2AUV A;  1UDI I;  1XW9 A;  2FWH A;  2H6Y A;  1Z3E A;  3X3X A;  3BLZ A;  3EU4 A;  4K5S A;  4HOH A;  4H3U A;  2N5A A;  1W5Z A;  5TGN A;  2YOI A;  3LYK A;  3VWX A;  5GZZ B;  1I0X A;  1CYV A;  1EGR A;  3KEB A;  2X4A A;  5IG5 A;  7GSS A;  3HHV A;  1X5C A;  1GLP A;  2IUJ A;  5EEO A;  2W03 A;  4ICY A;  5LCZ A;  3HZP A;  4HJ2 A;  3IDV A;  3MSO A;  1M3J A;  3KH7 A;  4GXZ A;  4GSP A;  2FWF A;  4N6M A;  1IV9 A;  4FR9 A;  4RNZ A;  4AKY A;  1ABA A;  3H8Q A;  3IK9 A;  3LEF A;  2WZ9 A;  4EL1 A;  1I3F A;  1YI2 3;  4G0K A;  4PQH A;  3NXJ A;  1RCK A;  5A4U A;  3LOY A;  5BXQ A;  3QD9 A;  4MH2 A;  5JCW A;  1RQM A;  1YEX A;  4HM6 B;  3TKS C;  1FA3 A;  4K5R A;  4ZBD A;  2OJL A;  1XWC A;  3MG1 A;  3FF2 A;  1VF2 A;  2XFT A;  3LJR A;  1UI8 A;  1JZD A;  4ORL A;  1FW1 A;  1E6B A;  1RGC A;  1WMP A;  1XZO A;  4CW9 A;  3TDG A;  1YEP A;  3EMP A;  5D8I A;  3K5T A;  1VQ6 3;  4BTW A;  4KFF A;  5J41 A;  3GYK A;  5IF6 A;  4TR3 A;  4KUN A;  3TJB A;  2CK3 H;  3SXX A;  2CFG A;  3NM7 A;  5LC6 A;  2K0M A;  3WA3 A;  1Y6E A;  3NUV A; 
#chains in the Genus database with same CATH homology
 4ZIL A;  1C72 A;  12GS A;  3HJP A;  4JBB A;  1WMJ A;  2O87 A;  5J4U A;  4GF0 A;  1EV4 A;  1ERW A;  1XXU A;  4KB3 A;  3ERW A;  3A2X A;  3ZFB A;  1V2A A;  2CT6 A;  2TRX A;  2MMN A;  5DAK A;  3GRX A;  3R3E A;  1FVJ A;  2C0F A;  4N30 A;  2H1D A;  1R26 A;  1QMV A;  2DJ0 A;  1XOA A;  4F0B A;  4FYU A;  3VI7 A;  3QMX A;  2X49 A;  5CAX A;  4FQU A;  1MD3 A;  2I1U A;  2J23 A;  19GS A;  2O8V B;  3M8N A;  5F07 A;  3ZMK A;  1XIY A;  5ECL B;  6GSW A;  3HVV A;  4LMW A;  1KTE A;  3QFB C;  1T1V A;  5IO2 A;  2YJH A;  4X4J A;  2CZ3 A;  1AUC A;  5GAN D;  1QFN A;  4OCF A;  2GTU A;  2QSI A;  1PX7 A;  4MK3 A;  2V6K A;  2Z9S A;  4GTU A;  4EDY A;  1ERV A;  2C3T A;  3I9V 2;  1GSU A;  4X1U A;  1K0A A;  5JWQ B;  4POM A;  3G7I A;  1A2J A;  2N5F A;  1ZYE A;  2WB9 A;  1A2M A;  3MDK A;  2B3S A;  4RQX A;  3UAR A;  5HFI A;  1ACV A;  2FGX A;  4OO4 A;  3IAS 2;  2I4A A;  3TB2 A;  1XW6 A;  5BMU A;  3GSS A;  1WJK A;  5JWR B;  5DAK B;  1VGL A;  3TJJ A;  3Q6O A;  2C1Y A;  1UA5 A;  1NHY A;  4K0G A;  1GTI A;  5KOW A;  1R5P A;  3G7Y A;  3IK7 A;  3OR5 A;  4KCA A;  3WGX A;  1TRS A;  4O92 A;  4JU5 A;  5EPF A;  2L6D A;  1Z5Y E;  1TRW A;  1EWX A;  3GKN A;  1VRS D;  1B48 A;  3TRP A;  2AJQ B;  3ERF A;  5J9C A;  5GSS A;  1U3I A;  4MH3 A;  2F8A A;  3GX8 A;  1YKC A;  1XWG A;  1XVQ A;  5INY A;  4USS A;  3EYT A;  1JLV A;  5F05 A;  4ECC A;  3ZYW A;  1V58 A;  2B7J A;  4PNF A;  5D9W A;  3ED3 A;  1R7H A;  1GH2 A;  4EDZ A;  1ON4 A;  4MPF A;  1J08 A;  5G5E A;  1M99 A;  5L71 A;  2F9S A;  2DKH A;  1GUH A;  1A8L A;  2DJK A;  2EIQ A;  1UN2 A;  4O7H A;  1K0D A;  4IN0 A;  1TP9 A;  3EU3 A;  3VUR A;  3QCP A;  2RUF A;  2VIM A;  4F0C A;  4Z2T A;  5LNK e;  1SD9 A;  4HU9 A;  4ILF A;  1O7U A;  2FY6 A;  5E4W A;  1OKD A;  2J9H A;  3M9K A;  5IPG A;  5FT3 A;  4IHU A;  2DJ2 A;  3HJM A;  4GCI A;  3GUR A;  4MJC A;  1J0F A;  2HRK A;  1GUM A;  1W4V A;  2V6O A;  3C8E A;  4OO5 A;  6GSX A;  5IOW A;  2IMI A;  1T00 A;  4LMV A;  5D73 A;  3A2W A;  3R2Q A;  2IMF A;  2P5Q A;  2V1M A;  4KDX A;  3HYP A;  2LV3 A;  4TW5 A;  3IXR A;  1MD4 A;  5AIS A;  1SKS B;  4BPY A;  3KMN A;  1MDK A;  2DJ3 A;  1BAY A;  2K9F A;  2V32 A;  4O5R A;  4ZBB A;  3APS A;  2H74 A;  10GS A;  3US3 A;  2LRT A;  2KUC A;  3D4T A;  2B6M A;  2WJU A;  1HNA A;  4MJA A;  1H75 A;  3LWA A;  3CSI A;  3N9J A;  3FMW A;  4WBR D;  2NBS A;  2A2R A;  1XVW A;  4JE1 A;  2DJ1 A;  1F6M C;  1JLW A;  2LJA A;  3EIN A;  2XPE A;  3UL3 A;  1VF3 A;  3WYW A;  3F6F A;  1MTC A;  1KBN A;  3Q18 A;  1O8W A;  5D9T A;  4EKZ A;  5ELA A;  1SYR A;  4Q5N A;  3KH9 A;  2K6V A;  1DE1 A;  4PXO A;  2ON7 A;  4OFN A;  3C73 A;  2F51 A;  1ZL9 A;  3P7X A;  3HD5 A;  3RAZ A;  1U6T A;  1GSD A;  5A5K A;  3ZLP A;  4PUR A;  1XFL A;  2GZZ A;  1E2Y A;  3F4R A;  3LXZ A;  4CDO A;  2CQ9 A;  5ECP B;  2LJR A;  3QDN A;  1GL8 A;  3ZIV A;  5C04 A;  1LJR A;  2R0P A;  2OBI A;  3I6A A;  3IC8 A;  2GZY A;  5BRT A;  1M2D A;  5HR1 A;  4WKW A;  2AAW A;  1O73 A;  5H5R A;  2F3M A;  1ZGN A;  4KF9 A;  4MCU A;  1CQG A;  4POL A;  3DIE A;  4IW9 A;  3GHA A;  4TXO A;  4OD7 A;  2XBQ A;  4XS1 A;  1R4W A;  2HE3 A;  1PX6 A;  3GTU A;  4BVY A;  2ZUP A;  2KOK A;  4MDC A;  3F4T A;  1OC8 A;  3HJO A;  2H19 A;  4K0N A;  5DVB A;  2PWJ A;  3QAW A;  1YF0 A;  4MLY A;  1PRX A;  1TTZ A;  3FR6 A;  2CZ2 A;  1R5A A;  5ECN B;  4ML1 A;  3VPQ A;  1YDK A;  3Q74 A;  4MF7 A;  3TCO A;  1M9A A;  4GSN A;  2JAC A;  4LL1 B;  1TJD A;  3D0Z A;  1A8Y A;  2ALB A;  4WET A;  3F4S A;  4N10 A;  3VLN A;  2NTO A;  1OVN A;  2PGT A;  2IWT A;  3ZVJ D;  4O5Q A;  1BQ7 A;  1PN9 A;  3GIX A;  1GSQ A;  3FZ9 A;  1PL2 A;  5D96 A;  2TIR A;  2VM2 A;  3FZ5 A;  4OFM A;  2C0G A;  2GQK A;  18GS A;  1ERT A;  3LXT A;  1FOV A;  1PSQ A;  1EGO A;  5KN1 A;  3P90 A;  3IE3 A;  1O8X A;  2CX4 A;  3O76 A;  3BCK A;  5CRE A;  3E0U A;  5H5S A;  1QGV A;  2R6K A;  3C1R A;  3HZ8 A;  5KEJ A;  5DJM A;  1TK0 B;  3L9V A;  2HI7 A;  4ZB6 A;  2WRT A;  2I3Y A;  3I43 A;  2H1A A;  2FA4 A;  3D6I A;  1TU8 A;  4KX4 A;  1DSB A;  3DXB A;  1YJ6 A;  2DBC A;  1BX9 A;  4TXO B;  3IPZ A;  2X8C A;  4RUV A;  3GTU B;  1JZO A;  1G0T A;  2FWG A;  4BVY B;  4WXT A;  2FCH A;  2B5X A;  4I2U A;  4FYC A;  4KSO A;  2K18 A;  4K2X A;  1SEN A;  4IS0 A;  1EP7 A;  3WT1 A;  2VLT A;  2H0I A;  2C4J A;  3PIN A;  1AAZ A;  3KD0 A;  2REM A;  4L0U A;  1HYU A;  2C3Q A;  4ECI A;  3ZRD A;  1LBK A;  3RHC A;  3MSZ A;  1ZYP A;  1BYE A;  3IBH A;  1QQ2 A;  3UIW A;  3ZL5 A;  4IEL A;  1A0F A;  3FW2 A;  2ON5 A;  4HU7 A;  5CRG A;  5IQY A;  3GA4 A;  4KCE A;  2L57 A;  3ZRE A;  1G7E A;  2VCT A;  1MEK A;  2E2M A;  4ZL7 A;  1GTU A;  5AIX A;  4J56 E;  4IJI A;  1AQV A;  4ID0 A;  1BG5 A;  4JRR A;  1T4Z A;  2NPB A;  4GWR A;  3A2V A;  4V1A p;  5B8B A;  5HQP A;  3D5J A;  3HDC A;  4K8M A;  4KW6 A;  2PUK C;  3FR9 A;  4JED A;  4YKF A;  2CAI A;  2JSZ A;  3SWL A;  4IQ1 A;  4MAB A;  3IC4 A;  1ZZY A;  1F3A A;  2H72 A;  3CMI A;  3LQ7 A;  1VF4 A;  2H73 A;  5IM9 A;  4LL4 B;  1SU9 A;  1K3Y A;  4MF5 A;  3TKQ A;  4YQV A;  1FG4 A;  1Z9H A;  2OAD A;  3G9B A;  3FZA A;  2MMO A;  5COH A;  1Q4J A;  1M9B A;  4TOP A;  1N8J A;  2LTK A;  2C0E A;  2PPT A;  2LRN A;  3CSJ A;  4YQM A;  3TRQ A;  4X43 A;  3TRX A;  1OYJ A;  4XTS A;  2IPA A;  5J9B A;  2YPM A;  5A4V A;  2IJY A;  2MYG A;  4DSR A;  2IMK A;  3ERG A;  4MF6 A;  4K2D A;  5FHI A;  3KCM A;  4ZXG A;  2O89 A;  3EE2 A;  4PTS A;  1WPI A;  2EIR A;  2BJX A;  5IPH A;  3Q19 A;  2RM5 A;  1SK2 A;  1YKA A;  1UC7 A;  2OE1 A;  1XWK A;  4QQ7 A;  3GX0 A;  3BOA A;  5IOX A;  1YY7 A;  3ZFL A;  2HYX A;  4L8E A;  2YZU A;  3D22 A;  2K8S A;  2VCW A;  1KNG A;  4HI7 A;  3MAK A;  2KLX A;  2DIZ A;  4V2M A;  3GKM A;  3RHB A;  1CQH A;  3QAV A;  4KA0 A;  4N0Z A;  4AGS A;  5CNW A;  2ZCT A;  4ZL8 A;  1USB A;  5IMA A;  4DEJ A;  3WGD A;  3D4M A;  4I2T A;  1MDI A;  3DVW A;  3EVI A;  3FR3 A;  2VM1 A;  4IBP A;  1QK8 A;  1ML6 A;  1JZW A;  3M3M A;  3DML A;  4N11 A;  1WIK A;  3W8J A;  5CYY A;  5IIZ A;  3MIX A;  3U5R E;  3PPU A;  2AYT A;  1YZX A;  2VD1 A;  2H1G A;  5CRD A;  1SYX A;  5ECH B;  3TOU A;  2OBK A;  1T8E B;  1OAZ A;  3EC3 A;  2LS5 A;  2C3N A;  2D2Z A;  4NV2 A;  3ZIJ A;  1X9M B;  3HKR A;  4QL7 A;  3MNG A;  2QC7 A;  4KDU A;  4D73 A;  2L5O A;  3ZIT A;  2JSY A;  2RII A;  1FO5 A;  3UVT A;  3F63 A;  1XOB A;  4G9H A;  2R2J A;  5DAL A;  3QFA C;  2YCD A;  4YAV A;  4HZ2 A;  2V41 A;  2DMM A;  2JL4 A;  3KGK A;  4MZC A;  1GRX A;  1H4O A;  1PL1 A;  2A2S A;  4MPG A;  1DBY A;  2IMD A;  4G10 A;  3P2A A;  2X99 A;  1BJX A;  5DJL A;  2QA1 A;  2FUG 2;  2L59 A;  2HRA A;  4ULX A;  2H6Z A;  2HRN A;  3HA9 A;  2YV7 A;  2TRC P;  4JR4 A;  3F9U A;  5HFG A;  1FHE A;  5IMF A;  2MZC A;  5AN1 A;  5E59 A;  2OAC A;  1A24 A;  3L0H A;  4Z2R A;  5ECM B;  3L78 A;  3L9S A;  1AQX A;  3LOR A;  3D21 A;  3F6D A;  2MMZ A;  2CVK A;  5F0G A;  4HJM A;  3PH9 A;  4OMV A;  4K7N A;  4RI6 A;  1HD2 A;  3UJ1 A;  3FZ4 A;  2H0H A;  2L4Q A;  3WGE A;  4N0V A;  1ZMA A;  4V1A g;  1SJ6 A;  4FH8 A;  3SBC A;  3GH6 A;  3ZML A;  3EWL A;  2V2G A;  2H01 A;  2VLU A;  2B5E A;  2OA7 A;  4D73 B;  1K0B A;  22GS A;  5IMV A;  1A23 A;  3WT2 A;  4NWY A;  4AJ7 A;  2YWO A;  3H93 A;  1SKW B;  3GL5 A;  4CY6 A;  5DAL B;  5ECO B;  3NZN A;  3FY7 A;  5B8A A;  4KAE A;  1TXX A;  3GUS A;  2QGV A;  1XBS A;  3FRC A;  1TU7 A;  4PGT A;  3O3T A;  3RPP A;  2GZP A;  1QUW A;  2VL2 A;  3GFK A;  4F82 A;  1YQ1 A;  3NIV A;  2FNO A;  1SL2 B;  3CTG A;  3WD6 A;  5CRH A;  4HQS A;  1QXH A;  1LU4 A;  3CRT A;  3APQ A;  3J7Y k;  1TOF A;  4OFT A;  1AW9 A;  2CVD A;  3W8S A;  4J57 E;  2DJJ A;  4MMM A;  4IP6 A;  3CTF A;  5EY6 A;  1OE7 A;  4L5O A;  2VO4 A;  4MZB A;  8GSS A;  4YAP A;  4KND A;  4EC0 A;  5F06 A;  2JZR A;  5CO3 A;  2H30 A;  5ECK B;  4BWS A;  4TR1 A;  3C7M A;  3M0F A;  1F3B A;  3HXS A;  4YQU A;  2N5B A;  5G30 A;  4MJE A;  1GUK A;  3TJG A;  2EC4 A;  1GLQ A;  2A4V A;  2YWI A;  4K9Z A;  2AV4 A;  2VCX A;  3RDW A;  1B9Y C;  3GKK A;  5GST A;  4LA1 A;  6GSV A;  3UVH A;  1ZOF A;  6GSU A;  2R5G A;  3DEX A;  1A2L A;  1F37 A;  2JAD A;  1OC9 A;  2PU9 C;  4EIQ A;  4KSM A;  2GT5 A;  5F8B A;  3VPT A;  4GST A;  5D93 A;  1DE2 A;  5DCG A;  2QKE A;  1OKT A;  2DML A;  2R0C A;  2E7P A;  3KIJ A;  5B7C A;  5ELG A;  3QOU A;  1TKD B;  1YF1 A;  2HLS A;  2HZE A;  2VAF A;  1S3A A;  2GT6 A;  5JCU A;  4NHW A;  2F8F A;  4DSS A;  4FIW A;  5J3R A;  1B4Q A;  2R0G A;  4NMU A;  4QL9 A;  2VLV A;  1GTB A;  1EP8 A;  2VCQ A;  1K0C A;  1NW2 A;  4H86 A;  5LD0 A;  3JCM L;  3A5W A;  5HR2 A;  3TKS A;  3KTL A;  6GSS A;  3DWV A;  4HZ4 A;  3FEU A;  1FOH A;  5ECI B;  2C8U A;  2WS2 A;  3GNJ A;  1RK4 A;  4KGI A;  4TR1 B;  2FLS A;  4WEY A;  4WR4 A;  2IFQ A;  4XIH A;  4F9Z A;  4TR0 A;  17GS A;  2R3X A;  5C00 A;  3DD3 A;  3GH9 A;  5DQY A;  1THO A;  3L4N A;  4G2E A;  2LUS A;  3E3E A;  3PR8 A;  1I9D A;  3VWU A;  2L5L A;  2OE3 A;  1XCC A;  4IKH A;  4K7O A;  1OC9 B;  2B5Y A;  4RI7 A;  4TKY A;  3UAP A;  2IN3 A;  4KDY A;  2NDO A;  3KXO A;  3KJY A;  3FHK A;  2PN8 A;  4TXV A;  1AC1 A;  4IGJ A;  3QPM A;  5ECS A;  5IMZ A;  4WR5 A;  3UMA A;  4NXI A;  3G7J A;  4CHS A;  1V40 A;  2LNT A;  4WF5 A;  5G2Z A;  2GSQ A;  3KP9 A;  2B1L A;  3UBK A;  2HZE B;  3N5O A;  5HR3 A;  4L5L A;  2K8V A;  4AF2 A;  4TVE A;  1ILO A;  3FYG A;  3HVS A;  1PQN A;  1TI3 A;  1F2E A;  1GSS A;  3F8U A;  4DSS B;  3GMF A;  1TK8 B;  2RLI A;  1TDI A;  4KH7 A;  1HNC A;  2HFD A;  5ECR B;  2LJK A;  4AJ6 A;  1THX A;  3IRA A;  3DYR A;  2NVL A;  2L4C A;  4F03 A;  2HXK A;  4GLT A;  1PKZ A;  3GST A;  4J2F A;  3VI5 A;  1SL1 B;  3CBU A;  3RBT A;  2A2P A;  4ZBA A;  4PUA A;  4G19 A;  3QR6 A;  5FWG A;  2O7K A;  1Z7R A;  3HY2 A;  3H4K A;  2IFQ B;  2LKU A;  5IO0 A;  3DVX A;  4PQ1 A;  2C80 A;  2X8G A;  1W89 A;  4EF0 A;  5EVO A;  3BJ5 A;  3IV4 A;  1PKW A;  1OE8 A;  4YH2 A;  3GKX A;  4EO3 A;  2H66 A;  4XRD A;  5H5Q A;  4K7I A;  1XPV A;  2DSA A;  1IYI A;  4MP4 A;  4V2L A;  2E0Q A;  1Y25 A;  3CSH A;  5HFK A;  4MJB A;  1ZYN A;  3DGQ A;  4K6X A;  1TRU A;  1BED A;  2JZS A;  2KP1 A;  2GGT A;  4WBJ A;  2CVB A;  1T4Y A;  2O85 A;  3CXG A;  3IA1 A;  2VCV A;  3LSZ A;  4TN8 A;  4GQF A;  4G0L A;  5DDL A;  2X8H A;  2OKA A;  5G1L A;  3C71 A;  2R4V A;  3TKR A;  2YWN A;  2EIO A;  1KEB A;  2H71 A;  1K0O A;  2H76 A;  3KMO A;  1M0U A;  4EIP A;  4ZB9 A;  2H75 A;  2GS3 A;  1GNW A;  4ML6 A;  1GNE A;  1U88 A;  1Z6N A;  1GUL A;  3IHG A;  3MWH A;  2LEG A;  4HUA A;  5ENU A;  1NM3 A;  4V2N A;  1X9S B;  2KHP A;  3EPT A;  2P31 A;  2XC2 A;  1K3L A;  1I5G A;  2B7K A;  2GSS A;  1EOH A;  3F0I A;  3A5I A;  3UBL A;  3HVX A;  4ECB A;  3M1G A;  1FB0 A;  5ID2 A;  2IY2 A;  4XRA A;  1K0M A;  1N2A A;  4OWY A;  4PNG A;  11GS A;  1O81 A;  5KN2 A;  3P8W A;  1M2A A;  5DCH A;  4NPB A;  4K1F A;  2BTO T;  1G7O A;  3NOF A;  2CA8 A;  2I9H A;  1SK1 A;  4POK A;  5KOX A;  4E8E A;  2VL3 A;  3TKP A;  4ZL9 A;  4JZQ A;  3LW9 A;  1EV9 A;  4ACS A;  4EUY A;  3H1N A;  4EVM A;  3VK9 A;  2IIY A;  2H0G A;  1K3O A;  9GSS A;  1SJZ A;  1HNB A;  1X9W B;  3ISO A;  1V98 A;  4XS6 A;  5KN0 A;  4HQZ A;  1ZYQ B;  2YN1 A;  3I69 A;  4Z2U A;  1X0R A;  2HRF A;  5J5N A;  3VFI A;  1PD2 1;  3KZQ A;  2HSM A;  1Z6M A;  2PVO C;  2H1B A;  2VL9 A;  2GLR A;  1EOG A;  6GSY A;  4FYB A;  5D9X A;  2M46 A;  4XCS A;  3EUR A;  2HT9 A;  2YNX A;  2C0D A;  5JCG A;  3RPN A;  2R37 A;  5AGY A;  2H6X A;  2GVP A;  4Z7X A;  5ID2 B;  2DKI A;  1AXD A;  1ZCP A;  3IOS A;  4Q5R A;  1WP0 A;  1XWA A;  2FWE A;  4G0I A;  4MZW A;  4XHM A;  2HNL A;  3W6G A;  1WOU A;  4MA9 A;  4P3Y B;  3DKS A;  3LG6 A;  2YV9 A;  2H8L A;  2IYJ A;  5HR0 A;  5IMC A;  4BVX A;  4ISD A;  3ZVJ A;  2WGR A;  1MDJ A;  4BWQ A;  2LQO A;  4RQR A;  2HZF A;  4EXJ A;  1PN0 A;  4KE3 A;  4O5U A;  4Q5Q A;  1DUG A;  1J9B A;  3K8N A;  5G1K A;  3ME8 A;  1O85 A;  5DQS A;  2AHE A;  3BD2 A;  1FB6 A;  1PMT A;  1G6W A;  2AB6 A;  1SL0 B;  4TRX A;  2IL3 A;  4F2I A;  13GS A;  4NV5 A;  1EZK A;  5KN3 A;  4GQC A;  4A5P A;  4NAX A;  4PQI A;  4DVC A;  1XW5 A;  3BBY A;  5EL8 A;  2DIY A;  2RUE A;  5AIV A;  2YP6 A;  2CAQ A;  1M2B A;  1RW1 A;  4BL7 A;  3A3T A;  4NHZ A;  5B6N A;  2DC5 A;  2MMA A;  3HZ4 A;  3V1W A;  1X5D A;  3L9U A;  1K0N A;  2LQQ A;  1S3D A;  3APO A;  3IAM 2;  5D9V A;  1FVK A;  2OE0 A;  2VD0 A;  4HDE A;  4I5Q A;  2I81 A;  1GTA A;  3GN3 A;  2PER A;  2P5R A;  5CP1 A;  5ECQ B;  1TRV A;  3U6V A;  1A0R P;  2YZH A;  5ABR A;  1F9M A;  1PGT A;  2FA8 A;  1PA3 A;  2L6C A;  1M7T A;  3IR4 A;  3TJK A;  1URM A;  4BVX B;  3KM6 A;  2WDU A;  1TI1 A;  3TJF A;  4FO5 A;  3FKF A;  3KP8 A;  3F3Q A;  2VUP A;  3CYN A;  4TR4 A;  3MYD A;  3TGZ A;  4PX1 A;  4AJ8 A;  20GS A;  1GWC A;  2ZNM A;  2XHF A;  5GAP D;  2KP2 A;  5IMD A;  3O6T A;  1JZR A;  3VWW A;  3LFL A;  2LNS A;  2XPD A;  1GSE A;  2GQL A;  1ERU A;  2JU5 A;  4XS4 A;  1G6Y A;  3S9F A;  4O32 A;  4JR6 A;  4BL7 B;  2BMX A;  2WFC A;  1SK0 A;  2A4H A;  2CX3 A;  2LRC A;  1TK5 B;  1UVZ A;  2MBT A;  2YAN A;  4I8B A;  5A4W A;  4X0X A;  2E2G A;  3M9J A;  1IYH A;  1AIU A;  1Q98 A;  3GV1 A;  2CV4 A;  2YJ7 A;  4OCE A;  2M72 A;  4DSQ A;  1VF1 A;  1ST9 A;  2B1K A;  3QAG A;  5G31 A;  2QA2 A;  1U87 A;  5B6M A;  2WUL A;  2GSR A;  2RM6 A;  2M80 A;  4ECJ A;  3F3R A;  4POB A;  3AY8 A;  3ME7 A;  4IQA A;  3TOT A;  16GS A;  1EEM A;  3UOM A;  4I6X A;  1V57 A;  1OC3 A;  1WRY A;  2P0G A;  1FAA A;  3KTB A;  3UEM A;  3HCZ A;  2H70 A;  3TUE A;  3LYP A;  1TW9 A;  2G2Q A;  1B4P A;  2MBS A;  4I97 A;  4Q5F A;  2VL2 C;  5JWO B;  4MNN A;  2FD3 A;  4ZB8 A;  2X64 A;  2HSH A;  4IJ3 A;  4ZIJ A;  4BA7 A;  4GRF A;  2LST A;  4HEA 2;  1XWB A;  1SJI A;  3H79 A;  2ES7 A;  3E9J B;  3IHQ A;  1B9X C;  3LGC A;  4CY8 A;  1GSY A;  3EMX A;  4HS1 A;  6GST A;  1O6J A;  5DBQ A;  4XS4 B;  1JHB A;  4LLR A;  2PVQ A;  1WWJ A;  1X5E A;  2DLX A;  2GQM A;  1T3B A;  2GDR A;  1U3A A;  1Z7P A;  4WF4 A;  3C1S A;  3ZZX A;  4L0W A;  2WCI A;  3PGT A;  3ZTL A;  1JFU A;  4E8H A;  4GSS A;  4HOJ A;  2PMT A;  5CRW A;  1T7P B;  14GS A;  2YWM A;  4PUF C;  2FHE A;  3GL3 A;  5G5F A;  3DRN A;  2VOC A;  1EEJ A;  1V9W A;  1GP1 A;  1NSW A;  1GSF A;  2IME A;  3VWV A;  1AQW A;  2VCZ A;  1NHO A;  1WE0 A;  2HSY A;  2JZT A;  3BCI A;  3FK8 A;  1SKR B;  1B8X A;  4EE0 A;  2XBI A;  1HQO A;  3TKS E;  2PBJ A;  4IVF A;  1SD8 A;  2UZ8 A;  2G0F A;  2GST A;  1S3C A;  4IP1 A;  4YKG A;  3CRU A;  3J7Y b;  2AUV A;  1XW9 A;  2FWH A;  2H6Y A;  1Z3E A;  4K5S A;  3EU4 A;  2YOI A;  3VWX A;  2N5A A;  3LYK A;  5GZZ B;  1EGR A;  3KEB A;  2X4A A;  7GSS A;  3HHV A;  1X5C A;  1GLP A;  4ICY A;  5LCZ A;  4HJ2 A;  3IDV A;  3KH7 A;  4GXZ A;  2FWF A;  1ABA A;  3H8Q A;  3IK9 A;  3LEF A;  2WZ9 A;  4EL1 A;  4G0K A;  4PQH A;  5A4U A;  4MH2 A;  3QD9 A;  5JCW A;  1RQM A;  1YEX A;  3TKS C;  4K5R A;  4ZBD A;  2OJL A;  1XWC A;  1VF2 A;  3LJR A;  1JZD A;  1FW1 A;  1E6B A;  1XZO A;  4CW9 A;  1YEP A;  3EMP A;  5D8I A;  3TDG A;  5J41 A;  3GYK A;  4TR3 A;  4KUN A;  3TJB A;  1Y6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...