4ILFA

Crystal structure of dsbc r125a from salmonella enterica serovar typhimurium
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
AMDPEFMDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPAQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein DsbC
publication title Crystal structure of the periplasmic disulfide-bond isomerase DsbC from Salmonella enterica serovar Typhimurium and the mechanistic implications.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 4ilfA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ilfA02
1THOA 4MMMA 4PQIA 2MMNA 3LFLA 1ZCPA 2JL4A 5KEJA 3PINA 3WT2A 1RQMA 2XBIA 1NHYA 2MMAA 2G2QA 5B7CA 2CVBA 1NHOA 3RHBA 3ZYWA 1YEPA 3Q74A 3EINA 1HQOA 3WGXA 3TGZA 4MZBA 4XS4B 3MAKA 5JCWA 5L71A 4ID0A 3GL3A 2RUEA 2A4VA 3GH6A 1GH2A 2CAQA 4PNFA 5IMDA 3E0UA 4MPFA 3M8NA 3QOUA 4KB3A 1QXHA 1GLPA 1BAYA 4I97A 1XVQA 1EGRA 3M1GA 1OVNA 4N10A 2QC7A 1ERVA 4YAVA 1Z9HA 1JZRA 2PUKC 3KTBA 2H0HA 1ILOA 3F3RA 2CA8A 3MSZA 3AY8A 3L9UA 1TP9A 2G0FA 3M9JA 1O7UA 2GDRA 2HSYA 1FO5A 4JE1A 4YQMA 4ECBA 2EC4A 3CRUA 2XHFA 1GNEA 4HU7A 2ZNMA 5A5KA 2JZTA 2VLTA 3M9KA 5H5SA 4MK3A 5DCGA 2WULA 1UA5A 3PGTA 2LEGA 1AW9A 1T8EB 3GN3A 5ECNB 1Y25A 1GUMA 2ALBA 3ZIJA 1W4VA 4HDEA 2GSSA 3QCPA 4RUVA 1FVJA 1G6WA 5CRDA 1QFNA 1BX9A 4IN0A 1M9AA 6GSVA 3ZREA 1GL8A 2VUPA 3L78A 1SK1A 4IJ3A 1YJ6A 3D21A 4PGTA 5GSSA 2YWOA 1IYIA 3UVTA 2TIRA 2YZUA 4IGJA 2OBIA 3O3TA 1U3IA 2PVQA 1X9WB 3HXSA 2O87A 5JWOB 1YZXA 3TJJA 3LSZA 4PXOA 1J08A 1SYRA 2V6OA 1O85A 4DSRA 1XVWA 2F8AA 1PQNA 3VFIA 1XW5A 1PD21 2R2JA 4OFTA 3ZMKA 4Q5FA 1W89A 2M46A 3F6FA 3LEFA 2DMLA 4HZ4A 2WGRA 5CRWA 2WS2A 3WYWA 2PU9C 3EC3A 2R5GA 1GSYA 1VRSD 2RM6A 3OR5A 4K0GA 2H19A 2GQLA 3UMAA 2BJXA 1TW9A 5DBQA 1BQ7A 4ECIA 1K0OA 1A2LA 2F51A 2P5QA 4KE3A 3UARA 2GGTA 2E0QA 5IMZA 1EGOA 2HZEA 4DSQA 4G10A 3FY7A 3ERWA 3SBCA 3D22A 5IMFA 3A2XA 4MF6A 1QUWA 3FR6A 2V6KA 1JHBA 1F2EA 4TR1A 1WRYA 3CYNA 5G30A 4NXIA 4KH7A 2E7PA 4BWQA 4KDYA 2VM1A 4ZL7A 1UVZA 3GH9A 1WIKA 2GT6A 1F6MC 3FK8A 4EC0A 1VF4A 3I9V2 4F03A 1H75A 1S3AA 3VPTA 4GSNA 3G7JA 5GAND 4NHWA 1H4OA 2DSAA 2K18A 5ECHB 2PGTA 1NSWA 3IAS2 4X43A 3F0IA 3C1RA 5JCGA 1MDIA 3IV4A 4AGSA 3O76A 3DKSA 5IIZA 2HXKA 5DAKB 5D9XA 2LJAA 2DIYA 3KP8A 1SKRB 3L0HA 2H1DA 2IY2A 5A4VA 1PL1A 2L5OA 4EDYA 2NTOA 2VLUA 4BVYA 2IPAA 4O32A 1SL0B 1JZWA 4ZXGA 2B5YA 5DDLA 2NBSA 2B3SA 4K1FA 3CSJA 1GTAA 3A2VA 3UL3A 3HA9A 4CDOA 2VCTA 2H0IA 4XRDA 1V9WA 3KM6A 1OE8A 2LNTA 2X64A 1Z3EA 1SJ6A 5IMVA 3BCIA 2VL9A 4HZ2A 4TXVA 4KNDA 4HJ2A 3HYPA 4OD7A 1WP0A 4AF2A 1XIYA 1O8XA 2C1YA 4KA0A 2C3NA 3D4TA 3ZIVA 2HE3A 1ML6A 5B6NA 1B4PA 1MD3A 1XWAA 2I81A 4LL4B 1JFUA 4RI6A 1GSDA 4TRXA 3KGKA 3G9BA 1GSUA 3UOMA 1ACVA 5IMAA 1J9BA 4TW5A 5HQPA 2LV3A 3P7XA 3ME8A 3CMIA 3L4NA 5HR3A 5AGYA 2VO4A 2B7KA 2C0EA 2IMDA 2CVKA 5KN2A 3TKRA 2CX3A 3LWAA 3EVIA 3D4MA 4HQZA 2KHPA 1R26A 5DAKA 2VCZA 3SWLA 1SYXA 4ISDA 2YV9A 22GSA 2GLRA 4PQHA 1SD9A 2O85A 3BJ5A 1ZOFA 4DSSB 4HOJA 5HR0A 3VWVA 2R3XA 3H93A 4ZB6A 4ML6A 3IBHA 1Q4JA 2GT5A 4D73B 2WRTA 1SENA 4EO3A 4HU9A 3EE2A 5DJMA 1HNBA 1BJXA 1G7EA 5ECLB 1X5EA 5GZZB 1ERWA 1U88A 1EWXA 4GSTA 3ZFLA 2VAFA 4JU5A 4ZILA 2BMXA 3GKKA 5ECMB 5LNKe 4XHMA 5LD0A 1HYUA 3RHCA 4TXOA 3L9SA 4EF0A 3APOA 1VF3A 3P8WA 1TOFA 2H72A 3EMPA 1GLQA 5IOXA 4MZWA 2FWFA 3KD0A 3RDWA 3IOSA 4ZB9A 1WMJA 3EU3A 3FZ5A 17GSA 4LLRA 3KJYA 1EV4A 3U6VA 2B5XA 1PRXA 4KGIA 1J0FA 1KNGA 4WXTA 1KEBA 1YEXA 3TJBA 10GSA 2OJLA 3TKSC 2B5EA 5J3RA 5KN0A 1K3YA 2C0DA 4OMVA 1PA3A 4XCSA 1SKSB 4I5QA 1A2JA 5C04A 4FYBA 3TCOA 5A4WA 2AJQB 2OA7A 4DSSA 5HR1A 1TI3A 3FHKA 4FYUA 5H5QA 4AJ8A 4YQUA 4EVMA 4TR4A 3TRXA 3GRXA 3ZTLA 2DC5A 3M0FA 2VM2A 2WZ9A 4WR4A 4E8HA 4V2NA 4JZQA 4F2IA 4KUNA 2JADA 3FKFA 5LCZA 1K0DA 2IMFA 2JACA 3F9UA 1IYHA 3HD5A 3DEXA 2YN1A 2JZSA 4IW9A 4GSSA 2YCDA 9GSSA 5AISA 3WD6A 3VLNA 2H74A 1ZYQB 4MJCA 1PSQA 3H4KA 3TOUA 4ML1A 1B9YC 4NHZA 1K0CA 1R5PA 1S3DA 2MBTA 3Q6OA 2AAWA 2IYJA 2GZPA 4BL7A 4NAXA 4WBJA 5J9BA 3GTUB 1PGTA 3H8QA 4TN8A 3N5OA 1PL2A 1FG4A 3F6DA 4X0XA 3TKQA 2QKEA 3QFBC 5G5EA 2LRCA 5AIVA 5FT3A 5J41A 1M7TA 2C80A 2H66A 4IELA 3DGQA 4Q5RA 3F8UA 3UEMA 4ZBAA 3P90A 3DYRA 3FR9A 3G7IA 5DALA 5DVBA 3GUSA 3VWUA 2V1MA 1F3AA 1OC8A 4E8EA 3GURA 5ECRB 1U6TA 4KDUA 5J5NA 3LYKA 4TOPA 2IIYA 2FHEA 4PUFC 2LTKA 4OFNA 2EIOA 1A8YA 1Z6NA 4MLYA 2C8UA 2OE3A 4N11A 2VCQA 3PH9A 1ERUA 3DIEA 2GSTA 3IE3A 2HYXA 2B7JA 5G31A 1MDKA 1K0NA 3W8JA 19GSA 4QL9A 2X8GA 5DQSA 1HD2A 3WT1A 1NW2A 5G1LA 2L4QA 2PVOC 2YPMA 3ZLPA 1EEMA 1B4QA 1TI1A 3GX0A 2L6DA 2MBSA 4K7IA 2YZHA 5G5FA 5ENUA 1XBSA 1X5DA 1ABAA 3FZAA 20GSA 3VWWA 1K0MA 2O8VB 2XPDA 3H1NA 2TRXA 3TJGA 1X0RA 4PURA 1XW6A 2YOIA 1BG5A 3D0ZA 1X9MB 5FHIA 3ERGA 1Z5YE 4POBA 2GZZA 4XS4A 2L5LA 3ZRDA 4MCUA 2H1GA 1PX6A 2KUCA 2HI7A 4IJIA 1A8LA 4ULXA 1B9XC 2I1UA 3F4SA 6GSXA 5IO0A 7GSSA 4MF7A 3C8EA 2H76A 1G7OA 1MEKA 2V41A 5DJLA 5D93A 3C73A 2I3YA 4MF5A 2FD3A 4GCIA 4AJ6A 4GWRA 4X1UA 5ECQB 2GVPA 3KMOA 1GTBA 1ST9A 2R6KA 4OO5A 3GYKA 3IRAA 3HKRA 2MMOA 5D9VA 2L4CA 4GLTA 2IMEA 1RK4A 3MDKA 5JWQB 4ACSA 2DJKA 5EL8A 2N5FA 6GSTA 3S9FA 3HZ8A 1EOGA 3IDVA 4WF4A 2VL2A 3FEUA 2CV4A 5IPGA 2QGVA 4TKYA 3US3A 2X8HA 3LXTA 4XTSA 3CTFA 1OC3A 1Y6EA 2L57A 4EUYA 4F0CA 4ZBBA 3W8SA 1NM3A 4EKZA 3TDGA 1YF1A 2DBCA 2FWHA 1TRUA 2ON5A 1V58A 2IFQB 1TJDA 2DJ3A 1TRWA 4HS1A 1M2DA 3ME7A 1AQXA 2H70A 1XWKA 4AJ7A 1E6BA 2JZRA 4F0BA 2Z9SA 3HVSA 5B8BA 4N30A 2DJ1A 1ZZYA 1VGLA 1AXDA 1ON4A 18GSA 3GNJA 3LG6A 3HHVA 1RW1A 5IPHA 1V57A 4IBPA 5CNWA 4ZB8A 5KN1A 5ID2B 3R2QA 4YAPA 12GSA 5CYYA 1K3OA 2GS3A 2LJRA 3TKPA 4BVXA 2R37A 3VI7A 5H5RA 1SL2B 3HZ4A 5HFIA 4PX1A 3M3MA 4HUAA 4I2UA 3LYPA 5ELAA 2MMZA 3HJMA 4NV2A 3GL5A 5D9WA 2MZCA 3EYTA 4H86A 3QAGA 2GQKA 3ERFA 5A4UA 1GUKA 3GA4A 3HJPA 1O6JA 4FIWA 3CRTA 6GSYA 1Z6MA 3V1WA 1XZOA 3IR4A 4PNGA 3IA1A 3NIVA 2LUSA 5B6MA 3ISOA 4ZL8A 1BYEA 3A2WA 4JR4A 2CAIA 3PR8A 1TU7A 3GHAA 3QD9A 1M2BA 1LJRA 4ILFA 1T4ZA 2VLVA 2DJJA 1QK8A 2J9HA 2YV7A 2O89A 4FYCA 3G7YA 2WJUA 4K9ZA 1T1VA 2E2GA 4YH2A 3W6GA 2OKAA 2H30A 5DCHA 3APQA 4DEJA 2HRFA 2CT6A 1EEJA 2X99A 3H79A 2LQQA 3GSSA 2DJ2A 4RQXA 1YQ1A 3RPPA 3P2AA 3JCML 4GF0A 3IC4A 1OKDA 2CZ2A 2RM5A 2EIQA 5F07A 4FO5A 3A5WA 3K8NA 2P5RA 1XOAA 5E4WA 14GSA 1TK0B 2HT9A 4NPBA 2QSIA 1KTEA 1SKWB 2I4AA 2KP1A 3LGCA 2PWJA 2K6VA 2L59A 3ZZXA 3DMLA 3EU4A 4I6XA 2B1KA 4NMUA 1TKDB 5DQYA 5B8AA 2H71A 4K2DA 5GSTA 1X9SB 3I69A 2GQMA 1GTUA 3QFAC 3ZVJA 5D96A 3FYGA 1TDIA 4OCEA 1TK8B 2V2GA 4EL1A 4IHUA 2M80A 4OO4A 2K8SA 4YQVA 4KSMA 4JBBA 4POLA 4IP6A 1GSQA 1LU4A 5IMCA 4NWYA 2FCHA 3KH9A 5CRHA 4P3YB 4L0UA 1DE1A 2TRCP 1DE2A 1OC9B 2LS5A 2REMA 2ZUPA 3MWHA 1A23A 3TKSE 1M0UA 5F05A 1PMTA 4HEA2 1SJIA 2CQ9A 3E3EA 3GMFA 1SJZA 5G2ZA 2JU5A 3WGEA 2XBQA 2OBKA 4F82A 1UC7A 2K8VA 4D73A 4I8BA 5IQYA 5AIXA 2OE1A 3IPZA 3C7MA 3KH7A 5GAPD 2H73A 1GULA 4F9ZA 2WB9A 3DRNA 3IXRA 4JEDA 2ON7A 4IQAA 3HVXA 1URMA 1WOUA 5ECIB 1JZDA 1QGVA 1G0TA 2H6XA 1K0AA 4GXZA 3F4RA 3FRCA 1PX7A 5HR2A 2HFDA 2LNSA 3ZMLA 4IP1A 3I6AA 3HVVA 3ED3A 4PQ1A 5JCUA 2C3TA 2YWNA 1GTIA 3QPMA 2IWTA 4MPGA 5ECSA 2O7KA 1PKWA 5IOWA 1EP8A 3IK9A 2WCIA 3EWLA 1K0BA 4WEYA 4I2TA 3BOAA 1ERTA 1QMVA 5F06A 1DBYA 4HJMA 2H8LA 2HLSA 2H0GA 1DSBA 4JR6A 4ZBDA 1SK0A 1EZKA 2YJ7A 5F8BA 2OACA 3LXZA 3HY2A 4MJAA 3EMXA 3GV1A 4KX4A 3TUEA 4K8MA 2C0FA 2C4JA 2JSZA 3UVHA 1TRSA 2KLXA 3UIWA 4EDZA 16GSA 1X5CA 3F4TA 3Q18A 3VPQA 4KSOA 3MNGA 4N0ZA 2VL3A 4V2LA 1GUHA 4XRAA 4IS0A 1O8WA 1O81A 1Z7RA 2F9SA 5J4UA 5IO2A 1FHEA 1HNAA 1UN2A 4J57E 2KP2A 3TJKA 1WE0A 2NDOA 4RQRA 2H1BA 6GSSA 3IHQA 4MJEA 3GKNA 4EXJA 2LJKA 1YKAA 2A2RA 4BWSA 1EV9A 3QMXA 2DMMA 2PPTA 1Q98A 4MA9A 5ECPB 4POMA 4WF5A 2DLXA 3GTUA 2H6ZA 2JSYA 1A24A 2OE0A 3ZFBA 4TR0A 4ZIJA 3FZ9A 4GQCA 4PUAA 4O7HA 4V2MA 4J56E 1TK5B 3KMNA 2VL2C 2RIIA 3CSHA 2FUG2 1ZGNA 3ZITA 2HZEB 4K0NA 3UBLA 1QQ2A 4L5LA 3U5RE 1MD4A 4TR1B 4MH3A 2FY6A 4XS6A 1AQWA 1THXA 5ABRA 13GSA 2V32A 1M99A 1FOVA 2LSTA 1WPIA 1WWJA 2X8CA 1USBA 3CTGA 2NVLA 2FWEA 2XC2A 2VD1A 1TXXA 3C1SA 5D8IA 5COHA 5CRGA 5IM9A 1PKZA 1EOHA 3IAM2 1R4WA 2YNXA 2FWGA 3VWXA 1JLWA 2LRTA 4Q5QA 3TRPA 2N5BA 3QDNA 2LQOA 3EURA 1SU9A 3J7Yk 1CQGA 3ZVJD 2ZCTA 3CBUA 1HNCA 1TTZA 4V1Ag 2HRNA 4O5RA 4QQ7A 3NOFA 4GTUA 4DVCA 3TOTA 2P31A 4MABA 1LBKA 3UAPA 2NPBA 1FB6A 1A0FA 1GSFA 3DXBA 1G6YA 1O73A 1V2AA 1AUCA 1N2AA 1KBNA 2DIZA 1BEDA 2AUVA 3TRQA 3WGDA 4MP4A 4TR3A 4POKA 3ZL5A 3HDCA 1DUGA 1GNWA 2I9HA 4K7OA 1R7HA 4KW6A 1B48A 2VCWA 4XIHA 4ECJA 3APSA 3CXGA 1A2MA 3L9VA 2YP6A 1B8XA 4L5OA 2DJ0A 3FW2A 2E2MA 1U3AA 1FAAA 2VIMA 3GKMA 4QL7A 5HFKA 4Z7XA 4TVEA 3KXOA 1FB0A 4WR5A 1XPVA 2PERA 4L0WA 1GWCA 4KCEA 2VOCA 3QAVA 4WETA 3E9JB 3GIXA 4KDXA 4LL1B 2F3MA 3BD2A 8GSSA 5C00A 3DWVA 4EE0A 1A0RP 2H01A 1CQHA 2ES7A 2IL3A 3BBYA 4OCFA 4K7NA 2YWMA 4O92A 6GSUA 2IMIA 2K9FA 5EY6A 1AIUA 4IKHA 5HFGA 2CZ3A 2AB6A 1XFLA 5AN1A 3FR3A 2L6CA 4MH2A 1PN9A 2IJYA 1MDJA 3KZQA 2WFCA 1SL1B 3TB2A 5FWGA 3O6TA 4JRRA 1I5GA 1FW1A 4GRFA 1F3BA 2H6YA 5CAXA 2FA4A 4LMVA 2XPEA 1WJKA 1TU8A 4GQFA 4OWYA 3HJOA 4IVFA 4CW9A 2IFQA 3KTLA 5ECOB 3QR6A 5D9TA 3VK9A 5J9CA 5CP1A 1GRXA 2M72A 2RUFA 4NV5A 1F37A 2C0GA 3C71A 2P0GA 5G1KA 1N8JA 1VF2A 1GP1A 2GZYA 4TXOB 5EPFA 2H75A 3I43A 3RAZA 2J23A 11GSA 1I9DA 1M9BA 4HI7A 4MDCA 5EVOA 1AC1A 4LMWA 2VD0A 4ZL9A 5ID2A 4KAEA 3LQ7A 2F8FA 3TJFA 1C72A 1OYJA 2YJHA 1VF1A 4BA7A 2BTOT 1MTCA 1XOBA 2N5AA 4HQSA 1XCCA 4L8EA 5D73A 2GSQA 3KEBA 3UBKA 5ECKB 5F0GA 4WBRD 1EP7A 2HZFA 1XW9A 2AV4A 3D5JA 3CSIA 3LJRA 3N9JA 2R4VA 2PBJA 4LA1A 2IMKA 4G9HA 4IQ1A 4G19A 3QAWA 1AAZA 4WKWA 3KCMA 3Q19A 2PN8A 1S3CA 1F9MA 4ECCA 1OKTA 4N0VA 3GFKA 1SK2A 2AHEA 1XWBA 4OFMA 2VCVA 1YDKA 4KCAA 2HSHA 1JLVA 2PMTA 3HCZA 3KP9A 1ZL9A 1T4YA 1YKCA 2FGXA 2OADA 3BCKA 1XWGA 1V40A 1YF0A 4BPYA 2KOKA 2AYTA 1R5AA 3GKXA 2GSRA 1T3BA 4V1Ap 5E59A 2CX4A 2HNLA 3VI5A 2LRNA 3F63A 1OAZA 1U87A 2YWIA 3RBTA 5CO3A 3GSTA 4G2EA 4MZCA 3DVXA 1Z7PA 3F3QA 1SD8A 1ZMAA 2VCXA 3DVWA 1E2YA 1V98A 1K3LA 4K6XA 2MYGA 3VURA 3J7Yb 2H1AA 3UJ1A 1XXUA 3IK7A 5KN3A 1OE7A 3LORA 2CVDA 4MJBA 2FLSA 2RLIA 2YANA 5JWRB 1T00A 5DALB 1FVKA 4XS1A 2B6MA 2FNOA 4FH8A 1YY7A 2EIRA 2LKUA 3GX8A 4RI7A 1XWCA 2IN3A 3RPNA 2B1LA 2GTUA 3D6IA 1T7PB 6GSWA 1M2AA 5INYA 3KIJA 3FZ4A 2WDUA 1GSSA 2C3QA 2D2ZA 1AQVA 3A3TA 4J2FA 1TRVA 4Q5NA 3NZNA 1JZOA 1GSEA 3DD3A 4CHSA 1ZYEA 3TKSA 5CREA 2FA8A 2A2SA 5ELGA 1OC9A
chains in the Genus database with same CATH superfamily
1THOA 1BRSA 4CPKA 4MMMA 1MWRA 1QMAA 4STDA 4PQIA 2MMNA 3LFLA 1ZCPA 4N6OB 2JL4A 5KEJA 3PINA 1RJOA 3WT2A 1AR0A 3EF8A 1BVIA 1RQMA 2XBIA 3KFQC 1NHYA 2CX0A 1HU9A 4JF8A 2MMAA 2W56B 2G2QA 5B7CA 1Q7HA 1TFKA 2CVBA 1NHOA 4WYKB 1OHPA 3RHBA 2CFGA 3ZYWA 1YEPA 2BU4A 3Q74A 3EINA 1HQOA 3WGXA 3TGZA 4MZBA 4XS4B 3MAKA 5JCWA 1CYVA 3OWUA 3GRDA 5L71A 5DREA 4ID0A 3GL3A 2RUEA 1JB4A 2A4VA 3GH6A 1GH2A 2CAQA 1RDSA 3MKIA 4PNFA 5IMDA 3E0UA 4MPFA 3M8NA 3QOUA 1K28A 4KB3A 1Z1SA 1QXHA 5M19A 4RNZA 1BNRA 1GLPA 1BAYA 4I97A 1XVQA 1IQXA 1IV7A 1EGRA 4R9KA 4K1UA 3M1GA 1OVNA 3D79A 5LC7A 4N10A 2QC7A 1ERVA 4YAVA 1Z9HA 1JZRA 1W6CA 2PUKC 3KTBA 2H0HA 1QJGA 1ILOA 3F3RA 3X42A 2CA8A 3MSZA 4FMAA 3AY8A 3L9UA 3ZFZA 1TP9A 2G0FA 3NM7A 3M9JA 3CCE3 1O7UA 2GDRA 4WWUC 2HSYA 1FO5A 1VQ53 4JE1A 1IV9A 4YQMA 4ECBA 2EC4A 3CRUA 2XHFA 1OF5A 1GNEA 4HU7A 2ZNMA 1EUIC 1I3FA 5A5KA 2JZTA 2VLTA 3K0ZA 4EV5A 5KOXA 1BANA 3M9KA 5H5SA 4MK3A 5DCGA 2WULA 4AKZA 5CK6A 1UA5A 3NBJA 3PGTA 3WOEB 2A4HA 2LEGA 2Z76A 1AW9A 1T8EB 2IUKA 3GN3A 5ECNB 1Y25A 1GUMA 3WR2A 2ALBA 3ZIJA 1W4VA 4HDEA 2GSSA 3QCPA 4RUVA 1FVJA 3NX0A 1G6WA 5CRDA 1QFNA 1BX9A 2C10A 4IN0A 1M9AA 1JJ22 6GSVA 7GSPA 3ZREA 1GL8A 1E3VA 3WDGB 2VUPA 5BVBA 3L78A 1SK1A 1W02A 3JUMA 3T8UA 4IJ3A 1YJ6A 3D21A 1KD14 4NREA 4PGTA 5GSSA 2YWOA 1L5GB 1IYIA 3UVTA 2TIRA 2YZUA 4IGJA 1RLSA 1D6YA 2OBIA 3O3TA 1U3IA 2PVQA 3MG1A 1X9WB 3HXSA 2O87A 5JWOB 3SXXA 1YZXA 3TJJA 1GY6A 3CNXA 3CCR3 3LSZA 1G02A 2CK3H 1G96A 3MPHA 4PXOA 1J08A 1RNBA 1SYRA 2V6OA 1O85A 4DSRA 1XVWA 2F8AA 2HMJB 4HKVB 1PQNA 3VFIA 1XW5A 2UX0A 3AGOA 1PD21 2R2JA 4N6LA 4OFTA 3ZMKA 4Q5FA 3HVNA 2CFKA 1W89A 2M46A 3F6FA 3LEFA 2DMLA 4KFEA 4HZ4A 5BMUA 1N8R4 2W2CA 1LRAA 3CCV3 4BVXB 2WGRA 3WA3A 5CRWA 2K54A 2WS2A 3WYWA 2PU9C 3EC3A 2R5GA 2D42A 2QA1A 1GSYA 4BVYB 1VRSD 2FXTA 2RM6A 3OR5A 4K0GA 2E2UA 4FMCA 2H19A 1US1A 2GQLA 3UMAA 1OGXA 4HM7B 5JPPA 2BJXA 2XGLA 1TW9A 5DBQA 1BQ7A 1IU7A 4ECIA 2AAEA 1K0OA 1A2LA 3CC43 2F51A 1NB3I 2P5QA 4KE3A 1VQP3 3UARA 1YNVX 2GGTA 2E0QA 5IMZA 1EGOA 4KF9A 2Y73A 3G0KA 2HZEA 4DSQA 2LYXA 4YKGA 3B7CA 3N8BA 4G10A 3FY7A 3ERWA 3SBCA 3N9HA 3D22A 4KZ1A 5IMFA 3A2XA 4MF6A 1QUWA 1W6YA 3NM2A 4NHFA 2V6KA 3FR6A 1JHBA 3D5IA 1F2EA 4TR1A 1WRYA 1UGIA 3CYNA 1JBTA 5G30A 1FGOA 2HOHA 4MMYB 4NXIA 4KH7A 2E7PA 3PS8A 4BWQA 3X40A 4KDYA 3MHEA 2VM1A 4ZL7A 1UVZA 3GH9A 2M7OA 1B3SA 1WIKA 2GT6A 1F6MC 1TIJA 3FK8A 1BGSA 3F8HA 4EC0A 1VF4A 1STDA 3I9V2 4F03A 3SOAA 1H75A 1S3AA 3VPTA 4GSNA 4K1VA 3V99A 3G7JA 5GAND 1SIHA 4NHWA 1H4OA 2DSAA 2K18A 5AIIA 5ECHB 2PGTA 1NSWA 3IAS2 4X43A 3EHCA 3F0IA 3C1RA 2XEPA 5JCGA 1VQL3 1MDIA 3IV4A 4AGSA 3O76A 3F8XA 3DKSA 4Z2TA 1VQN3 5IIZA 2CFDA 1Q42A 2HXKA 5JPUA 1IVVA 5DAKB 1C54A 2LJAA 5D9XA 2DIYA 1VQM3 3KP8A 3BNBA 3L0HA 1QVF2 1SKRB 2H1DA 2IY2A 5A4VA 2CKFB 3G4S3 1PL1A 2L5OA 4EDYA 2NTOA 2VLUA 4BVYA 2IPAA 3RNTA 1GOUA 4O32A 1SL0B 3FG4A 3UL5A 1JZWA 4K2XA 4ZXGA 2B5YA 1F8NA 5DDLA 3CU3A 2NBSA 1SARA 2B3SA 4K1FA 3CSJA 1GTAA 3A2VA 3UL3A 3HA9A 4CDOA 2WOHA 2VCTA 2H0IA 2F5WA 3F7SA 4XRDA 2C4BA 1FYSA 3SX1A 1M3IA 1V9WA 3KM6A 1OE8A 1VQ63 2LNTA 2X64A 4MNNA 1SPUA 1Z3EA 1BNSA 1SJ6A 5IMVA 3BCIA 2VL9A 4HZ2A 4TXVA 4KNDA 4HJ2A 3HYPA 3JUNA 1ROAA 2P0MA 4OD7A 1WP0A 4AF2A 1BSCA 1XIYA 1O8XA 2YFLB 2C1YA 4KA0A 2C3NA 3D4TA 1B20A 3ZIVA 2HE3A 2OCTA 1ML6A 3JVCA 5B6NA 1B4PA 1MD3A 1E3RA 1XWAA 2I81A 4LL4B 3PZWA 1JFUA 4RI6A 1GSDA 5M1AA 1I70A 4RZMA 4ECJA 1RCKA 4G1MB 1CYUA 4TRXA 3KGKA 3G9BA 1GSUA 3UOMA 1BRJA 1ACVA 5IMAA 3WOFB 1J9BA 4TW5A 5HQPA 2LV3A 3ME8A 3P7XA 3CMIA 3L4NA 5HR3A 3NV0B 5AGYA 2VO4A 2B7KA 2C0EA 2IMDA 2CVKA 5KN2A 6RNTA 3TKRA 3GZRA 2CX3A 2CG1A 3LWAA 1GOVA 3EVIA 3D4MA 3PCRA 4HQZA 2KHPA 1K734 2P05A 3NBRA 1R26A 3FG1A 1RGFA 3S5CA 5DAKA 1O7WB 2VCZA 4CCVA 1SYXA 3SWLA 4ISDA 3U1WA 2YV9A 22GSA 3BNEA 2GLRA 4PQHA 1SD9A 2O85A 2YX9A 1UW1A 3BJ5A 1ZOFA 4DSSB 4HOJA 5HR0A 3VWVA 2R3XA 3H93A 3LTBA 1RHLA 1YJN3 4ZB6A 1UCIA 2CG0A 4ML6A 4EV2A 3IBHA 3EC9A 1LXEA 1TFOA 1Q4JA 2GT5A 4D73B 3SEDA 2WRTA 1FA3A 1SENA 4EO3A 4HU9A 3EE2A 1OPYA 2KAAA 2L4VA 5DJMA 1HNBA 1BJXA 1G7EA 4USSA 5ECLB 1X5EA 5GZZB 1ERWA 1U88A 1EWXA 3T0UA 4GSTA 3ZG5A 3ZFLA 2R41A 1V74A 2KF4A 2VAFA 4JU5A 2Z7AA 4ZILA 2BMXA 4WFOA 4HYZA 1MNLA 3X3YA 3PCSA 3GZYB 3GKKA 5ECMB 2A2PA 1JB5A 5LNKe 4XHMA 5LD0A 1HYUA 3RHCA 4TXOA 3L9SA 4BTWA 4EF0A 2Q07A 3APOA 3D5GA 3IHGA 1VF3A 1NU3A 3P8WA 1TOFA 2H72A 3K5TA 3EMPA 2OQEA 2BNGA 5BXQA 1GLQA 5IOXA 4MZWA 3B4OA 2FWFA 3KD0A 2HMKB 4HAAA 3RDWA 1RN4A 4XBYA 1W6GA 2HSMA 3BB9A 3IOSA 1GD3A 4ZB9A 3DH2A 1TRQA 3HZPA 5D81A 1WMJA 3EU3A 1DYUA 2PZVA 3FZ5A 17GSA 4LLRA 3KJYA 3NXJA 3FLJA 2ZHXB 1EV4A 3U6VA 3QK9A 2B5XA 1PRXA 5KP1A 4MMZB 4KGIA 1J0FA 3F40A 1KNGA 1UUVB 4K5SA 4WXTA 4RNTA 2XH9A 4OVMA 1KEBA 1UCJA 1MWUA 1VQ93 2L1SA 1YEXA 2GEXA 2GU3A 3TJBA 10GSA 2OJLA 3TKSC 3DXOA 2ZDJA 1HKXA 1BAOA 4YKFA 3QRDA 2B5EA 5J3RA 5KN0A 1K3YA 3NUVA 2C0DA 4OMVA 1PA3A 4XCSA 1SKSB 4I5QA 1A2JA 5C04A 4FYBA 3TCOA 4HSCX 2HMNB 1DE3A 5A4WA 2OA7A 2AJQB 2GU1A 4DSSA 4Q53A 1NWWA 1UI7A 5HR1A 5AIFA 3KSPA 1TI3A 3FHKA 4FYUA 3BLZA 5H5QA 1RRLA 4AJ8A 4YQUA 4O5UA 3HIGA 4TR4A 4EVMA 4A5PA 2UZ8A 3TRXA 4WHAA 1NB5I 3GRXA 2I9WA 2DC5A 3ZTLA 2STDA 3M0FA 1TP6A 2VM2A 2WZ9A 6GSPA 4WR4A 1RNTA 4E8HA 4V2NA 4JZQA 1U8CB 4F2IA 4KUNA 2JADA 1M3JA 3FKFA 3VGNA 5LCZA 1K0DA 2IMFA 2JACA 1B27A 2XRXB 3F9UA 1GS3A 1IYHA 3HD5A 3DEXA 1B2ZA 2YN1A 2JZSA 1I2GA 3O8YA 5KOWA 4IW9A 4GSSA 2YCDA 3M8CA 2XFSA 5FW5A 5RNTA 2XGNA 9GSSA 5AISA 3WD6A 3VLNA 2HRKA 2H74A 1ZYQB 4G0IA 4MJCA 1YVSA 4CY8A 3URPA 1PSQA 3H4KA 3TOUA 4ML1A 1B9YC 3X41A 3DM8A 4NHZA 1WMPA 1K0CA 1R5PA 1S3DA 2E2VA 2MBTA 4HVNA 1YJW3 5AIGA 4H3UA 2AAWA 3Q6OA 2IYJA 2GZPA 1LVNA 1BRKA 1CH0A 4BL7A 4NAXA 2W6JH 4WBJA 1JBSA 2KF3A 1HYFA 2BIRA 2J8XB 5J9BA 1RGGA 3GTUB 4HM2B 1PGTA 4O8SA 1YGWA 3H8QA 4TN8A 3N5OA 3DGMA 2QIYA 1PL2A 1FG4A 3F6DA 4X0XA 3K9MC 3TKQA 1N9JA 1BRGA 1BNEA 2QKEA 3QFBC 5G5EA 2LRCA 3A76A 1LOXA 5AIVA 1R4YA 5FT3A 5J41A 1M7TA 2C80A 2CFWA 2H66A 4IELA 3DGQA 4GB5A 4XDVA 2SARA 4Q5RA 3F8UA 3HK4A 3UEMA 4ZBAA 3P90A 3DYRA 3FR9A 3G7IA 1LOWA 5IG0A 5DALA 2Z77A 5DVBA 3GUSA 3VWUA 1M904 2V1MA 1F3AA 1OC8A 2P38A 1U5OA 4E8EA 3GURA 5EQLA 5ECRB 2OTJ3 4X4JA 1U6TA 1NO3A 4KDUA 5J5NA 3PGBA 3LYKA 1RGAA 1ISKA 3CD63 3LYGA 4TOPA 5CF1A 1LOYA 2IIYA 2FHEA 4PUFC 2LTKA 4OFNA 1QVG2 4FMBA 3STDA 2EIOA 3JUOA 1A8YA 2PNCA 3BU4A 1Z6NA 2AADA 4MLYA 4HM4B 2XF3A 2C8UA 2OE3A 4N11A 4HM6B 2VCQA 3PH9A 1ERUA 3DIEA 2GSTA 1JB2A 1WMNA 3IE3A 2QEX3 3AMOA 2HYXA 2B7JA 5G31A 2XSHB 1MDKA 1N5PA 1K0NA 1W2B2 3W8JA 3VF1A 19GSA 4QL9A 2X8GA 5DQSA 1HD2A 3WT1A 4HZ9B 1NW2A 5G1LA 1OACA 5IEPA 2L4QA 3Q3FA 2PVOC 2YPMA 3ZLPA 1EEMA 1B4QA 4J8TA 2KXGA 3D4AA 4FMDA 1TI1A 3GX0A 2L6DA 3I0YA 2MBSA 4K7IA 2YZHA 5G5FA 4EW5A 4MJDA 5ENUA 1XBSA 1X5DA 1ABAA 2F86B 2FGTA 3FZAA 20GSA 2WGOA 2CC3A 3VWWA 3FKAA 1K0MA 2O8VB 4EBGA 2XPDA 3SLUA 3H1NA 1RGCA 3ER7A 2TRXA 1SQWA 3TJGA 3CCJ3 1X0RA 2WO0A 4PURA 1XW6A 2W56A 1JKGB 4EXRA 2YOIA 1BG5A 3D0ZA 1X9MB 4WYKA 5FHIA 3ERGA 5G2GA 1Z5YE 1DVCA 4POBA 2GZZA 1VQQA 4XS4A 1N9EA 2L5LA 1B21A 4BTYA 3ZRDA 4MCUA 2BMQB 3MG3A 4HJLB 2H1GA 1PX6A 2KUCA 3CNMA 2HI7A 3IMAB 4IJIA 1T2IA 1A8LA 1ZYPA 4ULXA 1B2XA 1B9XC 2I1UA 3F4SA 6GSXA 5IF6A 2MC8A 5IO0A 7GSSA 4MF7A 3EQQB 3C8EA 2H76A 1G7OA 1MEKA 2V41A 3B4PA 5DJLA 5D93A 1FGQA 4H61A 3J7Yd 3C73A 2I3YA 1X1UA 4MF5A 3IJEB 5STDA 4RNYA 2FD3A 1IK3A 4GCIA 4AJ6A 1O7GB 4GWRA 2BHMA 4X1UA 1EA2A 5ECQB 4LGQA 2GVPA 4I4KA 3S28A 1DMQA 3KMOA 1I8VA 1MWTA 1GTBA 1ST9A 3F14A 2R6KA 4OO5A 3L0RA 4ZM8A 3IC8A 3ECFA 2IA7A 3GYKA 3IRAA 3HKRA 3BNDA 2MMOA 3EB8A 5KP4A 3ALAA 3PXMA 1Q864 5D9VA 1ZO2A 4KVHA 2L4CA 2IMEA 1RK4A 3MDKA 4GLTA 5JWQB 4ACSA 1VQO3 2DJKA 5EL8A 2N5FA 1I3IA 3I563 1KC84 2F4YA 1UGHI 6GSTA 3S9FA 3HZ8A 3GZBA 4LMIA 1EOGA 3IDVA 4WF4A 2OTL3 4XM4A 2VL2A 3FEUA 2CV4A 5IPGA 2QGVA 2C11A 1IQ8A 4TKYA 3US3A 2X8HA 4O3VA 3LXTA 2JQ5A 4XTSA 3FG3A 3CTFA 1OC3A 1Y6EA 1MGWA 2L57A 1S723 4EUYA 4F0CA 4ZBBA 1O7HB 3W8SA 1NM3A 4EKZA 1RGEA 3TDGA 2X4AA 1YF1A 2DBCA 1TTOA 2FWHA 3CCU3 1TRUA 2ON5A 2ML6A 4PTSA 1BNIA 5BRTA 1V58A 2IFQB 1TJDA 1IT8A 1BNFA 1BRHA 1A90A 1YIT3 2V1LA 4L8OA 2DJ3A 1TRWA 4HS1A 1M2DA 3ME7A 1AQXA 2H70A 1XWKA 4AJ7A 4HBRA 3AHSA 4FCZA 1E6BA 1JN5B 2JZRA 4F0BA 2Z9SA 1QAKA 2INXA 3HVSA 5B8BA 3U97A 4N30A 2DJ1A 1ZZYA 4BIRA 1VGLA 2W9PA 1AXDA 1ON4A 18GSA 3GNJA 3LG6A 3HHVA 2Y74A 1RW1A 5IPHA 1V57A 4FCMA 4IBPA 1Q40B 3KZTA 5CNWA 1ZS7A 4ZB8A 5KN1A 5ID2B 2W9QA 1Q824 3R2QA 4YAPA 12GSA 5CYYA 1K3OA 2GS3A 2LJRA 1AVLA 3TKPA 4BVXA 1VQ73 1GMQA 4XDWA 2P0XA 2R37A 2DKHA 3DGYA 3VI7A 5H5RA 1SL2B 3HZ4A 3UB1A 3KE7A 5HFIA 4PX1A 2UGIA 3M3MA 4HUAA 4I2UA 3LYPA 5ELAA 2YFJB 1I2EA 2MMZA 3HJMA 4NV2A 3GL5A 4FCJA 1BNGA 4XBTA 1YI23 2BMRB 3F9SA 5D9WA 3D9RA 1RMSA 2MZCA 3EYTA 4H86A 1RGLA 3QAGA 2GQKA 3ERFA 5A4UA 5IEOA 5M18A 1GUKA 3H51A 3GA4A 1T5YA 3LTCA 1TUHA 3FH1A 3HJPA 1O6JA 1GY5A 4N6NB 4FIWA 1I0VA 5HGRA 3CRTA 2SBLA 6GSYA 4FR9A 1Z6MA 3V1WA 1XZOA 3IR4A 4PNGA 3IA1A 1AVKA 3KSED 2X49A 3NIVA 1JBRA 1ASKA 1Q814 1BNJA 1FUTA 4EC6A 3HX8A 2LUSA 5B6MA 2R0PA 1OHSA 3ISOA 4ZL8A 3H3HA 1BYEA 3A2WA 2D1WA 4JR4A 1FOHA 2CAIA 3PR8A 1UUWB 1W00A 4J5KA 1TU7A 3GHAA 3CME3 3QD9A 1M2BA 2OOVC 1LJRA 4ILFA 1JN5A 1T4ZA 1RN7A 2VLVA 2DJJA 1QK8A 1K9M4 2J9HA 3BIRA 2YV7A 2O89A 4FYCA 3G7YA 1K41A 3NQZA 2WJUA 4K9ZA 1T1VA 1C7HA 4XBXA 2E2GA 4YH2A 1N8QA 2K0MA 3W6GA 2OKAA 2H30A 2K3DA 5DCHA 2OQEC 1BU4A 3APQA 4J9AA 4DEJA 2HRFA 5IG5A 2CT6A 1WMOA 1RKYA 1EEJA 2X99A 3H79A 2LQQA 3GSSA 2DJ2A 3EN1B 4RQXA 1YQ1A 3RPPA 3P2AA 3JCML 4GF0A 3IC4A 1OKDA 1ROVA 1PU4A 1BRNL 1LNIA 2CZ2A 2RM5A 2WGQA 2EIQA 3RGRA 5F07A 4FO5A 3A5WA 3K8NA 3ZG0A 2P5RA 1XOAA 5E4WA 14GSA 3LT9A 1WNHA 1TK0B 2HT9A 4NPBA 2QSIA 1KTEA 2XFTA 2W0QA 1SKWB 2I4AA 2KP1A 3LGCA 1DETA 1CEWI 2PWJA 2CIUA 2K6VA 2L59A 3ZZXA 3FF0A 3DMLA 2JDIH 1PFPA 3EU4A 4I6XA 5BIRA 5AEWB 4Z2UA 2B1KA 4NMUA 1IVUA 1RGHA 1TKDB 3UJMA 5DQYA 1VQ83 1GSPA 1TU5A 1ZGXA 5B8AA 3HIIA 2H71A 4K2DA 5GSTA 1X9SB 2ZA4A 3I69A 4BTXA 2GQMA 1NNVA 1GTUA 3QFAC 5D96A 3FYGA 3ZVJA 1TDIA 1X1XA 4OCEA 1Q9EA 1TK8B 2V2GA 4EL1A 3NHXA 5A0OB 2LQVA 3CCM3 4IHUA 2M80A 4OO4A 5IG3A 1RTUA 3GZXB 2K8SA 4YQVA 4KSMA 4JBBA 3OV4A 4POLA 4IP6A 3CXC2 1GSQA 2KF5A 1LU4A 4O2HA 4NWYA 5IMCA 2FCHA 3KH9A 4IT7A 5CRHA 4CDLA 3NV0A 4P3YB 2GSPA 4L0UA 1LNHA 1DE1A 2TRCP 1BUJA 5CLKA 1XG8A 1DE2A 1OC9B 2O3OA 2LS5A 2REMA 4G0KA 2ZUPA 3MWHA 5D83A 4HZBB 1A23A 3TKSE 1M0UA 4X2OA 1YVBI 1FGTA 2GXFA 4LZIA 5F05A 3LZAA 1PMTA 2XR8B 4HEA2 1SJIA 5DRVA 2CQ9A 3E3EA 1MWSA 1BSBA 3GMFA 1SJZA 5G2ZA 2FNQA 2JU5A 3WGEA 1GMRA 2XBQA 2OBKA 4FQUA 3A5EA 2E2TA 4F82A 1UC7A 1OUNA 2K8VA 4HM1B 2HRAA 4D73A 4I8BA 5IQYA 5AIXA 2OE1A 1FUWA 3IPZA 3C7MA 4L7KA 3V92A 3KH7A 5GAPD 2H73A 3MYTA 1GULA 3MWZA 4F9ZA 2WB9A 3DRNA 4MEIA 3IXRA 4L8PA 4JEDA 2ON7A 4IQAA 3HVXA 2F56A 1URMA 1WOUA 2ZL8A 5ECIB 1JZDA 4JRFA 1QGVA 1G0TA 2H6XA 1K0AA 5AEUB 3DGLA 3FSDA 4IIAA 4GXZA 3F4RA 3FRCA 3KIIA 1PX7A 5HR2A 2HFDA 2RGQA 2LNSA 3ZMLA 4IP1A 3UL6A 1T2HA 3I6AA 3HVVA 3ED3A 4PQ1A 5JCUA 2C3TA 2YWNA 1GTIA 3QPMA 1J2BA 2IWTA 2BO9B 4MPGA 4BU4A 1PYLA 5ECSA 2O7KA 2RNTA 1EKMA 1VZZA 1PKWA 4K90B 5IOWA 2MF7A 1EP8A 2P09A 3IK9A 1OF5B 5LC6A 2WCIA 3EWLA 1K0BA 1M1XB 4WEYA 3Q1CA 4I2TA 1YIJ3 3BOAA 1WQLB 1ERTA 4N6V0 1QMVA 5F06A 1B2SA 1DBYA 4HJMA 2H8LA 4QWTA 2IUJA 3Q2PA 2HLSA 1E97A 3PPUA 4KT3B 1D6ZA 3AHWA 1W7CA 4Z2RA 2H0GA 1DSBA 7STDA 4JR6A 4ZBDA 1SK0A 2CHCA 1EZKA 1RRHA 2YJ7A 5F8BA 2CX1A 5GSPA 2OACA 3LXZA 4ORLA 3HY2A 3EMXA 4MJAA 3GV1A 4KX4A 3TUEA 4K8MA 2C0FA 2CH9A 2C4JA 2JSZA 3UVHA 1TRSA 2KLXA 1Q7Y4 5ELJA 4BL3A 3UIWA 4EDZA 3CCQ3 16GSA 1X5CA 3F4TA 5IERA 3Q18A 3EX9A 3WMDA 3VPQA 4KSOA 3V98A 3MNGA 1UI8A 4N0ZA 2VL3A 1O7MB 4V2LA 1GUHA 4XRAA 4IS0A 3LW9A 1A2KA 1O8WA 1WTHA 5KP3A 1X1YA 1O81A 1Z7RA 2F9SA 5J4UA 5IO2A 4N6UA 1FHEA 1HNAA 1AQZA 1UN2A 1CQSA 4XB5A 4J57E 2KP2A 5FGOA 4TX4A 1M1K4 4GL6A 5BU4A 3TJKA 1OCVA 1WE0A 2NDOA 4RQRA 2H1BA 6GSSA 3IHQA 4MJEA 4X2HA 3GKNA 4EXJA 2LJKA 2KCDA 1IQYA 1YKAA 2A2RA 4BWSA 1EV9A 3QMXA 2DMMA 4CY6A 2PPTA 1QALA 1Q98A 4MA9A 5ECPB 4POMA 4WF5A 3HI7A 1UCLA 4R80A 2DLXA 1FGMA 4RBNA 3GTUA 5CXOA 2H6ZA 2JSYA 1GY7A 3JUQA 1O7NB 2OE0A 3ZFBA 4TR0A 4ZIJA 1A24A 4LSOA 3X3XA 3FZ9A 4GQCA 4PUAA 4O7HA 4V2MA 3KN4A 4J56E 1I2FA 1GOYA 1TK5B 3OWYA 3KMNA 2VL2C 2RIIA 4OUQA 3CSHA 3CC73 4J5GA 2FUG2 3CPOA 1ZGNA 2IMJA 1RSNA 2DKIA 3ZITA 2HZEB 2B24B 3MYDA 4K0NA 3UBLA 1QQ2A 3JUPA 4L5LA 3U5RE 1MD4A 1BSEA 4TR1B 4MH3A 1BSAA 2FY6A 4BIKA 4XS6A 4ICYA 1AQWA 1THXA 2R0CA 3HOHA 1GMPA 5ABRA 13GSA 2V32A 1IYYA 3OWSA 1M99A 3FZWA 1FOVA 4O5QA 2LSTA 1S5AA 1WPIA 1WWJA 2X8CA 2W03A 3DGOA 1USBA 3SOYA 1JNQA 3CTGA 2NVLA 2RBIA 2FWEA 2XC2A 2VD1A 3IPTA 1TXXA 1TRPA 3C1SA 5D8IA 5COHA 5CRGA 5IM9A 1PKZA 1EOHA 3IAM2 1R4WA 1I0XA 2YNXA 2FWGA 3VWXA 5ELUA 1JLWA 2LRTA 4Q5QA 3TRPA 3CCS3 2N5BA 3QDNA 2LQOA 3EURA 4HM0B 1SU9A 1O7PB 3J7Yk 1CQGA 1NDOB 3GWRA 3ZVJD 3FCSB 1SIIA 2ZCTA 3CBUA 1HNCA 1SJWA 1TTZA 3MIXA 4EIPA 1MGRA 3DY5A 3N54B 4V1Ag 2HRNA 4O5RA 4QQ7A 3NOFA 4GTUA 1BIRA 4DVCA 3TOTA 5EEOA 2P31A 1VQK3 4MABA 1LBKA 3UAPA 1FUSA 2NPBA 1FB6A 1A0FA 1GSFA 1MOLA 3WODG 3KKGA 1S3RA 3DXBA 1STFI 1DMMA 4PEJA 1G6YA 1O73A 1JKGA 1V2AA 1AUCA 1N2AA 1KBNA 3I553 2DIZA 5JBSA 1BEDA 2AUVA 3TRQA 1IVWA 3WGDA 4MP4A 4TR3A 2A15A 4N3VA 1LQMB 4R9LA 4POKA 3OXAA 3HDCA 3ZL5A 1UDII 3G8ZA 1HZ1A 5IENA 1DUGA 1GNWA 9RNTA 2I9HA 3SYUA 4K7OA 1DMNA 1R7HA 4KW6A 1B48A 4N6MA 2VCWA 4XIHA 3APSA 3CXGA 1A2MA 3L9VA 2YP6A 2CFLA 1B8XA 2CW9A 1ULJB 4L5OA 1A2PA 2DJ0A 3FW2A 1BUQA 2E2MA 1U3AA 1FAAA 1M9GA 2VIMA 3GKMA 4QL7A 5HFKA 4GSPA 4Z7XA 3S67A 4TVEA 2BT3A 2HMOB 3KXOA 1FB0A 4WR5A 1LOVA 1XPVA 2PERA 4L0WA 3G6E3 1GWCA 4KCEA 2UUGC 2VOCA 3QAVA 4WETA 3E9JB 3LOYA 4R4KA 3GIXA 4KDXA 4LL1B 2F3MA 4KFDA 3MG2A 4HM8B 4AKYA 5IW9A 3BD2A 3LMLA 8GSSA 5C00A 1VQ43 1IT7A 2W04A 3DWVA 4EE0A 1ZYNA 1A0RP 2H01A 1A67A 1CQHA 1N5HA 2ES7A 2IL3A 3BBYA 4OCFA 4K7NA 2YWMA 4O92A 6GSUA 2IMIA 3UNLA 1PN0A 1EG9B 3GAXA 2K9FA 5EY6A 1FW7A 1AIUA 3K7CA 1QAFA 3EN8A 3CCL3 4IKHA 5HFGA 3LTDA 2CZ3A 2AB6A 1XFLA 5AN1A 3FR3A 7RNTA 2L6CA 4MH2A 1PN9A 2IJYA 1B2MA 1MDJA 3KZQA 1RGKA 3GSPA 3LXUX 3G713 2R4IA 3EPTA 2WFCA 1SL1B 4MMXB 3TB2A 5FWGA 3O6TA 4JRRA 1I5GA 1FW1A 4GRFA 2QA43 2GEYA 1F3BA 2H6YA 5CAXA 1LQGC 2R0GA 2FA4A 4LMVA 3BNCA 3DUKA 2XPEA 2HMLB 5IG4A 1TU8A 1WJKA 2F5MA 4GQFA 4OWYA 2HMMB 2RCDA 3HJOA 4IVFA 5TGNA 4CW9A 2IFQA 3KTLA 5ECOB 3QR6A 5D9TA 1KQS2 3VK9A 5J9CA 5CP1A 1GRXA 3NQYA 2M72A 5CF2A 5HOHA 3G16A 8CHOA 2RUFA 4NV5A 3Q90A 1F37A 3WHOA 4AEQA 2RFRA 3RGAA 1YJ93 2C0GA 5D82A 2QGUA 2P0GA 3C71A 1OHOA 5G1KA 1N8JA 1VF2A 3LH4A 1GP1A 2GZYA 4TXOB 5EPFA 6STDA 2H75A 3I43A 1W01A 3RAZA 1Y4KA 2J23A 11GSA 1ZX2A 3F7XA 3EBTA 1I9DA 1K8A4 1M9BA 4HI7A 1GYBA 3WA2X 4MDCA 5EVOA 1AC1A 4LMWA 2VD0A 3NBBA 1D6UA 1Q40A 5EVHA 3OW22 1IDPA 4ZL9A 5ID2A 4KAEA 3LQ7A 2F8FA 3TJFA 1C72A 1OYJA 5I97A 2B1XB 2YJHA 1VF1A 4BA7A 2BTOT 3FF2A 1MTCA 3PYJA 1BOXA 4DKIA 1XOBA 1YGEA 3MSOA 2N5AA 1KWIA 1IVXA 4HQSA 1OGZA 1XCCA 1JRQA 4L8EA 3DGNA 5D73A 2GSQA 3A5IA 5AYRB 3KEBA 3KCHA 3UBKA 5ECKB 5F0GA 1BSDA 4WBRD 1EP7A 3E99A 2HZFA 5AYSC 1XW9A 1NJI4 2AV4A 1RN1A 3D5JA 3CSIA 3LJRA 3N9JA 2R4VA 2PBJA 4LA1A 2IMKA 4G9HA 2GBXB 3EJVA 4IQ1A 2OWPA 3AGNA 1X1WA 4G19A 2YFIB 3QAWA 1AAZA 4WKWA 3KCMA 3Q19A 2PN8A 1S3CA 3S27A 1F9MA 4ECCA 2GBWB 1OKTA 4N0VA 3GFKA 1SK2A 4BL2A 2AHEA 1XWBA 4OFMA 2VCVA 1YDKA 4IPBA 4KCAA 2HSHA 1JLVA 3CQFA 2OOVA 3LT8A 2PMTA 3HCZA 3D3LA 3KP9A 1ZL9A 4CJNA 1T4YA 1YKCA 1KSIA 2FGXA 2OADA 3BCKA 1XWGA 4HM5B 1V40A 3SVAA 3K63A 1YF0A 4BPYA 3RDEA 1PY3A 2KOKA 4R1KA 3DMCA 2AYTA 3VSYA 1R5AA 3B8LA 1W2ZA 3GKXA 2GSRA 1T3BA 4V1Ap 5E59A 2CX4A 2HNLA 4BL7B 3VI5A 1FZUA 2XSOB 2LRNA 3F63A 1OAZA 4GHOA 1U87A 2YWIA 1UUGB 3RBTA 5CO3A 3OX9A 4O02B 3GSTA 4G2EA 4MZCA 4KFFA 3DVXA 1Z7PA 3F3QA 1SD8A 1ZMAA 3X3ZA 1FGRA 2QA2A 3FGYA 2CWUA 2VCXA 3DVWA 1E2YA 1V98A 2Z6BA 4LYLB 1K3LA 4K6XA 3EE1A 2MYGA 4K61A 3VURA 1DVDA 4N6TA 2ML5A 3J7Yb 1EQKA 2H1AA 3S29A 3UJ1A 2CWVA 1W5ZA 1YHQ3 3CC23 1XXUA 3IK7A 5KN3A 1OE7A 3LORA 3CMA3 2CVDA 4MJBA 4K5RA 4WP5A 2FLSA 5AIHA 3FMWA 2CWTA 2RLIA 2YANA 4OK0A 1R4CA 8RNTA 5JWRB 1T00A 5DALB 1FVKA 1OH0A 4XS1A 4EYCA 2B6MA 2RSXA 1ULIB 4LEHA 2FNOA 4FH8A 1YY7A 2EIRA 2LKUA 3GX8A 4RI7A 2F99A 1XWCA 2IN3A 3RPNA 3CPW2 2B1LA 1BRIA 1B2UA 2GTUA 3D6IA 1T7PB 1GD4A 6GSWA 2F98A 1M2AA 5INYA 3KIJA 2WOFA 3FZ4A 2WDUA 1GSSA 1AV4A 2C3QA 4EIQA 3EBYA 4HOHA 2D2ZA 1AQVA 3ROBA 3A3TA 4J2FA 2BMOB 1TRVA 3DZLA 3AMOB 4U13A 4Q5NA 1UCKA 3NZNA 4G0LA 1AY7A 1JZOA 5AI1A 1GSEA 2O9UX 1RCLA 3DD3A 4CHSA 2KRTA 1ZYEA 3T8NA 3LTAA 2KF6A 1A2VA 1JV2B 4HM3B 3TKSA 5CREA 2FA8A 1W4NA 2A2SA 1PFOA 5ELGA 3R3EA 1OC9A
chains in the Genus database with same CATH topology
1THOA 4MMMA 4PQIA 2MMNA 3LFLA 1ZCPA 2JL4A 5KEJA 3PINA 3WT2A 1RQMA 2XBIA 1NHYA 2MMAA 2G2QA 5B7CA 2CVBA 1NHOA 3RHBA 3ZYWA 1YEPA 3Q74A 3EINA 1HQOA 3WGXA 3TGZA 4MZBA 4XS4B 3MAKA 5JCWA 5L71A 4ID0A 3GL3A 2RUEA 2A4VA 3GH6A 1GH2A 2CAQA 4PNFA 5IMDA 3E0UA 4MPFA 3M8NA 3QOUA 4KB3A 1QXHA 1GLPA 1BAYA 4I97A 1XVQA 1EGRA 3M1GA 1OVNA 4N10A 2QC7A 1ERVA 4YAVA 1Z9HA 1JZRA 2PUKC 3KTBA 2H0HA 1ILOA 3F3RA 2CA8A 3MSZA 3AY8A 3L9UA 1TP9A 2G0FA 3M9JA 1O7UA 2GDRA 2HSYA 1FO5A 4JE1A 4YQMA 4ECBA 2EC4A 3CRUA 2XHFA 1GNEA 4HU7A 2ZNMA 5A5KA 2JZTA 2VLTA 5KOXA 3M9KA 5H5SA 4MK3A 5DCGA 2WULA 1UA5A 3PGTA 2A4HA 2LEGA 1AW9A 1T8EB 3GN3A 5ECNB 1Y25A 1GUMA 2ALBA 3ZIJA 1W4VA 4HDEA 2GSSA 3QCPA 4RUVA 1FVJA 1G6WA 5CRDA 1QFNA 1BX9A 4IN0A 1M9AA 6GSVA 3ZREA 1GL8A 2VUPA 3L78A 1SK1A 4IJ3A 1YJ6A 3D21A 4PGTA 5GSSA 2YWOA 1IYIA 3UVTA 2TIRA 2YZUA 4IGJA 2OBIA 3O3TA 1U3IA 2PVQA 1X9WB 3HXSA 2O87A 5JWOB 1YZXA 3TJJA 3LSZA 4PXOA 1J08A 1SYRA 2V6OA 1O85A 4DSRA 1XVWA 2F8AA 1PQNA 3VFIA 1XW5A 1PD21 2R2JA 4OFTA 3ZMKA 4Q5FA 1W89A 2M46A 3F6FA 3LEFA 2DMLA 4HZ4A 5BMUA 4BVXB 2WGRA 5CRWA 2WS2A 3WYWA 2PU9C 3EC3A 2R5GA 2QA1A 1GSYA 4BVYB 1VRSD 2RM6A 3OR5A 4K0GA 2H19A 2GQLA 3UMAA 2BJXA 1TW9A 5DBQA 1BQ7A 4ECIA 1K0OA 1A2LA 2F51A 2P5QA 4KE3A 3UARA 2GGTA 2E0QA 5IMZA 1EGOA 4KF9A 2HZEA 4DSQA 4YKGA 4G10A 3FY7A 3ERWA 3SBCA 3D22A 5IMFA 3A2XA 4MF6A 1QUWA 3FR6A 2V6KA 1JHBA 1F2EA 4TR1A 1WRYA 3CYNA 5G30A 4NXIA 4KH7A 2E7PA 4BWQA 4KDYA 2VM1A 4ZL7A 1UVZA 3GH9A 1WIKA 2GT6A 1F6MC 3FK8A 4EC0A 1VF4A 3I9V2 4F03A 1H75A 1S3AA 3VPTA 4GSNA 3G7JA 5GAND 4NHWA 1H4OA 2DSAA 2K18A 5ECHB 2PGTA 1NSWA 3IAS2 4X43A 3F0IA 3C1RA 5JCGA 1MDIA 3IV4A 4AGSA 3O76A 3DKSA 4Z2TA 5IIZA 2HXKA 5DAKB 2LJAA 5D9XA 2DIYA 3KP8A 1SKRB 3L0HA 2H1DA 2IY2A 5A4VA 1PL1A 2L5OA 4EDYA 2NTOA 2VLUA 4BVYA 2IPAA 4O32A 1SL0B 1JZWA 4K2XA 4ZXGA 2B5YA 5DDLA 2NBSA 2B3SA 4K1FA 3CSJA 1GTAA 3A2VA 3UL3A 3HA9A 4CDOA 2VCTA 2H0IA 4XRDA 1V9WA 3KM6A 1OE8A 2LNTA 2X64A 4MNNA 1Z3EA 1SJ6A 5IMVA 3BCIA 2VL9A 4HZ2A 4TXVA 4KNDA 4HJ2A 3HYPA 4OD7A 1WP0A 4AF2A 1XIYA 1O8XA 2C1YA 4KA0A 2C3NA 3D4TA 3ZIVA 2HE3A 1ML6A 5B6NA 1B4PA 1MD3A 1XWAA 2I81A 4LL4B 1JFUA 4RI6A 1GSDA 4TRXA 3KGKA 3G9BA 1GSUA 3UOMA 1ACVA 5IMAA 1J9BA 4TW5A 5HQPA 2LV3A 3P7XA 3ME8A 3CMIA 3L4NA 5HR3A 5AGYA 2VO4A 2B7KA 2C0EA 2IMDA 2CVKA 5KN2A 3TKRA 2CX3A 3LWAA 3EVIA 3D4MA 4HQZA 2KHPA 1R26A 5DAKA 2VCZA 3SWLA 1SYXA 4ISDA 2YV9A 22GSA 2GLRA 4PQHA 1SD9A 2O85A 3BJ5A 1ZOFA 4DSSB 4HOJA 5HR0A 3VWVA 2R3XA 3H93A 4ZB6A 4ML6A 3IBHA 1Q4JA 2GT5A 4D73B 2WRTA 1SENA 4EO3A 4HU9A 3EE2A 5DJMA 1HNBA 1BJXA 1G7EA 4USSA 5ECLB 1X5EA 5GZZB 1ERWA 1U88A 1EWXA 4GSTA 3ZFLA 2VAFA 4JU5A 4ZILA 2BMXA 3GKKA 5ECMB 2A2PA 5LNKe 4XHMA 5LD0A 1HYUA 3RHCA 4TXOA 3L9SA 4EF0A 3APOA 3IHGA 1VF3A 3P8WA 1TOFA 2H72A 3EMPA 1GLQA 5IOXA 4MZWA 2FWFA 3KD0A 3RDWA 2HSMA 3IOSA 4ZB9A 1WMJA 3EU3A 3FZ5A 17GSA 4LLRA 3KJYA 1EV4A 3U6VA 2B5XA 1PRXA 4KGIA 1J0FA 1KNGA 4K5SA 4WXTA 1KEBA 1YEXA 3TJBA 10GSA 2OJLA 3TKSC 4YKFA 2B5EA 5J3RA 5KN0A 1K3YA 2C0DA 4OMVA 1PA3A 4XCSA 1SKSB 4I5QA 1A2JA 5C04A 4FYBA 3TCOA 5A4WA 2AJQB 2OA7A 4DSSA 5HR1A 1TI3A 3FHKA 4FYUA 5H5QA 4AJ8A 4YQUA 4O5UA 4EVMA 4TR4A 4A5PA 2UZ8A 3TRXA 3GRXA 3ZTLA 2DC5A 3M0FA 2VM2A 2WZ9A 4WR4A 4E8HA 4V2NA 4JZQA 4F2IA 4KUNA 2JADA 3FKFA 5LCZA 1K0DA 2IMFA 2JACA 3F9UA 1IYHA 3HD5A 3DEXA 2YN1A 2JZSA 5KOWA 4IW9A 4GSSA 2YCDA 9GSSA 5AISA 3WD6A 3VLNA 2HRKA 2H74A 1ZYQB 4G0IA 4MJCA 4CY8A 1PSQA 3H4KA 3TOUA 4ML1A 1B9YC 4NHZA 1K0CA 1R5PA 1S3DA 2MBTA 3Q6OA 2AAWA 2IYJA 2GZPA 4BL7A 4NAXA 4WBJA 5J9BA 3GTUB 1PGTA 3H8QA 4TN8A 3N5OA 1PL2A 1FG4A 3F6DA 4X0XA 3TKQA 2QKEA 3QFBC 5G5EA 2LRCA 5AIVA 5FT3A 5J41A 1M7TA 2C80A 2H66A 4IELA 3DGQA 4Q5RA 3F8UA 3UEMA 4ZBAA 3P90A 3DYRA 3FR9A 3G7IA 5DALA 5DVBA 3GUSA 3VWUA 2V1MA 1F3AA 1OC8A 4E8EA 3GURA 5ECRB 4X4JA 1U6TA 4KDUA 5J5NA 3LYKA 4TOPA 2IIYA 2FHEA 4PUFC 2LTKA 4OFNA 2EIOA 1A8YA 1Z6NA 4MLYA 2C8UA 2OE3A 4N11A 2VCQA 3PH9A 1ERUA 3DIEA 2GSTA 3IE3A 2HYXA 2B7JA 5G31A 1MDKA 1K0NA 3W8JA 19GSA 4QL9A 2X8GA 5DQSA 1HD2A 3WT1A 1NW2A 5G1LA 2L4QA 2PVOC 2YPMA 3ZLPA 1EEMA 1B4QA 1TI1A 3GX0A 2L6DA 2MBSA 4K7IA 2YZHA 5G5FA 5ENUA 1XBSA 1X5DA 1ABAA 3FZAA 20GSA 3VWWA 1K0MA 2O8VB 2XPDA 3H1NA 2TRXA 3TJGA 1X0RA 4PURA 1XW6A 2YOIA 1BG5A 3D0ZA 1X9MB 5FHIA 3ERGA 1Z5YE 4POBA 2GZZA 4XS4A 2L5LA 3ZRDA 4MCUA 2H1GA 1PX6A 2KUCA 2HI7A 4IJIA 1A8LA 4ULXA 1ZYPA 1B9XC 2I1UA 3F4SA 6GSXA 5IO0A 7GSSA 4MF7A 3C8EA 2H76A 1G7OA 1MEKA 2V41A 5DJLA 5D93A 3C73A 2I3YA 4MF5A 2FD3A 4GCIA 4AJ6A 4GWRA 4X1UA 5ECQB 2GVPA 3KMOA 1GTBA 1ST9A 2R6KA 4OO5A 3IC8A 3GYKA 3IRAA 3HKRA 2MMOA 5D9VA 2L4CA 4GLTA 2IMEA 1RK4A 3MDKA 5JWQB 4ACSA 2DJKA 5EL8A 2N5FA 6GSTA 3S9FA 3HZ8A 1EOGA 3IDVA 4WF4A 2VL2A 3FEUA 2CV4A 5IPGA 2QGVA 4TKYA 3US3A 2X8HA 3LXTA 4XTSA 3CTFA 1OC3A 1Y6EA 2L57A 4EUYA 4F0CA 4ZBBA 3W8SA 1NM3A 4EKZA 3TDGA 2X4AA 1YF1A 2DBCA 2FWHA 1TRUA 2ON5A 4PTSA 5BRTA 1V58A 2IFQB 1TJDA 2DJ3A 1TRWA 4HS1A 1M2DA 3ME7A 1AQXA 2H70A 1XWKA 4AJ7A 1E6BA 2JZRA 4F0BA 2Z9SA 3HVSA 5B8BA 4N30A 2DJ1A 1ZZYA 1VGLA 1AXDA 1ON4A 18GSA 3GNJA 3LG6A 3HHVA 1RW1A 5IPHA 1V57A 4IBPA 5CNWA 4ZB8A 5KN1A 5ID2B 3R2QA 4YAPA 12GSA 5CYYA 1K3OA 2GS3A 2LJRA 3TKPA 4BVXA 2R37A 2DKHA 3VI7A 5H5RA 1SL2B 3HZ4A 5HFIA 4PX1A 3M3MA 4HUAA 4I2UA 3LYPA 5ELAA 2MMZA 3HJMA 4NV2A 3GL5A 5D9WA 2MZCA 3EYTA 4H86A 3QAGA 2GQKA 3ERFA 5A4UA 1GUKA 3GA4A 3HJPA 1O6JA 4FIWA 3CRTA 6GSYA 1Z6MA 3V1WA 1XZOA 3IR4A 4PNGA 3IA1A 2X49A 3NIVA 2LUSA 5B6MA 2R0PA 3ISOA 4ZL8A 1BYEA 3A2WA 4JR4A 1FOHA 2CAIA 3PR8A 1TU7A 3GHAA 3QD9A 1M2BA 1LJRA 4ILFA 1T4ZA 2VLVA 2DJJA 1QK8A 2J9HA 2YV7A 2O89A 4FYCA 3G7YA 2WJUA 4K9ZA 1T1VA 2E2GA 4YH2A 3W6GA 2OKAA 2H30A 5DCHA 3APQA 4DEJA 2HRFA 2CT6A 1EEJA 2X99A 3H79A 2LQQA 3GSSA 2DJ2A 4RQXA 1YQ1A 3RPPA 3P2AA 3JCML 4GF0A 3IC4A 1OKDA 2CZ2A 2RM5A 2EIQA 5F07A 4FO5A 3A5WA 3K8NA 2P5RA 1XOAA 5E4WA 14GSA 1TK0B 2HT9A 4NPBA 2QSIA 1KTEA 1SKWB 2I4AA 2KP1A 3LGCA 2PWJA 2K6VA 2L59A 3ZZXA 3DMLA 3EU4A 4I6XA 4Z2UA 2B1KA 4NMUA 1TKDB 5DQYA 5B8AA 2H71A 4K2DA 5GSTA 1X9SB 3I69A 2GQMA 1GTUA 3QFAC 3ZVJA 5D96A 3FYGA 1TDIA 4OCEA 1TK8B 2V2GA 4EL1A 4IHUA 2M80A 4OO4A 2K8SA 4YQVA 4KSMA 4JBBA 4POLA 4IP6A 1GSQA 1LU4A 5IMCA 4NWYA 2FCHA 3KH9A 5CRHA 4P3YB 4L0UA 1DE1A 2TRCP 1DE2A 1OC9B 2LS5A 2REMA 4G0KA 2ZUPA 3MWHA 1A23A 3TKSE 1M0UA 5F05A 1PMTA 4HEA2 1SJIA 2CQ9A 3E3EA 3GMFA 1SJZA 5G2ZA 2JU5A 3WGEA 2XBQA 2OBKA 4FQUA 4F82A 1UC7A 2K8VA 2HRAA 4D73A 4I8BA 5IQYA 5AIXA 2OE1A 3IPZA 3C7MA 3KH7A 5GAPD 2H73A 1GULA 4F9ZA 2WB9A 3DRNA 3IXRA 4JEDA 2ON7A 4IQAA 3HVXA 1URMA 1WOUA 5ECIB 1JZDA 1QGVA 1G0TA 2H6XA 1K0AA 4GXZA 3F4RA 3FRCA 1PX7A 5HR2A 2HFDA 2LNSA 3ZMLA 4IP1A 3I6AA 3HVVA 3ED3A 4PQ1A 5JCUA 2C3TA 2YWNA 1GTIA 3QPMA 2IWTA 4MPGA 5ECSA 2O7KA 1PKWA 5IOWA 1EP8A 3IK9A 2WCIA 3EWLA 1K0BA 4WEYA 4I2TA 3BOAA 1ERTA 1QMVA 5F06A 1DBYA 4HJMA 2H8LA 2HLSA 3PPUA 4Z2RA 2H0GA 1DSBA 4JR6A 4ZBDA 1SK0A 1EZKA 2YJ7A 5F8BA 2OACA 3LXZA 3HY2A 4MJAA 3EMXA 3GV1A 4KX4A 3TUEA 4K8MA 2C0FA 2C4JA 2JSZA 3UVHA 1TRSA 2KLXA 3UIWA 4EDZA 16GSA 1X5CA 3F4TA 3Q18A 3VPQA 4KSOA 3MNGA 4N0ZA 2VL3A 4V2LA 1GUHA 4XRAA 4IS0A 3LW9A 1O8WA 1O81A 1Z7RA 2F9SA 5J4UA 5IO2A 1FHEA 1HNAA 1UN2A 4J57E 2KP2A 3TJKA 1WE0A 2NDOA 4RQRA 2H1BA 6GSSA 3IHQA 4MJEA 3GKNA 4EXJA 2LJKA 1YKAA 2A2RA 4BWSA 1EV9A 3QMXA 2DMMA 4CY6A 2PPTA 1Q98A 4MA9A 5ECPB 4POMA 4WF5A 2DLXA 3GTUA 2H6ZA 2JSYA 1A24A 2OE0A 3ZFBA 4TR0A 4ZIJA 3FZ9A 4GQCA 4PUAA 4O7HA 4V2MA 4J56E 1TK5B 3KMNA 2VL2C 2RIIA 3CSHA 2FUG2 1ZGNA 2DKIA 3ZITA 2HZEB 3MYDA 4K0NA 3UBLA 1QQ2A 4L5LA 3U5RE 1MD4A 4TR1B 4MH3A 2FY6A 4XS6A 4ICYA 1AQWA 1THXA 2R0CA 5ABRA 13GSA 2V32A 1M99A 1FOVA 4O5QA 2LSTA 1WPIA 1WWJA 2X8CA 1USBA 3CTGA 2NVLA 2FWEA 2XC2A 2VD1A 1TXXA 3C1SA 5D8IA 5COHA 5CRGA 5IM9A 1PKZA 1EOHA 3IAM2 1R4WA 2YNXA 2FWGA 3VWXA 1JLWA 2LRTA 4Q5QA 3TRPA 2N5BA 3QDNA 2LQOA 3EURA 1SU9A 3J7Yk 1CQGA 3ZVJD 2ZCTA 3CBUA 1HNCA 1TTZA 3MIXA 4EIPA 4V1Ag 2HRNA 4O5RA 4QQ7A 3NOFA 4GTUA 4DVCA 3TOTA 2P31A 4MABA 1LBKA 3UAPA 2NPBA 1FB6A 1A0FA 1GSFA 3DXBA 1G6YA 1O73A 1V2AA 1AUCA 1N2AA 1KBNA 2DIZA 1BEDA 2AUVA 3TRQA 3WGDA 4MP4A 4TR3A 4POKA 3ZL5A 3HDCA 1DUGA 1GNWA 2I9HA 4K7OA 1R7HA 4KW6A 1B48A 2VCWA 4XIHA 4ECJA 3APSA 3CXGA 1A2MA 3L9VA 2YP6A 1B8XA 4L5OA 2DJ0A 3FW2A 2E2MA 1U3AA 1FAAA 2VIMA 3GKMA 4QL7A 5HFKA 4Z7XA 4TVEA 3KXOA 1FB0A 4WR5A 1XPVA 2PERA 4L0WA 1GWCA 4KCEA 2VOCA 3QAVA 4WETA 3E9JB 3GIXA 4KDXA 4LL1B 2F3MA 3BD2A 8GSSA 5C00A 3DWVA 4EE0A 1ZYNA 1A0RP 2H01A 1CQHA 2ES7A 2IL3A 3BBYA 4OCFA 4K7NA 2YWMA 4O92A 6GSUA 2IMIA 1PN0A 2K9FA 5EY6A 1AIUA 4IKHA 5HFGA 2CZ3A 2AB6A 1XFLA 5AN1A 3FR3A 2L6CA 4MH2A 1PN9A 2IJYA 1MDJA 3KZQA 3EPTA 2WFCA 1SL1B 3TB2A 5FWGA 3O6TA 4JRRA 1I5GA 1FW1A 4GRFA 1F3BA 2H6YA 5CAXA 2R0GA 2FA4A 4LMVA 2XPEA 1WJKA 1TU8A 4GQFA 4OWYA 3HJOA 4IVFA 4CW9A 2IFQA 3KTLA 5ECOB 3QR6A 5D9TA 3VK9A 5J9CA 5CP1A 1GRXA 2M72A 2RUFA 4NV5A 1F37A 2C0GA 3C71A 2P0GA 5G1KA 1N8JA 1VF2A 1GP1A 2GZYA 4TXOB 5EPFA 2H75A 3I43A 3RAZA 2J23A 11GSA 1I9DA 1M9BA 4HI7A 4MDCA 5EVOA 1AC1A 4LMWA 2VD0A 4ZL9A 5ID2A 4KAEA 3LQ7A 2F8FA 3TJFA 1C72A 1OYJA 2YJHA 1VF1A 4BA7A 2BTOT 1MTCA 1XOBA 2N5AA 4HQSA 1XCCA 4L8EA 5D73A 2GSQA 3A5IA 3KEBA 3UBKA 5ECKB 5F0GA 4WBRD 1EP7A 2HZFA 1XW9A 2AV4A 3D5JA 3CSIA 3LJRA 3N9JA 2R4VA 2PBJA 4LA1A 2IMKA 4G9HA 4IQ1A 4G19A 3QAWA 1AAZA 4WKWA 3KCMA 3Q19A 2PN8A 1S3CA 1F9MA 4ECCA 1OKTA 4N0VA 3GFKA 1SK2A 2AHEA 1XWBA 4OFMA 2VCVA 1YDKA 4KCAA 2HSHA 1JLVA 2PMTA 3HCZA 3KP9A 1ZL9A 1T4YA 1YKCA 2FGXA 2OADA 3BCKA 1XWGA 1V40A 1YF0A 4BPYA 2KOKA 2AYTA 1R5AA 3GKXA 2GSRA 1T3BA 4V1Ap 5E59A 2CX4A 2HNLA 4BL7B 3VI5A 2LRNA 3F63A 1OAZA 1U87A 2YWIA 3RBTA 5CO3A 3GSTA 4G2EA 4MZCA 3DVXA 1Z7PA 3F3QA 1SD8A 1ZMAA 2QA2A 2VCXA 3DVWA 1E2YA 1V98A 1K3LA 4K6XA 2MYGA 3VURA 3J7Yb 2H1AA 3UJ1A 1XXUA 3IK7A 5KN3A 1OE7A 3LORA 2CVDA 4MJBA 4K5RA 2FLSA 3FMWA 2RLIA 2YANA 5JWRB 1T00A 5DALB 1FVKA 4XS1A 2B6MA 2FNOA 4FH8A 1YY7A 2EIRA 2LKUA 3GX8A 4RI7A 1XWCA 2IN3A 3RPNA 2B1LA 2GTUA 3D6IA 1T7PB 6GSWA 1M2AA 5INYA 3KIJA 3FZ4A 2WDUA 1GSSA 2C3QA 4EIQA 2D2ZA 1AQVA 3A3TA 4J2FA 1TRVA 4Q5NA 3NZNA 4G0LA 1JZOA 1GSEA 3DD3A 4CHSA 1ZYEA 3TKSA 5CREA 2FA8A 2A2SA 5ELGA 3R3EA 1OC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1THO A;  4MMM A;  4PQI A;  2MMN A;  3LFL A;  1ZCP A;  2JL4 A;  5KEJ A;  3PIN A;  3WT2 A;  1RQM A;  2XBI A;  1NHY A;  2MMA A;  2G2Q A;  5B7C A;  2CVB A;  1NHO A;  3RHB A;  3ZYW A;  1YEP A;  3Q74 A;  3EIN A;  1HQO A;  3WGX A;  3TGZ A;  4MZB A;  4XS4 B;  3MAK A;  5JCW A;  5L71 A;  4ID0 A;  3GL3 A;  2RUE A;  2A4V A;  3GH6 A;  1GH2 A;  2CAQ A;  4PNF A;  5IMD A;  3E0U A;  4MPF A;  3M8N A;  3QOU A;  4KB3 A;  1QXH A;  1GLP A;  1BAY A;  4I97 A;  1XVQ A;  1EGR A;  3M1G A;  1OVN A;  4N10 A;  2QC7 A;  1ERV A;  4YAV A;  1Z9H A;  1JZR A;  2PUK C;  3KTB A;  2H0H A;  1ILO A;  3F3R A;  2CA8 A;  3MSZ A;  3AY8 A;  3L9U A;  1TP9 A;  2G0F A;  3M9J A;  1O7U A;  2GDR A;  2HSY A;  1FO5 A;  4JE1 A;  4YQM A;  4ECB A;  2EC4 A;  3CRU A;  2XHF A;  1GNE A;  4HU7 A;  2ZNM A;  5A5K A;  2JZT A;  2VLT A;  3M9K A;  5H5S A;  4MK3 A;  5DCG A;  2WUL A;  1UA5 A;  3PGT A;  2LEG A;  1AW9 A;  1T8E B;  3GN3 A;  5ECN B;  1Y25 A;  1GUM A;  2ALB A;  3ZIJ A;  1W4V A;  4HDE A;  2GSS A;  3QCP A;  4RUV A;  1FVJ A;  1G6W A;  5CRD A;  1QFN A;  1BX9 A;  4IN0 A;  1M9A A;  6GSV A;  3ZRE A;  1GL8 A;  2VUP A;  3L78 A;  1SK1 A;  4IJ3 A;  1YJ6 A;  3D21 A;  4PGT A;  5GSS A;  2YWO A;  1IYI A;  3UVT A;  2TIR A;  2YZU A;  4IGJ A;  2OBI A;  3O3T A;  1U3I A;  2PVQ A;  1X9W B;  3HXS A;  2O87 A;  5JWO B;  1YZX A;  3TJJ A;  3LSZ A;  4PXO A;  1J08 A;  1SYR A;  2V6O A;  1O85 A;  4DSR A;  1XVW A;  2F8A A;  1PQN A;  3VFI A;  1XW5 A;  1PD2 1;  2R2J A;  4OFT A;  3ZMK A;  4Q5F A;  1W89 A;  2M46 A;  3F6F A;  3LEF A;  2DML A;  4HZ4 A;  2WGR A;  5CRW A;  2WS2 A;  3WYW A;  2PU9 C;  3EC3 A;  2R5G A;  1GSY A;  1VRS D;  2RM6 A;  3OR5 A;  4K0G A;  2H19 A;  2GQL A;  3UMA A;  2BJX A;  1TW9 A;  5DBQ A;  1BQ7 A;  4ECI A;  1K0O A;  1A2L A;  2F51 A;  2P5Q A;  4KE3 A;  3UAR A;  2GGT A;  2E0Q A;  5IMZ A;  1EGO A;  2HZE A;  4DSQ A;  4G10 A;  3FY7 A;  3ERW A;  3SBC A;  3D22 A;  5IMF A;  3A2X A;  4MF6 A;  1QUW A;  3FR6 A;  2V6K A;  1JHB A;  1F2E A;  4TR1 A;  1WRY A;  3CYN A;  5G30 A;  4NXI A;  4KH7 A;  2E7P A;  4BWQ A;  4KDY A;  2VM1 A;  4ZL7 A;  1UVZ A;  3GH9 A;  1WIK A;  2GT6 A;  1F6M C;  3FK8 A;  4EC0 A;  1VF4 A;  3I9V 2;  4F03 A;  1H75 A;  1S3A A;  3VPT A;  4GSN A;  3G7J A;  5GAN D;  4NHW A;  1H4O A;  2DSA A;  2K18 A;  5ECH B;  2PGT A;  1NSW A;  3IAS 2;  4X43 A;  3F0I A;  3C1R A;  5JCG A;  1MDI A;  3IV4 A;  4AGS A;  3O76 A;  3DKS A;  5IIZ A;  2HXK A;  5DAK B;  5D9X A;  2LJA A;  2DIY A;  3KP8 A;  1SKR B;  3L0H A;  2H1D A;  2IY2 A;  5A4V A;  1PL1 A;  2L5O A;  4EDY A;  2NTO A;  2VLU A;  4BVY A;  2IPA A;  4O32 A;  1SL0 B;  1JZW A;  4ZXG A;  2B5Y A;  5DDL A;  2NBS A;  2B3S A;  4K1F A;  3CSJ A;  1GTA A;  3A2V A;  3UL3 A;  3HA9 A;  4CDO A;  2VCT A;  2H0I A;  4XRD A;  1V9W A;  3KM6 A;  1OE8 A;  2LNT A;  2X64 A;  1Z3E A;  1SJ6 A;  5IMV A;  3BCI A;  2VL9 A;  4HZ2 A;  4TXV A;  4KND A;  4HJ2 A;  3HYP A;  4OD7 A;  1WP0 A;  4AF2 A;  1XIY A;  1O8X A;  2C1Y A;  4KA0 A;  2C3N A;  3D4T A;  3ZIV A;  2HE3 A;  1ML6 A;  5B6N A;  1B4P A;  1MD3 A;  1XWA A;  2I81 A;  4LL4 B;  1JFU A;  4RI6 A;  1GSD A;  4TRX A;  3KGK A;  3G9B A;  1GSU A;  3UOM A;  1ACV A;  5IMA A;  1J9B A;  4TW5 A;  5HQP A;  2LV3 A;  3P7X A;  3ME8 A;  3CMI A;  3L4N A;  5HR3 A;  5AGY A;  2VO4 A;  2B7K A;  2C0E A;  2IMD A;  2CVK A;  5KN2 A;  3TKR A;  2CX3 A;  3LWA A;  3EVI A;  3D4M A;  4HQZ A;  2KHP A;  1R26 A;  5DAK A;  2VCZ A;  3SWL A;  1SYX A;  4ISD A;  2YV9 A;  22GS A;  2GLR A;  4PQH A;  1SD9 A;  2O85 A;  3BJ5 A;  1ZOF A;  4DSS B;  4HOJ A;  5HR0 A;  3VWV A;  2R3X A;  3H93 A;  4ZB6 A;  4ML6 A;  3IBH A;  1Q4J A;  2GT5 A;  4D73 B;  2WRT A;  1SEN A;  4EO3 A;  4HU9 A;  3EE2 A;  5DJM A;  1HNB A;  1BJX A;  1G7E A;  5ECL B;  1X5E A;  5GZZ B;  1ERW A;  1U88 A;  1EWX A;  4GST A;  3ZFL A;  2VAF A;  4JU5 A;  4ZIL A;  2BMX A;  3GKK A;  5ECM B;  5LNK e;  4XHM A;  5LD0 A;  1HYU A;  3RHC A;  4TXO A;  3L9S A;  4EF0 A;  3APO A;  1VF3 A;  3P8W A;  1TOF A;  2H72 A;  3EMP A;  1GLQ A;  5IOX A;  4MZW A;  2FWF A;  3KD0 A;  3RDW A;  3IOS A;  4ZB9 A;  1WMJ A;  3EU3 A;  3FZ5 A;  17GS A;  4LLR A;  3KJY A;  1EV4 A;  3U6V A;  2B5X A;  1PRX A;  4KGI A;  1J0F A;  1KNG A;  4WXT A;  1KEB A;  1YEX A;  3TJB A;  10GS A;  2OJL A;  3TKS C;  2B5E A;  5J3R A;  5KN0 A;  1K3Y A;  2C0D A;  4OMV A;  1PA3 A;  4XCS A;  1SKS B;  4I5Q A;  1A2J A;  5C04 A;  4FYB A;  3TCO A;  5A4W A;  2AJQ B;  2OA7 A;  4DSS A;  5HR1 A;  1TI3 A;  3FHK A;  4FYU A;  5H5Q A;  4AJ8 A;  4YQU A;  4EVM A;  4TR4 A;  3TRX A;  3GRX A;  3ZTL A;  2DC5 A;  3M0F A;  2VM2 A;  2WZ9 A;  4WR4 A;  4E8H A;  4V2N A;  4JZQ A;  4F2I A;  4KUN A;  2JAD A;  3FKF A;  5LCZ A;  1K0D A;  2IMF A;  2JAC A;  3F9U A;  1IYH A;  3HD5 A;  3DEX A;  2YN1 A;  2JZS A;  4IW9 A;  4GSS A;  2YCD A;  9GSS A;  5AIS A;  3WD6 A;  3VLN A;  2H74 A;  1ZYQ B;  4MJC A;  1PSQ A;  3H4K A;  3TOU A;  4ML1 A;  1B9Y C;  4NHZ A;  1K0C A;  1R5P A;  1S3D A;  2MBT A;  3Q6O A;  2AAW A;  2IYJ A;  2GZP A;  4BL7 A;  4NAX A;  4WBJ A;  5J9B A;  3GTU B;  1PGT A;  3H8Q A;  4TN8 A;  3N5O A;  1PL2 A;  1FG4 A;  3F6D A;  4X0X A;  3TKQ A;  2QKE A;  3QFB C;  5G5E A;  2LRC A;  5AIV A;  5FT3 A;  5J41 A;  1M7T A;  2C80 A;  2H66 A;  4IEL A;  3DGQ A;  4Q5R A;  3F8U A;  3UEM A;  4ZBA A;  3P90 A;  3DYR A;  3FR9 A;  3G7I A;  5DAL A;  5DVB A;  3GUS A;  3VWU A;  2V1M A;  1F3A A;  1OC8 A;  4E8E A;  3GUR A;  5ECR B;  1U6T A;  4KDU A;  5J5N A;  3LYK A;  4TOP A;  2IIY A;  2FHE A;  4PUF C;  2LTK A;  4OFN A;  2EIO A;  1A8Y A;  1Z6N A;  4MLY A;  2C8U A;  2OE3 A;  4N11 A;  2VCQ A;  3PH9 A;  1ERU A;  3DIE A;  2GST A;  3IE3 A;  2HYX A;  2B7J A;  5G31 A;  1MDK A;  1K0N A;  3W8J A;  19GS A;  4QL9 A;  2X8G A;  5DQS A;  1HD2 A;  3WT1 A;  1NW2 A;  5G1L A;  2L4Q A;  2PVO C;  2YPM A;  3ZLP A;  1EEM A;  1B4Q A;  1TI1 A;  3GX0 A;  2L6D A;  2MBS A;  4K7I A;  2YZH A;  5G5F A;  5ENU A;  1XBS A;  1X5D A;  1ABA A;  3FZA A;  20GS A;  3VWW A;  1K0M A;  2O8V B;  2XPD A;  3H1N A;  2TRX A;  3TJG A;  1X0R A;  4PUR A;  1XW6 A;  2YOI A;  1BG5 A;  3D0Z A;  1X9M B;  5FHI A;  3ERG A;  1Z5Y E;  4POB A;  2GZZ A;  4XS4 A;  2L5L A;  3ZRD A;  4MCU A;  2H1G A;  1PX6 A;  2KUC A;  2HI7 A;  4IJI A;  1A8L A;  4ULX A;  1B9X C;  2I1U A;  3F4S A;  6GSX A;  5IO0 A;  7GSS A;  4MF7 A;  3C8E A;  2H76 A;  1G7O A;  1MEK A;  2V41 A;  5DJL A;  5D93 A;  3C73 A;  2I3Y A;  4MF5 A;  2FD3 A;  4GCI A;  4AJ6 A;  4GWR A;  4X1U A;  5ECQ B;  2GVP A;  3KMO A;  1GTB A;  1ST9 A;  2R6K A;  4OO5 A;  3GYK A;  3IRA A;  3HKR A;  2MMO A;  5D9V A;  2L4C A;  4GLT A;  2IME A;  1RK4 A;  3MDK A;  5JWQ B;  4ACS A;  2DJK A;  5EL8 A;  2N5F A;  6GST A;  3S9F A;  3HZ8 A;  1EOG A;  3IDV A;  4WF4 A;  2VL2 A;  3FEU A;  2CV4 A;  5IPG A;  2QGV A;  4TKY A;  3US3 A;  2X8H A;  3LXT A;  4XTS A;  3CTF A;  1OC3 A;  1Y6E A;  2L57 A;  4EUY A;  4F0C A;  4ZBB A;  3W8S A;  1NM3 A;  4EKZ A;  3TDG A;  1YF1 A;  2DBC A;  2FWH A;  1TRU A;  2ON5 A;  1V58 A;  2IFQ B;  1TJD A;  2DJ3 A;  1TRW A;  4HS1 A;  1M2D A;  3ME7 A;  1AQX A;  2H70 A;  1XWK A;  4AJ7 A;  1E6B A;  2JZR A;  4F0B A;  2Z9S A;  3HVS A;  5B8B A;  4N30 A;  2DJ1 A;  1ZZY A;  1VGL A;  1AXD A;  1ON4 A;  18GS A;  3GNJ A;  3LG6 A;  3HHV A;  1RW1 A;  5IPH A;  1V57 A;  4IBP A;  5CNW A;  4ZB8 A;  5KN1 A;  5ID2 B;  3R2Q A;  4YAP A;  12GS A;  5CYY A;  1K3O A;  2GS3 A;  2LJR A;  3TKP A;  4BVX A;  2R37 A;  3VI7 A;  5H5R A;  1SL2 B;  3HZ4 A;  5HFI A;  4PX1 A;  3M3M A;  4HUA A;  4I2U A;  3LYP A;  5ELA A;  2MMZ A;  3HJM A;  4NV2 A;  3GL5 A;  5D9W A;  2MZC A;  3EYT A;  4H86 A;  3QAG A;  2GQK A;  3ERF A;  5A4U A;  1GUK A;  3GA4 A;  3HJP A;  1O6J A;  4FIW A;  3CRT A;  6GSY A;  1Z6M A;  3V1W A;  1XZO A;  3IR4 A;  4PNG A;  3IA1 A;  3NIV A;  2LUS A;  5B6M A;  3ISO A;  4ZL8 A;  1BYE A;  3A2W A;  4JR4 A;  2CAI A;  3PR8 A;  1TU7 A;  3GHA A;  3QD9 A;  1M2B A;  1LJR A;  4ILF A;  1T4Z A;  2VLV A;  2DJJ A;  1QK8 A;  2J9H A;  2YV7 A;  2O89 A;  4FYC A;  3G7Y A;  2WJU A;  4K9Z A;  1T1V A;  2E2G A;  4YH2 A;  3W6G A;  2OKA A;  2H30 A;  5DCH A;  3APQ A;  4DEJ A;  2HRF A;  2CT6 A;  1EEJ A;  2X99 A;  3H79 A;  2LQQ A;  3GSS A;  2DJ2 A;  4RQX A;  1YQ1 A;  3RPP A;  3P2A A;  3JCM L;  4GF0 A;  3IC4 A;  1OKD A;  2CZ2 A;  2RM5 A;  2EIQ A;  5F07 A;  4FO5 A;  3A5W A;  3K8N A;  2P5R A;  1XOA A;  5E4W A;  14GS A;  1TK0 B;  2HT9 A;  4NPB A;  2QSI A;  1KTE A;  1SKW B;  2I4A A;  2KP1 A;  3LGC A;  2PWJ A;  2K6V A;  2L59 A;  3ZZX A;  3DML A;  3EU4 A;  4I6X A;  2B1K A;  4NMU A;  1TKD B;  5DQY A;  5B8A A;  2H71 A;  4K2D A;  5GST A;  1X9S B;  3I69 A;  2GQM A;  1GTU A;  3QFA C;  3ZVJ A;  5D96 A;  3FYG A;  1TDI A;  4OCE A;  1TK8 B;  2V2G A;  4EL1 A;  4IHU A;  2M80 A;  4OO4 A;  2K8S A;  4YQV A;  4KSM A;  4JBB A;  4POL A;  4IP6 A;  1GSQ A;  1LU4 A;  5IMC A;  4NWY A;  2FCH A;  3KH9 A;  5CRH A;  4P3Y B;  4L0U A;  1DE1 A;  2TRC P;  1DE2 A;  1OC9 B;  2LS5 A;  2REM A;  2ZUP A;  3MWH A;  1A23 A;  3TKS E;  1M0U A;  5F05 A;  1PMT A;  4HEA 2;  1SJI A;  2CQ9 A;  3E3E A;  3GMF A;  1SJZ A;  5G2Z A;  2JU5 A;  3WGE A;  2XBQ A;  2OBK A;  4F82 A;  1UC7 A;  2K8V A;  4D73 A;  4I8B A;  5IQY A;  5AIX A;  2OE1 A;  3IPZ A;  3C7M A;  3KH7 A;  5GAP D;  2H73 A;  1GUL A;  4F9Z A;  2WB9 A;  3DRN A;  3IXR A;  4JED A;  2ON7 A;  4IQA A;  3HVX A;  1URM A;  1WOU A;  5ECI B;  1JZD A;  1QGV A;  1G0T A;  2H6X A;  1K0A A;  4GXZ A;  3F4R A;  3FRC A;  1PX7 A;  5HR2 A;  2HFD A;  2LNS A;  3ZML A;  4IP1 A;  3I6A A;  3HVV A;  3ED3 A;  4PQ1 A;  5JCU A;  2C3T A;  2YWN A;  1GTI A;  3QPM A;  2IWT A;  4MPG A;  5ECS A;  2O7K A;  1PKW A;  5IOW A;  1EP8 A;  3IK9 A;  2WCI A;  3EWL A;  1K0B A;  4WEY A;  4I2T A;  3BOA A;  1ERT A;  1QMV A;  5F06 A;  1DBY A;  4HJM A;  2H8L A;  2HLS A;  2H0G A;  1DSB A;  4JR6 A;  4ZBD A;  1SK0 A;  1EZK A;  2YJ7 A;  5F8B A;  2OAC A;  3LXZ A;  3HY2 A;  4MJA A;  3EMX A;  3GV1 A;  4KX4 A;  3TUE A;  4K8M A;  2C0F A;  2C4J A;  2JSZ A;  3UVH A;  1TRS A;  2KLX A;  3UIW A;  4EDZ A;  16GS A;  1X5C A;  3F4T A;  3Q18 A;  3VPQ A;  4KSO A;  3MNG A;  4N0Z A;  2VL3 A;  4V2L A;  1GUH A;  4XRA A;  4IS0 A;  1O8W A;  1O81 A;  1Z7R A;  2F9S A;  5J4U A;  5IO2 A;  1FHE A;  1HNA A;  1UN2 A;  4J57 E;  2KP2 A;  3TJK A;  1WE0 A;  2NDO A;  4RQR A;  2H1B A;  6GSS A;  3IHQ A;  4MJE A;  3GKN A;  4EXJ A;  2LJK A;  1YKA A;  2A2R A;  4BWS A;  1EV9 A;  3QMX A;  2DMM A;  2PPT A;  1Q98 A;  4MA9 A;  5ECP B;  4POM A;  4WF5 A;  2DLX A;  3GTU A;  2H6Z A;  2JSY A;  1A24 A;  2OE0 A;  3ZFB A;  4TR0 A;  4ZIJ A;  3FZ9 A;  4GQC A;  4PUA A;  4O7H A;  4V2M A;  4J56 E;  1TK5 B;  3KMN A;  2VL2 C;  2RII A;  3CSH A;  2FUG 2;  1ZGN A;  3ZIT A;  2HZE B;  4K0N A;  3UBL A;  1QQ2 A;  4L5L A;  3U5R E;  1MD4 A;  4TR1 B;  4MH3 A;  2FY6 A;  4XS6 A;  1AQW A;  1THX A;  5ABR A;  13GS A;  2V32 A;  1M99 A;  1FOV A;  2LST A;  1WPI A;  1WWJ A;  2X8C A;  1USB A;  3CTG A;  2NVL A;  2FWE A;  2XC2 A;  2VD1 A;  1TXX A;  3C1S A;  5D8I A;  5COH A;  5CRG A;  5IM9 A;  1PKZ A;  1EOH A;  3IAM 2;  1R4W A;  2YNX A;  2FWG A;  3VWX A;  1JLW A;  2LRT A;  4Q5Q A;  3TRP A;  2N5B A;  3QDN A;  2LQO A;  3EUR A;  1SU9 A;  3J7Y k;  1CQG A;  3ZVJ D;  2ZCT A;  3CBU A;  1HNC A;  1TTZ A;  4V1A g;  2HRN A;  4O5R A;  4QQ7 A;  3NOF A;  4GTU A;  4DVC A;  3TOT A;  2P31 A;  4MAB A;  1LBK A;  3UAP A;  2NPB A;  1FB6 A;  1A0F A;  1GSF A;  3DXB A;  1G6Y A;  1O73 A;  1V2A A;  1AUC A;  1N2A A;  1KBN A;  2DIZ A;  1BED A;  2AUV A;  3TRQ A;  3WGD A;  4MP4 A;  4TR3 A;  4POK A;  3ZL5 A;  3HDC A;  1DUG A;  1GNW A;  2I9H A;  4K7O A;  1R7H A;  4KW6 A;  1B48 A;  2VCW A;  4XIH A;  4ECJ A;  3APS A;  3CXG A;  1A2M A;  3L9V A;  2YP6 A;  1B8X A;  4L5O A;  2DJ0 A;  3FW2 A;  2E2M A;  1U3A A;  1FAA A;  2VIM A;  3GKM A;  4QL7 A;  5HFK A;  4Z7X A;  4TVE A;  3KXO A;  1FB0 A;  4WR5 A;  1XPV A;  2PER A;  4L0W A;  1GWC A;  4KCE A;  2VOC A;  3QAV A;  4WET A;  3E9J B;  3GIX A;  4KDX A;  4LL1 B;  2F3M A;  3BD2 A;  8GSS A;  5C00 A;  3DWV A;  4EE0 A;  1A0R P;  2H01 A;  1CQH A;  2ES7 A;  2IL3 A;  3BBY A;  4OCF A;  4K7N A;  2YWM A;  4O92 A;  6GSU A;  2IMI A;  2K9F A;  5EY6 A;  1AIU A;  4IKH A;  5HFG A;  2CZ3 A;  2AB6 A;  1XFL A;  5AN1 A;  3FR3 A;  2L6C A;  4MH2 A;  1PN9 A;  2IJY A;  1MDJ A;  3KZQ A;  2WFC A;  1SL1 B;  3TB2 A;  5FWG A;  3O6T A;  4JRR A;  1I5G A;  1FW1 A;  4GRF A;  1F3B A;  2H6Y A;  5CAX A;  2FA4 A;  4LMV A;  2XPE A;  1WJK A;  1TU8 A;  4GQF A;  4OWY A;  3HJO A;  4IVF A;  4CW9 A;  2IFQ A;  3KTL A;  5ECO B;  3QR6 A;  5D9T A;  3VK9 A;  5J9C A;  5CP1 A;  1GRX A;  2M72 A;  2RUF A;  4NV5 A;  1F37 A;  2C0G A;  3C71 A;  2P0G A;  5G1K A;  1N8J A;  1VF2 A;  1GP1 A;  2GZY A;  4TXO B;  5EPF A;  2H75 A;  3I43 A;  3RAZ A;  2J23 A;  11GS A;  1I9D A;  1M9B A;  4HI7 A;  4MDC A;  5EVO A;  1AC1 A;  4LMW A;  2VD0 A;  4ZL9 A;  5ID2 A;  4KAE A;  3LQ7 A;  2F8F A;  3TJF A;  1C72 A;  1OYJ A;  2YJH A;  1VF1 A;  4BA7 A;  2BTO T;  1MTC A;  1XOB A;  2N5A A;  4HQS A;  1XCC A;  4L8E A;  5D73 A;  2GSQ A;  3KEB A;  3UBK A;  5ECK B;  5F0G A;  4WBR D;  1EP7 A;  2HZF A;  1XW9 A;  2AV4 A;  3D5J A;  3CSI A;  3LJR A;  3N9J A;  2R4V A;  2PBJ A;  4LA1 A;  2IMK A;  4G9H A;  4IQ1 A;  4G19 A;  3QAW A;  1AAZ A;  4WKW A;  3KCM A;  3Q19 A;  2PN8 A;  1S3C A;  1F9M A;  4ECC A;  1OKT A;  4N0V A;  3GFK A;  1SK2 A;  2AHE A;  1XWB A;  4OFM A;  2VCV A;  1YDK A;  4KCA A;  2HSH A;  1JLV A;  2PMT A;  3HCZ A;  3KP9 A;  1ZL9 A;  1T4Y A;  1YKC A;  2FGX A;  2OAD A;  3BCK A;  1XWG A;  1V40 A;  1YF0 A;  4BPY A;  2KOK A;  2AYT A;  1R5A A;  3GKX A;  2GSR A;  1T3B A;  4V1A p;  5E59 A;  2CX4 A;  2HNL A;  3VI5 A;  2LRN A;  3F63 A;  1OAZ A;  1U87 A;  2YWI A;  3RBT A;  5CO3 A;  3GST A;  4G2E A;  4MZC A;  3DVX A;  1Z7P A;  3F3Q A;  1SD8 A;  1ZMA A;  2VCX A;  3DVW A;  1E2Y A;  1V98 A;  1K3L A;  4K6X A;  2MYG A;  3VUR A;  3J7Y b;  2H1A A;  3UJ1 A;  1XXU A;  3IK7 A;  5KN3 A;  1OE7 A;  3LOR A;  2CVD A;  4MJB A;  2FLS A;  2RLI A;  2YAN A;  5JWR B;  1T00 A;  5DAL B;  1FVK A;  4XS1 A;  2B6M A;  2FNO A;  4FH8 A;  1YY7 A;  2EIR A;  2LKU A;  3GX8 A;  4RI7 A;  1XWC A;  2IN3 A;  3RPN A;  2B1L A;  2GTU A;  3D6I A;  1T7P B;  6GSW A;  1M2A A;  5INY A;  3KIJ A;  3FZ4 A;  2WDU A;  1GSS A;  2C3Q A;  2D2Z A;  1AQV A;  3A3T A;  4J2F A;  1TRV A;  4Q5N A;  3NZN A;  1JZO A;  1GSE A;  3DD3 A;  4CHS A;  1ZYE A;  3TKS A;  5CRE A;  2FA8 A;  2A2S A;  5ELG A;  1OC9 A; 
#chains in the Genus database with same CATH topology
 1THO A;  1BRS A;  4CPK A;  4MMM A;  1MWR A;  1QMA A;  4STD A;  4PQI A;  2MMN A;  3LFL A;  1ZCP A;  4N6O B;  2JL4 A;  5KEJ A;  3PIN A;  1RJO A;  3WT2 A;  1AR0 A;  3EF8 A;  1BVI A;  1RQM A;  2XBI A;  3KFQ C;  1NHY A;  2CX0 A;  1HU9 A;  4JF8 A;  2MMA A;  2W56 B;  2G2Q A;  5B7C A;  1Q7H A;  1TFK A;  2CVB A;  1NHO A;  4WYK B;  1OHP A;  3RHB A;  2CFG A;  3ZYW A;  1YEP A;  2BU4 A;  3Q74 A;  3EIN A;  1HQO A;  3WGX A;  3TGZ A;  4MZB A;  4XS4 B;  3MAK A;  5JCW A;  1CYV A;  3OWU A;  3GRD A;  5L71 A;  5DRE A;  4ID0 A;  3GL3 A;  2RUE A;  1JB4 A;  2A4V A;  3GH6 A;  1GH2 A;  2CAQ A;  1RDS A;  3MKI A;  4PNF A;  5IMD A;  3E0U A;  4MPF A;  3M8N A;  3QOU A;  1K28 A;  4KB3 A;  1Z1S A;  1QXH A;  5M19 A;  4RNZ A;  1BNR A;  1GLP A;  1BAY A;  4I97 A;  1XVQ A;  1IQX A;  1IV7 A;  1EGR A;  4R9K A;  4K1U A;  3M1G A;  1OVN A;  3D79 A;  5LC7 A;  4N10 A;  2QC7 A;  1ERV A;  4YAV A;  1Z9H A;  1JZR A;  1W6C A;  2PUK C;  3KTB A;  2H0H A;  1QJG A;  1ILO A;  3F3R A;  3X42 A;  2CA8 A;  3MSZ A;  4FMA A;  3AY8 A;  3L9U A;  3ZFZ A;  1TP9 A;  2G0F A;  3NM7 A;  3M9J A;  3CCE 3;  1O7U A;  2GDR A;  4WWU C;  2HSY A;  1FO5 A;  1VQ5 3;  4JE1 A;  1IV9 A;  4YQM A;  4ECB A;  2EC4 A;  3CRU A;  2XHF A;  1OF5 A;  1GNE A;  4HU7 A;  2ZNM A;  1EUI C;  1I3F A;  5A5K A;  2JZT A;  2VLT A;  3K0Z A;  4EV5 A;  5KOX A;  1BAN A;  3M9K A;  5H5S A;  4MK3 A;  5DCG A;  2WUL A;  4AKZ A;  5CK6 A;  1UA5 A;  3NBJ A;  3PGT A;  3WOE B;  2A4H A;  2LEG A;  2Z76 A;  1AW9 A;  1T8E B;  2IUK A;  3GN3 A;  5ECN B;  1Y25 A;  1GUM A;  3WR2 A;  2ALB A;  3ZIJ A;  1W4V A;  4HDE A;  2GSS A;  3QCP A;  4RUV A;  1FVJ A;  3NX0 A;  1G6W A;  5CRD A;  1QFN A;  1BX9 A;  2C10 A;  4IN0 A;  1M9A A;  1JJ2 2;  6GSV A;  7GSP A;  3ZRE A;  1GL8 A;  1E3V A;  3WDG B;  2VUP A;  5BVB A;  3L78 A;  1SK1 A;  1W02 A;  3JUM A;  3T8U A;  4IJ3 A;  1YJ6 A;  3D21 A;  1KD1 4;  4NRE A;  4PGT A;  5GSS A;  2YWO A;  1L5G B;  1IYI A;  3UVT A;  2TIR A;  2YZU A;  4IGJ A;  1RLS A;  1D6Y A;  2OBI A;  3O3T A;  1U3I A;  2PVQ A;  3MG1 A;  1X9W B;  3HXS A;  2O87 A;  5JWO B;  3SXX A;  1YZX A;  3TJJ A;  1GY6 A;  3CNX A;  3CCR 3;  3LSZ A;  1G02 A;  2CK3 H;  1G96 A;  3MPH A;  4PXO A;  1J08 A;  1RNB A;  1SYR A;  2V6O A;  1O85 A;  4DSR A;  1XVW A;  2F8A A;  2HMJ B;  4HKV B;  1PQN A;  3VFI A;  1XW5 A;  2UX0 A;  3AGO A;  1PD2 1;  2R2J A;  4N6L A;  4OFT A;  3ZMK A;  4Q5F A;  3HVN A;  2CFK A;  1W89 A;  2M46 A;  3F6F A;  3LEF A;  2DML A;  4KFE A;  4HZ4 A;  5BMU A;  1N8R 4;  2W2C A;  1LRA A;  3CCV 3;  4BVX B;  2WGR A;  3WA3 A;  5CRW A;  2K54 A;  2WS2 A;  3WYW A;  2PU9 C;  3EC3 A;  2R5G A;  2D42 A;  2QA1 A;  1GSY A;  4BVY B;  1VRS D;  2FXT A;  2RM6 A;  3OR5 A;  4K0G A;  2E2U A;  4FMC A;  2H19 A;  1US1 A;  2GQL A;  3UMA A;  1OGX A;  4HM7 B;  5JPP A;  2BJX A;  2XGL A;  1TW9 A;  5DBQ A;  1BQ7 A;  1IU7 A;  4ECI A;  2AAE A;  1K0O A;  1A2L A;  3CC4 3;  2F51 A;  1NB3 I;  2P5Q A;  4KE3 A;  1VQP 3;  3UAR A;  1YNV X;  2GGT A;  2E0Q A;  5IMZ A;  1EGO A;  4KF9 A;  2Y73 A;  3G0K A;  2HZE A;  4DSQ A;  2LYX A;  4YKG A;  3B7C A;  3N8B A;  4G10 A;  3FY7 A;  3ERW A;  3SBC A;  3N9H A;  3D22 A;  4KZ1 A;  5IMF A;  3A2X A;  4MF6 A;  1QUW A;  1W6Y A;  3NM2 A;  4NHF A;  2V6K A;  3FR6 A;  1JHB A;  3D5I A;  1F2E A;  4TR1 A;  1WRY A;  1UGI A;  3CYN A;  1JBT A;  5G30 A;  1FGO A;  2HOH A;  4MMY B;  4NXI A;  4KH7 A;  2E7P A;  3PS8 A;  4BWQ A;  3X40 A;  4KDY A;  3MHE A;  2VM1 A;  4ZL7 A;  1UVZ A;  3GH9 A;  2M7O A;  1B3S A;  1WIK A;  2GT6 A;  1F6M C;  1TIJ A;  3FK8 A;  1BGS A;  3F8H A;  4EC0 A;  1VF4 A;  1STD A;  3I9V 2;  4F03 A;  3SOA A;  1H75 A;  1S3A A;  3VPT A;  4GSN A;  4K1V A;  3V99 A;  3G7J A;  5GAN D;  1SIH A;  4NHW A;  1H4O A;  2DSA A;  2K18 A;  5AII A;  5ECH B;  2PGT A;  1NSW A;  3IAS 2;  4X43 A;  3EHC A;  3F0I A;  3C1R A;  2XEP A;  5JCG A;  1VQL 3;  1MDI A;  3IV4 A;  4AGS A;  3O76 A;  3F8X A;  3DKS A;  4Z2T A;  1VQN 3;  5IIZ A;  2CFD A;  1Q42 A;  2HXK A;  5JPU A;  1IVV A;  5DAK B;  1C54 A;  2LJA A;  5D9X A;  2DIY A;  1VQM 3;  3KP8 A;  3BNB A;  3L0H A;  1QVF 2;  1SKR B;  2H1D A;  2IY2 A;  5A4V A;  2CKF B;  3G4S 3;  1PL1 A;  2L5O A;  4EDY A;  2NTO A;  2VLU A;  4BVY A;  2IPA A;  3RNT A;  1GOU A;  4O32 A;  1SL0 B;  3FG4 A;  3UL5 A;  1JZW A;  4K2X A;  4ZXG A;  2B5Y A;  1F8N A;  5DDL A;  3CU3 A;  2NBS A;  1SAR A;  2B3S A;  4K1F A;  3CSJ A;  1GTA A;  3A2V A;  3UL3 A;  3HA9 A;  4CDO A;  2WOH A;  2VCT A;  2H0I A;  2F5W A;  3F7S A;  4XRD A;  2C4B A;  1FYS A;  3SX1 A;  1M3I A;  1V9W A;  3KM6 A;  1OE8 A;  1VQ6 3;  2LNT A;  2X64 A;  4MNN A;  1SPU A;  1Z3E A;  1BNS A;  1SJ6 A;  5IMV A;  3BCI A;  2VL9 A;  4HZ2 A;  4TXV A;  4KND A;  4HJ2 A;  3HYP A;  3JUN A;  1ROA A;  2P0M A;  4OD7 A;  1WP0 A;  4AF2 A;  1BSC A;  1XIY A;  1O8X A;  2YFL B;  2C1Y A;  4KA0 A;  2C3N A;  3D4T A;  1B20 A;  3ZIV A;  2HE3 A;  2OCT A;  1ML6 A;  3JVC A;  5B6N A;  1B4P A;  1MD3 A;  1E3R A;  1XWA A;  2I81 A;  4LL4 B;  3PZW A;  1JFU A;  4RI6 A;  1GSD A;  5M1A A;  1I70 A;  4RZM A;  4ECJ A;  1RCK A;  4G1M B;  1CYU A;  4TRX A;  3KGK A;  3G9B A;  1GSU A;  3UOM A;  1BRJ A;  1ACV A;  5IMA A;  3WOF B;  1J9B A;  4TW5 A;  5HQP A;  2LV3 A;  3ME8 A;  3P7X A;  3CMI A;  3L4N A;  5HR3 A;  3NV0 B;  5AGY A;  2VO4 A;  2B7K A;  2C0E A;  2IMD A;  2CVK A;  5KN2 A;  6RNT A;  3TKR A;  3GZR A;  2CX3 A;  2CG1 A;  3LWA A;  1GOV A;  3EVI A;  3D4M A;  3PCR A;  4HQZ A;  2KHP A;  1K73 4;  2P05 A;  3NBR A;  1R26 A;  3FG1 A;  1RGF A;  3S5C A;  5DAK A;  1O7W B;  2VCZ A;  4CCV A;  1SYX A;  3SWL A;  4ISD A;  3U1W A;  2YV9 A;  22GS A;  3BNE A;  2GLR A;  4PQH A;  1SD9 A;  2O85 A;  2YX9 A;  1UW1 A;  3BJ5 A;  1ZOF A;  4DSS B;  4HOJ A;  5HR0 A;  3VWV A;  2R3X A;  3H93 A;  3LTB A;  1RHL A;  1YJN 3;  4ZB6 A;  1UCI A;  2CG0 A;  4ML6 A;  4EV2 A;  3IBH A;  3EC9 A;  1LXE A;  1TFO A;  1Q4J A;  2GT5 A;  4D73 B;  3SED A;  2WRT A;  1FA3 A;  1SEN A;  4EO3 A;  4HU9 A;  3EE2 A;  1OPY A;  2KAA A;  2L4V A;  5DJM A;  1HNB A;  1BJX A;  1G7E A;  4USS A;  5ECL B;  1X5E A;  5GZZ B;  1ERW A;  1U88 A;  1EWX A;  3T0U A;  4GST A;  3ZG5 A;  3ZFL A;  2R41 A;  1V74 A;  2KF4 A;  2VAF A;  4JU5 A;  2Z7A A;  4ZIL A;  2BMX A;  4WFO A;  4HYZ A;  1MNL A;  3X3Y A;  3PCS A;  3GZY B;  3GKK A;  5ECM B;  2A2P A;  1JB5 A;  5LNK e;  4XHM A;  5LD0 A;  1HYU A;  3RHC A;  4TXO A;  3L9S A;  4BTW A;  4EF0 A;  2Q07 A;  3APO A;  3D5G A;  3IHG A;  1VF3 A;  1NU3 A;  3P8W A;  1TOF A;  2H72 A;  3K5T A;  3EMP A;  2OQE A;  2BNG A;  5BXQ A;  1GLQ A;  5IOX A;  4MZW A;  3B4O A;  2FWF A;  3KD0 A;  2HMK B;  4HAA A;  3RDW A;  1RN4 A;  4XBY A;  1W6G A;  2HSM A;  3BB9 A;  3IOS A;  1GD3 A;  4ZB9 A;  3DH2 A;  1TRQ A;  3HZP A;  5D81 A;  1WMJ A;  3EU3 A;  1DYU A;  2PZV A;  3FZ5 A;  17GS A;  4LLR A;  3KJY A;  3NXJ A;  3FLJ A;  2ZHX B;  1EV4 A;  3U6V A;  3QK9 A;  2B5X A;  1PRX A;  5KP1 A;  4MMZ B;  4KGI A;  1J0F A;  3F40 A;  1KNG A;  1UUV B;  4K5S A;  4WXT A;  4RNT A;  2XH9 A;  4OVM A;  1KEB A;  1UCJ A;  1MWU A;  1VQ9 3;  2L1S A;  1YEX A;  2GEX A;  2GU3 A;  3TJB A;  10GS A;  2OJL A;  3TKS C;  3DXO A;  2ZDJ A;  1HKX A;  1BAO A;  4YKF A;  3QRD A;  2B5E A;  5J3R A;  5KN0 A;  1K3Y A;  3NUV A;  2C0D A;  4OMV A;  1PA3 A;  4XCS A;  1SKS B;  4I5Q A;  1A2J A;  5C04 A;  4FYB A;  3TCO A;  4HSC X;  2HMN B;  1DE3 A;  5A4W A;  2OA7 A;  2AJQ B;  2GU1 A;  4DSS A;  4Q53 A;  1NWW A;  1UI7 A;  5HR1 A;  5AIF A;  3KSP A;  1TI3 A;  3FHK A;  4FYU A;  3BLZ A;  5H5Q A;  1RRL A;  4AJ8 A;  4YQU A;  4O5U A;  3HIG A;  4TR4 A;  4EVM A;  4A5P A;  2UZ8 A;  3TRX A;  4WHA A;  1NB5 I;  3GRX A;  2I9W A;  2DC5 A;  3ZTL A;  2STD A;  3M0F A;  1TP6 A;  2VM2 A;  2WZ9 A;  6GSP A;  4WR4 A;  1RNT A;  4E8H A;  4V2N A;  4JZQ A;  1U8C B;  4F2I A;  4KUN A;  2JAD A;  1M3J A;  3FKF A;  3VGN A;  5LCZ A;  1K0D A;  2IMF A;  2JAC A;  1B27 A;  2XRX B;  3F9U A;  1GS3 A;  1IYH A;  3HD5 A;  3DEX A;  1B2Z A;  2YN1 A;  2JZS A;  1I2G A;  3O8Y A;  5KOW A;  4IW9 A;  4GSS A;  2YCD A;  3M8C A;  2XFS A;  5FW5 A;  5RNT A;  2XGN A;  9GSS A;  5AIS A;  3WD6 A;  3VLN A;  2HRK A;  2H74 A;  1ZYQ B;  4G0I A;  4MJC A;  1YVS A;  4CY8 A;  3URP A;  1PSQ A;  3H4K A;  3TOU A;  4ML1 A;  1B9Y C;  3X41 A;  3DM8 A;  4NHZ A;  1WMP A;  1K0C A;  1R5P A;  1S3D A;  2E2V A;  2MBT A;  4HVN A;  1YJW 3;  5AIG A;  4H3U A;  2AAW A;  3Q6O A;  2IYJ A;  2GZP A;  1LVN A;  1BRK A;  1CH0 A;  4BL7 A;  4NAX A;  2W6J H;  4WBJ A;  1JBS A;  2KF3 A;  1HYF A;  2BIR A;  2J8X B;  5J9B A;  1RGG A;  3GTU B;  4HM2 B;  1PGT A;  4O8S A;  1YGW A;  3H8Q A;  4TN8 A;  3N5O A;  3DGM A;  2QIY A;  1PL2 A;  1FG4 A;  3F6D A;  4X0X A;  3K9M C;  3TKQ A;  1N9J A;  1BRG A;  1BNE A;  2QKE A;  3QFB C;  5G5E A;  2LRC A;  3A76 A;  1LOX A;  5AIV A;  1R4Y A;  5FT3 A;  5J41 A;  1M7T A;  2C80 A;  2CFW A;  2H66 A;  4IEL A;  3DGQ A;  4GB5 A;  4XDV A;  2SAR A;  4Q5R A;  3F8U A;  3HK4 A;  3UEM A;  4ZBA A;  3P90 A;  3DYR A;  3FR9 A;  3G7I A;  1LOW A;  5IG0 A;  5DAL A;  2Z77 A;  5DVB A;  3GUS A;  3VWU A;  1M90 4;  2V1M A;  1F3A A;  1OC8 A;  2P38 A;  1U5O A;  4E8E A;  3GUR A;  5EQL A;  5ECR B;  2OTJ 3;  4X4J A;  1U6T A;  1NO3 A;  4KDU A;  5J5N A;  3PGB A;  3LYK A;  1RGA A;  1ISK A;  3CD6 3;  3LYG A;  4TOP A;  5CF1 A;  1LOY A;  2IIY A;  2FHE A;  4PUF C;  2LTK A;  4OFN A;  1QVG 2;  4FMB A;  3STD A;  2EIO A;  3JUO A;  1A8Y A;  2PNC A;  3BU4 A;  1Z6N A;  2AAD A;  4MLY A;  4HM4 B;  2XF3 A;  2C8U A;  2OE3 A;  4N11 A;  4HM6 B;  2VCQ A;  3PH9 A;  1ERU A;  3DIE A;  2GST A;  1JB2 A;  1WMN A;  3IE3 A;  2QEX 3;  3AMO A;  2HYX A;  2B7J A;  5G31 A;  2XSH B;  1MDK A;  1N5P A;  1K0N A;  1W2B 2;  3W8J A;  3VF1 A;  19GS A;  4QL9 A;  2X8G A;  5DQS A;  1HD2 A;  3WT1 A;  4HZ9 B;  1NW2 A;  5G1L A;  1OAC A;  5IEP A;  2L4Q A;  3Q3F A;  2PVO C;  2YPM A;  3ZLP A;  1EEM A;  1B4Q A;  4J8T A;  2KXG A;  3D4A A;  4FMD A;  1TI1 A;  3GX0 A;  2L6D A;  3I0Y A;  2MBS A;  4K7I A;  2YZH A;  5G5F A;  4EW5 A;  4MJD A;  5ENU A;  1XBS A;  1X5D A;  1ABA A;  2F86 B;  2FGT A;  3FZA A;  20GS A;  2WGO A;  2CC3 A;  3VWW A;  3FKA A;  1K0M A;  2O8V B;  4EBG A;  2XPD A;  3SLU A;  3H1N A;  1RGC A;  3ER7 A;  2TRX A;  1SQW A;  3TJG A;  3CCJ 3;  1X0R A;  2WO0 A;  4PUR A;  1XW6 A;  2W56 A;  1JKG B;  4EXR A;  2YOI A;  1BG5 A;  3D0Z A;  1X9M B;  4WYK A;  5FHI A;  3ERG A;  5G2G A;  1Z5Y E;  1DVC A;  4POB A;  2GZZ A;  1VQQ A;  4XS4 A;  1N9E A;  2L5L A;  1B21 A;  4BTY A;  3ZRD A;  4MCU A;  2BMQ B;  3MG3 A;  4HJL B;  2H1G A;  1PX6 A;  2KUC A;  3CNM A;  2HI7 A;  3IMA B;  4IJI A;  1T2I A;  1A8L A;  1ZYP A;  4ULX A;  1B2X A;  1B9X C;  2I1U A;  3F4S A;  6GSX A;  5IF6 A;  2MC8 A;  5IO0 A;  7GSS A;  4MF7 A;  3EQQ B;  3C8E A;  2H76 A;  1G7O A;  1MEK A;  2V41 A;  3B4P A;  5DJL A;  5D93 A;  1FGQ A;  4H61 A;  3J7Y d;  3C73 A;  2I3Y A;  1X1U A;  4MF5 A;  3IJE B;  5STD A;  4RNY A;  2FD3 A;  1IK3 A;  4GCI A;  4AJ6 A;  1O7G B;  4GWR A;  2BHM A;  4X1U A;  1EA2 A;  5ECQ B;  4LGQ A;  2GVP A;  4I4K A;  3S28 A;  1DMQ A;  3KMO A;  1I8V A;  1MWT A;  1GTB A;  1ST9 A;  3F14 A;  2R6K A;  4OO5 A;  3L0R A;  4ZM8 A;  3IC8 A;  3ECF A;  2IA7 A;  3GYK A;  3IRA A;  3HKR A;  3BND A;  2MMO A;  3EB8 A;  5KP4 A;  3ALA A;  3PXM A;  1Q86 4;  5D9V A;  1ZO2 A;  4KVH A;  2L4C A;  2IME A;  1RK4 A;  3MDK A;  4GLT A;  5JWQ B;  4ACS A;  1VQO 3;  2DJK A;  5EL8 A;  2N5F A;  1I3I A;  3I56 3;  1KC8 4;  2F4Y A;  1UGH I;  6GST A;  3S9F A;  3HZ8 A;  3GZB A;  4LMI A;  1EOG A;  3IDV A;  4WF4 A;  2OTL 3;  4XM4 A;  2VL2 A;  3FEU A;  2CV4 A;  5IPG A;  2QGV A;  2C11 A;  1IQ8 A;  4TKY A;  3US3 A;  2X8H A;  4O3V A;  3LXT A;  2JQ5 A;  4XTS A;  3FG3 A;  3CTF A;  1OC3 A;  1Y6E A;  1MGW A;  2L57 A;  1S72 3;  4EUY A;  4F0C A;  4ZBB A;  1O7H B;  3W8S A;  1NM3 A;  4EKZ A;  1RGE A;  3TDG A;  2X4A A;  1YF1 A;  2DBC A;  1TTO A;  2FWH A;  3CCU 3;  1TRU A;  2ON5 A;  2ML6 A;  4PTS A;  1BNI A;  5BRT A;  1V58 A;  2IFQ B;  1TJD A;  1IT8 A;  1BNF A;  1BRH A;  1A90 A;  1YIT 3;  2V1L A;  4L8O A;  2DJ3 A;  1TRW A;  4HS1 A;  1M2D A;  3ME7 A;  1AQX A;  2H70 A;  1XWK A;  4AJ7 A;  4HBR A;  3AHS A;  4FCZ A;  1E6B A;  1JN5 B;  2JZR A;  4F0B A;  2Z9S A;  1QAK A;  2INX A;  3HVS A;  5B8B A;  3U97 A;  4N30 A;  2DJ1 A;  1ZZY A;  4BIR A;  1VGL A;  2W9P A;  1AXD A;  1ON4 A;  18GS A;  3GNJ A;  3LG6 A;  3HHV A;  2Y74 A;  1RW1 A;  5IPH A;  1V57 A;  4FCM A;  4IBP A;  1Q40 B;  3KZT A;  5CNW A;  1ZS7 A;  4ZB8 A;  5KN1 A;  5ID2 B;  2W9Q A;  1Q82 4;  3R2Q A;  4YAP A;  12GS A;  5CYY A;  1K3O A;  2GS3 A;  2LJR A;  1AVL A;  3TKP A;  4BVX A;  1VQ7 3;  1GMQ A;  4XDW A;  2P0X A;  2R37 A;  2DKH A;  3DGY A;  3VI7 A;  5H5R A;  1SL2 B;  3HZ4 A;  3UB1 A;  3KE7 A;  5HFI A;  4PX1 A;  2UGI A;  3M3M A;  4HUA A;  4I2U A;  3LYP A;  5ELA A;  2YFJ B;  1I2E A;  2MMZ A;  3HJM A;  4NV2 A;  3GL5 A;  4FCJ A;  1BNG A;  4XBT A;  1YI2 3;  2BMR B;  3F9S A;  5D9W A;  3D9R A;  1RMS A;  2MZC A;  3EYT A;  4H86 A;  1RGL A;  3QAG A;  2GQK A;  3ERF A;  5A4U A;  5IEO A;  5M18 A;  1GUK A;  3H51 A;  3GA4 A;  1T5Y A;  3LTC A;  1TUH A;  3FH1 A;  3HJP A;  1O6J A;  1GY5 A;  4N6N B;  4FIW A;  1I0V A;  5HGR A;  3CRT A;  2SBL A;  6GSY A;  4FR9 A;  1Z6M A;  3V1W A;  1XZO A;  3IR4 A;  4PNG A;  3IA1 A;  1AVK A;  3KSE D;  2X49 A;  3NIV A;  1JBR A;  1ASK A;  1Q81 4;  1BNJ A;  1FUT A;  4EC6 A;  3HX8 A;  2LUS A;  5B6M A;  2R0P A;  1OHS A;  3ISO A;  4ZL8 A;  3H3H A;  1BYE A;  3A2W A;  2D1W A;  4JR4 A;  1FOH A;  2CAI A;  3PR8 A;  1UUW B;  1W00 A;  4J5K A;  1TU7 A;  3GHA A;  3CME 3;  3QD9 A;  1M2B A;  2OOV C;  1LJR A;  4ILF A;  1JN5 A;  1T4Z A;  1RN7 A;  2VLV A;  2DJJ A;  1QK8 A;  1K9M 4;  2J9H A;  3BIR A;  2YV7 A;  2O89 A;  4FYC A;  3G7Y A;  1K41 A;  3NQZ A;  2WJU A;  4K9Z A;  1T1V A;  1C7H A;  4XBX A;  2E2G A;  4YH2 A;  1N8Q A;  2K0M A;  3W6G A;  2OKA A;  2H30 A;  2K3D A;  5DCH A;  2OQE C;  1BU4 A;  3APQ A;  4J9A A;  4DEJ A;  2HRF A;  5IG5 A;  2CT6 A;  1WMO A;  1RKY A;  1EEJ A;  2X99 A;  3H79 A;  2LQQ A;  3GSS A;  2DJ2 A;  3EN1 B;  4RQX A;  1YQ1 A;  3RPP A;  3P2A A;  3JCM L;  4GF0 A;  3IC4 A;  1OKD A;  1ROV A;  1PU4 A;  1BRN L;  1LNI A;  2CZ2 A;  2RM5 A;  2WGQ A;  2EIQ A;  3RGR A;  5F07 A;  4FO5 A;  3A5W A;  3K8N A;  3ZG0 A;  2P5R A;  1XOA A;  5E4W A;  14GS A;  3LT9 A;  1WNH A;  1TK0 B;  2HT9 A;  4NPB A;  2QSI A;  1KTE A;  2XFT A;  2W0Q A;  1SKW B;  2I4A A;  2KP1 A;  3LGC A;  1DET A;  1CEW I;  2PWJ A;  2CIU A;  2K6V A;  2L59 A;  3ZZX A;  3FF0 A;  3DML A;  2JDI H;  1PFP A;  3EU4 A;  4I6X A;  5BIR A;  5AEW B;  4Z2U A;  2B1K A;  4NMU A;  1IVU A;  1RGH A;  1TKD B;  3UJM A;  5DQY A;  1VQ8 3;  1GSP A;  1TU5 A;  1ZGX A;  5B8A A;  3HII A;  2H71 A;  4K2D A;  5GST A;  1X9S B;  2ZA4 A;  3I69 A;  4BTX A;  2GQM A;  1NNV A;  1GTU A;  3QFA C;  5D96 A;  3FYG A;  3ZVJ A;  1TDI A;  1X1X A;  4OCE A;  1Q9E A;  1TK8 B;  2V2G A;  4EL1 A;  3NHX A;  5A0O B;  2LQV A;  3CCM 3;  4IHU A;  2M80 A;  4OO4 A;  5IG3 A;  1RTU A;  3GZX B;  2K8S A;  4YQV A;  4KSM A;  4JBB A;  3OV4 A;  4POL A;  4IP6 A;  3CXC 2;  1GSQ A;  2KF5 A;  1LU4 A;  4O2H A;  4NWY A;  5IMC A;  2FCH A;  3KH9 A;  4IT7 A;  5CRH A;  4CDL A;  3NV0 A;  4P3Y B;  2GSP A;  4L0U A;  1LNH A;  1DE1 A;  2TRC P;  1BUJ A;  5CLK A;  1XG8 A;  1DE2 A;  1OC9 B;  2O3O A;  2LS5 A;  2REM A;  4G0K A;  2ZUP A;  3MWH A;  5D83 A;  4HZB B;  1A23 A;  3TKS E;  1M0U A;  4X2O A;  1YVB I;  1FGT A;  2GXF A;  4LZI A;  5F05 A;  3LZA A;  1PMT A;  2XR8 B;  4HEA 2;  1SJI A;  5DRV A;  2CQ9 A;  3E3E A;  1MWS A;  1BSB A;  3GMF A;  1SJZ A;  5G2Z A;  2FNQ A;  2JU5 A;  3WGE A;  1GMR A;  2XBQ A;  2OBK A;  4FQU A;  3A5E A;  2E2T A;  4F82 A;  1UC7 A;  1OUN A;  2K8V A;  4HM1 B;  2HRA A;  4D73 A;  4I8B A;  5IQY A;  5AIX A;  2OE1 A;  1FUW A;  3IPZ A;  3C7M A;  4L7K A;  3V92 A;  3KH7 A;  5GAP D;  2H73 A;  3MYT A;  1GUL A;  3MWZ A;  4F9Z A;  2WB9 A;  3DRN A;  4MEI A;  3IXR A;  4L8P A;  4JED A;  2ON7 A;  4IQA A;  3HVX A;  2F56 A;  1URM A;  1WOU A;  2ZL8 A;  5ECI B;  1JZD A;  4JRF A;  1QGV A;  1G0T A;  2H6X A;  1K0A A;  5AEU B;  3DGL A;  3FSD A;  4IIA A;  4GXZ A;  3F4R A;  3FRC A;  3KII A;  1PX7 A;  5HR2 A;  2HFD A;  2RGQ A;  2LNS A;  3ZML A;  4IP1 A;  3UL6 A;  1T2H A;  3I6A A;  3HVV A;  3ED3 A;  4PQ1 A;  5JCU A;  2C3T A;  2YWN A;  1GTI A;  3QPM A;  1J2B A;  2IWT A;  2BO9 B;  4MPG A;  4BU4 A;  1PYL A;  5ECS A;  2O7K A;  2RNT A;  1EKM A;  1VZZ A;  1PKW A;  4K90 B;  5IOW A;  2MF7 A;  1EP8 A;  2P09 A;  3IK9 A;  1OF5 B;  5LC6 A;  2WCI A;  3EWL A;  1K0B A;  1M1X B;  4WEY A;  3Q1C A;  4I2T A;  1YIJ 3;  3BOA A;  1WQL B;  1ERT A;  4N6V 0;  1QMV A;  5F06 A;  1B2S A;  1DBY A;  4HJM A;  2H8L A;  4QWT A;  2IUJ A;  3Q2P A;  2HLS A;  1E97 A;  3PPU A;  4KT3 B;  1D6Z A;  3AHW A;  1W7C A;  4Z2R A;  2H0G A;  1DSB A;  7STD A;  4JR6 A;  4ZBD A;  1SK0 A;  2CHC A;  1EZK A;  1RRH A;  2YJ7 A;  5F8B A;  2CX1 A;  5GSP A;  2OAC A;  3LXZ A;  4ORL A;  3HY2 A;  3EMX A;  4MJA A;  3GV1 A;  4KX4 A;  3TUE A;  4K8M A;  2C0F A;  2CH9 A;  2C4J A;  2JSZ A;  3UVH A;  1TRS A;  2KLX A;  1Q7Y 4;  5ELJ A;  4BL3 A;  3UIW A;  4EDZ A;  3CCQ 3;  16GS A;  1X5C A;  3F4T A;  5IER A;  3Q18 A;  3EX9 A;  3WMD A;  3VPQ A;  4KSO A;  3V98 A;  3MNG A;  1UI8 A;  4N0Z A;  2VL3 A;  1O7M B;  4V2L A;  1GUH A;  4XRA A;  4IS0 A;  3LW9 A;  1A2K A;  1O8W A;  1WTH A;  5KP3 A;  1X1Y A;  1O81 A;  1Z7R A;  2F9S A;  5J4U A;  5IO2 A;  4N6U A;  1FHE A;  1HNA A;  1AQZ A;  1UN2 A;  1CQS A;  4XB5 A;  4J57 E;  2KP2 A;  5FGO A;  4TX4 A;  1M1K 4;  4GL6 A;  5BU4 A;  3TJK A;  1OCV A;  1WE0 A;  2NDO A;  4RQR A;  2H1B A;  6GSS A;  3IHQ A;  4MJE A;  4X2H A;  3GKN A;  4EXJ A;  2LJK A;  2KCD A;  1IQY A;  1YKA A;  2A2R A;  4BWS A;  1EV9 A;  3QMX A;  2DMM A;  4CY6 A;  2PPT A;  1QAL A;  1Q98 A;  4MA9 A;  5ECP B;  4POM A;  4WF5 A;  3HI7 A;  1UCL A;  4R80 A;  2DLX A;  1FGM A;  4RBN A;  3GTU A;  5CXO A;  2H6Z A;  2JSY A;  1GY7 A;  3JUQ A;  1O7N B;  2OE0 A;  3ZFB A;  4TR0 A;  4ZIJ A;  1A24 A;  4LSO A;  3X3X A;  3FZ9 A;  4GQC A;  4PUA A;  4O7H A;  4V2M A;  3KN4 A;  4J56 E;  1I2F A;  1GOY A;  1TK5 B;  3OWY A;  3KMN A;  2VL2 C;  2RII A;  4OUQ A;  3CSH A;  3CC7 3;  4J5G A;  2FUG 2;  3CPO A;  1ZGN A;  2IMJ A;  1RSN A;  2DKI A;  3ZIT A;  2HZE B;  2B24 B;  3MYD A;  4K0N A;  3UBL A;  1QQ2 A;  3JUP A;  4L5L A;  3U5R E;  1MD4 A;  1BSE A;  4TR1 B;  4MH3 A;  1BSA A;  2FY6 A;  4BIK A;  4XS6 A;  4ICY A;  1AQW A;  1THX A;  2R0C A;  3HOH A;  1GMP A;  5ABR A;  13GS A;  2V32 A;  1IYY A;  3OWS A;  1M99 A;  3FZW A;  1FOV A;  4O5Q A;  2LST A;  1S5A A;  1WPI A;  1WWJ A;  2X8C A;  2W03 A;  3DGO A;  1USB A;  3SOY A;  1JNQ A;  3CTG A;  2NVL A;  2RBI A;  2FWE A;  2XC2 A;  2VD1 A;  3IPT A;  1TXX A;  1TRP A;  3C1S A;  5D8I A;  5COH A;  5CRG A;  5IM9 A;  1PKZ A;  1EOH A;  3IAM 2;  1R4W A;  1I0X A;  2YNX A;  2FWG A;  3VWX A;  5ELU A;  1JLW A;  2LRT A;  4Q5Q A;  3TRP A;  3CCS 3;  2N5B A;  3QDN A;  2LQO A;  3EUR A;  4HM0 B;  1SU9 A;  1O7P B;  3J7Y k;  1CQG A;  1NDO B;  3GWR A;  3ZVJ D;  3FCS B;  1SII A;  2ZCT A;  3CBU A;  1HNC A;  1SJW A;  1TTZ A;  3MIX A;  4EIP A;  1MGR A;  3DY5 A;  3N54 B;  4V1A g;  2HRN A;  4O5R A;  4QQ7 A;  3NOF A;  4GTU A;  1BIR A;  4DVC A;  3TOT A;  5EEO A;  2P31 A;  1VQK 3;  4MAB A;  1LBK A;  3UAP A;  1FUS A;  2NPB A;  1FB6 A;  1A0F A;  1GSF A;  1MOL A;  3WOD G;  3KKG A;  1S3R A;  3DXB A;  1STF I;  1DMM A;  4PEJ A;  1G6Y A;  1O73 A;  1JKG A;  1V2A A;  1AUC A;  1N2A A;  1KBN A;  3I55 3;  2DIZ A;  5JBS A;  1BED A;  2AUV A;  3TRQ A;  1IVW A;  3WGD A;  4MP4 A;  4TR3 A;  2A15 A;  4N3V A;  1LQM B;  4R9L A;  4POK A;  3OXA A;  3HDC A;  3ZL5 A;  1UDI I;  3G8Z A;  1HZ1 A;  5IEN A;  1DUG A;  1GNW A;  9RNT A;  2I9H A;  3SYU A;  4K7O A;  1DMN A;  1R7H A;  4KW6 A;  1B48 A;  4N6M A;  2VCW A;  4XIH A;  3APS A;  3CXG A;  1A2M A;  3L9V A;  2YP6 A;  2CFL A;  1B8X A;  2CW9 A;  1ULJ B;  4L5O A;  1A2P A;  2DJ0 A;  3FW2 A;  1BUQ A;  2E2M A;  1U3A A;  1FAA A;  1M9G A;  2VIM A;  3GKM A;  4QL7 A;  5HFK A;  4GSP A;  4Z7X A;  3S67 A;  4TVE A;  2BT3 A;  2HMO B;  3KXO A;  1FB0 A;  4WR5 A;  1LOV A;  1XPV A;  2PER A;  4L0W A;  3G6E 3;  1GWC A;  4KCE A;  2UUG C;  2VOC A;  3QAV A;  4WET A;  3E9J B;  3LOY A;  4R4K A;  3GIX A;  4KDX A;  4LL1 B;  2F3M A;  4KFD A;  3MG2 A;  4HM8 B;  4AKY A;  5IW9 A;  3BD2 A;  3LML A;  8GSS A;  5C00 A;  1VQ4 3;  1IT7 A;  2W04 A;  3DWV A;  4EE0 A;  1ZYN A;  1A0R P;  2H01 A;  1A67 A;  1CQH A;  1N5H A;  2ES7 A;  2IL3 A;  3BBY A;  4OCF A;  4K7N A;  2YWM A;  4O92 A;  6GSU A;  2IMI A;  3UNL A;  1PN0 A;  1EG9 B;  3GAX A;  2K9F A;  5EY6 A;  1FW7 A;  1AIU A;  3K7C A;  1QAF A;  3EN8 A;  3CCL 3;  4IKH A;  5HFG A;  3LTD A;  2CZ3 A;  2AB6 A;  1XFL A;  5AN1 A;  3FR3 A;  7RNT A;  2L6C A;  4MH2 A;  1PN9 A;  2IJY A;  1B2M A;  1MDJ A;  3KZQ A;  1RGK A;  3GSP A;  3LXU X;  3G71 3;  2R4I A;  3EPT A;  2WFC A;  1SL1 B;  4MMX B;  3TB2 A;  5FWG A;  3O6T A;  4JRR A;  1I5G A;  1FW1 A;  4GRF A;  2QA4 3;  2GEY A;  1F3B A;  2H6Y A;  5CAX A;  1LQG C;  2R0G A;  2FA4 A;  4LMV A;  3BNC A;  3DUK A;  2XPE A;  2HML B;  5IG4 A;  1TU8 A;  1WJK A;  2F5M A;  4GQF A;  4OWY A;  2HMM B;  2RCD A;  3HJO A;  4IVF A;  5TGN A;  4CW9 A;  2IFQ A;  3KTL A;  5ECO B;  3QR6 A;  5D9T A;  1KQS 2;  3VK9 A;  5J9C A;  5CP1 A;  1GRX A;  3NQY A;  2M72 A;  5CF2 A;  5HOH A;  3G16 A;  8CHO A;  2RUF A;  4NV5 A;  3Q90 A;  1F37 A;  3WHO A;  4AEQ A;  2RFR A;  3RGA A;  1YJ9 3;  2C0G A;  5D82 A;  2QGU A;  2P0G A;  3C71 A;  1OHO A;  5G1K A;  1N8J A;  1VF2 A;  3LH4 A;  1GP1 A;  2GZY A;  4TXO B;  5EPF A;  6STD A;  2H75 A;  3I43 A;  1W01 A;  3RAZ A;  1Y4K A;  2J23 A;  11GS A;  1ZX2 A;  3F7X A;  3EBT A;  1I9D A;  1K8A 4;  1M9B A;  4HI7 A;  1GYB A;  3WA2 X;  4MDC A;  5EVO A;  1AC1 A;  4LMW A;  2VD0 A;  3NBB A;  1D6U A;  1Q40 A;  5EVH A;  3OW2 2;  1IDP A;  4ZL9 A;  5ID2 A;  4KAE A;  3LQ7 A;  2F8F A;  3TJF A;  1C72 A;  1OYJ A;  5I97 A;  2B1X B;  2YJH A;  1VF1 A;  4BA7 A;  2BTO T;  3FF2 A;  1MTC A;  3PYJ A;  1BOX A;  4DKI A;  1XOB A;  1YGE A;  3MSO A;  2N5A A;  1KWI A;  1IVX A;  4HQS A;  1OGZ A;  1XCC A;  1JRQ A;  4L8E A;  3DGN A;  5D73 A;  2GSQ A;  3A5I A;  5AYR B;  3KEB A;  3KCH A;  3UBK A;  5ECK B;  5F0G A;  1BSD A;  4WBR D;  1EP7 A;  3E99 A;  2HZF A;  5AYS C;  1XW9 A;  1NJI 4;  2AV4 A;  1RN1 A;  3D5J A;  3CSI A;  3LJR A;  3N9J A;  2R4V A;  2PBJ A;  4LA1 A;  2IMK A;  4G9H A;  2GBX B;  3EJV A;  4IQ1 A;  2OWP A;  3AGN A;  1X1W A;  4G19 A;  2YFI B;  3QAW A;  1AAZ A;  4WKW A;  3KCM A;  3Q19 A;  2PN8 A;  1S3C A;  3S27 A;  1F9M A;  4ECC A;  2GBW B;  1OKT A;  4N0V A;  3GFK A;  1SK2 A;  4BL2 A;  2AHE A;  1XWB A;  4OFM A;  2VCV A;  1YDK A;  4IPB A;  4KCA A;  2HSH A;  1JLV A;  3CQF A;  2OOV A;  3LT8 A;  2PMT A;  3HCZ A;  3D3L A;  3KP9 A;  1ZL9 A;  4CJN A;  1T4Y A;  1YKC A;  1KSI A;  2FGX A;  2OAD A;  3BCK A;  1XWG A;  4HM5 B;  1V40 A;  3SVA A;  3K63 A;  1YF0 A;  4BPY A;  3RDE A;  1PY3 A;  2KOK A;  4R1K A;  3DMC A;  2AYT A;  3VSY A;  1R5A A;  3B8L A;  1W2Z A;  3GKX A;  2GSR A;  1T3B A;  4V1A p;  5E59 A;  2CX4 A;  2HNL A;  4BL7 B;  3VI5 A;  1FZU A;  2XSO B;  2LRN A;  3F63 A;  1OAZ A;  4GHO A;  1U87 A;  2YWI A;  1UUG B;  3RBT A;  5CO3 A;  3OX9 A;  4O02 B;  3GST A;  4G2E A;  4MZC A;  4KFF A;  3DVX A;  1Z7P A;  3F3Q A;  1SD8 A;  1ZMA A;  3X3Z A;  1FGR A;  2QA2 A;  3FGY A;  2CWU A;  2VCX A;  3DVW A;  1E2Y A;  1V98 A;  2Z6B A;  4LYL B;  1K3L A;  4K6X A;  3EE1 A;  2MYG A;  4K61 A;  3VUR A;  1DVD A;  4N6T A;  2ML5 A;  3J7Y b;  1EQK A;  2H1A A;  3S29 A;  3UJ1 A;  2CWV A;  1W5Z A;  1YHQ 3;  3CC2 3;  1XXU A;  3IK7 A;  5KN3 A;  1OE7 A;  3LOR A;  3CMA 3;  2CVD A;  4MJB A;  4K5R A;  4WP5 A;  2FLS A;  5AIH A;  3FMW A;  2CWT A;  2RLI A;  2YAN A;  4OK0 A;  1R4C A;  8RNT A;  5JWR B;  1T00 A;  5DAL B;  1FVK A;  1OH0 A;  4XS1 A;  4EYC A;  2B6M A;  2RSX A;  1ULI B;  4LEH A;  2FNO A;  4FH8 A;  1YY7 A;  2EIR A;  2LKU A;  3GX8 A;  4RI7 A;  2F99 A;  1XWC A;  2IN3 A;  3RPN A;  3CPW 2;  2B1L A;  1BRI A;  1B2U A;  2GTU A;  3D6I A;  1T7P B;  1GD4 A;  6GSW A;  2F98 A;  1M2A A;  5INY A;  3KIJ A;  2WOF A;  3FZ4 A;  2WDU A;  1GSS A;  1AV4 A;  2C3Q A;  4EIQ A;  3EBY A;  4HOH A;  2D2Z A;  1AQV A;  3ROB A;  3A3T A;  4J2F A;  2BMO B;  1TRV A;  3DZL A;  3AMO B;  4U13 A;  4Q5N A;  1UCK A;  3NZN A;  4G0L A;  1AY7 A;  1JZO A;  5AI1 A;  1GSE A;  2O9U X;  1RCL A;  3DD3 A;  4CHS A;  2KRT A;  1ZYE A;  3T8N A;  3LTA A;  2KF6 A;  1A2V A;  1JV2 B;  4HM3 B;  3TKS A;  5CRE A;  2FA8 A;  1W4N A;  2A2S A;  1PFO A;  5ELG A;  3R3E A;  1OC9 A; 
#chains in the Genus database with same CATH homology
 1THO A;  4MMM A;  4PQI A;  2MMN A;  3LFL A;  1ZCP A;  2JL4 A;  5KEJ A;  3PIN A;  3WT2 A;  1RQM A;  2XBI A;  1NHY A;  2MMA A;  2G2Q A;  5B7C A;  2CVB A;  1NHO A;  3RHB A;  3ZYW A;  1YEP A;  3Q74 A;  3EIN A;  1HQO A;  3WGX A;  3TGZ A;  4MZB A;  4XS4 B;  3MAK A;  5JCW A;  5L71 A;  4ID0 A;  3GL3 A;  2RUE A;  2A4V A;  3GH6 A;  1GH2 A;  2CAQ A;  4PNF A;  5IMD A;  3E0U A;  4MPF A;  3M8N A;  3QOU A;  4KB3 A;  1QXH A;  1GLP A;  1BAY A;  4I97 A;  1XVQ A;  1EGR A;  3M1G A;  1OVN A;  4N10 A;  2QC7 A;  1ERV A;  4YAV A;  1Z9H A;  1JZR A;  2PUK C;  3KTB A;  2H0H A;  1ILO A;  3F3R A;  2CA8 A;  3MSZ A;  3AY8 A;  3L9U A;  1TP9 A;  2G0F A;  3M9J A;  1O7U A;  2GDR A;  2HSY A;  1FO5 A;  4JE1 A;  4YQM A;  4ECB A;  2EC4 A;  3CRU A;  2XHF A;  1GNE A;  4HU7 A;  2ZNM A;  5A5K A;  2JZT A;  2VLT A;  5KOX A;  3M9K A;  5H5S A;  4MK3 A;  5DCG A;  2WUL A;  1UA5 A;  3PGT A;  2A4H A;  2LEG A;  1AW9 A;  1T8E B;  3GN3 A;  5ECN B;  1Y25 A;  1GUM A;  2ALB A;  3ZIJ A;  1W4V A;  4HDE A;  2GSS A;  3QCP A;  4RUV A;  1FVJ A;  1G6W A;  5CRD A;  1QFN A;  1BX9 A;  4IN0 A;  1M9A A;  6GSV A;  3ZRE A;  1GL8 A;  2VUP A;  3L78 A;  1SK1 A;  4IJ3 A;  1YJ6 A;  3D21 A;  4PGT A;  5GSS A;  2YWO A;  1IYI A;  3UVT A;  2TIR A;  2YZU A;  4IGJ A;  2OBI A;  3O3T A;  1U3I A;  2PVQ A;  1X9W B;  3HXS A;  2O87 A;  5JWO B;  1YZX A;  3TJJ A;  3LSZ A;  4PXO A;  1J08 A;  1SYR A;  2V6O A;  1O85 A;  4DSR A;  1XVW A;  2F8A A;  1PQN A;  3VFI A;  1XW5 A;  1PD2 1;  2R2J A;  4OFT A;  3ZMK A;  4Q5F A;  1W89 A;  2M46 A;  3F6F A;  3LEF A;  2DML A;  4HZ4 A;  5BMU A;  4BVX B;  2WGR A;  5CRW A;  2WS2 A;  3WYW A;  2PU9 C;  3EC3 A;  2R5G A;  2QA1 A;  1GSY A;  4BVY B;  1VRS D;  2RM6 A;  3OR5 A;  4K0G A;  2H19 A;  2GQL A;  3UMA A;  2BJX A;  1TW9 A;  5DBQ A;  1BQ7 A;  4ECI A;  1K0O A;  1A2L A;  2F51 A;  2P5Q A;  4KE3 A;  3UAR A;  2GGT A;  2E0Q A;  5IMZ A;  1EGO A;  4KF9 A;  2HZE A;  4DSQ A;  4YKG A;  4G10 A;  3FY7 A;  3ERW A;  3SBC A;  3D22 A;  5IMF A;  3A2X A;  4MF6 A;  1QUW A;  3FR6 A;  2V6K A;  1JHB A;  1F2E A;  4TR1 A;  1WRY A;  3CYN A;  5G30 A;  4NXI A;  4KH7 A;  2E7P A;  4BWQ A;  4KDY A;  2VM1 A;  4ZL7 A;  1UVZ A;  3GH9 A;  1WIK A;  2GT6 A;  1F6M C;  3FK8 A;  4EC0 A;  1VF4 A;  3I9V 2;  4F03 A;  1H75 A;  1S3A A;  3VPT A;  4GSN A;  3G7J A;  5GAN D;  4NHW A;  1H4O A;  2DSA A;  2K18 A;  5ECH B;  2PGT A;  1NSW A;  3IAS 2;  4X43 A;  3F0I A;  3C1R A;  5JCG A;  1MDI A;  3IV4 A;  4AGS A;  3O76 A;  3DKS A;  4Z2T A;  5IIZ A;  2HXK A;  5DAK B;  2LJA A;  5D9X A;  2DIY A;  3KP8 A;  1SKR B;  3L0H A;  2H1D A;  2IY2 A;  5A4V A;  1PL1 A;  2L5O A;  4EDY A;  2NTO A;  2VLU A;  4BVY A;  2IPA A;  4O32 A;  1SL0 B;  1JZW A;  4K2X A;  4ZXG A;  2B5Y A;  5DDL A;  2NBS A;  2B3S A;  4K1F A;  3CSJ A;  1GTA A;  3A2V A;  3UL3 A;  3HA9 A;  4CDO A;  2VCT A;  2H0I A;  4XRD A;  1V9W A;  3KM6 A;  1OE8 A;  2LNT A;  2X64 A;  4MNN A;  1Z3E A;  1SJ6 A;  5IMV A;  3BCI A;  2VL9 A;  4HZ2 A;  4TXV A;  4KND A;  4HJ2 A;  3HYP A;  4OD7 A;  1WP0 A;  4AF2 A;  1XIY A;  1O8X A;  2C1Y A;  4KA0 A;  2C3N A;  3D4T A;  3ZIV A;  2HE3 A;  1ML6 A;  5B6N A;  1B4P A;  1MD3 A;  1XWA A;  2I81 A;  4LL4 B;  1JFU A;  4RI6 A;  1GSD A;  4TRX A;  3KGK A;  3G9B A;  1GSU A;  3UOM A;  1ACV A;  5IMA A;  1J9B A;  4TW5 A;  5HQP A;  2LV3 A;  3P7X A;  3ME8 A;  3CMI A;  3L4N A;  5HR3 A;  5AGY A;  2VO4 A;  2B7K A;  2C0E A;  2IMD A;  2CVK A;  5KN2 A;  3TKR A;  2CX3 A;  3LWA A;  3EVI A;  3D4M A;  4HQZ A;  2KHP A;  1R26 A;  5DAK A;  2VCZ A;  3SWL A;  1SYX A;  4ISD A;  2YV9 A;  22GS A;  2GLR A;  4PQH A;  1SD9 A;  2O85 A;  3BJ5 A;  1ZOF A;  4DSS B;  4HOJ A;  5HR0 A;  3VWV A;  2R3X A;  3H93 A;  4ZB6 A;  4ML6 A;  3IBH A;  1Q4J A;  2GT5 A;  4D73 B;  2WRT A;  1SEN A;  4EO3 A;  4HU9 A;  3EE2 A;  5DJM A;  1HNB A;  1BJX A;  1G7E A;  4USS A;  5ECL B;  1X5E A;  5GZZ B;  1ERW A;  1U88 A;  1EWX A;  4GST A;  3ZFL A;  2VAF A;  4JU5 A;  4ZIL A;  2BMX A;  3GKK A;  5ECM B;  2A2P A;  5LNK e;  4XHM A;  5LD0 A;  1HYU A;  3RHC A;  4TXO A;  3L9S A;  4EF0 A;  3APO A;  3IHG A;  1VF3 A;  3P8W A;  1TOF A;  2H72 A;  3EMP A;  1GLQ A;  5IOX A;  4MZW A;  2FWF A;  3KD0 A;  3RDW A;  2HSM A;  3IOS A;  4ZB9 A;  1WMJ A;  3EU3 A;  3FZ5 A;  17GS A;  4LLR A;  3KJY A;  1EV4 A;  3U6V A;  2B5X A;  1PRX A;  4KGI A;  1J0F A;  1KNG A;  4K5S A;  4WXT A;  1KEB A;  1YEX A;  3TJB A;  10GS A;  2OJL A;  3TKS C;  4YKF A;  2B5E A;  5J3R A;  5KN0 A;  1K3Y A;  2C0D A;  4OMV A;  1PA3 A;  4XCS A;  1SKS B;  4I5Q A;  1A2J A;  5C04 A;  4FYB A;  3TCO A;  5A4W A;  2AJQ B;  2OA7 A;  4DSS A;  5HR1 A;  1TI3 A;  3FHK A;  4FYU A;  5H5Q A;  4AJ8 A;  4YQU A;  4O5U A;  4EVM A;  4TR4 A;  4A5P A;  2UZ8 A;  3TRX A;  3GRX A;  3ZTL A;  2DC5 A;  3M0F A;  2VM2 A;  2WZ9 A;  4WR4 A;  4E8H A;  4V2N A;  4JZQ A;  4F2I A;  4KUN A;  2JAD A;  3FKF A;  5LCZ A;  1K0D A;  2IMF A;  2JAC A;  3F9U A;  1IYH A;  3HD5 A;  3DEX A;  2YN1 A;  2JZS A;  5KOW A;  4IW9 A;  4GSS A;  2YCD A;  9GSS A;  5AIS A;  3WD6 A;  3VLN A;  2HRK A;  2H74 A;  1ZYQ B;  4G0I A;  4MJC A;  4CY8 A;  1PSQ A;  3H4K A;  3TOU A;  4ML1 A;  1B9Y C;  4NHZ A;  1K0C A;  1R5P A;  1S3D A;  2MBT A;  3Q6O A;  2AAW A;  2IYJ A;  2GZP A;  4BL7 A;  4NAX A;  4WBJ A;  5J9B A;  3GTU B;  1PGT A;  3H8Q A;  4TN8 A;  3N5O A;  1PL2 A;  1FG4 A;  3F6D A;  4X0X A;  3TKQ A;  2QKE A;  3QFB C;  5G5E A;  2LRC A;  5AIV A;  5FT3 A;  5J41 A;  1M7T A;  2C80 A;  2H66 A;  4IEL A;  3DGQ A;  4Q5R A;  3F8U A;  3UEM A;  4ZBA A;  3P90 A;  3DYR A;  3FR9 A;  3G7I A;  5DAL A;  5DVB A;  3GUS A;  3VWU A;  2V1M A;  1F3A A;  1OC8 A;  4E8E A;  3GUR A;  5ECR B;  4X4J A;  1U6T A;  4KDU A;  5J5N A;  3LYK A;  4TOP A;  2IIY A;  2FHE A;  4PUF C;  2LTK A;  4OFN A;  2EIO A;  1A8Y A;  1Z6N A;  4MLY A;  2C8U A;  2OE3 A;  4N11 A;  2VCQ A;  3PH9 A;  1ERU A;  3DIE A;  2GST A;  3IE3 A;  2HYX A;  2B7J A;  5G31 A;  1MDK A;  1K0N A;  3W8J A;  19GS A;  4QL9 A;  2X8G A;  5DQS A;  1HD2 A;  3WT1 A;  1NW2 A;  5G1L A;  2L4Q A;  2PVO C;  2YPM A;  3ZLP A;  1EEM A;  1B4Q A;  1TI1 A;  3GX0 A;  2L6D A;  2MBS A;  4K7I A;  2YZH A;  5G5F A;  5ENU A;  1XBS A;  1X5D A;  1ABA A;  3FZA A;  20GS A;  3VWW A;  1K0M A;  2O8V B;  2XPD A;  3H1N A;  2TRX A;  3TJG A;  1X0R A;  4PUR A;  1XW6 A;  2YOI A;  1BG5 A;  3D0Z A;  1X9M B;  5FHI A;  3ERG A;  1Z5Y E;  4POB A;  2GZZ A;  4XS4 A;  2L5L A;  3ZRD A;  4MCU A;  2H1G A;  1PX6 A;  2KUC A;  2HI7 A;  4IJI A;  1A8L A;  4ULX A;  1ZYP A;  1B9X C;  2I1U A;  3F4S A;  6GSX A;  5IO0 A;  7GSS A;  4MF7 A;  3C8E A;  2H76 A;  1G7O A;  1MEK A;  2V41 A;  5DJL A;  5D93 A;  3C73 A;  2I3Y A;  4MF5 A;  2FD3 A;  4GCI A;  4AJ6 A;  4GWR A;  4X1U A;  5ECQ B;  2GVP A;  3KMO A;  1GTB A;  1ST9 A;  2R6K A;  4OO5 A;  3IC8 A;  3GYK A;  3IRA A;  3HKR A;  2MMO A;  5D9V A;  2L4C A;  4GLT A;  2IME A;  1RK4 A;  3MDK A;  5JWQ B;  4ACS A;  2DJK A;  5EL8 A;  2N5F A;  6GST A;  3S9F A;  3HZ8 A;  1EOG A;  3IDV A;  4WF4 A;  2VL2 A;  3FEU A;  2CV4 A;  5IPG A;  2QGV A;  4TKY A;  3US3 A;  2X8H A;  3LXT A;  4XTS A;  3CTF A;  1OC3 A;  1Y6E A;  2L57 A;  4EUY A;  4F0C A;  4ZBB A;  3W8S A;  1NM3 A;  4EKZ A;  3TDG A;  2X4A A;  1YF1 A;  2DBC A;  2FWH A;  1TRU A;  2ON5 A;  4PTS A;  5BRT A;  1V58 A;  2IFQ B;  1TJD A;  2DJ3 A;  1TRW A;  4HS1 A;  1M2D A;  3ME7 A;  1AQX A;  2H70 A;  1XWK A;  4AJ7 A;  1E6B A;  2JZR A;  4F0B A;  2Z9S A;  3HVS A;  5B8B A;  4N30 A;  2DJ1 A;  1ZZY A;  1VGL A;  1AXD A;  1ON4 A;  18GS A;  3GNJ A;  3LG6 A;  3HHV A;  1RW1 A;  5IPH A;  1V57 A;  4IBP A;  5CNW A;  4ZB8 A;  5KN1 A;  5ID2 B;  3R2Q A;  4YAP A;  12GS A;  5CYY A;  1K3O A;  2GS3 A;  2LJR A;  3TKP A;  4BVX A;  2R37 A;  2DKH A;  3VI7 A;  5H5R A;  1SL2 B;  3HZ4 A;  5HFI A;  4PX1 A;  3M3M A;  4HUA A;  4I2U A;  3LYP A;  5ELA A;  2MMZ A;  3HJM A;  4NV2 A;  3GL5 A;  5D9W A;  2MZC A;  3EYT A;  4H86 A;  3QAG A;  2GQK A;  3ERF A;  5A4U A;  1GUK A;  3GA4 A;  3HJP A;  1O6J A;  4FIW A;  3CRT A;  6GSY A;  1Z6M A;  3V1W A;  1XZO A;  3IR4 A;  4PNG A;  3IA1 A;  2X49 A;  3NIV A;  2LUS A;  5B6M A;  2R0P A;  3ISO A;  4ZL8 A;  1BYE A;  3A2W A;  4JR4 A;  1FOH A;  2CAI A;  3PR8 A;  1TU7 A;  3GHA A;  3QD9 A;  1M2B A;  1LJR A;  4ILF A;  1T4Z A;  2VLV A;  2DJJ A;  1QK8 A;  2J9H A;  2YV7 A;  2O89 A;  4FYC A;  3G7Y A;  2WJU A;  4K9Z A;  1T1V A;  2E2G A;  4YH2 A;  3W6G A;  2OKA A;  2H30 A;  5DCH A;  3APQ A;  4DEJ A;  2HRF A;  2CT6 A;  1EEJ A;  2X99 A;  3H79 A;  2LQQ A;  3GSS A;  2DJ2 A;  4RQX A;  1YQ1 A;  3RPP A;  3P2A A;  3JCM L;  4GF0 A;  3IC4 A;  1OKD A;  2CZ2 A;  2RM5 A;  2EIQ A;  5F07 A;  4FO5 A;  3A5W A;  3K8N A;  2P5R A;  1XOA A;  5E4W A;  14GS A;  1TK0 B;  2HT9 A;  4NPB A;  2QSI A;  1KTE A;  1SKW B;  2I4A A;  2KP1 A;  3LGC A;  2PWJ A;  2K6V A;  2L59 A;  3ZZX A;  3DML A;  3EU4 A;  4I6X A;  4Z2U A;  2B1K A;  4NMU A;  1TKD B;  5DQY A;  5B8A A;  2H71 A;  4K2D A;  5GST A;  1X9S B;  3I69 A;  2GQM A;  1GTU A;  3QFA C;  3ZVJ A;  5D96 A;  3FYG A;  1TDI A;  4OCE A;  1TK8 B;  2V2G A;  4EL1 A;  4IHU A;  2M80 A;  4OO4 A;  2K8S A;  4YQV A;  4KSM A;  4JBB A;  4POL A;  4IP6 A;  1GSQ A;  1LU4 A;  5IMC A;  4NWY A;  2FCH A;  3KH9 A;  5CRH A;  4P3Y B;  4L0U A;  1DE1 A;  2TRC P;  1DE2 A;  1OC9 B;  2LS5 A;  2REM A;  4G0K A;  2ZUP A;  3MWH A;  1A23 A;  3TKS E;  1M0U A;  5F05 A;  1PMT A;  4HEA 2;  1SJI A;  2CQ9 A;  3E3E A;  3GMF A;  1SJZ A;  5G2Z A;  2JU5 A;  3WGE A;  2XBQ A;  2OBK A;  4FQU A;  4F82 A;  1UC7 A;  2K8V A;  2HRA A;  4D73 A;  4I8B A;  5IQY A;  5AIX A;  2OE1 A;  3IPZ A;  3C7M A;  3KH7 A;  5GAP D;  2H73 A;  1GUL A;  4F9Z A;  2WB9 A;  3DRN A;  3IXR A;  4JED A;  2ON7 A;  4IQA A;  3HVX A;  1URM A;  1WOU A;  5ECI B;  1JZD A;  1QGV A;  1G0T A;  2H6X A;  1K0A A;  4GXZ A;  3F4R A;  3FRC A;  1PX7 A;  5HR2 A;  2HFD A;  2LNS A;  3ZML A;  4IP1 A;  3I6A A;  3HVV A;  3ED3 A;  4PQ1 A;  5JCU A;  2C3T A;  2YWN A;  1GTI A;  3QPM A;  2IWT A;  4MPG A;  5ECS A;  2O7K A;  1PKW A;  5IOW A;  1EP8 A;  3IK9 A;  2WCI A;  3EWL A;  1K0B A;  4WEY A;  4I2T A;  3BOA A;  1ERT A;  1QMV A;  5F06 A;  1DBY A;  4HJM A;  2H8L A;  2HLS A;  3PPU A;  4Z2R A;  2H0G A;  1DSB A;  4JR6 A;  4ZBD A;  1SK0 A;  1EZK A;  2YJ7 A;  5F8B A;  2OAC A;  3LXZ A;  3HY2 A;  4MJA A;  3EMX A;  3GV1 A;  4KX4 A;  3TUE A;  4K8M A;  2C0F A;  2C4J A;  2JSZ A;  3UVH A;  1TRS A;  2KLX A;  3UIW A;  4EDZ A;  16GS A;  1X5C A;  3F4T A;  3Q18 A;  3VPQ A;  4KSO A;  3MNG A;  4N0Z A;  2VL3 A;  4V2L A;  1GUH A;  4XRA A;  4IS0 A;  3LW9 A;  1O8W A;  1O81 A;  1Z7R A;  2F9S A;  5J4U A;  5IO2 A;  1FHE A;  1HNA A;  1UN2 A;  4J57 E;  2KP2 A;  3TJK A;  1WE0 A;  2NDO A;  4RQR A;  2H1B A;  6GSS A;  3IHQ A;  4MJE A;  3GKN A;  4EXJ A;  2LJK A;  1YKA A;  2A2R A;  4BWS A;  1EV9 A;  3QMX A;  2DMM A;  4CY6 A;  2PPT A;  1Q98 A;  4MA9 A;  5ECP B;  4POM A;  4WF5 A;  2DLX A;  3GTU A;  2H6Z A;  2JSY A;  1A24 A;  2OE0 A;  3ZFB A;  4TR0 A;  4ZIJ A;  3FZ9 A;  4GQC A;  4PUA A;  4O7H A;  4V2M A;  4J56 E;  1TK5 B;  3KMN A;  2VL2 C;  2RII A;  3CSH A;  2FUG 2;  1ZGN A;  2DKI A;  3ZIT A;  2HZE B;  3MYD A;  4K0N A;  3UBL A;  1QQ2 A;  4L5L A;  3U5R E;  1MD4 A;  4TR1 B;  4MH3 A;  2FY6 A;  4XS6 A;  4ICY A;  1AQW A;  1THX A;  2R0C A;  5ABR A;  13GS A;  2V32 A;  1M99 A;  1FOV A;  4O5Q A;  2LST A;  1WPI A;  1WWJ A;  2X8C A;  1USB A;  3CTG A;  2NVL A;  2FWE A;  2XC2 A;  2VD1 A;  1TXX A;  3C1S A;  5D8I A;  5COH A;  5CRG A;  5IM9 A;  1PKZ A;  1EOH A;  3IAM 2;  1R4W A;  2YNX A;  2FWG A;  3VWX A;  1JLW A;  2LRT A;  4Q5Q A;  3TRP A;  2N5B A;  3QDN A;  2LQO A;  3EUR A;  1SU9 A;  3J7Y k;  1CQG A;  3ZVJ D;  2ZCT A;  3CBU A;  1HNC A;  1TTZ A;  3MIX A;  4EIP A;  4V1A g;  2HRN A;  4O5R A;  4QQ7 A;  3NOF A;  4GTU A;  4DVC A;  3TOT A;  2P31 A;  4MAB A;  1LBK A;  3UAP A;  2NPB A;  1FB6 A;  1A0F A;  1GSF A;  3DXB A;  1G6Y A;  1O73 A;  1V2A A;  1AUC A;  1N2A A;  1KBN A;  2DIZ A;  1BED A;  2AUV A;  3TRQ A;  3WGD A;  4MP4 A;  4TR3 A;  4POK A;  3ZL5 A;  3HDC A;  1DUG A;  1GNW A;  2I9H A;  4K7O A;  1R7H A;  4KW6 A;  1B48 A;  2VCW A;  4XIH A;  4ECJ A;  3APS A;  3CXG A;  1A2M A;  3L9V A;  2YP6 A;  1B8X A;  4L5O A;  2DJ0 A;  3FW2 A;  2E2M A;  1U3A A;  1FAA A;  2VIM A;  3GKM A;  4QL7 A;  5HFK A;  4Z7X A;  4TVE A;  3KXO A;  1FB0 A;  4WR5 A;  1XPV A;  2PER A;  4L0W A;  1GWC A;  4KCE A;  2VOC A;  3QAV A;  4WET A;  3E9J B;  3GIX A;  4KDX A;  4LL1 B;  2F3M A;  3BD2 A;  8GSS A;  5C00 A;  3DWV A;  4EE0 A;  1ZYN A;  1A0R P;  2H01 A;  1CQH A;  2ES7 A;  2IL3 A;  3BBY A;  4OCF A;  4K7N A;  2YWM A;  4O92 A;  6GSU A;  2IMI A;  1PN0 A;  2K9F A;  5EY6 A;  1AIU A;  4IKH A;  5HFG A;  2CZ3 A;  2AB6 A;  1XFL A;  5AN1 A;  3FR3 A;  2L6C A;  4MH2 A;  1PN9 A;  2IJY A;  1MDJ A;  3KZQ A;  3EPT A;  2WFC A;  1SL1 B;  3TB2 A;  5FWG A;  3O6T A;  4JRR A;  1I5G A;  1FW1 A;  4GRF A;  1F3B A;  2H6Y A;  5CAX A;  2R0G A;  2FA4 A;  4LMV A;  2XPE A;  1WJK A;  1TU8 A;  4GQF A;  4OWY A;  3HJO A;  4IVF A;  4CW9 A;  2IFQ A;  3KTL A;  5ECO B;  3QR6 A;  5D9T A;  3VK9 A;  5J9C A;  5CP1 A;  1GRX A;  2M72 A;  2RUF A;  4NV5 A;  1F37 A;  2C0G A;  3C71 A;  2P0G A;  5G1K A;  1N8J A;  1VF2 A;  1GP1 A;  2GZY A;  4TXO B;  5EPF A;  2H75 A;  3I43 A;  3RAZ A;  2J23 A;  11GS A;  1I9D A;  1M9B A;  4HI7 A;  4MDC A;  5EVO A;  1AC1 A;  4LMW A;  2VD0 A;  4ZL9 A;  5ID2 A;  4KAE A;  3LQ7 A;  2F8F A;  3TJF A;  1C72 A;  1OYJ A;  2YJH A;  1VF1 A;  4BA7 A;  2BTO T;  1MTC A;  1XOB A;  2N5A A;  4HQS A;  1XCC A;  4L8E A;  5D73 A;  2GSQ A;  3A5I A;  3KEB A;  3UBK A;  5ECK B;  5F0G A;  4WBR D;  1EP7 A;  2HZF A;  1XW9 A;  2AV4 A;  3D5J A;  3CSI A;  3LJR A;  3N9J A;  2R4V A;  2PBJ A;  4LA1 A;  2IMK A;  4G9H A;  4IQ1 A;  4G19 A;  3QAW A;  1AAZ A;  4WKW A;  3KCM A;  3Q19 A;  2PN8 A;  1S3C A;  1F9M A;  4ECC A;  1OKT A;  4N0V A;  3GFK A;  1SK2 A;  2AHE A;  1XWB A;  4OFM A;  2VCV A;  1YDK A;  4KCA A;  2HSH A;  1JLV A;  2PMT A;  3HCZ A;  3KP9 A;  1ZL9 A;  1T4Y A;  1YKC A;  2FGX A;  2OAD A;  3BCK A;  1XWG A;  1V40 A;  1YF0 A;  4BPY A;  2KOK A;  2AYT A;  1R5A A;  3GKX A;  2GSR A;  1T3B A;  4V1A p;  5E59 A;  2CX4 A;  2HNL A;  4BL7 B;  3VI5 A;  2LRN A;  3F63 A;  1OAZ A;  1U87 A;  2YWI A;  3RBT A;  5CO3 A;  3GST A;  4G2E A;  4MZC A;  3DVX A;  1Z7P A;  3F3Q A;  1SD8 A;  1ZMA A;  2QA2 A;  2VCX A;  3DVW A;  1E2Y A;  1V98 A;  1K3L A;  4K6X A;  2MYG A;  3VUR A;  3J7Y b;  2H1A A;  3UJ1 A;  1XXU A;  3IK7 A;  5KN3 A;  1OE7 A;  3LOR A;  2CVD A;  4MJB A;  4K5R A;  2FLS A;  3FMW A;  2RLI A;  2YAN A;  5JWR B;  1T00 A;  5DAL B;  1FVK A;  4XS1 A;  2B6M A;  2FNO A;  4FH8 A;  1YY7 A;  2EIR A;  2LKU A;  3GX8 A;  4RI7 A;  1XWC A;  2IN3 A;  3RPN A;  2B1L A;  2GTU A;  3D6I A;  1T7P B;  6GSW A;  1M2A A;  5INY A;  3KIJ A;  3FZ4 A;  2WDU A;  1GSS A;  2C3Q A;  4EIQ A;  2D2Z A;  1AQV A;  3A3T A;  4J2F A;  1TRV A;  4Q5N A;  3NZN A;  4G0L A;  1JZO A;  1GSE A;  3DD3 A;  4CHS A;  1ZYE A;  3TKS A;  5CRE A;  2FA8 A;  2A2S A;  5ELG A;  3R3E A;  1OC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...