4ILFA

Crystal structure of dsbc r125a from salmonella enterica serovar typhimurium
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
AMDPEFMDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPAQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbC
publication title Crystal structure of the periplasmic disulfide-bond isomerase DsbC from Salmonella enterica serovar Typhimurium and the mechanistic implications.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 4ilfA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ilfA02
1VF3A 2LTKA 1GULA 1JZWA 3F9UA 2DIYA 1M9AA 4K0GA 3ZREA 4ZXGA 1EV4A 4JRRA 2MZCA 2FLSA 2WS2A 3VPQA 4NV2A 4TR0A 2YN1A 2A4VA 4XHMA 5ECNB 5CP1A 1XCCA 2AUVA 1YEPA 2M46A 1XBSA 3KEBA 2MYGA 2TRXA 3IV4A 1EEJA 5DQSA 3KXOA 1EP7A 4JZQA 1H4OA 3DVXA 4I97A 3TRQA 3M9KA 2KLXA 4TVEA 3GNJA 1GSUA 2CV4A 2XHFA 5J9CA 4ZB6A 4BWQA 3C1SA 5EPFA 3G7JA 5H5QA 2GZZA 3LGCA 5FT3A 2O85A 2TRCP 4LA1A 1TRSA 1GNWA 5ECHB 3CXGA 2ON5A 1TXXA 3TKSA 4G19A 5E59A 1G6YA 2CZ2A 4IQAA 1W89A 5HQPA 3E3EA 2VM2A 5JWRB 4AJ7A 5IO0A 5G5FA 3FRCA 2LRNA 1B9XC 4HZ4A 1OC9A 1UC7A 19GSA 2L59A 4JEDA 1M2BA 1ILOA 2JZTA 3TUEA 3IR4A 4EDYA 1EOGA 3FR3A 1VF2A 2C4JA 4GSSA 4PGTA 5F05A 1SD9A 3KIJA 1ACVA 1YKCA 2FGXA 2H72A 4XIHA 1EP8A 1SJZA 2PN8A 3UIWA 1OYJA 2JSZA 1YQ1A 5DDLA 2PU9C 1M7TA 3VWVA 3E9JB 3H8QA 3NIVA 3M8NA 5DAKB 5ECKB 3QAGA 2N5BA 3ISOA 4N0ZA 4YH2A 3EU3A 2VIMA 4KGIA 1YJ6A 2B5XA 2OE3A 5DCGA 5JCWA 1U6TA 2R4VA 4KUNA 3VLNA 3J7Yb 1QK8A 2DJ0A 3LSZA 4TW5A 1BG5A 3ZIVA 4ZB9A 4BL7A 2F8AA 4WBJA 3I6AA 4IGJA 4N30A 4LLRA 3H4KA 4GLTA 1MD3A 2EIQA 2DSAA 2C0GA 1SJIA 3IHQA 5CO3A 1ZYEA 2Z9SA 1SKSB 2FUG2 4WF4A 1TI3A 5ECOB 3UBLA 1G7EA 3QAWA 3M3MA 3A2WA 3L78A 3FZ9A 2PBJA 2DBCA 2IL3A 2CX4A 4EO3A 3FKFA 3IK9A 3P90A 2O8VB 3O3TA 4NWYA 2O89A 4IP1A 4IJIA 3ME8A 4XS4B 4KW6A 2OE1A 3FW2A 1WMJA 1URMA 2H0IA 5DAKA 3L0HA 3SWLA 1EEMA 2JADA 2I3YA 5A5KA 4EL1A 2KOKA 1F6MC 2H70A 3DRNA 3DGQA 2IIYA 4N11A 3TGZA 3CSJA 2G0FA 2H74A 2L4QA 1PD21 2GLRA 3MAKA 2NPBA 2X8HA 3ERWA 3F4SA 2C0FA 1GSFA 2I1UA 1K0BA 1T4ZA 4QL9A 1MDIA 5ID2B 1F37A 2GGTA 2IWTA 5HR1A 2IMKA 2YWIA 3EMXA 2CAIA 3HA9A 1XW9A 3VWUA 4MP4A 2HLSA 3D0ZA 4NXIA 4V1Ag 3TJBA 3TOTA 2PWJA 1XFLA 4X1UA 3VWWA 3ZYWA 3LXZA 4F2IA 5ECRB 3MNGA 1YDKA 2YPMA 1X9SB 5IMFA 1KTEA 3KM6A 1DUGA 5DJLA 2X64A 4MH3A 1EZKA 5HR3A 4XS4A 3TKQA 1TK8B 2JSYA 2YWOA 1PL1A 3BBYA 4V2MA 2FCHA 4KA0A 2QKEA 3TB2A 2CVDA 4K2DA 5F06A 2OKAA 4K7IA 3RHBA 1VF1A 1A2MA 5ECIB 2KUCA 1XWGA 4OWYA 5HR0A 3QAVA 1OC8A 4POBA 5ECQB 2H1DA 2L6DA 3F63A 4CW9A 2GTUA 3GKKA 4HZ2A 1XWAA 3IXRA 2V2GA 2P5QA 2X8GA 3UBKA 1SKRB 3ZMLA 4IELA 2PMTA 1NM3A 1J08A 1WJKA 6GSXA 2BTOT 3BD2A 4BVXA 2GVPA 2YWMA 1Q4JA 4OFMA 2VL3A 4ZL9A 1G6WA 3TRPA 4GQCA 4NPBA 1HD2A 1LJRA 3QOUA 4E8HA 2H8LA 4NHWA 1SL1B 4CDOA 3CRUA 5IMVA 3EINA 5IMCA 1Z5YE 1U88A 2H0GA 3ERFA 4FYBA 1A23A 4PUFC 2H6YA 5GSTA 2RM5A 2K6VA 4ID0A 3IRAA 1LBKA 2DMMA 1V98A 3ZZXA 3G7YA 2NTOA 4WR5A 3LXTA 1SK2A 3APQA 3BCKA 1PQNA 4IVFA 2H6ZA 3A5WA 2VLUA 2CT6A 4BVYA 3L9VA 3U5RE 1K0NA 4LMWA 1B8XA 5B6MA 4MZWA 4EUYA 1OVNA 1ST9A 3IOSA 1XVQA 5EY6A 3UEMA 1GSDA 5ENUA 3IE3A 2IYJA 1OE7A 3F8UA 4KCEA 5KN0A 3TJKA 4L0UA 3W8JA 4QL7A 5B8BA 2B5YA 2OBKA 3FYGA 4PQHA 5C04A 1B48A 1T7PB 3GHAA 3EE2A 2H66A 2C3TA 4HQZA 1PRXA 1XWCA 1QFNA 5JWQB 2OJLA 3HVXA 1Z6MA 3ZFLA 2B3SA 5A4WA 1V57A 5KN3A 4HUAA 2GZPA 1AAZA 2F8FA 5ECSA 5CYYA 1RK4A 2HFDA 3BOAA 3UAPA 3UOMA 1WE0A 1RW1A 5F07A 5J4UA 1QMVA 4GF0A 4WETA 3M1GA 2GSQA 1U3IA 3UARA 2BJXA 4YAVA 5J3RA 2VO4A 1V9WA 2VCWA 2LNTA 1JFUA 3QCPA 3I69A 4D73A 5CAXA 1DE2A 3NZNA 5A4UA 2WULA 1MDJA 1ML6A 3KH7A 1PN9A 4KH7A 2R5GA 5C00A 2IY2A 2GSTA 3GL3A 2HT9A 3FZAA 2P5RA 4ACSA 5IMDA 2AB6A 2LJRA 2J23A 4ZBDA 2RUEA 5LD0A 3WGEA 2E2GA 4J56E 3HCZA 4ECBA 3KD0A 2C1YA 4PQIA 2XPEA 3WGXA 4ISDA 1SK0A 5JCGA 1IYIA 2OE0A 4IQ1A 1OC9B 1Y6EA 2PUKC 3M0FA 1A8YA 1XXUA 1LU4A 4POLA 1Y25A 4KB3A 6GSSA 2R37A 5ELGA 2M80A 4BWSA 4G9HA 1V40A 1B4QA 1FG4A 3L4NA 3GFKA 3PINA 1M2DA 1SJ6A 5AIVA 3TRXA 2LV3A 2EIOA 2G2QA 1ON4A 3EMPA 4N0VA 5B6NA 2VUPA 4IHUA 1OKDA 1R26A 1A2LA 1WP0A 3RPPA 5GAND 1ZMAA 4GWRA 5FWGA 2OBIA 2LJAA 1UN2A 4I2UA 2YANA 2YJHA 4RI6A 5EVOA 3GSTA 4TXVA 1OAZA 3CSHA 1ZL9A 1UA5A 2CVBA 1GUMA 1PX6A 4O92A 2CZ3A 1R5PA 4K1FA 2F51A 5GZZB 2GSRA 4IP6A 1BJXA 3HVVA 1NHYA 2B1KA 3FR9A 4OMVA 2YJ7A 4JR6A 4HQSA 4QQ7A 2DJ3A 2L5OA 1YF1A 4EF0A 4MJBA 4HEA2 4ECIA 4K7NA 3A2VA 5JWOB 3CSIA 3EWLA 3PH9A 1B4PA 4TR1A 13GSA 5KN1A 3U6VA 2V1MA 5EL8A 4ECJA 4HJMA 1XOAA 4ZL7A 1ZOFA 3C8EA 5ECPB 1TK0B 3KP9A 3TDGA 3Q19A 4MMMA 3A2XA 1PSQA 2HZEB 3QR6A 5IPGA 5IPHA 1TW9A 4N10A 3ERGA 3RHCA 1VF4A 1TRVA 2FA4A 3C71A 4ZBAA 4L5OA 2RM6A 2GQKA 2IPAA 4MJCA 5G1LA 1X9WB 4LL4B 6GSYA 2VCXA 2VAFA 1DSBA 4POMA 1GTAA 4L5LA 3GURA 9GSSA 2V32A 4JBBA 2WZ9A 3IA1A 3Q74A 1HNBA 2ON7A 2FWHA 2VCZA 3HJMA 2VOCA 4OO5A 1K3YA 4HS1A 3L9SA 3QFAC 3VK9A 2WGRA 3LYKA 1OC3A 12GSA 4WEYA 3E0UA 3FR6A 2IMFA 4ZBBA 2H75A 4V1Ap 3L9UA 4GQFA 1R5AA 1OE8A 4XCSA 3WGDA 3FHKA 4MDCA 3JCML 2HRNA 1GSYA 4G2EA 4K7OA 2HYXA 3VURA 1ERUA 4HI7A 5G2ZA 2K8SA 3CBUA 1C72A 1M9BA 2HZEA 1GTUA 5COHA 2MBSA 2MMAA 6GSUA 3LEFA 1SKWB 5DVBA 5J5NA 1JLVA 2C0EA 1SL2B 18GSA 1XIYA 1Z7PA 5CRWA 3PGTA 2VL2C 4JU5A 1BEDA 1TRWA 4KDXA 4K6XA 1FHEA 3ZRDA 5G1KA 3EC3A 3GL5A 1XZOA 1DE1A 4XS6A 4KSOA 1WWJA 4FYUA 3IDVA 5AGYA 2O7KA 1FB6A 1SYRA 3P8WA 2GS3A 2VD0A 1JLWA 1KEBA 2YCDA 2DC5A 5D9VA 3D6IA 4LMVA 1EOHA 14GSA 4AF2A 4KCAA 1XWKA 4WBRD 1GSSA 5KEJA 1EV9A 1PKWA 2M72A 3WT1A 2RUFA 1GSEA 2I9HA 2LSTA 4JE1A 1A0FA 4TRXA 4IKHA 2LQOA 3GIXA 1GH2A 3D5JA 1YF0A 5CRHA 3F4TA 3GKNA 1F3AA 2N5FA 3I43A 6GSVA 1EWXA 2H6XA 1O8WA 2WDUA 4HDEA 1GWCA 2KP2A 4K9ZA 1GUKA 1M99A 1N8JA 5D93A 1QXHA 1Z9HA 5D8IA 2JACA 4KX4A 3KMNA 1GUHA 1AIUA 1JZRA 3EYTA 1FW1A 1EGRA 5JCUA 2QC7A 3Q6OA 3ZLPA 2H71A 3BCIA 1X9MB 3VI7A 1SK1A 4FO5A 4Q5NA 1O81A 3TJGA 2A2SA 1BYEA 4PQ1A 1VGLA 4OCFA 3KJYA 2F9SA 4DSSB 1JHBA 1NHOA 2REMA 3IK7A 1YY7A 5LCZA 1TKDB 1KBNA 1THOA 1EGOA 3H79A 2EC4A 3F3RA 4O7HA 3HVSA 5G31A 2FWFA 4J2FA 2L6CA 3EURA 4F0BA 4EKZA 5AN1A 2GZYA 1V2AA 2K8VA 4TR4A 2VLTA 4NAXA 2H1BA 4MF5A 2AV4A 3TKPA 2TIRA 1U3AA 1BQ7A 3KP8A 4L8EA 2MMNA 1F9MA 3CYNA 4XTSA 10GSA 1QUWA 1FVKA 2DIZA 2N5AA 3O76A 4IJ3A 1GL8A 1O8XA 4AGSA 4ULXA 1YZXA 3F6FA 2H01A 2RLIA 3OR5A 4EXJA 2B5EA 1FO5A 2ES7A 1ZGNA 2F3MA 4D73B 4MPFA 4TR3A 4KSMA 3LG6A 2WFCA 2WB9A 1AQXA 3HD5A 1NSWA 4OCEA 5CNWA 2H19A 4AJ6A 4MABA 1S3CA 4DSSA 2H1AA 4EC0A 1PGTA 5GAPD 4PNFA 3KCMA 3GA4A 4MCUA 2WJUA 16GSA 4MK3A 5LNKe 1X0RA 2PPTA 3HJPA 3HZ8A 2PERA 22GSA 4XRDA 4P3YB 2CQ9A 2L4CA 1GNEA 5F8BA 4HU7A 4ML1A 4IW9A 1TDIA 2PVOC 2RIIA 1ZZYA 2FWGA 2GSSA 3HZ4A 4NHZA 1M2AA 1PL2A 1TOFA 4K0NA 4TXOB 5FHIA 2YZHA 5ELAA 3CTFA 2R6KA 3HKRA 1T3BA 4HU9A 3GKXA 4XS1A 3N9JA 1PA3A 4V2NA 1GLPA 5B8AA 3LORA 1K3OA 2EIRA 1N2AA 3UL3A 2HSHA 4GSTA 4CHSA 1RQMA 2IMEA 1TU7A 4IS0A 2XBIA 1TTZA 3J7Yk 4YQUA 4PUAA 2C8UA 1NW2A 5INYA 17GSA 1O7UA 4PXOA 1KNGA 5G5EA 1AC1A 5CRGA 1TRUA 20GSA 2O87A 2YV7A 1ERWA 3DD3A 1GSQA 1ZYQB 3GN3A 2FHEA 1WOUA 3C7MA 4OD7A 2C3NA 5IOXA 3GX8A 2YV9A 3HY2A 2YZUA 2V6KA 2P0GA 2C80A 1GLQA 1A2JA 3D4TA 5E4WA 4POKA 1CQHA 4DEJA 3IAM2 1I5GA 4ZL8A 5G30A 3DIEA 4XRAA 1XWBA 3TOUA 2GT5A 2VCTA 2MMOA 3ME7A 3KTBA 3IPZA 4TXOA 2R3XA 1WRYA 4YAPA 4MJAA 3TJJA 3GH6A 1YKAA 4MZBA 4Q5RA 2IFQA 2VL9A 1CQGA 3ZVJA 2LJKA 4DSQA 3W8SA 2NVLA 4X43A 4TR1B 3F3QA 1M0UA 2L5LA 3HXSA 2QSIA 3FEUA 1G7OA 1ZCPA 4NV5A 3UMAA 4O32A 2GT6A 2MMZA 3D4MA 3F4RA 3LYPA 4OO4A 2VLVA 1E2YA 3W6GA 4WF5A 1TI1A 3FK8A 2VD1A 1GTBA 3VFIA 1HQOA 3H1NA 1K3LA 3DEXA 2B7JA 1AQWA 2HI7A 4FYCA 3GRXA 3APSA 3I9V2 4Q5QA 4KNDA 5J9BA 2WCIA 4X0XA 3UVTA 3VWXA 4DVCA 3F0IA 2X8CA 5ECMB 1MDKA 5IMZA 1R4WA 3TKSC 1K0AA 1XVWA 2K9FA 4MH2A 1BX9A 2YNXA 2B6MA 4NMUA 4WR4A 4TN8A 3KH9A 1GP1A 2JZRA 5D9WA 4JR4A 2X99A 1XPVA 1USBA 2LEGA 2DJJA 5F0GA 2WRTA 4F0CA 1SU9A 1ABAA 1H75A 2DJKA 4GTUA 4MLYA 1HNCA 1PKZA 2ZCTA 2VCVA 5AIXA 7GSSA 1UVZA 4MA9A 1V58A 3VI5A 4O5RA 2YOIA 1Q98A 5L71A 3WT2A 2BMXA 2OA7A 2PVQA 5HFGA 2AHEA 4E8EA 2IJYA 2C3QA 3LFLA 2AAWA 4F82A 2V41A 3RDWA 1S3DA 2CAQA 2QGVA 4H86A 4K8MA 1J0FA 1WPIA 4J57E 3GUSA 3V1WA 3EVIA 4PURA 4V2LA 1K0MA 4KDUA 1OKTA 4WXTA 3R2QA 1U87A 2R2JA 2H1GA 1IYHA 1SL0B 1I9DA 1JZDA 3TKRA 3G7IA 3CTGA 3D21A 3P2AA 3KTLA 5HFKA 5HFIA 5AISA 3KZQA 2A2RA 2LNSA 3IAS2 4RI7A 3ED3A 3UVHA 1AW9A 3WD6A 4GSNA 4ML6A 1K0OA 5H5RA 2JU5A 3GX0A 1YEXA 1R7HA 1FAAA 3N5OA 1A24A 2DJ2A 1TU8A 1QGVA 1TP9A 1BAYA 3FZ5A 1S3AA 11GSA 3HYPA 4GCIA 4KDYA 4I2TA 3RBTA 3DXBA 4EDZA 3CRTA 2FWEA 1HNAA 1G0TA 4BA7A 4Z7XA 3QFBC 1QQ2A 1XW5A 2XC2A 1T00A 3QPMA 2LRTA 2HRFA 2VL2A 3GV1A 4WKWA 3RPNA 2OADA 2CVKA 2LKUA 5HR2A 3HDCA 2H30A 2MBTA 3GYKA 4LL1B 2E0QA 1X5EA 3A3TA 3H93A 1Z7RA 4GRFA 2B1LA 1X5CA 3GKMA 1FB0A 2P31A 2H73A 1E6BA 4HJ2A 1W4VA 2LRCA 3S9FA 3ZTLA 2JL4A 5IQYA 1O85A 4OFNA 2K18A 3EU4A 5D9XA 1AXDA 3TKSE 3LJRA 4GXZA 2FNOA 4FIWA 3TJFA 4EE0A 2CX3A 6GSWA 2J9HA 2XPDA 2HNLA 1HYUA 4MF7A 5DBQA 5DJMA 5CREA 3MSZA 3ZFBA 5D73A 2I81A 1Z6NA 2H76A 3M9JA 1X5DA 2DLXA 5DALB 3QDNA 3P7XA 1O73A 3K8NA 4TOPA 5CRDA 1Z3EA 3UJ1A 4MZCA 2HE3A 4ZB8A 1PMTA 4DSRA 1B9YC 3O6TA 3GTUB 3LWAA 4MJEA 1GRXA 1J9BA 4I5QA 2LS5A 2VM1A 1A8LA 3VPTA 3DVWA 5IOWA 1T1VA 2NBSA 4RQRA 2PGTA 3MWHA 2IN3A 1O6JA 2HZFA 4RQXA 4G10A 3F6DA 5ECLB 5ID2A 2HXKA 1MD4A 2GDRA 3ZL5A 2FY6A 5DCHA 3C1RA 1VRSD 4L0WA 3GH9A 2KHPA 1AUCA 1MTCA 4ZILA 2KP1A 3DMLA 1XW6A 3GMFA 5IIZA 3ZMKA 5D96A 3CMIA 5GSSA 2LUSA 4I6XA 5B7CA 5DALA 3KGKA 8GSSA 2AJQB 4HOJA 4KAEA 1JZOA 2HSYA 1T4YA 3QMXA 4AJ8A 3US3A 4BPYA 2C0DA 4ECCA 1A0RP 2L57A 3GTUA 3MDKA 3AY8A 2YWNA 5KN2A 1TJDA 5D9TA 3SBCA 3Q18A 2H0HA 1ERVA 4YQMA 1ERTA 1THXA 3C73A 1AQVA 2JZSA 2CA8A 3DKSA 2I4AA 1SYXA 4Q5FA 4RUVA 2B7KA 6GSTA 1PX7A 2LQQA 1SENA 5A4VA 2E7PA 3GSSA 4TKYA 5IM9A 3FY7A 2IMDA 2GQMA 2D2ZA 1F3BA 4ZIJA 3QD9A 2ZUPA 1T8EB 5J41A 2AYTA 4YQVA 1WIKA 1K0DA 1FVJA 4ILFA 3LQ7A 2IFQB 1K0CA 4MPGA 1MEKA 2FD3A 2XBQA 1SD8A 4IBPA 3DWVA 2DMLA 5IO2A 3HJOA 2VCQA 3IC4A 2YP6A 3D22A 3BJ5A 4FH8A 1FOVA 5ABRA 3ZVJD 2DJ1A 2ALBA 2ZNMA 5H5SA 1DBYA 3FZ4A 3ZIJA 2V6OA 4IN0A 3IBHA 2NDOA 3NOFA 4F03A 2FA8A 1XOBA 2E2MA 3G9BA 2IMIA 5IMAA 3APOA 4OFTA 4PX1A 3KMOA 3TCOA 1TK5B 3DYRA 3RAZA 4EVMA 4I8BA 4F9ZA 2OACA 5DQYA 3HHVA 4KE3A 3WYWA 4MF6A 3PR8A 2GQLA 1F2EA 3ZITA 1GTIA 4PNGA
chains in the Genus database with same CATH superfamily
2OTJ3 5IEPA 1VF3A 2LTKA 1GULA 1JZWA 1S5AA 3F9UA 4N6MA 2DIYA 1WNHA 3SXXA 1M9AA 1BRHA 4K0GA 4HOHA 3SYUA 1R4CA 3ZREA 4ZXGA 1EV4A 5CXOA 4JRRA 1BVIA 2MZCA 2FLSA 2WS2A 5CK6A 3VPQA 4NV2A 4TR0A 2YN1A 1STDA 4XDVA 2A4VA 4XHMA 5ECNB 5CP1A 1XCCA 3CU3A 2AUVA 1YEPA 2M46A 3QRDA 5I97A 3PCSA 1VQ73 1XBSA 3KEBA 2MYGA 2CWVA 2TRXA 3IV4A 3R3EA 1EEJA 5DQSA 2YX9A 1EP7A 3KXOA 1FOHA 4JZQA 1H4OA 3DVXA 4I97A 3TRQA 3CC43 1UW1A 4WHAA 4YKGA 1Q9EA 3M9KA 2KLXA 4HM1B 3QK9A 1EA2A 2F5WA 2R41A 3DMCA 2A2PA 2HMKB 4TVEA 1TTOA 2C11A 3GNJA 1GSUA 1OPYA 4KFEA 5AI1A 2CV4A 2XHFA 1DETA 5J9CA 4ZB6A 4HM7B 1LNIA 4DKIA 4BWQA 3C1SA 5EPFA 3G7JA 2HMNB 5H5QA 2GZZA 3LGCA 1BIRA 5FT3A 2A4HA 2O85A 2TRCP 4LA1A 3OXAA 1TRSA 3SOYA 1GNWA 5ECHB 2XFSA 3CXGA 3JVCA 4G0LA 4XBYA 4OUQA 3X3ZA 2ON5A 3WMDA 3KSPA 4G0IA 1TXXA 3TKSA 4G19A 5E59A 1G6YA 2CZ2A 4IQAA 2UGIA 4BTWA 3FMWA 1W89A 5HQPA 2QIYA 1F8NA 3E3EA 2VM2A 5JWRB 3PYJA 4AJ7A 5IO0A 1MGWA 5G5FA 3FRCA 5HGRA 1RGKA 2LRNA 1I70A 5HOHA 8CHOA 5KP1A 1B9XC 1UCJA 3JUNA 3S27A 4HZ4A 4PEJA 2XSHB 1OC9A 1UC7A 2GXFA 19GSA 2L59A 4JEDA 1M2BA 1RGFA 4N6OB 1ILOA 1A2PA 2JZTA 3TUEA 3IR4A 4EDYA 1EOGA 3FR3A 1VF2A 2C4JA 2E2VA 4N6LA 4GSSA 4PGTA 1M9GA 5F05A 1SD9A 3KIJA 1ACVA 1YKCA 2FGXA 1RRLA 2H72A 3FG3A 3X3XA 4XIHA 2CFGA 1EP8A 1SJZA 2PN8A 3UIWA 5IG4A 3PS8A 1OYJA 2JSZA 3U97A 1OGZA 1RKYA 3WR2A 1FGTA 2IUJA 1YQ1A 2ML5A 2E2UA 2PU9C 5DDLA 1M7TA 3VWVA 3E9JB 3H8QA 3NIVA 3M8NA 5DAKB 5ECKB 3QAGA 2OOVC 2N5BA 5AYSC 3ISOA 3MHEA 4N0ZA 4YH2A 3EU3A 2VIMA 2CG1A 1X1XA 3BB9A 2XFTA 1PFPA 3GRDA 4KGIA 1YJ6A 4STDA 3NBRA 2B5XA 2OE3A 4EIQA 1C54A 1ZGXA 5DCGA 5JCWA 1CYUA 1WMPA 1U6TA 2R4VA 4KUNA 3VLNA 2GU3A 2B24B 1B21A 3J7Yb 1QK8A 2DJ0A 3LSZA 4LYLB 4TW5A 1BG5A 3ZIVA 1BUJA 1JBTA 5TGNA 4ZB9A 4EV2A 4BL7A 2F8AA 4WBJA 2R0CA 3I6AA 4IGJA 4N30A 5GSPA 2OCTA 4LLRA 3H4KA 4GLTA 1MD3A 2W04A 1FZUA 2EIQA 2DSAA 2C0GA 3UJMA 1TU5A 1MGRA 2YFJB 3RNTA 3DGNA 1SJIA 3IHQA 5CO3A 1ZYEA 2HOHA 3N9HA 2Z9SA 1SKSB 1M1XB 4K61A 2FUG2 4WF4A 3KFQC 4LMIA 1A90A 3UNLA 2F98A 1TI3A 4X2HA 5ECOB 3UBLA 1G7EA 1MWUA 1ROAA 3QAWA 3NQYA 3WA2X 3M3MA 3A2WA 3L78A 3KE7A 1NDOB 3FZ9A 2PBJA 2DBCA 2W9QA 2HMOB 2IL3A 2CX4A 4EO3A 3FKFA 3IK9A 3P90A 2O8VB 3O3TA 4NWYA 1GY5A 2O89A 4IP1A 3D5GA 4IJIA 3ME8A 4XS4B 4KW6A 2XF3A 2OE1A 1TP6A 3FW2A 3HOHA 1WMJA 1URMA 2H0IA 4WFOA 3CMA3 3V98A 3X41A 5DAKA 3L0HA 3SWLA 1EEMA 2JADA 2I3YA 5A5KA 4EL1A 2KOKA 1F6MC 2H70A 3DRNA 3DGQA 1RJOA 3K7CA 2IIYA 4N11A 4LEHA 3TGZA 2HRAA 1SARA 3G16A 4OK0A 3CSJA 2G0FA 4LSOA 2H74A 2L4QA 2W9PA 5KOXA 4HM3B 9RNTA 1PD21 2GLRA 3MAKA 2NPBA 1RGAA 2X8HA 3LOYA 3ERWA 5JBSA 3F4SA 4HKVB 1JB4A 2C0FA 1GSFA 2CFWA 2I1UA 1K0BA 1T4ZA 1G96A 3WODG 1MDIA 4QL9A 2W0QA 3HIIA 5ID2B 1F37A 2GGTA 2IWTA 1VQ43 5HR1A 4CY6A 1X1YA 1Y4KA 1HZ1A 2IMKA 2YWIA 4BVXB 4R9LA 3EMXA 2CAIA 3HA9A 1XW9A 4O2HA 3KSED 3VWUA 4MP4A 2HLSA 3D0ZA 4NXIA 4V1Ag 2JQ5A 3TJBA 5EEOA 1NB5I 3TOTA 5CLKA 1XFLA 2PWJA 4X1UA 1W7CA 3MYDA 3VWWA 3ZYWA 3FG1A 3LXZA 4F2IA 5ECRB 3MNGA 1JJ22 1YDKA 3D79A 2YPMA 2KXGA 1X9SB 5IMFA 2BMOB 1FUSA 1KTEA 3KM6A 3DY5A 1BNRA 1DUGA 5DJLA 2X64A 4MH3A 1EZKA 1TRPA 1GOYA 3Q1CA 5HR3A 3FH1A 1A67A 4XS4A 4X4JA 1I3IA 3TKQA 4CJNA 4IIAA 5CF2A 4HVNA 2SBLA 1TK8B 3PXMA 3DM8A 2JSYA 4EV5A 2YWOA 1JRQA 1PL1A 3BBYA 4V2MA 2FCHA 4EIPA 4KA0A 5M19A 2QKEA 3TB2A 2CVDA 4K2DA 5F06A 2OKAA 4K7IA 3RHBA 4J9AA 1VF1A 1A2MA 2XGNA 5ECIB 2KUCA 1XWGA 4OWYA 6RNTA 5HR0A 3QAVA 3T8UA 3UL6A 1OC8A 4POBA 3LW9A 5ECQB 2H1DA 2WO0A 1I3FA 3B4PA 2L6DA 3F63A 1QAFA 4CW9A 2GTUA 3NHXA 3GKKA 1NB3I 4HZ2A 1LNHA 1XWAA 3IXRA 4KFFA 2V2GA 1B2MA 2CX1A 3WOEB 1UGHI 1J2BA 1B2ZA 2P5QA 2X8GA 1RGHA 7STDA 3UBKA 1SKRB 4FMCA 3ZMLA 1DYUA 4IELA 2PMTA 1TRQA 1DMQA 3E99A 1NM3A 1J08A 3EBYA 1WJKA 6GSXA 2BTOT 3BD2A 3FCSB 4BVXA 1I2GA 1FUTA 2GVPA 2OTL3 2XGLA 2YWMA 1Q4JA 4OFMA 2VL3A 1MNLA 4ZL9A 1K734 1G6WA 3TRPA 4GQCA 3AHSA 1LOXA 4NPBA 1HD2A 1LJRA 3QOUA 5IG3A 4E8HA 2H8LA 4NHWA 2RBIA 1SL1B 4CDOA 3CRUA 5IMVA 3EINA 5IMCA 1Z5YE 2O3OA 1U88A 2H0GA 3ERFA 3NBBA 3CPW2 3F9SA 3CCR3 4FYBA 1A23A 1JB2A 4R9KA 4PUFC 5FGOA 1I0XA 2H6YA 2CX0A 1TFKA 2UZ8A 5GSTA 3MG3A 2RM5A 2K6VA 2Y73A 4ID0A 3IRAA 1LBKA 3LZAA 2DMMA 1V98A 3ZZXA 3LH4A 1SQWA 1IU7A 3G7YA 4HM2B 2NTOA 4WR5A 3RDEA 3LXTA 1SK2A 3APQA 3BCKA 1PQNA 3EJVA 4NREA 2H6ZA 4IVFA 3A5WA 3DH2A 2VLUA 4L8PA 4RBNA 2CT6A 4BVYA 1Q864 1VQK3 3L9VA 3U5RE 3LTAA 1K0NA 1OF5A 4LMWA 1B8XA 5B6MA 3FLJA 4MZWA 2CH9A 4EUYA 1OVNA 1ST9A 3LYGA 1AV4A 3CC23 3I563 3IOSA 1XVQA 4ORLA 5EY6A 3UEMA 1GSDA 5ENUA 3IE3A 3EF8A 2IYJA 1OE7A 4GHOA 3F8UA 4KCEA 3UL5A 5KN0A 3TJKA 4L0UA 3W8JA 4QL7A 5B8BA 4LGQA 2B5YA 2KF6A 1BNIA 2OBKA 3FYGA 1Q42A 1WTHA 1BU4A 1I2FA 4PQHA 5C04A 1B48A 3T8NA 1K8A4 1T7PB 3GHAA 4TX4A 3CCU3 3EE2A 3LMLA 2H66A 2C3TA 1RGCA 4HQZA 1PRXA 1QJGA 1M1K4 3DGLA 2D42A 3PZWA 1XWCA 1QFNA 5JWQB 2OJLA 3FZWA 3EPTA 3HVXA 1Z6MA 3ZFLA 2B3SA 5A4WA 1V57A 2CWTA 5KN3A 4HUAA 2GZPA 1AAZA 2F8FA 5ECSA 1OHOA 5CYYA 2A15A 1RK4A 2HFDA 3BOAA 3UAPA 3UOMA 3EN1B 1QALA 1ZYPA 3CCS3 1WE0A 1RW1A 5F07A 5J4UA 1QMVA 4GF0A 1W4NA 4WETA 1I8VA 3M1GA 2GSQA 1AVLA 1U3IA 3UARA 2BJXA 4YAVA 4L7KA 5J3RA 3MWZA 1O7HB 1W6CA 1GY7A 2VO4A 1V9WA 2VCWA 1IQXA 2LNTA 1JFUA 3QCPA 3I69A 5D81A 4D73A 4MNNA 5CAXA 1DE2A 3NZNA 1BSCA 5A4UA 2WULA 1MDJA 1VZZA 4XBTA 1ML6A 3KH7A 1PN9A 4KH7A 5AIGA 3DZLA 4KVHA 2R5GA 3ZG0A 5C00A 1GY6A 1Q7HA 2IY2A 3MG1A 3URPA 2GSTA 2K3DA 3GL3A 2HT9A 1U5OA 3FZAA 1STFI 2P5RA 3M8CA 1G02A 4ACSA 1VQ53 5IMDA 2AB6A 4A5PA 1DVCA 2LJRA 3Q2PA 2J23A 4ZBDA 2RUEA 1BSEA 3LTDA 5LD0A 3WDGB 3WGEA 2E2GA 4USSA 4J56E 3HCZA 4ECBA 1SIIA 1FW7A 3NBJA 3KD0A 2C1YA 4PQIA 1E97A 2XPEA 4N6TA 3WGXA 4ISDA 3X42A 2JDIH 1SK0A 5JCGA 1IYIA 2OE0A 3SLUA 4IQ1A 1OC9B 2V1LA 1Y6EA 2PUKC 3BNBA 3S5CA 3M0FA 1A8YA 2HMJB 1XXUA 1FGQA 1GMQA 3IHGA 1RLSA 4BL3A 1LU4A 4POLA 1Y25A 4KB3A 6GSSA 2R37A 2O9UX 1RHLA 5ELGA 2M80A 4BWSA 4G9HA 1V40A 4I4KA 2KCDA 3DUKA 1B4QA 4GB5A 1FG4A 3NXJA 5CF1A 3L4NA 3BNCA 3GFKA 1M2DA 1NJI4 3PINA 4ICYA 1SJ6A 5AIVA 1Q40A 3TRXA 2LV3A 3Q3FA 3MKIA 2EIOA 1N9EA 3HIGA 2G2QA 3U1WA 1ON4A 3EMPA 4N0VA 5B6NA 2R0PA 2VUPA 3F7XA 1UCKA 1RCLA 3DGOA 5BVBA 4IHUA 1OKDA 1R26A 1C7HA 3GZBA 1A2LA 1WP0A 3RPPA 5GAND 1ZMAA 1DE3A 4H3UA 4R1KA 4R4KA 1LQMB 1NO3A 4GWRA 5FWGA 2OBIA 2LJAA 1DVDA 1RMSA 1UN2A 4I2UA 3OWSA 2P05A 1U8CB 2YANA 2YJHA 2GEYA 4RI6A 5EVOA 3GSTA 4TXVA 1OAZA 4CY8A 3CSHA 1ZL9A 1UA5A 3V92A 2RCDA 3B7CA 2CVBA 1GUMA 1PX6A 1L5GB 4O92A 2KF5A 2CZ3A 1R5PA 3SX1A 4K1FA 3G713 2F51A 2XR8B 3CXC2 5GZZB 1O7GB 5BU4A 4BL7B 2GSRA 4IP6A 1BJXA 4ZM8A 3HVVA 5M18A 1NHYA 2B1KA 3FR9A 4KT3B 4OMVA 2YJ7A 3BIRA 3NV0B 3I0YA 4JR6A 4HQSA 4QQ7A 1RTUA 2DJ3A 3FF0A 2L5OA 1YF1A 4EF0A 3PCRA 4MJBA 4HEA2 3B4OA 4ECIA 4K7NA 4FCMA 1YGEA 5AIIA 3A2VA 5JWOB 3CSIA 3EWLA 2ZA4A 3PH9A 1B4PA 2YFLB 5JPUA 4WYKB 4TR1A 13GSA 5KN1A 1M3IA 1D6YA 1IQ8A 1GMPA 3U6VA 1BRGA 2V1MA 5EL8A 4ECJA 4HJMA 3SVAA 4AKZA 3S29A 1O7NB 1XOAA 4ZL7A 1AQZA 1ZOFA 3C8EA 5ECPB 2OWPA 5LC6A 1S3RA 1TK0B 3KP9A 3TDGA 1CEWI 1OHPA 3Q19A 1BSDA 1UUWB 4MMMA 3A2XA 1PSQA 4CCVA 2HZEB 3QR6A 2J8XB 3F8XA 3CC73 5IPGA 5IPHA 1TW9A 3F14A 4N10A 3ERGA 3RHCA 1VF4A 1TRVA 2FA4A 3C71A 4ZBAA 3FGYA 4L5OA 4FMAA 2RM6A 2GQKA 2IPAA 3UB1A 4MJCA 5A0OB 5G1LA 1X9WB 2OOVA 4LL4B 2FXTA 2VCXA 6GSYA 2VAFA 1DSBA 4POMA 1GTAA 2QA43 4L5LA 3GURA 9GSSA 1KC84 2V32A 1DMMA 4JBBA 1EG9B 2MF7A 1ZS7A 1W2B2 2WZ9A 3IA1A 3IPTA 3Q74A 4HM5B 1HNBA 2ON7A 2FWHA 5BIRA 2VCZA 1RNTA 3EQQB 2ML6A 3HJMA 1LOVA 2VOCA 4OO5A 1K3YA 4HS1A 3L9SA 3QFAC 3HX8A 4JF8A 1O7PB 1B2SA 3VK9A 2WGRA 1N8R4 3LYKA 3GSPA 1OC3A 4FMBA 2W2CA 12GSA 2P0MA 1IT7A 2STDA 4WEYA 5IERA 3E0UA 3NV0A 3FR6A 8RNTA 2IMFA 2CFKA 4ZBBA 3J7Yd 1BUQA 2H75A 3O8YA 4V1Ap 3L9UA 4GQFA 1PY3A 1BANA 2GU1A 1R5AA 1OE8A 4XCSA 3WGDA 3FHKA 4J8TA 1RNBA 5DREA 4MDCA 3JCML 2HRNA 1GSYA 4FCJA 4WYKA 4G2EA 4K7OA 2HYXA 3VURA 1ERUA 1OH0A 3KZTA 4HI7A 3HI7A 5G2ZA 2K0MA 2K8SA 1JKGB 2GEXA 1NU3A 5EVHA 3CBUA 1C72A 1LOWA 5IW9A 1M9BA 1JNQA 2HZEA 1GTUA 5COHA 2CFLA 2MBSA 2F86B 2MMAA 6GSUA 3LEFA 2KAAA 4MEIA 1SKWB 5AIFA 5DVBA 5J5NA 1JLVA 2C0EA 1SL2B 3LT8A 1R4YA 18GSA 1XIYA 1Z7PA 1I0VA 5CRWA 4X2OA 3PGTA 3GAXA 3D5IA 2VL2C 2CIUA 1IV9A 4JU5A 5IENA 1BEDA 1TRWA 4KDXA 4K6XA 1FHEA 3ZRDA 5G1KA 1FGOA 3EC3A 1IT8A 3GL5A 1XZOA 1DE1A 4XS6A 3EB8A 4KSOA 1WWJA 4FYUA 2HMLB 3IDVA 4O5QA 2FGTA 5AGYA 1XG8A 2F99A 2O7KA 1FB6A 4CDLA 1SYRA 3P8WA 2GS3A 2VD0A 1JLWA 1KEBA 2YCDA 1RN4A 2DC5A 5D9VA 3BNEA 1RSNA 1OACA 6GSPA 3D6IA 4LMVA 1BAOA 4GL6A 4EW5A 2XH9A 1EOHA 14GSA 4AF2A 4KCAA 1LQGC 1XWKA 4WBRD 1GSSA 5KEJA 1EV9A 1PKWA 2M72A 3WT1A 1YGWA 2RUFA 1VQO3 1GSEA 3FF2A 2I9HA 2LSTA 4EYCA 4JE1A 1A0FA 4TRXA 3CCM3 4IKHA 2LQOA 3GIXA 1GH2A 3D5JA 1YF0A 5CRHA 3F4TA 3GKNA 4N6UA 1F3AA 1VQ93 2N5FA 3I43A 1KQS2 1ISKA 1JKGA 6GSVA 1EWXA 2H6XA 1O8WA 3GZYB 2WDUA 4HDEA 3K9MC 1GWCA 2KP2A 4Q53A 4K9ZA 1GUKA 1M99A 1N8JA 5D93A 1QXHA 1Z9HA 5D8IA 2JACA 4KX4A 1RGLA 3KMNA 1GUHA 1AIUA 1JZRA 3EX9A 3Q90A 3EYTA 1FW1A 2W56A 3OWYA 1EGRA 4K1VA 1JN5B 4RNZA 3SEDA 1MWRA 5JCUA 2QC7A 1SIHA 3Q6OA 3ZLPA 2H71A 1BNSA 3WA3A 3BCIA 1X9MB 3VI7A 1SK1A 4FO5A 4XM4A 4BVYB 4Q5NA 1O81A 3TJGA 3LTCA 2A2SA 4AEQA 4G1MB 2WOFA 4HAAA 1OF5B 1BYEA 4EXRA 1ULJB 4PQ1A 3OV4A 1VGLA 4OCFA 3KJYA 2F9SA 4DSSB 1JHBA 1NHOA 3F40A 2REMA 1QVG2 3IK7A 4WWUC 1W01A 5ELUA 1YY7A 3BU4A 5LCZA 1A2VA 1TKDB 4O8SA 3LT9A 1KBNA 1PFOA 1THOA 1EGOA 3H79A 4K1UA 2EC4A 1VQL3 3F3RA 3HVSA 4O7HA 5G31A 2FWFA 4J2FA 5G2GA 2L6CA 3EURA 4F0BA 1IVUA 4EKZA 5AN1A 2GZYA 1NWWA 1V2AA 2K8VA 4TR4A 2VLTA 1WMOA 4NAXA 2H1BA 3HVNA 4MF5A 2AV4A 3TKPA 2TIRA 2INXA 1U3AA 2UX0A 1BQ7A 3KP8A 4L8EA 4OVMA 3EBTA 1Z1SA 1ZX2A 4LZIA 2MMNA 1F9MA 3CYNA 4XTSA 1JV2B 1QUWA 4Z2UA 10GSA 1FVKA 2DIZA 2N5AA 3O76A 1TIJA 4IJ3A 1GL8A 1MOLA 1O8XA 2L4VA 4R80A 1E3RA 1JN5A 4AGSA 4ULXA 1YZXA 2WOHA 3F6FA 4O3VA 3KIIA 2H01A 2RLIA 2K54A 4HZBB 3OR5A 4EXJA 2B5EA 1FO5A 2ES7A 1ZGNA 2F3MA 4D73B 2E2TA 1ULIB 4G0KA 4MPFA 4TR3A 4KSMA 3STDA 3LG6A 1W5ZA 1DMNA 2WFCA 3K0ZA 2WB9A 1AQXA 3HD5A 1NSWA 3RGRA 4OCEA 1VQN3 5CNWA 2H19A 4AJ6A 4MABA 1S3CA 3T0UA 4DSSA 2GBWB 2H1AA 1HKXA 1PGTA 1VQM3 3A5IA 4PNFA 4EC0A 3KCMA 5GAPD 1IYYA 3GA4A 4MCUA 2WJUA 1FGRA 16GSA 4MK3A 1VQ63 5LNKe 1RGEA 1X0RA 2PPTA 3HJPA 3HZ8A 2PERA 1MWSA 22GSA 4XRDA 4P3YB 2CQ9A 2QA2A 2L4CA 1GNEA 2F56A 5F8BA 1US1A 1KD14 1W6YA 3ZFZA 4HU7A 1PYLA 5KP3A 4ML1A 2R4IA 1ROVA 5DRVA 2OQEA 4IW9A 1TDIA 2PVOC 2RIIA 1ZZYA 2FWGA 2GSSA 3HZ4A 4NHZA 3AMOB 3ER7A 2DKIA 2Z76A 3JUPA 1M2AA 5STDA 1PL2A 1TOFA 4K0NA 4TXOB 5FHIA 2YZHA 5ELAA 3CTFA 1KWIA 5M1AA 2CWUA 2R6KA 3HKRA 1T3BA 4HU9A 3GKXA 4XS1A 3I553 2F5MA 3CQFA 3N9JA 1EQKA 1PA3A 1GLPA 1EUIC 4V2NA 1W00A 5B8AA 3LORA 1K3OA 3X40A 2EIRA 1N2AA 3UL3A 3D9RA 2HSHA 4GSTA 1B3SA 4CHSA 1RQMA 2IMEA 4HZ9B 1Q40B 1TU7A 4IS0A 2XBIA 1TTZA 4K5RA 3J7Yk 4YQUA 1QAKA 4PUAA 3L0RA 2C8UA 1NW2A 1W02A 5INYA 1BSAA 1BGSA 17GSA 2ZDJA 1O7UA 4PXOA 1KNGA 1HYFA 5G5EA 4FMDA 1AC1A 1D6ZA 4J5GA 3EC9A 5CRGA 3BNDA 3CCL3 1TRUA 20GSA 2O87A 2YV7A 1ERWA 3DD3A 2B1XB 1GSQA 1CYVA 1ZYQB 4HM6B 3GN3A 1JB5A 2HMMB 2FHEA 1WOUA 3C7MA 1IK3A 1QMAA 2C3NA 1AY7A 4OD7A 1AVKA 3GX8A 1N9JA 5IOXA 2YV9A 3HY2A 4HBRA 4BIRA 3KKGA 2YZUA 2V6KA 2P0GA 4O5UA 2C80A 1GLQA 1IV7A 1IVVA 1A2JA 3WOFB 4RNYA 1B2XA 4HM0B 1GD4A 3D4TA 5E4WA 4POKA 1CQHA 1Q814 4DEJA 4Z2TA 3IAM2 1I5GA 2P38A 1D6UA 1TFOA 3MSOA 2PNCA 4ZL8A 3JUMA 5G30A 3DIEA 1T5YA 4XRAA 1UDII 2IMJA 1XWBA 3TOUA 2GT5A 2VCTA 1ZO2A 5IEOA 2MMOA 3AMOA 4L8OA 3ME7A 1TUHA 3KTBA 3IPZA 3EE1A 4TXOA 1E3VA 3D4AA 2R3XA 1WRYA 4YAPA 4MJAA 3CPOA 2LQVA 4BL2A 7GSPA 4N6NB 4MMXB 2Y74A 2F4YA 3TJJA 3GH6A 2CHCA 1T2IA 1YKAA 4MZBA 4Q5RA 1RN1A 2IFQA 2VL9A 1CQGA 3NUVA 3ZVJA 2LJKA 1PN0A 3W8SA 4DSQA 4Z2RA 2NVLA 5RNTA 2WGOA 4X43A 4TR1B 3F3QA 4QWTA 5AEWB 1M0UA 2L5LA 2I9WA 4MMZB 3HXSA 1BRSA 3MG2A 2QSIA 3FEUA 1G7OA 3G4S3 1ZCPA 4NV5A 3UMAA 3EHCA 1JBRA 2BU4A 2GT6A 4O32A 2MMZA 3D4MA 3F4RA 3LYPA 4OO4A 1VQP3 2VLVA 1E2YA 1GYBA 2W6JH 1ZYNA 3W6GA 4WF5A 1TI1A 1YI23 3FK8A 3JUQA 1UUVB 3B8LA 2VD1A 3F8HA 1GTBA 4IPBA 3VFIA 2CK3H 1HQOA 1X1WA 3H1NA 1K3LA 3DEXA 1RCKA 2B7JA 4O02B 1AQWA 4U13A 2HI7A 3VSYA 2CKFB 1BNEA 4FYCA 3GRXA 3APSA 3I9V2 2RNTA 4Q5QA 2GSPA 4HJLB 1BRNL 4KNDA 5J9BA 2WCIA 1LVNA 4X0XA 3UVTA 4GSPA 3VWXA 4DVCA 3F0IA 2X8CA 5ECMB 1MDKA 4FQUA 5IMZA 1GOUA 5IF6A 1R4WA 3TKSC 1GOVA 1K0AA 1XVWA 2K9FA 4MH2A 1UI7A 1BX9A 2YNXA 2R0GA 2B6MA 4NMUA 4WR4A 4TN8A 3KH9A 3G8ZA 4K5SA 3NM2A 1GP1A 4IT7A 4EC6A 2JZRA 5D9WA 4JR4A 2X99A 2P09A 1XPVA 1USBA 2LEGA 2DJJA 5F0GA 3CCQ3 4K2XA 2WRTA 1T2HA 4F0CA 1SU9A 1ABAA 1H75A 2DJKA 4GTUA 4MLYA 1HNCA 1PKZA 2CW9A 2UUGC 1ASKA 2ZCTA 3LTBA 2VCVA 5AIXA 1YHQ3 3IJEB 3AGNA 1UVZA 7GSSA 3F7SA 4HM4B 4MA9A 1V58A 3VI5A 3FSDA 4O5RA 2YOIA 1Q98A 5L71A 3WT2A 2QGUA 2BMXA 2OA7A 5JPPA 3NM7A 2PVQA 5HFGA 2AHEA 4E8EA 2IJYA 2C3QA 3LFLA 2AAWA 4F82A 2V41A 3RDWA 1S3DA 3AGOA 2CAQA 2QGVA 2MC8A 4H86A 4K8MA 2CG0A 1BOXA 1V74A 1J0FA 3ROBA 1WPIA 4J57E 3GUSA 3CCV3 3WHOA 3V1WA 2DKHA 3CD63 3EVIA 4HYZA 4PURA 1UUGB 3KCHA 4KFDA 4V2LA 3JUOA 1K0MA 1BNFA 1S723 5EQLA 4KDUA 2IA7A 1OKTA 3G6E3 4WXTA 2AAEA 3R2QA 1U87A 1W6GA 2R2JA 2H1GA 1IYHA 1SL0B 4YKFA 1I9DA 1JZDA 3PGBA 2WGQA 3H3HA 3TKRA 3G7IA 4HSCX 3CTGA 1IDPA 3D21A 3P2AA 3KTLA 4RNTA 5HFKA 5HFIA 3MPHA 5AISA 3KZQA 3ZG5A 1M904 2A2RA 1RN7A 1VQQA 2LNSA 3IAS2 4FR9A 1YVSA 3ED3A 2BO9B 1RRHA 1AW9A 4RI7A 5D82A 3HK4A 3UVHA 3WD6A 4GSNA 3GZXB 1CQSA 4ML6A 1K0OA 5H5RA 1OGXA 3X3YA 2JU5A 1Q824 3GX0A 2IUKA 1LRAA 1M3JA 1MWTA 1YEXA 1R7HA 3S28A 1FAAA 1IVXA 1RGGA 3DGMA 3ALAA 3N5OA 2DJ2A 1TU8A 1QGVA 3DXOA 1A24A 1TP9A 1BAYA 1OUNA 3N8BA 3FZ5A 1S3AA 11GSA 3HYPA 1KSIA 4GCIA 3N54B 1K9M4 4KDYA 4I2TA 3RBTA 3DXBA 3CCE3 3OW22 1B2UA 3SOAA 2W56B 4NHFA 4EDZA 1NNVA 3KN4A 3CRTA 3VGNA 3VF1A 5AEUB 2FWEA 1HNAA 1GD3A 4CPKA 2BIRA 2Z77A 1B27A 1G0TA 4BA7A 4Z7XA 3QFBC 1AR0A 1QQ2A 1XW5A 2XC2A 1T00A 3QPMA 2BMRB 2LRTA 1BRKA 2HRFA 2VL2A 3GV1A 4WKWA 2BT3A 2HSMA 1RDSA 2OADA 2ZHXB 3RPNA 2CVKA 2LKUA 1BRJA 3G0KA 5HR2A 1FGMA 3OWUA 3HDCA 2H30A 2MBTA 2KF3A 3MYTA 3GYKA 2ZL8A 4LL1B 2E0QA 1X5EA 3A3TA 3H93A 1Z7RA 4GRFA 2B1LA 3EN8A 1X5CA 3GKMA 1FB0A 2P31A 2H73A 1E6BA 1YVBI 4HJ2A 4H61A 1W4VA 2LRCA 3S9FA 1WQLB 7RNTA 3ZTLA 1LXEA 2JL4A 4XDWA 5IQYA 1O85A 4JRFA 3D3LA 4OFNA 3ECFA 4WP5A 2PZVA 3CNMA 1FYSA 2K18A 3EU4A 5D9XA 1AXDA 2RSXA 3TKSE 3LJRA 4GXZA 2FNOA 2HRKA 4FIWA 1N8QA 3TJFA 4EE0A 2CX3A 2BMQB 6GSWA 2J9HA 2KF4A 1K41A 4XB5A 3CNXA 2HNLA 1PU4A 4AKYA 1HYUA 2XPDA 3PPUA 3FG4A 4MF7A 4MMYB 5DBQA 2AADA 5DJMA 5CREA 3MSZA 3ZFBA 5D73A 2I81A 1Z6NA 1SPUA 2H76A 3NQZA 2DLXA 1X5DA 3M9JA 5DALB 3QDNA 2XRXB 3P7XA 5IG5A 1O73A 3K8NA 4TOPA 5CRDA 1Z3EA 1O7WB 4MZCA 3UJ1A 2HE3A 1WMNA 1VQ83 2QEX3 4ZB8A 1UCIA 1GMRA 1PMTA 4DSRA 1B9YC 3O6TA 3GTUB 3LWAA 4MJEA 1OCVA 2XEPA 1J9BA 4PTSA 1GRXA 4I5QA 1UI8A 2SARA 2LS5A 3FKAA 3NX0A 2VM1A 1O7MB 3CCJ3 2Z6BA 3LXUX 1A8LA 1UGIA 1HU9A 5AIHA 3H51A 3VPTA 1N5HA 3IMAB 3DVWA 5IOWA 1T1VA 5BMUA 2XSOB 2NBSA 4RQRA 2PGTA 3MWHA 2CC3A 3CME3 1YJN3 2BNGA 4K90B 2IN3A 5ELJA 3A76A 1O6JA 2HZFA 2CFDA 1UCLA 4RQXA 4G10A 3F6DA 5ECLB 1CH0A 5ID2A 2HXKA 1MD4A 2GDRA 3ZL5A 2FY6A 5DCHA 2QA1A 3C1RA 1VRSD 4L0WA 5D83A 3GH9A 2KHPA 3GWRA 1AUCA 1Q7Y4 1MTCA 4ZILA 2KP1A 3DMLA 1XW6A 3GMFA 5IIZA 3ZMKA 5BXQA 1YJW3 5D96A 1BNJA 2RFRA 3CMIA 5GSSA 5KOWA 2LUSA 1X1UA 3DGYA 1K28A 5FW5A 1B20A 4I6XA 5B7CA 1LOYA 5DALA 3KGKA 8GSSA 1BSBA 4J5KA 4N3VA 1JBSA 2AJQB 4HOJA 4KAEA 1JZOA 2HSYA 6STDA 1T4YA 3QMXA 4AJ8A 3US3A 4BPYA 2C0DA 3HZPA 1OHSA 1IQYA 1SJWA 2LYXA 4ECCA 1A0RP 2L57A 3GTUA 1EKMA 5BRTA 2C10A 2W03A 3MDKA 3AY8A 1YNVX 2YWNA 1W2ZA 5KN2A 1TJDA 5D9TA 3SBCA 3Q18A 1GSPA 2H0HA 2RGQA 1ERVA 4YQMA 3OX9A 1ERTA 1THXA 3C73A 3A5EA 1AQVA 1YIJ3 2JZSA 5LC7A 4N6V0 2CA8A 3DKSA 1YJ93 2I4AA 1SYXA 3IC8A 4Q5FA 4RUVA 1BNGA 2B7KA 2D1WA 1YIT3 6GSTA 1PX7A 2LQQA 1SENA 5KP4A 5A4VA 2E7PA 3GSSA 4TKYA 5IM9A 4HM8B 3FY7A 2IMDA 2GQMA 4MJDA 2D2ZA 3BLZA 1F3BA 3GZRA 4ZIJA 3QD9A 1I2EA 2ZUPA 1T8EB 2OQEC 3RGAA 2Q07A 3AHWA 2AYTA 5J41A 4YQVA 1FUWA 1WIKA 2YFIB 4RZMA 2X49A 1K0DA 2FNQA 1FVJA 4ILFA 3LQ7A 2IFQB 1K0CA 4MPGA 1MEKA 2FD3A 2C4BA 3MIXA 4BTYA 2XBQA 4BTXA 1SD8A 4XBXA 4IBPA 3DWVA 4FCZA 2X4AA 4BU4A 2DMLA 5IO2A 3HJOA 5AYRB 2Z7AA 2VCQA 3IC4A 1IVWA 2YP6A 3D22A 3BJ5A 4FH8A 1FOVA 5ABRA 3S67A 5IG0A 3ZVJD 2KRTA 2DJ1A 2ALBA 2ZNMA 5H5SA 1DBYA 3FZ4A 3ZIJA 2V6OA 4KF9A 4IN0A 4EBGA 3IBHA 2NDOA 3NOFA 4F03A 2FA8A 2GBXB 2L1SA 1XOBA 2E2MA 3G9BA 4BIKA 2IMIA 1GS3A 5IMAA 3K5TA 3APOA 4OFTA 4PX1A 2M7OA 3KMOA 3TCOA 4KZ1A 1TK5B 3DYRA 3V99A 3RAZA 1A2KA 1N5PA 4EVMA 1BRIA 3K63A 4I8BA 4F9ZA 2OACA 5DQYA 2P0XA 3HHVA 4KE3A 1FA3A 3WYWA 4MF6A 2BHMA 3PR8A 2GQLA 1F2EA 3ZITA 1QVF2 1GTIA 4PNGA
chains in the Genus database with same CATH topology
1VF3A 2LTKA 1GULA 1JZWA 3F9UA 2DIYA 1M9AA 4K0GA 3ZREA 4ZXGA 1EV4A 4JRRA 2MZCA 2FLSA 2WS2A 3VPQA 4NV2A 4TR0A 2YN1A 2A4VA 4XHMA 5ECNB 5CP1A 1XCCA 2AUVA 1YEPA 2M46A 1XBSA 3KEBA 2MYGA 2TRXA 3IV4A 3R3EA 1EEJA 5DQSA 3KXOA 1EP7A 1FOHA 4JZQA 1H4OA 3DVXA 4I97A 3TRQA 4YKGA 3M9KA 2KLXA 2A2PA 4TVEA 3GNJA 1GSUA 2CV4A 2XHFA 5J9CA 4ZB6A 4BWQA 3C1SA 5EPFA 3G7JA 5H5QA 2GZZA 3LGCA 5FT3A 2A4HA 2O85A 2TRCP 4LA1A 1TRSA 1GNWA 5ECHB 3CXGA 4G0LA 2ON5A 4G0IA 1TXXA 3TKSA 4G19A 5E59A 1G6YA 2CZ2A 4IQAA 3FMWA 1W89A 5HQPA 3E3EA 2VM2A 5JWRB 4AJ7A 5IO0A 5G5FA 3FRCA 2LRNA 1B9XC 4HZ4A 1OC9A 1UC7A 19GSA 2L59A 4JEDA 1M2BA 1ILOA 2JZTA 3TUEA 3IR4A 4EDYA 1EOGA 3FR3A 1VF2A 2C4JA 4GSSA 4PGTA 5F05A 1SD9A 3KIJA 1ACVA 1YKCA 2FGXA 2H72A 4XIHA 1EP8A 1SJZA 2PN8A 3UIWA 1OYJA 2JSZA 1YQ1A 5DDLA 2PU9C 1M7TA 3VWVA 3E9JB 3H8QA 3NIVA 3M8NA 5DAKB 5ECKB 3QAGA 2N5BA 3ISOA 4N0ZA 4YH2A 3EU3A 2VIMA 4KGIA 1YJ6A 2B5XA 2OE3A 4EIQA 5DCGA 5JCWA 1U6TA 2R4VA 4KUNA 3VLNA 3J7Yb 1QK8A 2DJ0A 3LSZA 4TW5A 1BG5A 3ZIVA 4ZB9A 4BL7A 2F8AA 4WBJA 2R0CA 3I6AA 4IGJA 4N30A 4LLRA 3H4KA 4GLTA 1MD3A 2EIQA 2DSAA 2C0GA 1SJIA 3IHQA 5CO3A 1ZYEA 2Z9SA 1SKSB 2FUG2 4WF4A 1TI3A 5ECOB 3UBLA 1G7EA 3QAWA 3M3MA 3A2WA 3L78A 3FZ9A 2PBJA 2DBCA 2IL3A 2CX4A 4EO3A 3FKFA 3IK9A 3P90A 2O8VB 3O3TA 4NWYA 2O89A 4IP1A 4IJIA 3ME8A 4XS4B 4KW6A 2OE1A 3FW2A 1WMJA 1URMA 2H0IA 5DAKA 3L0HA 3SWLA 1EEMA 2JADA 2I3YA 5A5KA 4EL1A 2KOKA 1F6MC 2H70A 3DRNA 3DGQA 2IIYA 4N11A 3TGZA 2HRAA 3CSJA 2G0FA 2H74A 2L4QA 5KOXA 1PD21 2GLRA 3MAKA 2NPBA 2X8HA 3ERWA 3F4SA 2C0FA 1GSFA 2I1UA 1K0BA 1T4ZA 4QL9A 1MDIA 5ID2B 1F37A 2GGTA 2IWTA 5HR1A 4CY6A 2IMKA 2YWIA 4BVXB 3EMXA 2CAIA 3HA9A 1XW9A 3VWUA 4MP4A 2HLSA 3D0ZA 4NXIA 4V1Ag 3TJBA 3TOTA 2PWJA 1XFLA 4X1UA 3MYDA 3VWWA 3ZYWA 3LXZA 4F2IA 5ECRB 3MNGA 1YDKA 2YPMA 1X9SB 5IMFA 1KTEA 3KM6A 1DUGA 5DJLA 2X64A 4MH3A 1EZKA 5HR3A 4XS4A 4X4JA 3TKQA 1TK8B 2JSYA 2YWOA 1PL1A 3BBYA 4V2MA 2FCHA 4EIPA 4KA0A 2QKEA 3TB2A 2CVDA 4K2DA 5F06A 2OKAA 4K7IA 3RHBA 1VF1A 1A2MA 5ECIB 2KUCA 1XWGA 4OWYA 5HR0A 3QAVA 1OC8A 4POBA 3LW9A 5ECQB 2H1DA 2L6DA 3F63A 4CW9A 2GTUA 3GKKA 4HZ2A 1XWAA 3IXRA 2V2GA 2P5QA 2X8GA 3UBKA 1SKRB 3ZMLA 4IELA 2PMTA 1NM3A 1J08A 1WJKA 6GSXA 2BTOT 3BD2A 4BVXA 2GVPA 2YWMA 1Q4JA 4OFMA 2VL3A 4ZL9A 1G6WA 3TRPA 4GQCA 4NPBA 1HD2A 1LJRA 3QOUA 4E8HA 2H8LA 4NHWA 1SL1B 4CDOA 3CRUA 5IMVA 3EINA 5IMCA 1Z5YE 1U88A 2H0GA 3ERFA 4FYBA 1A23A 4PUFC 2H6YA 2UZ8A 5GSTA 2RM5A 2K6VA 4ID0A 3IRAA 1LBKA 2DMMA 1V98A 3ZZXA 3G7YA 2NTOA 4WR5A 3LXTA 1SK2A 3APQA 3BCKA 1PQNA 4IVFA 2H6ZA 3A5WA 2VLUA 2CT6A 4BVYA 3L9VA 3U5RE 1K0NA 4LMWA 1B8XA 5B6MA 4MZWA 4EUYA 1OVNA 1ST9A 3IOSA 1XVQA 5EY6A 3UEMA 1GSDA 5ENUA 3IE3A 2IYJA 1OE7A 3F8UA 4KCEA 5KN0A 3TJKA 4L0UA 3W8JA 4QL7A 5B8BA 2B5YA 2OBKA 3FYGA 4PQHA 5C04A 1B48A 1T7PB 3GHAA 3EE2A 2H66A 2C3TA 4HQZA 1PRXA 1XWCA 1QFNA 5JWQB 2OJLA 3EPTA 3HVXA 1Z6MA 3ZFLA 2B3SA 5A4WA 1V57A 5KN3A 4HUAA 2GZPA 1AAZA 2F8FA 5ECSA 5CYYA 1RK4A 2HFDA 3BOAA 3UAPA 3UOMA 1ZYPA 1WE0A 1RW1A 5F07A 5J4UA 1QMVA 4GF0A 4WETA 3M1GA 2GSQA 1U3IA 3UARA 2BJXA 4YAVA 5J3RA 2VO4A 1V9WA 2VCWA 2LNTA 1JFUA 3QCPA 3I69A 4D73A 4MNNA 5CAXA 1DE2A 3NZNA 5A4UA 2WULA 1MDJA 1ML6A 3KH7A 1PN9A 4KH7A 2R5GA 5C00A 2IY2A 2GSTA 3GL3A 2HT9A 3FZAA 2P5RA 4ACSA 5IMDA 2AB6A 4A5PA 2LJRA 2J23A 4ZBDA 2RUEA 5LD0A 3WGEA 2E2GA 4USSA 4J56E 3HCZA 4ECBA 3KD0A 2C1YA 4PQIA 2XPEA 3WGXA 4ISDA 1SK0A 5JCGA 1IYIA 2OE0A 4IQ1A 1OC9B 1Y6EA 2PUKC 3M0FA 1A8YA 1XXUA 3IHGA 1LU4A 4POLA 1Y25A 4KB3A 6GSSA 2R37A 5ELGA 2M80A 4BWSA 4G9HA 1V40A 1B4QA 1FG4A 3L4NA 3GFKA 3PINA 1M2DA 4ICYA 1SJ6A 5AIVA 3TRXA 2LV3A 2EIOA 2G2QA 1ON4A 3EMPA 4N0VA 5B6NA 2R0PA 2VUPA 4IHUA 1OKDA 1R26A 1A2LA 1WP0A 3RPPA 5GAND 1ZMAA 4GWRA 5FWGA 2OBIA 2LJAA 1UN2A 4I2UA 2YANA 2YJHA 4RI6A 5EVOA 3GSTA 4TXVA 1OAZA 4CY8A 3CSHA 1ZL9A 1UA5A 2CVBA 1GUMA 1PX6A 4O92A 2CZ3A 1R5PA 4K1FA 2F51A 5GZZB 4BL7B 2GSRA 4IP6A 1BJXA 3HVVA 1NHYA 2B1KA 3FR9A 4OMVA 2YJ7A 4JR6A 4HQSA 4QQ7A 2DJ3A 2L5OA 1YF1A 4EF0A 4MJBA 4HEA2 4ECIA 4K7NA 3A2VA 5JWOB 3CSIA 3EWLA 3PH9A 1B4PA 4TR1A 13GSA 5KN1A 3U6VA 2V1MA 5EL8A 4ECJA 4HJMA 1XOAA 4ZL7A 1ZOFA 3C8EA 5ECPB 1TK0B 3KP9A 3TDGA 3Q19A 4MMMA 3A2XA 1PSQA 2HZEB 3QR6A 5IPGA 5IPHA 1TW9A 4N10A 3ERGA 3RHCA 1VF4A 1TRVA 2FA4A 3C71A 4ZBAA 4L5OA 2RM6A 2GQKA 2IPAA 4MJCA 5G1LA 1X9WB 4LL4B 6GSYA 2VCXA 2VAFA 1DSBA 4POMA 1GTAA 4L5LA 3GURA 9GSSA 2V32A 4JBBA 2WZ9A 3IA1A 3Q74A 1HNBA 2ON7A 2FWHA 2VCZA 3HJMA 2VOCA 4OO5A 1K3YA 4HS1A 3L9SA 3QFAC 3VK9A 2WGRA 3LYKA 1OC3A 12GSA 4WEYA 3E0UA 3FR6A 2IMFA 4ZBBA 2H75A 4V1Ap 3L9UA 4GQFA 1R5AA 1OE8A 4XCSA 3WGDA 3FHKA 4MDCA 3JCML 2HRNA 1GSYA 4G2EA 4K7OA 2HYXA 3VURA 1ERUA 4HI7A 5G2ZA 2K8SA 3CBUA 1C72A 1M9BA 2HZEA 1GTUA 5COHA 2MBSA 2MMAA 6GSUA 3LEFA 1SKWB 5DVBA 5J5NA 1JLVA 2C0EA 1SL2B 18GSA 1XIYA 1Z7PA 5CRWA 3PGTA 2VL2C 4JU5A 1BEDA 1TRWA 4KDXA 4K6XA 1FHEA 3ZRDA 5G1KA 3EC3A 3GL5A 1XZOA 1DE1A 4XS6A 4KSOA 1WWJA 4FYUA 3IDVA 4O5QA 5AGYA 2O7KA 1FB6A 1SYRA 3P8WA 2GS3A 2VD0A 1JLWA 1KEBA 2YCDA 2DC5A 5D9VA 3D6IA 4LMVA 1EOHA 14GSA 4AF2A 4KCAA 1XWKA 4WBRD 1GSSA 5KEJA 1EV9A 1PKWA 2M72A 3WT1A 2RUFA 1GSEA 2I9HA 2LSTA 4JE1A 1A0FA 4TRXA 4IKHA 2LQOA 3GIXA 1GH2A 3D5JA 1YF0A 5CRHA 3F4TA 3GKNA 1F3AA 2N5FA 3I43A 6GSVA 1EWXA 2H6XA 1O8WA 2WDUA 4HDEA 1GWCA 2KP2A 4K9ZA 1GUKA 1M99A 1N8JA 5D93A 1QXHA 1Z9HA 5D8IA 2JACA 4KX4A 3KMNA 1GUHA 1AIUA 1JZRA 3EYTA 1FW1A 1EGRA 5JCUA 2QC7A 3Q6OA 3ZLPA 2H71A 3BCIA 1X9MB 3VI7A 1SK1A 4FO5A 4BVYB 4Q5NA 1O81A 3TJGA 2A2SA 1BYEA 4PQ1A 1VGLA 4OCFA 3KJYA 2F9SA 4DSSB 1JHBA 1NHOA 2REMA 3IK7A 1YY7A 5LCZA 1TKDB 1KBNA 1THOA 1EGOA 3H79A 2EC4A 3F3RA 4O7HA 3HVSA 5G31A 2FWFA 4J2FA 2L6CA 3EURA 4F0BA 4EKZA 5AN1A 2GZYA 1V2AA 2K8VA 4TR4A 2VLTA 4NAXA 2H1BA 4MF5A 2AV4A 3TKPA 2TIRA 1U3AA 1BQ7A 3KP8A 4L8EA 2MMNA 1F9MA 3CYNA 4XTSA 10GSA 1QUWA 4Z2UA 1FVKA 2DIZA 2N5AA 3O76A 4IJ3A 1GL8A 1O8XA 4AGSA 4ULXA 1YZXA 3F6FA 2H01A 2RLIA 3OR5A 4EXJA 2B5EA 1FO5A 2ES7A 1ZGNA 2F3MA 4D73B 4G0KA 4MPFA 4TR3A 4KSMA 3LG6A 2WFCA 2WB9A 1AQXA 3HD5A 1NSWA 4OCEA 5CNWA 2H19A 4AJ6A 4MABA 1S3CA 4DSSA 2H1AA 4EC0A 1PGTA 3A5IA 5GAPD 4PNFA 3KCMA 3GA4A 4MCUA 2WJUA 16GSA 4MK3A 5LNKe 1X0RA 2PPTA 3HJPA 3HZ8A 2PERA 22GSA 4XRDA 4P3YB 2CQ9A 2QA2A 2L4CA 1GNEA 5F8BA 4HU7A 4ML1A 4IW9A 1TDIA 2PVOC 2RIIA 1ZZYA 2FWGA 4NHZA 2GSSA 3HZ4A 2DKIA 1M2AA 1PL2A 1TOFA 4K0NA 4TXOB 5FHIA 2YZHA 5ELAA 3CTFA 2R6KA 3HKRA 1T3BA 4HU9A 3GKXA 4XS1A 3N9JA 1PA3A 4V2NA 1GLPA 5B8AA 3LORA 1K3OA 2EIRA 1N2AA 3UL3A 2HSHA 4GSTA 4CHSA 1RQMA 2IMEA 1TU7A 4IS0A 2XBIA 1TTZA 4K5RA 3J7Yk 4YQUA 4PUAA 2C8UA 1NW2A 5INYA 17GSA 1O7UA 4PXOA 1KNGA 5G5EA 1AC1A 5CRGA 1TRUA 20GSA 2O87A 2YV7A 1ERWA 3DD3A 1GSQA 1ZYQB 3GN3A 2FHEA 1WOUA 3C7MA 4OD7A 2C3NA 5IOXA 3GX8A 2YV9A 3HY2A 2YZUA 2V6KA 2P0GA 4O5UA 2C80A 1GLQA 1A2JA 3D4TA 5E4WA 4POKA 1CQHA 4DEJA 4Z2TA 3IAM2 1I5GA 4ZL8A 5G30A 3DIEA 4XRAA 1XWBA 3TOUA 2GT5A 2VCTA 2MMOA 3ME7A 3KTBA 3IPZA 4TXOA 2R3XA 1WRYA 4YAPA 4MJAA 3TJJA 3GH6A 1YKAA 4MZBA 4Q5RA 2IFQA 2VL9A 1CQGA 3ZVJA 2LJKA 1PN0A 3W8SA 4DSQA 4Z2RA 2NVLA 4X43A 4TR1B 3F3QA 1M0UA 2L5LA 3HXSA 2QSIA 3FEUA 1G7OA 1ZCPA 4NV5A 3UMAA 4O32A 2GT6A 2MMZA 3D4MA 3F4RA 3LYPA 4OO4A 2VLVA 1E2YA 1ZYNA 3W6GA 4WF5A 1TI1A 3FK8A 2VD1A 1GTBA 3VFIA 1HQOA 3H1NA 1K3LA 3DEXA 2B7JA 1AQWA 2HI7A 4FYCA 3GRXA 3APSA 3I9V2 4Q5QA 4KNDA 5J9BA 2WCIA 4X0XA 3UVTA 3VWXA 4DVCA 3F0IA 2X8CA 5ECMB 1MDKA 4FQUA 5IMZA 1R4WA 3TKSC 1K0AA 1XVWA 2K9FA 4MH2A 1BX9A 2YNXA 2R0GA 2B6MA 4NMUA 4WR4A 4TN8A 3KH9A 4K5SA 1GP1A 2JZRA 5D9WA 4JR4A 2X99A 1XPVA 1USBA 2LEGA 2DJJA 5F0GA 4K2XA 2WRTA 4F0CA 1SU9A 1ABAA 1H75A 2DJKA 4GTUA 4MLYA 1HNCA 1PKZA 2ZCTA 2VCVA 5AIXA 7GSSA 1UVZA 4MA9A 1V58A 3VI5A 4O5RA 2YOIA 1Q98A 5L71A 3WT2A 2BMXA 2OA7A 2PVQA 5HFGA 2AHEA 4E8EA 2IJYA 2C3QA 3LFLA 2AAWA 4F82A 2V41A 3RDWA 1S3DA 2CAQA 2QGVA 4H86A 4K8MA 1J0FA 1WPIA 4J57E 3GUSA 3V1WA 2DKHA 3EVIA 4PURA 4V2LA 1K0MA 4KDUA 1OKTA 4WXTA 3R2QA 1U87A 2R2JA 2H1GA 1IYHA 1SL0B 4YKFA 1I9DA 1JZDA 3TKRA 3G7IA 3CTGA 3D21A 3P2AA 3KTLA 5HFKA 5HFIA 5AISA 3KZQA 2A2RA 2LNSA 3IAS2 4RI7A 3ED3A 3UVHA 1AW9A 3WD6A 4GSNA 4ML6A 1K0OA 5H5RA 2JU5A 3GX0A 1YEXA 1R7HA 1FAAA 3N5OA 1A24A 2DJ2A 1TU8A 1QGVA 1TP9A 1BAYA 3FZ5A 1S3AA 11GSA 3HYPA 4GCIA 4KDYA 4I2TA 3RBTA 3DXBA 4EDZA 3CRTA 2FWEA 1HNAA 1G0TA 4BA7A 4Z7XA 3QFBC 1QQ2A 1XW5A 2XC2A 1T00A 3QPMA 2LRTA 2HRFA 2VL2A 3GV1A 4WKWA 2HSMA 3RPNA 2OADA 2CVKA 2LKUA 5HR2A 3HDCA 2H30A 2MBTA 3GYKA 4LL1B 2E0QA 1X5EA 3A3TA 3H93A 1Z7RA 4GRFA 2B1LA 1X5CA 3GKMA 1FB0A 2P31A 2H73A 1E6BA 4HJ2A 1W4VA 2LRCA 3S9FA 3ZTLA 2JL4A 5IQYA 1O85A 4OFNA 2K18A 3EU4A 5D9XA 1AXDA 3TKSE 3LJRA 4GXZA 2FNOA 2HRKA 4FIWA 3TJFA 4EE0A 2CX3A 6GSWA 2J9HA 2XPDA 2HNLA 1HYUA 3PPUA 4MF7A 5DBQA 5DJMA 5CREA 3MSZA 3ZFBA 5D73A 2I81A 1Z6NA 2H76A 3M9JA 1X5DA 2DLXA 5DALB 3QDNA 3P7XA 1O73A 3K8NA 4TOPA 5CRDA 1Z3EA 3UJ1A 4MZCA 2HE3A 4ZB8A 1PMTA 4DSRA 1B9YC 3O6TA 3GTUB 3LWAA 4MJEA 1GRXA 1J9BA 4PTSA 4I5QA 2LS5A 2VM1A 1A8LA 3VPTA 3DVWA 5IOWA 1T1VA 5BMUA 2NBSA 4RQRA 2PGTA 3MWHA 2IN3A 1O6JA 2HZFA 4RQXA 4G10A 3F6DA 5ECLB 5ID2A 2HXKA 1MD4A 2GDRA 3ZL5A 2FY6A 5DCHA 2QA1A 3C1RA 1VRSD 4L0WA 3GH9A 2KHPA 1AUCA 1MTCA 4ZILA 2KP1A 3DMLA 1XW6A 3GMFA 5IIZA 3ZMKA 5D96A 3CMIA 5GSSA 5KOWA 2LUSA 4I6XA 5B7CA 5DALA 3KGKA 8GSSA 2AJQB 4HOJA 4KAEA 1JZOA 2HSYA 1T4YA 3QMXA 4AJ8A 3US3A 4BPYA 2C0DA 4ECCA 1A0RP 2L57A 3GTUA 5BRTA 3MDKA 3AY8A 2YWNA 5KN2A 1TJDA 5D9TA 3SBCA 3Q18A 2H0HA 1ERVA 4YQMA 1ERTA 1THXA 3C73A 1AQVA 2JZSA 2CA8A 3DKSA 2I4AA 1SYXA 3IC8A 4Q5FA 4RUVA 2B7KA 6GSTA 1PX7A 2LQQA 1SENA 5A4VA 2E7PA 3GSSA 4TKYA 5IM9A 3FY7A 2IMDA 2GQMA 2D2ZA 1F3BA 4ZIJA 3QD9A 2ZUPA 1T8EB 5J41A 2AYTA 4YQVA 1WIKA 2X49A 1K0DA 1FVJA 4ILFA 3LQ7A 2IFQB 1K0CA 4MPGA 1MEKA 2FD3A 3MIXA 2XBQA 1SD8A 4IBPA 3DWVA 2X4AA 2DMLA 5IO2A 3HJOA 2VCQA 3IC4A 2YP6A 3D22A 3BJ5A 4FH8A 1FOVA 5ABRA 3ZVJD 2DJ1A 2ALBA 2ZNMA 5H5SA 1DBYA 3FZ4A 3ZIJA 2V6OA 4KF9A 4IN0A 3IBHA 2NDOA 3NOFA 4F03A 2FA8A 1XOBA 2E2MA 3G9BA 2IMIA 5IMAA 3APOA 4OFTA 4PX1A 3KMOA 3TCOA 1TK5B 3DYRA 3RAZA 4EVMA 4I8BA 4F9ZA 2OACA 5DQYA 3HHVA 4KE3A 3WYWA 4MF6A 3PR8A 2GQLA 1F2EA 3ZITA 1GTIA 4PNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF3 A;  2LTK A;  1GUL A;  1JZW A;  3F9U A;  2DIY A;  1M9A A;  4K0G A;  3ZRE A;  4ZXG A;  1EV4 A;  4JRR A;  2MZC A;  2FLS A;  2WS2 A;  3VPQ A;  4NV2 A;  4TR0 A;  2YN1 A;  2A4V A;  4XHM A;  5ECN B;  5CP1 A;  1XCC A;  2AUV A;  1YEP A;  2M46 A;  1XBS A;  3KEB A;  2MYG A;  2TRX A;  3IV4 A;  1EEJ A;  5DQS A;  3KXO A;  1EP7 A;  4JZQ A;  1H4O A;  3DVX A;  4I97 A;  3TRQ A;  3M9K A;  2KLX A;  4TVE A;  3GNJ A;  1GSU A;  2CV4 A;  2XHF A;  5J9C A;  4ZB6 A;  4BWQ A;  3C1S A;  5EPF A;  3G7J A;  5H5Q A;  2GZZ A;  3LGC A;  5FT3 A;  2O85 A;  2TRC P;  4LA1 A;  1TRS A;  1GNW A;  5ECH B;  3CXG A;  2ON5 A;  1TXX A;  3TKS A;  4G19 A;  5E59 A;  1G6Y A;  2CZ2 A;  4IQA A;  1W89 A;  5HQP A;  3E3E A;  2VM2 A;  5JWR B;  4AJ7 A;  5IO0 A;  5G5F A;  3FRC A;  2LRN A;  1B9X C;  4HZ4 A;  1OC9 A;  1UC7 A;  19GS A;  2L59 A;  4JED A;  1M2B A;  1ILO A;  2JZT A;  3TUE A;  3IR4 A;  4EDY A;  1EOG A;  3FR3 A;  1VF2 A;  2C4J A;  4GSS A;  4PGT A;  5F05 A;  1SD9 A;  3KIJ A;  1ACV A;  1YKC A;  2FGX A;  2H72 A;  4XIH A;  1EP8 A;  1SJZ A;  2PN8 A;  3UIW A;  1OYJ A;  2JSZ A;  1YQ1 A;  5DDL A;  2PU9 C;  1M7T A;  3VWV A;  3E9J B;  3H8Q A;  3NIV A;  3M8N A;  5DAK B;  5ECK B;  3QAG A;  2N5B A;  3ISO A;  4N0Z A;  4YH2 A;  3EU3 A;  2VIM A;  4KGI A;  1YJ6 A;  2B5X A;  2OE3 A;  5DCG A;  5JCW A;  1U6T A;  2R4V A;  4KUN A;  3VLN A;  3J7Y b;  1QK8 A;  2DJ0 A;  3LSZ A;  4TW5 A;  1BG5 A;  3ZIV A;  4ZB9 A;  4BL7 A;  2F8A A;  4WBJ A;  3I6A A;  4IGJ A;  4N30 A;  4LLR A;  3H4K A;  4GLT A;  1MD3 A;  2EIQ A;  2DSA A;  2C0G A;  1SJI A;  3IHQ A;  5CO3 A;  1ZYE A;  2Z9S A;  1SKS B;  2FUG 2;  4WF4 A;  1TI3 A;  5ECO B;  3UBL A;  1G7E A;  3QAW A;  3M3M A;  3A2W A;  3L78 A;  3FZ9 A;  2PBJ A;  2DBC A;  2IL3 A;  2CX4 A;  4EO3 A;  3FKF A;  3IK9 A;  3P90 A;  2O8V B;  3O3T A;  4NWY A;  2O89 A;  4IP1 A;  4IJI A;  3ME8 A;  4XS4 B;  4KW6 A;  2OE1 A;  3FW2 A;  1WMJ A;  1URM A;  2H0I A;  5DAK A;  3L0H A;  3SWL A;  1EEM A;  2JAD A;  2I3Y A;  5A5K A;  4EL1 A;  2KOK A;  1F6M C;  2H70 A;  3DRN A;  3DGQ A;  2IIY A;  4N11 A;  3TGZ A;  3CSJ A;  2G0F A;  2H74 A;  2L4Q A;  1PD2 1;  2GLR A;  3MAK A;  2NPB A;  2X8H A;  3ERW A;  3F4S A;  2C0F A;  1GSF A;  2I1U A;  1K0B A;  1T4Z A;  4QL9 A;  1MDI A;  5ID2 B;  1F37 A;  2GGT A;  2IWT A;  5HR1 A;  2IMK A;  2YWI A;  3EMX A;  2CAI A;  3HA9 A;  1XW9 A;  3VWU A;  4MP4 A;  2HLS A;  3D0Z A;  4NXI A;  4V1A g;  3TJB A;  3TOT A;  2PWJ A;  1XFL A;  4X1U A;  3VWW A;  3ZYW A;  3LXZ A;  4F2I A;  5ECR B;  3MNG A;  1YDK A;  2YPM A;  1X9S B;  5IMF A;  1KTE A;  3KM6 A;  1DUG A;  5DJL A;  2X64 A;  4MH3 A;  1EZK A;  5HR3 A;  4XS4 A;  3TKQ A;  1TK8 B;  2JSY A;  2YWO A;  1PL1 A;  3BBY A;  4V2M A;  2FCH A;  4KA0 A;  2QKE A;  3TB2 A;  2CVD A;  4K2D A;  5F06 A;  2OKA A;  4K7I A;  3RHB A;  1VF1 A;  1A2M A;  5ECI B;  2KUC A;  1XWG A;  4OWY A;  5HR0 A;  3QAV A;  1OC8 A;  4POB A;  5ECQ B;  2H1D A;  2L6D A;  3F63 A;  4CW9 A;  2GTU A;  3GKK A;  4HZ2 A;  1XWA A;  3IXR A;  2V2G A;  2P5Q A;  2X8G A;  3UBK A;  1SKR B;  3ZML A;  4IEL A;  2PMT A;  1NM3 A;  1J08 A;  1WJK A;  6GSX A;  2BTO T;  3BD2 A;  4BVX A;  2GVP A;  2YWM A;  1Q4J A;  4OFM A;  2VL3 A;  4ZL9 A;  1G6W A;  3TRP A;  4GQC A;  4NPB A;  1HD2 A;  1LJR A;  3QOU A;  4E8H A;  2H8L A;  4NHW A;  1SL1 B;  4CDO A;  3CRU A;  5IMV A;  3EIN A;  5IMC A;  1Z5Y E;  1U88 A;  2H0G A;  3ERF A;  4FYB A;  1A23 A;  4PUF C;  2H6Y A;  5GST A;  2RM5 A;  2K6V A;  4ID0 A;  3IRA A;  1LBK A;  2DMM A;  1V98 A;  3ZZX A;  3G7Y A;  2NTO A;  4WR5 A;  3LXT A;  1SK2 A;  3APQ A;  3BCK A;  1PQN A;  4IVF A;  2H6Z A;  3A5W A;  2VLU A;  2CT6 A;  4BVY A;  3L9V A;  3U5R E;  1K0N A;  4LMW A;  1B8X A;  5B6M A;  4MZW A;  4EUY A;  1OVN A;  1ST9 A;  3IOS A;  1XVQ A;  5EY6 A;  3UEM A;  1GSD A;  5ENU A;  3IE3 A;  2IYJ A;  1OE7 A;  3F8U A;  4KCE A;  5KN0 A;  3TJK A;  4L0U A;  3W8J A;  4QL7 A;  5B8B A;  2B5Y A;  2OBK A;  3FYG A;  4PQH A;  5C04 A;  1B48 A;  1T7P B;  3GHA A;  3EE2 A;  2H66 A;  2C3T A;  4HQZ A;  1PRX A;  1XWC A;  1QFN A;  5JWQ B;  2OJL A;  3HVX A;  1Z6M A;  3ZFL A;  2B3S A;  5A4W A;  1V57 A;  5KN3 A;  4HUA A;  2GZP A;  1AAZ A;  2F8F A;  5ECS A;  5CYY A;  1RK4 A;  2HFD A;  3BOA A;  3UAP A;  3UOM A;  1WE0 A;  1RW1 A;  5F07 A;  5J4U A;  1QMV A;  4GF0 A;  4WET A;  3M1G A;  2GSQ A;  1U3I A;  3UAR A;  2BJX A;  4YAV A;  5J3R A;  2VO4 A;  1V9W A;  2VCW A;  2LNT A;  1JFU A;  3QCP A;  3I69 A;  4D73 A;  5CAX A;  1DE2 A;  3NZN A;  5A4U A;  2WUL A;  1MDJ A;  1ML6 A;  3KH7 A;  1PN9 A;  4KH7 A;  2R5G A;  5C00 A;  2IY2 A;  2GST A;  3GL3 A;  2HT9 A;  3FZA A;  2P5R A;  4ACS A;  5IMD A;  2AB6 A;  2LJR A;  2J23 A;  4ZBD A;  2RUE A;  5LD0 A;  3WGE A;  2E2G A;  4J56 E;  3HCZ A;  4ECB A;  3KD0 A;  2C1Y A;  4PQI A;  2XPE A;  3WGX A;  4ISD A;  1SK0 A;  5JCG A;  1IYI A;  2OE0 A;  4IQ1 A;  1OC9 B;  1Y6E A;  2PUK C;  3M0F A;  1A8Y A;  1XXU A;  1LU4 A;  4POL A;  1Y25 A;  4KB3 A;  6GSS A;  2R37 A;  5ELG A;  2M80 A;  4BWS A;  4G9H A;  1V40 A;  1B4Q A;  1FG4 A;  3L4N A;  3GFK A;  3PIN A;  1M2D A;  1SJ6 A;  5AIV A;  3TRX A;  2LV3 A;  2EIO A;  2G2Q A;  1ON4 A;  3EMP A;  4N0V A;  5B6N A;  2VUP A;  4IHU A;  1OKD A;  1R26 A;  1A2L A;  1WP0 A;  3RPP A;  5GAN D;  1ZMA A;  4GWR A;  5FWG A;  2OBI A;  2LJA A;  1UN2 A;  4I2U A;  2YAN A;  2YJH A;  4RI6 A;  5EVO A;  3GST A;  4TXV A;  1OAZ A;  3CSH A;  1ZL9 A;  1UA5 A;  2CVB A;  1GUM A;  1PX6 A;  4O92 A;  2CZ3 A;  1R5P A;  4K1F A;  2F51 A;  5GZZ B;  2GSR A;  4IP6 A;  1BJX A;  3HVV A;  1NHY A;  2B1K A;  3FR9 A;  4OMV A;  2YJ7 A;  4JR6 A;  4HQS A;  4QQ7 A;  2DJ3 A;  2L5O A;  1YF1 A;  4EF0 A;  4MJB A;  4HEA 2;  4ECI A;  4K7N A;  3A2V A;  5JWO B;  3CSI A;  3EWL A;  3PH9 A;  1B4P A;  4TR1 A;  13GS A;  5KN1 A;  3U6V A;  2V1M A;  5EL8 A;  4ECJ A;  4HJM A;  1XOA A;  4ZL7 A;  1ZOF A;  3C8E A;  5ECP B;  1TK0 B;  3KP9 A;  3TDG A;  3Q19 A;  4MMM A;  3A2X A;  1PSQ A;  2HZE B;  3QR6 A;  5IPG A;  5IPH A;  1TW9 A;  4N10 A;  3ERG A;  3RHC A;  1VF4 A;  1TRV A;  2FA4 A;  3C71 A;  4ZBA A;  4L5O A;  2RM6 A;  2GQK A;  2IPA A;  4MJC A;  5G1L A;  1X9W B;  4LL4 B;  6GSY A;  2VCX A;  2VAF A;  1DSB A;  4POM A;  1GTA A;  4L5L A;  3GUR A;  9GSS A;  2V32 A;  4JBB A;  2WZ9 A;  3IA1 A;  3Q74 A;  1HNB A;  2ON7 A;  2FWH A;  2VCZ A;  3HJM A;  2VOC A;  4OO5 A;  1K3Y A;  4HS1 A;  3L9S A;  3QFA C;  3VK9 A;  2WGR A;  3LYK A;  1OC3 A;  12GS A;  4WEY A;  3E0U A;  3FR6 A;  2IMF A;  4ZBB A;  2H75 A;  4V1A p;  3L9U A;  4GQF A;  1R5A A;  1OE8 A;  4XCS A;  3WGD A;  3FHK A;  4MDC A;  3JCM L;  2HRN A;  1GSY A;  4G2E A;  4K7O A;  2HYX A;  3VUR A;  1ERU A;  4HI7 A;  5G2Z A;  2K8S A;  3CBU A;  1C72 A;  1M9B A;  2HZE A;  1GTU A;  5COH A;  2MBS A;  2MMA A;  6GSU A;  3LEF A;  1SKW B;  5DVB A;  5J5N A;  1JLV A;  2C0E A;  1SL2 B;  18GS A;  1XIY A;  1Z7P A;  5CRW A;  3PGT A;  2VL2 C;  4JU5 A;  1BED A;  1TRW A;  4KDX A;  4K6X A;  1FHE A;  3ZRD A;  5G1K A;  3EC3 A;  3GL5 A;  1XZO A;  1DE1 A;  4XS6 A;  4KSO A;  1WWJ A;  4FYU A;  3IDV A;  5AGY A;  2O7K A;  1FB6 A;  1SYR A;  3P8W A;  2GS3 A;  2VD0 A;  1JLW A;  1KEB A;  2YCD A;  2DC5 A;  5D9V A;  3D6I A;  4LMV A;  1EOH A;  14GS A;  4AF2 A;  4KCA A;  1XWK A;  4WBR D;  1GSS A;  5KEJ A;  1EV9 A;  1PKW A;  2M72 A;  3WT1 A;  2RUF A;  1GSE A;  2I9H A;  2LST A;  4JE1 A;  1A0F A;  4TRX A;  4IKH A;  2LQO A;  3GIX A;  1GH2 A;  3D5J A;  1YF0 A;  5CRH A;  3F4T A;  3GKN A;  1F3A A;  2N5F A;  3I43 A;  6GSV A;  1EWX A;  2H6X A;  1O8W A;  2WDU A;  4HDE A;  1GWC A;  2KP2 A;  4K9Z A;  1GUK A;  1M99 A;  1N8J A;  5D93 A;  1QXH A;  1Z9H A;  5D8I A;  2JAC A;  4KX4 A;  3KMN A;  1GUH A;  1AIU A;  1JZR A;  3EYT A;  1FW1 A;  1EGR A;  5JCU A;  2QC7 A;  3Q6O A;  3ZLP A;  2H71 A;  3BCI A;  1X9M B;  3VI7 A;  1SK1 A;  4FO5 A;  4Q5N A;  1O81 A;  3TJG A;  2A2S A;  1BYE A;  4PQ1 A;  1VGL A;  4OCF A;  3KJY A;  2F9S A;  4DSS B;  1JHB A;  1NHO A;  2REM A;  3IK7 A;  1YY7 A;  5LCZ A;  1TKD B;  1KBN A;  1THO A;  1EGO A;  3H79 A;  2EC4 A;  3F3R A;  4O7H A;  3HVS A;  5G31 A;  2FWF A;  4J2F A;  2L6C A;  3EUR A;  4F0B A;  4EKZ A;  5AN1 A;  2GZY A;  1V2A A;  2K8V A;  4TR4 A;  2VLT A;  4NAX A;  2H1B A;  4MF5 A;  2AV4 A;  3TKP A;  2TIR A;  1U3A A;  1BQ7 A;  3KP8 A;  4L8E A;  2MMN A;  1F9M A;  3CYN A;  4XTS A;  10GS A;  1QUW A;  1FVK A;  2DIZ A;  2N5A A;  3O76 A;  4IJ3 A;  1GL8 A;  1O8X A;  4AGS A;  4ULX A;  1YZX A;  3F6F A;  2H01 A;  2RLI A;  3OR5 A;  4EXJ A;  2B5E A;  1FO5 A;  2ES7 A;  1ZGN A;  2F3M A;  4D73 B;  4MPF A;  4TR3 A;  4KSM A;  3LG6 A;  2WFC A;  2WB9 A;  1AQX A;  3HD5 A;  1NSW A;  4OCE A;  5CNW A;  2H19 A;  4AJ6 A;  4MAB A;  1S3C A;  4DSS A;  2H1A A;  4EC0 A;  1PGT A;  5GAP D;  4PNF A;  3KCM A;  3GA4 A;  4MCU A;  2WJU A;  16GS A;  4MK3 A;  5LNK e;  1X0R A;  2PPT A;  3HJP A;  3HZ8 A;  2PER A;  22GS A;  4XRD A;  4P3Y B;  2CQ9 A;  2L4C A;  1GNE A;  5F8B A;  4HU7 A;  4ML1 A;  4IW9 A;  1TDI A;  2PVO C;  2RII A;  1ZZY A;  2FWG A;  2GSS A;  3HZ4 A;  4NHZ A;  1M2A A;  1PL2 A;  1TOF A;  4K0N A;  4TXO B;  5FHI A;  2YZH A;  5ELA A;  3CTF A;  2R6K A;  3HKR A;  1T3B A;  4HU9 A;  3GKX A;  4XS1 A;  3N9J A;  1PA3 A;  4V2N A;  1GLP A;  5B8A A;  3LOR A;  1K3O A;  2EIR A;  1N2A A;  3UL3 A;  2HSH A;  4GST A;  4CHS A;  1RQM A;  2IME A;  1TU7 A;  4IS0 A;  2XBI A;  1TTZ A;  3J7Y k;  4YQU A;  4PUA A;  2C8U A;  1NW2 A;  5INY A;  17GS A;  1O7U A;  4PXO A;  1KNG A;  5G5E A;  1AC1 A;  5CRG A;  1TRU A;  20GS A;  2O87 A;  2YV7 A;  1ERW A;  3DD3 A;  1GSQ A;  1ZYQ B;  3GN3 A;  2FHE A;  1WOU A;  3C7M A;  4OD7 A;  2C3N A;  5IOX A;  3GX8 A;  2YV9 A;  3HY2 A;  2YZU A;  2V6K A;  2P0G A;  2C80 A;  1GLQ A;  1A2J A;  3D4T A;  5E4W A;  4POK A;  1CQH A;  4DEJ A;  3IAM 2;  1I5G A;  4ZL8 A;  5G30 A;  3DIE A;  4XRA A;  1XWB A;  3TOU A;  2GT5 A;  2VCT A;  2MMO A;  3ME7 A;  3KTB A;  3IPZ A;  4TXO A;  2R3X A;  1WRY A;  4YAP A;  4MJA A;  3TJJ A;  3GH6 A;  1YKA A;  4MZB A;  4Q5R A;  2IFQ A;  2VL9 A;  1CQG A;  3ZVJ A;  2LJK A;  4DSQ A;  3W8S A;  2NVL A;  4X43 A;  4TR1 B;  3F3Q A;  1M0U A;  2L5L A;  3HXS A;  2QSI A;  3FEU A;  1G7O A;  1ZCP A;  4NV5 A;  3UMA A;  4O32 A;  2GT6 A;  2MMZ A;  3D4M A;  3F4R A;  3LYP A;  4OO4 A;  2VLV A;  1E2Y A;  3W6G A;  4WF5 A;  1TI1 A;  3FK8 A;  2VD1 A;  1GTB A;  3VFI A;  1HQO A;  3H1N A;  1K3L A;  3DEX A;  2B7J A;  1AQW A;  2HI7 A;  4FYC A;  3GRX A;  3APS A;  3I9V 2;  4Q5Q A;  4KND A;  5J9B A;  2WCI A;  4X0X A;  3UVT A;  3VWX A;  4DVC A;  3F0I A;  2X8C A;  5ECM B;  1MDK A;  5IMZ A;  1R4W A;  3TKS C;  1K0A A;  1XVW A;  2K9F A;  4MH2 A;  1BX9 A;  2YNX A;  2B6M A;  4NMU A;  4WR4 A;  4TN8 A;  3KH9 A;  1GP1 A;  2JZR A;  5D9W A;  4JR4 A;  2X99 A;  1XPV A;  1USB A;  2LEG A;  2DJJ A;  5F0G A;  2WRT A;  4F0C A;  1SU9 A;  1ABA A;  1H75 A;  2DJK A;  4GTU A;  4MLY A;  1HNC A;  1PKZ A;  2ZCT A;  2VCV A;  5AIX A;  7GSS A;  1UVZ A;  4MA9 A;  1V58 A;  3VI5 A;  4O5R A;  2YOI A;  1Q98 A;  5L71 A;  3WT2 A;  2BMX A;  2OA7 A;  2PVQ A;  5HFG A;  2AHE A;  4E8E A;  2IJY A;  2C3Q A;  3LFL A;  2AAW A;  4F82 A;  2V41 A;  3RDW A;  1S3D A;  2CAQ A;  2QGV A;  4H86 A;  4K8M A;  1J0F A;  1WPI A;  4J57 E;  3GUS A;  3V1W A;  3EVI A;  4PUR A;  4V2L A;  1K0M A;  4KDU A;  1OKT A;  4WXT A;  3R2Q A;  1U87 A;  2R2J A;  2H1G A;  1IYH A;  1SL0 B;  1I9D A;  1JZD A;  3TKR A;  3G7I A;  3CTG A;  3D21 A;  3P2A A;  3KTL A;  5HFK A;  5HFI A;  5AIS A;  3KZQ A;  2A2R A;  2LNS A;  3IAS 2;  4RI7 A;  3ED3 A;  3UVH A;  1AW9 A;  3WD6 A;  4GSN A;  4ML6 A;  1K0O A;  5H5R A;  2JU5 A;  3GX0 A;  1YEX A;  1R7H A;  1FAA A;  3N5O A;  1A24 A;  2DJ2 A;  1TU8 A;  1QGV A;  1TP9 A;  1BAY A;  3FZ5 A;  1S3A A;  11GS A;  3HYP A;  4GCI A;  4KDY A;  4I2T A;  3RBT A;  3DXB A;  4EDZ A;  3CRT A;  2FWE A;  1HNA A;  1G0T A;  4BA7 A;  4Z7X A;  3QFB C;  1QQ2 A;  1XW5 A;  2XC2 A;  1T00 A;  3QPM A;  2LRT A;  2HRF A;  2VL2 A;  3GV1 A;  4WKW A;  3RPN A;  2OAD A;  2CVK A;  2LKU A;  5HR2 A;  3HDC A;  2H30 A;  2MBT A;  3GYK A;  4LL1 B;  2E0Q A;  1X5E A;  3A3T A;  3H93 A;  1Z7R A;  4GRF A;  2B1L A;  1X5C A;  3GKM A;  1FB0 A;  2P31 A;  2H73 A;  1E6B A;  4HJ2 A;  1W4V A;  2LRC A;  3S9F A;  3ZTL A;  2JL4 A;  5IQY A;  1O85 A;  4OFN A;  2K18 A;  3EU4 A;  5D9X A;  1AXD A;  3TKS E;  3LJR A;  4GXZ A;  2FNO A;  4FIW A;  3TJF A;  4EE0 A;  2CX3 A;  6GSW A;  2J9H A;  2XPD A;  2HNL A;  1HYU A;  4MF7 A;  5DBQ A;  5DJM A;  5CRE A;  3MSZ A;  3ZFB A;  5D73 A;  2I81 A;  1Z6N A;  2H76 A;  3M9J A;  1X5D A;  2DLX A;  5DAL B;  3QDN A;  3P7X A;  1O73 A;  3K8N A;  4TOP A;  5CRD A;  1Z3E A;  3UJ1 A;  4MZC A;  2HE3 A;  4ZB8 A;  1PMT A;  4DSR A;  1B9Y C;  3O6T A;  3GTU B;  3LWA A;  4MJE A;  1GRX A;  1J9B A;  4I5Q A;  2LS5 A;  2VM1 A;  1A8L A;  3VPT A;  3DVW A;  5IOW A;  1T1V A;  2NBS A;  4RQR A;  2PGT A;  3MWH A;  2IN3 A;  1O6J A;  2HZF A;  4RQX A;  4G10 A;  3F6D A;  5ECL B;  5ID2 A;  2HXK A;  1MD4 A;  2GDR A;  3ZL5 A;  2FY6 A;  5DCH A;  3C1R A;  1VRS D;  4L0W A;  3GH9 A;  2KHP A;  1AUC A;  1MTC A;  4ZIL A;  2KP1 A;  3DML A;  1XW6 A;  3GMF A;  5IIZ A;  3ZMK A;  5D96 A;  3CMI A;  5GSS A;  2LUS A;  4I6X A;  5B7C A;  5DAL A;  3KGK A;  8GSS A;  2AJQ B;  4HOJ A;  4KAE A;  1JZO A;  2HSY A;  1T4Y A;  3QMX A;  4AJ8 A;  3US3 A;  4BPY A;  2C0D A;  4ECC A;  1A0R P;  2L57 A;  3GTU A;  3MDK A;  3AY8 A;  2YWN A;  5KN2 A;  1TJD A;  5D9T A;  3SBC A;  3Q18 A;  2H0H A;  1ERV A;  4YQM A;  1ERT A;  1THX A;  3C73 A;  1AQV A;  2JZS A;  2CA8 A;  3DKS A;  2I4A A;  1SYX A;  4Q5F A;  4RUV A;  2B7K A;  6GST A;  1PX7 A;  2LQQ A;  1SEN A;  5A4V A;  2E7P A;  3GSS A;  4TKY A;  5IM9 A;  3FY7 A;  2IMD A;  2GQM A;  2D2Z A;  1F3B A;  4ZIJ A;  3QD9 A;  2ZUP A;  1T8E B;  5J41 A;  2AYT A;  4YQV A;  1WIK A;  1K0D A;  1FVJ A;  4ILF A;  3LQ7 A;  2IFQ B;  1K0C A;  4MPG A;  1MEK A;  2FD3 A;  2XBQ A;  1SD8 A;  4IBP A;  3DWV A;  2DML A;  5IO2 A;  3HJO A;  2VCQ A;  3IC4 A;  2YP6 A;  3D22 A;  3BJ5 A;  4FH8 A;  1FOV A;  5ABR A;  3ZVJ D;  2DJ1 A;  2ALB A;  2ZNM A;  5H5S A;  1DBY A;  3FZ4 A;  3ZIJ A;  2V6O A;  4IN0 A;  3IBH A;  2NDO A;  3NOF A;  4F03 A;  2FA8 A;  1XOB A;  2E2M A;  3G9B A;  2IMI A;  5IMA A;  3APO A;  4OFT A;  4PX1 A;  3KMO A;  3TCO A;  1TK5 B;  3DYR A;  3RAZ A;  4EVM A;  4I8B A;  4F9Z A;  2OAC A;  5DQY A;  3HHV A;  4KE3 A;  3WYW A;  4MF6 A;  3PR8 A;  2GQL A;  1F2E A;  3ZIT A;  1GTI A;  4PNG A; 
#chains in the Genus database with same CATH topology
 2OTJ 3;  5IEP A;  1VF3 A;  2LTK A;  1GUL A;  1JZW A;  1S5A A;  3F9U A;  4N6M A;  2DIY A;  1WNH A;  3SXX A;  1M9A A;  1BRH A;  4K0G A;  4HOH A;  3SYU A;  1R4C A;  3ZRE A;  4ZXG A;  1EV4 A;  5CXO A;  4JRR A;  1BVI A;  2MZC A;  2FLS A;  2WS2 A;  5CK6 A;  3VPQ A;  4NV2 A;  4TR0 A;  2YN1 A;  1STD A;  4XDV A;  2A4V A;  4XHM A;  5ECN B;  5CP1 A;  1XCC A;  3CU3 A;  2AUV A;  1YEP A;  2M46 A;  3QRD A;  5I97 A;  3PCS A;  1VQ7 3;  1XBS A;  3KEB A;  2MYG A;  2CWV A;  2TRX A;  3IV4 A;  3R3E A;  1EEJ A;  5DQS A;  2YX9 A;  1EP7 A;  3KXO A;  1FOH A;  4JZQ A;  1H4O A;  3DVX A;  4I97 A;  3TRQ A;  3CC4 3;  1UW1 A;  4WHA A;  4YKG A;  1Q9E A;  3M9K A;  2KLX A;  4HM1 B;  3QK9 A;  1EA2 A;  2F5W A;  2R41 A;  3DMC A;  2A2P A;  2HMK B;  4TVE A;  1TTO A;  2C11 A;  3GNJ A;  1GSU A;  1OPY A;  4KFE A;  5AI1 A;  2CV4 A;  2XHF A;  1DET A;  5J9C A;  4ZB6 A;  4HM7 B;  1LNI A;  4DKI A;  4BWQ A;  3C1S A;  5EPF A;  3G7J A;  2HMN B;  5H5Q A;  2GZZ A;  3LGC A;  1BIR A;  5FT3 A;  2A4H A;  2O85 A;  2TRC P;  4LA1 A;  3OXA A;  1TRS A;  3SOY A;  1GNW A;  5ECH B;  2XFS A;  3CXG A;  3JVC A;  4G0L A;  4XBY A;  4OUQ A;  3X3Z A;  2ON5 A;  3WMD A;  3KSP A;  4G0I A;  1TXX A;  3TKS A;  4G19 A;  5E59 A;  1G6Y A;  2CZ2 A;  4IQA A;  2UGI A;  4BTW A;  3FMW A;  1W89 A;  5HQP A;  2QIY A;  1F8N A;  3E3E A;  2VM2 A;  5JWR B;  3PYJ A;  4AJ7 A;  5IO0 A;  1MGW A;  5G5F A;  3FRC A;  5HGR A;  1RGK A;  2LRN A;  1I70 A;  5HOH A;  8CHO A;  5KP1 A;  1B9X C;  1UCJ A;  3JUN A;  3S27 A;  4HZ4 A;  4PEJ A;  2XSH B;  1OC9 A;  1UC7 A;  2GXF A;  19GS A;  2L59 A;  4JED A;  1M2B A;  1RGF A;  4N6O B;  1ILO A;  1A2P A;  2JZT A;  3TUE A;  3IR4 A;  4EDY A;  1EOG A;  3FR3 A;  1VF2 A;  2C4J A;  2E2V A;  4N6L A;  4GSS A;  4PGT A;  1M9G A;  5F05 A;  1SD9 A;  3KIJ A;  1ACV A;  1YKC A;  2FGX A;  1RRL A;  2H72 A;  3FG3 A;  3X3X A;  4XIH A;  2CFG A;  1EP8 A;  1SJZ A;  2PN8 A;  3UIW A;  5IG4 A;  3PS8 A;  1OYJ A;  2JSZ A;  3U97 A;  1OGZ A;  1RKY A;  3WR2 A;  1FGT A;  2IUJ A;  1YQ1 A;  2ML5 A;  2E2U A;  2PU9 C;  5DDL A;  1M7T A;  3VWV A;  3E9J B;  3H8Q A;  3NIV A;  3M8N A;  5DAK B;  5ECK B;  3QAG A;  2OOV C;  2N5B A;  5AYS C;  3ISO A;  3MHE A;  4N0Z A;  4YH2 A;  3EU3 A;  2VIM A;  2CG1 A;  1X1X A;  3BB9 A;  2XFT A;  1PFP A;  3GRD A;  4KGI A;  1YJ6 A;  4STD A;  3NBR A;  2B5X A;  2OE3 A;  4EIQ A;  1C54 A;  1ZGX A;  5DCG A;  5JCW A;  1CYU A;  1WMP A;  1U6T A;  2R4V A;  4KUN A;  3VLN A;  2GU3 A;  2B24 B;  1B21 A;  3J7Y b;  1QK8 A;  2DJ0 A;  3LSZ A;  4LYL B;  4TW5 A;  1BG5 A;  3ZIV A;  1BUJ A;  1JBT A;  5TGN A;  4ZB9 A;  4EV2 A;  4BL7 A;  2F8A A;  4WBJ A;  2R0C A;  3I6A A;  4IGJ A;  4N30 A;  5GSP A;  2OCT A;  4LLR A;  3H4K A;  4GLT A;  1MD3 A;  2W04 A;  1FZU A;  2EIQ A;  2DSA A;  2C0G A;  3UJM A;  1TU5 A;  1MGR A;  2YFJ B;  3RNT A;  3DGN A;  1SJI A;  3IHQ A;  5CO3 A;  1ZYE A;  2HOH A;  3N9H A;  2Z9S A;  1SKS B;  1M1X B;  4K61 A;  2FUG 2;  4WF4 A;  3KFQ C;  4LMI A;  1A90 A;  3UNL A;  2F98 A;  1TI3 A;  4X2H A;  5ECO B;  3UBL A;  1G7E A;  1MWU A;  1ROA A;  3QAW A;  3NQY A;  3WA2 X;  3M3M A;  3A2W A;  3L78 A;  3KE7 A;  1NDO B;  3FZ9 A;  2PBJ A;  2DBC A;  2W9Q A;  2HMO B;  2IL3 A;  2CX4 A;  4EO3 A;  3FKF A;  3IK9 A;  3P90 A;  2O8V B;  3O3T A;  4NWY A;  1GY5 A;  2O89 A;  4IP1 A;  3D5G A;  4IJI A;  3ME8 A;  4XS4 B;  4KW6 A;  2XF3 A;  2OE1 A;  1TP6 A;  3FW2 A;  3HOH A;  1WMJ A;  1URM A;  2H0I A;  4WFO A;  3CMA 3;  3V98 A;  3X41 A;  5DAK A;  3L0H A;  3SWL A;  1EEM A;  2JAD A;  2I3Y A;  5A5K A;  4EL1 A;  2KOK A;  1F6M C;  2H70 A;  3DRN A;  3DGQ A;  1RJO A;  3K7C A;  2IIY A;  4N11 A;  4LEH A;  3TGZ A;  2HRA A;  1SAR A;  3G16 A;  4OK0 A;  3CSJ A;  2G0F A;  4LSO A;  2H74 A;  2L4Q A;  2W9P A;  5KOX A;  4HM3 B;  9RNT A;  1PD2 1;  2GLR A;  3MAK A;  2NPB A;  1RGA A;  2X8H A;  3LOY A;  3ERW A;  5JBS A;  3F4S A;  4HKV B;  1JB4 A;  2C0F A;  1GSF A;  2CFW A;  2I1U A;  1K0B A;  1T4Z A;  1G96 A;  3WOD G;  1MDI A;  4QL9 A;  2W0Q A;  3HII A;  5ID2 B;  1F37 A;  2GGT A;  2IWT A;  1VQ4 3;  5HR1 A;  4CY6 A;  1X1Y A;  1Y4K A;  1HZ1 A;  2IMK A;  2YWI A;  4BVX B;  4R9L A;  3EMX A;  2CAI A;  3HA9 A;  1XW9 A;  4O2H A;  3KSE D;  3VWU A;  4MP4 A;  2HLS A;  3D0Z A;  4NXI A;  4V1A g;  2JQ5 A;  3TJB A;  5EEO A;  1NB5 I;  3TOT A;  5CLK A;  1XFL A;  2PWJ A;  4X1U A;  1W7C A;  3MYD A;  3VWW A;  3ZYW A;  3FG1 A;  3LXZ A;  4F2I A;  5ECR B;  3MNG A;  1JJ2 2;  1YDK A;  3D79 A;  2YPM A;  2KXG A;  1X9S B;  5IMF A;  2BMO B;  1FUS A;  1KTE A;  3KM6 A;  3DY5 A;  1BNR A;  1DUG A;  5DJL A;  2X64 A;  4MH3 A;  1EZK A;  1TRP A;  1GOY A;  3Q1C A;  5HR3 A;  3FH1 A;  1A67 A;  4XS4 A;  4X4J A;  1I3I A;  3TKQ A;  4CJN A;  4IIA A;  5CF2 A;  4HVN A;  2SBL A;  1TK8 B;  3PXM A;  3DM8 A;  2JSY A;  4EV5 A;  2YWO A;  1JRQ A;  1PL1 A;  3BBY A;  4V2M A;  2FCH A;  4EIP A;  4KA0 A;  5M19 A;  2QKE A;  3TB2 A;  2CVD A;  4K2D A;  5F06 A;  2OKA A;  4K7I A;  3RHB A;  4J9A A;  1VF1 A;  1A2M A;  2XGN A;  5ECI B;  2KUC A;  1XWG A;  4OWY A;  6RNT A;  5HR0 A;  3QAV A;  3T8U A;  3UL6 A;  1OC8 A;  4POB A;  3LW9 A;  5ECQ B;  2H1D A;  2WO0 A;  1I3F A;  3B4P A;  2L6D A;  3F63 A;  1QAF A;  4CW9 A;  2GTU A;  3NHX A;  3GKK A;  1NB3 I;  4HZ2 A;  1LNH A;  1XWA A;  3IXR A;  4KFF A;  2V2G A;  1B2M A;  2CX1 A;  3WOE B;  1UGH I;  1J2B A;  1B2Z A;  2P5Q A;  2X8G A;  1RGH A;  7STD A;  3UBK A;  1SKR B;  4FMC A;  3ZML A;  1DYU A;  4IEL A;  2PMT A;  1TRQ A;  1DMQ A;  3E99 A;  1NM3 A;  1J08 A;  3EBY A;  1WJK A;  6GSX A;  2BTO T;  3BD2 A;  3FCS B;  4BVX A;  1I2G A;  1FUT A;  2GVP A;  2OTL 3;  2XGL A;  2YWM A;  1Q4J A;  4OFM A;  2VL3 A;  1MNL A;  4ZL9 A;  1K73 4;  1G6W A;  3TRP A;  4GQC A;  3AHS A;  1LOX A;  4NPB A;  1HD2 A;  1LJR A;  3QOU A;  5IG3 A;  4E8H A;  2H8L A;  4NHW A;  2RBI A;  1SL1 B;  4CDO A;  3CRU A;  5IMV A;  3EIN A;  5IMC A;  1Z5Y E;  2O3O A;  1U88 A;  2H0G A;  3ERF A;  3NBB A;  3CPW 2;  3F9S A;  3CCR 3;  4FYB A;  1A23 A;  1JB2 A;  4R9K A;  4PUF C;  5FGO A;  1I0X A;  2H6Y A;  2CX0 A;  1TFK A;  2UZ8 A;  5GST A;  3MG3 A;  2RM5 A;  2K6V A;  2Y73 A;  4ID0 A;  3IRA A;  1LBK A;  3LZA A;  2DMM A;  1V98 A;  3ZZX A;  3LH4 A;  1SQW A;  1IU7 A;  3G7Y A;  4HM2 B;  2NTO A;  4WR5 A;  3RDE A;  3LXT A;  1SK2 A;  3APQ A;  3BCK A;  1PQN A;  3EJV A;  4NRE A;  2H6Z A;  4IVF A;  3A5W A;  3DH2 A;  2VLU A;  4L8P A;  4RBN A;  2CT6 A;  4BVY A;  1Q86 4;  1VQK 3;  3L9V A;  3U5R E;  3LTA A;  1K0N A;  1OF5 A;  4LMW A;  1B8X A;  5B6M A;  3FLJ A;  4MZW A;  2CH9 A;  4EUY A;  1OVN A;  1ST9 A;  3LYG A;  1AV4 A;  3CC2 3;  3I56 3;  3IOS A;  1XVQ A;  4ORL A;  5EY6 A;  3UEM A;  1GSD A;  5ENU A;  3IE3 A;  3EF8 A;  2IYJ A;  1OE7 A;  4GHO A;  3F8U A;  4KCE A;  3UL5 A;  5KN0 A;  3TJK A;  4L0U A;  3W8J A;  4QL7 A;  5B8B A;  4LGQ A;  2B5Y A;  2KF6 A;  1BNI A;  2OBK A;  3FYG A;  1Q42 A;  1WTH A;  1BU4 A;  1I2F A;  4PQH A;  5C04 A;  1B48 A;  3T8N A;  1K8A 4;  1T7P B;  3GHA A;  4TX4 A;  3CCU 3;  3EE2 A;  3LML A;  2H66 A;  2C3T A;  1RGC A;  4HQZ A;  1PRX A;  1QJG A;  1M1K 4;  3DGL A;  2D42 A;  3PZW A;  1XWC A;  1QFN A;  5JWQ B;  2OJL A;  3FZW A;  3EPT A;  3HVX A;  1Z6M A;  3ZFL A;  2B3S A;  5A4W A;  1V57 A;  2CWT A;  5KN3 A;  4HUA A;  2GZP A;  1AAZ A;  2F8F A;  5ECS A;  1OHO A;  5CYY A;  2A15 A;  1RK4 A;  2HFD A;  3BOA A;  3UAP A;  3UOM A;  3EN1 B;  1QAL A;  1ZYP A;  3CCS 3;  1WE0 A;  1RW1 A;  5F07 A;  5J4U A;  1QMV A;  4GF0 A;  1W4N A;  4WET A;  1I8V A;  3M1G A;  2GSQ A;  1AVL A;  1U3I A;  3UAR A;  2BJX A;  4YAV A;  4L7K A;  5J3R A;  3MWZ A;  1O7H B;  1W6C A;  1GY7 A;  2VO4 A;  1V9W A;  2VCW A;  1IQX A;  2LNT A;  1JFU A;  3QCP A;  3I69 A;  5D81 A;  4D73 A;  4MNN A;  5CAX A;  1DE2 A;  3NZN A;  1BSC A;  5A4U A;  2WUL A;  1MDJ A;  1VZZ A;  4XBT A;  1ML6 A;  3KH7 A;  1PN9 A;  4KH7 A;  5AIG A;  3DZL A;  4KVH A;  2R5G A;  3ZG0 A;  5C00 A;  1GY6 A;  1Q7H A;  2IY2 A;  3MG1 A;  3URP A;  2GST A;  2K3D A;  3GL3 A;  2HT9 A;  1U5O A;  3FZA A;  1STF I;  2P5R A;  3M8C A;  1G02 A;  4ACS A;  1VQ5 3;  5IMD A;  2AB6 A;  4A5P A;  1DVC A;  2LJR A;  3Q2P A;  2J23 A;  4ZBD A;  2RUE A;  1BSE A;  3LTD A;  5LD0 A;  3WDG B;  3WGE A;  2E2G A;  4USS A;  4J56 E;  3HCZ A;  4ECB A;  1SII A;  1FW7 A;  3NBJ A;  3KD0 A;  2C1Y A;  4PQI A;  1E97 A;  2XPE A;  4N6T A;  3WGX A;  4ISD A;  3X42 A;  2JDI H;  1SK0 A;  5JCG A;  1IYI A;  2OE0 A;  3SLU A;  4IQ1 A;  1OC9 B;  2V1L A;  1Y6E A;  2PUK C;  3BNB A;  3S5C A;  3M0F A;  1A8Y A;  2HMJ B;  1XXU A;  1FGQ A;  1GMQ A;  3IHG A;  1RLS A;  4BL3 A;  1LU4 A;  4POL A;  1Y25 A;  4KB3 A;  6GSS A;  2R37 A;  2O9U X;  1RHL A;  5ELG A;  2M80 A;  4BWS A;  4G9H A;  1V40 A;  4I4K A;  2KCD A;  3DUK A;  1B4Q A;  4GB5 A;  1FG4 A;  3NXJ A;  5CF1 A;  3L4N A;  3BNC A;  3GFK A;  1M2D A;  1NJI 4;  3PIN A;  4ICY A;  1SJ6 A;  5AIV A;  1Q40 A;  3TRX A;  2LV3 A;  3Q3F A;  3MKI A;  2EIO A;  1N9E A;  3HIG A;  2G2Q A;  3U1W A;  1ON4 A;  3EMP A;  4N0V A;  5B6N A;  2R0P A;  2VUP A;  3F7X A;  1UCK A;  1RCL A;  3DGO A;  5BVB A;  4IHU A;  1OKD A;  1R26 A;  1C7H A;  3GZB A;  1A2L A;  1WP0 A;  3RPP A;  5GAN D;  1ZMA A;  1DE3 A;  4H3U A;  4R1K A;  4R4K A;  1LQM B;  1NO3 A;  4GWR A;  5FWG A;  2OBI A;  2LJA A;  1DVD A;  1RMS A;  1UN2 A;  4I2U A;  3OWS A;  2P05 A;  1U8C B;  2YAN A;  2YJH A;  2GEY A;  4RI6 A;  5EVO A;  3GST A;  4TXV A;  1OAZ A;  4CY8 A;  3CSH A;  1ZL9 A;  1UA5 A;  3V92 A;  2RCD A;  3B7C A;  2CVB A;  1GUM A;  1PX6 A;  1L5G B;  4O92 A;  2KF5 A;  2CZ3 A;  1R5P A;  3SX1 A;  4K1F A;  3G71 3;  2F51 A;  2XR8 B;  3CXC 2;  5GZZ B;  1O7G B;  5BU4 A;  4BL7 B;  2GSR A;  4IP6 A;  1BJX A;  4ZM8 A;  3HVV A;  5M18 A;  1NHY A;  2B1K A;  3FR9 A;  4KT3 B;  4OMV A;  2YJ7 A;  3BIR A;  3NV0 B;  3I0Y A;  4JR6 A;  4HQS A;  4QQ7 A;  1RTU A;  2DJ3 A;  3FF0 A;  2L5O A;  1YF1 A;  4EF0 A;  3PCR A;  4MJB A;  4HEA 2;  3B4O A;  4ECI A;  4K7N A;  4FCM A;  1YGE A;  5AII A;  3A2V A;  5JWO B;  3CSI A;  3EWL A;  2ZA4 A;  3PH9 A;  1B4P A;  2YFL B;  5JPU A;  4WYK B;  4TR1 A;  13GS A;  5KN1 A;  1M3I A;  1D6Y A;  1IQ8 A;  1GMP A;  3U6V A;  1BRG A;  2V1M A;  5EL8 A;  4ECJ A;  4HJM A;  3SVA A;  4AKZ A;  3S29 A;  1O7N B;  1XOA A;  4ZL7 A;  1AQZ A;  1ZOF A;  3C8E A;  5ECP B;  2OWP A;  5LC6 A;  1S3R A;  1TK0 B;  3KP9 A;  3TDG A;  1CEW I;  1OHP A;  3Q19 A;  1BSD A;  1UUW B;  4MMM A;  3A2X A;  1PSQ A;  4CCV A;  2HZE B;  3QR6 A;  2J8X B;  3F8X A;  3CC7 3;  5IPG A;  5IPH A;  1TW9 A;  3F14 A;  4N10 A;  3ERG A;  3RHC A;  1VF4 A;  1TRV A;  2FA4 A;  3C71 A;  4ZBA A;  3FGY A;  4L5O A;  4FMA A;  2RM6 A;  2GQK A;  2IPA A;  3UB1 A;  4MJC A;  5A0O B;  5G1L A;  1X9W B;  2OOV A;  4LL4 B;  2FXT A;  2VCX A;  6GSY A;  2VAF A;  1DSB A;  4POM A;  1GTA A;  2QA4 3;  4L5L A;  3GUR A;  9GSS A;  1KC8 4;  2V32 A;  1DMM A;  4JBB A;  1EG9 B;  2MF7 A;  1ZS7 A;  1W2B 2;  2WZ9 A;  3IA1 A;  3IPT A;  3Q74 A;  4HM5 B;  1HNB A;  2ON7 A;  2FWH A;  5BIR A;  2VCZ A;  1RNT A;  3EQQ B;  2ML6 A;  3HJM A;  1LOV A;  2VOC A;  4OO5 A;  1K3Y A;  4HS1 A;  3L9S A;  3QFA C;  3HX8 A;  4JF8 A;  1O7P B;  1B2S A;  3VK9 A;  2WGR A;  1N8R 4;  3LYK A;  3GSP A;  1OC3 A;  4FMB A;  2W2C A;  12GS A;  2P0M A;  1IT7 A;  2STD A;  4WEY A;  5IER A;  3E0U A;  3NV0 A;  3FR6 A;  8RNT A;  2IMF A;  2CFK A;  4ZBB A;  3J7Y d;  1BUQ A;  2H75 A;  3O8Y A;  4V1A p;  3L9U A;  4GQF A;  1PY3 A;  1BAN A;  2GU1 A;  1R5A A;  1OE8 A;  4XCS A;  3WGD A;  3FHK A;  4J8T A;  1RNB A;  5DRE A;  4MDC A;  3JCM L;  2HRN A;  1GSY A;  4FCJ A;  4WYK A;  4G2E A;  4K7O A;  2HYX A;  3VUR A;  1ERU A;  1OH0 A;  3KZT A;  4HI7 A;  3HI7 A;  5G2Z A;  2K0M A;  2K8S A;  1JKG B;  2GEX A;  1NU3 A;  5EVH A;  3CBU A;  1C72 A;  1LOW A;  5IW9 A;  1M9B A;  1JNQ A;  2HZE A;  1GTU A;  5COH A;  2CFL A;  2MBS A;  2F86 B;  2MMA A;  6GSU A;  3LEF A;  2KAA A;  4MEI A;  1SKW B;  5AIF A;  5DVB A;  5J5N A;  1JLV A;  2C0E A;  1SL2 B;  3LT8 A;  1R4Y A;  18GS A;  1XIY A;  1Z7P A;  1I0V A;  5CRW A;  4X2O A;  3PGT A;  3GAX A;  3D5I A;  2VL2 C;  2CIU A;  1IV9 A;  4JU5 A;  5IEN A;  1BED A;  1TRW A;  4KDX A;  4K6X A;  1FHE A;  3ZRD A;  5G1K A;  1FGO A;  3EC3 A;  1IT8 A;  3GL5 A;  1XZO A;  1DE1 A;  4XS6 A;  3EB8 A;  4KSO A;  1WWJ A;  4FYU A;  2HML B;  3IDV A;  4O5Q A;  2FGT A;  5AGY A;  1XG8 A;  2F99 A;  2O7K A;  1FB6 A;  4CDL A;  1SYR A;  3P8W A;  2GS3 A;  2VD0 A;  1JLW A;  1KEB A;  2YCD A;  1RN4 A;  2DC5 A;  5D9V A;  3BNE A;  1RSN A;  1OAC A;  6GSP A;  3D6I A;  4LMV A;  1BAO A;  4GL6 A;  4EW5 A;  2XH9 A;  1EOH A;  14GS A;  4AF2 A;  4KCA A;  1LQG C;  1XWK A;  4WBR D;  1GSS A;  5KEJ A;  1EV9 A;  1PKW A;  2M72 A;  3WT1 A;  1YGW A;  2RUF A;  1VQO 3;  1GSE A;  3FF2 A;  2I9H A;  2LST A;  4EYC A;  4JE1 A;  1A0F A;  4TRX A;  3CCM 3;  4IKH A;  2LQO A;  3GIX A;  1GH2 A;  3D5J A;  1YF0 A;  5CRH A;  3F4T A;  3GKN A;  4N6U A;  1F3A A;  1VQ9 3;  2N5F A;  3I43 A;  1KQS 2;  1ISK A;  1JKG A;  6GSV A;  1EWX A;  2H6X A;  1O8W A;  3GZY B;  2WDU A;  4HDE A;  3K9M C;  1GWC A;  2KP2 A;  4Q53 A;  4K9Z A;  1GUK A;  1M99 A;  1N8J A;  5D93 A;  1QXH A;  1Z9H A;  5D8I A;  2JAC A;  4KX4 A;  1RGL A;  3KMN A;  1GUH A;  1AIU A;  1JZR A;  3EX9 A;  3Q90 A;  3EYT A;  1FW1 A;  2W56 A;  3OWY A;  1EGR A;  4K1V A;  1JN5 B;  4RNZ A;  3SED A;  1MWR A;  5JCU A;  2QC7 A;  1SIH A;  3Q6O A;  3ZLP A;  2H71 A;  1BNS A;  3WA3 A;  3BCI A;  1X9M B;  3VI7 A;  1SK1 A;  4FO5 A;  4XM4 A;  4BVY B;  4Q5N A;  1O81 A;  3TJG A;  3LTC A;  2A2S A;  4AEQ A;  4G1M B;  2WOF A;  4HAA A;  1OF5 B;  1BYE A;  4EXR A;  1ULJ B;  4PQ1 A;  3OV4 A;  1VGL A;  4OCF A;  3KJY A;  2F9S A;  4DSS B;  1JHB A;  1NHO A;  3F40 A;  2REM A;  1QVG 2;  3IK7 A;  4WWU C;  1W01 A;  5ELU A;  1YY7 A;  3BU4 A;  5LCZ A;  1A2V A;  1TKD B;  4O8S A;  3LT9 A;  1KBN A;  1PFO A;  1THO A;  1EGO A;  3H79 A;  4K1U A;  2EC4 A;  1VQL 3;  3F3R A;  3HVS A;  4O7H A;  5G31 A;  2FWF A;  4J2F A;  5G2G A;  2L6C A;  3EUR A;  4F0B A;  1IVU A;  4EKZ A;  5AN1 A;  2GZY A;  1NWW A;  1V2A A;  2K8V A;  4TR4 A;  2VLT A;  1WMO A;  4NAX A;  2H1B A;  3HVN A;  4MF5 A;  2AV4 A;  3TKP A;  2TIR A;  2INX A;  1U3A A;  2UX0 A;  1BQ7 A;  3KP8 A;  4L8E A;  4OVM A;  3EBT A;  1Z1S A;  1ZX2 A;  4LZI A;  2MMN A;  1F9M A;  3CYN A;  4XTS A;  1JV2 B;  1QUW A;  4Z2U A;  10GS A;  1FVK A;  2DIZ A;  2N5A A;  3O76 A;  1TIJ A;  4IJ3 A;  1GL8 A;  1MOL A;  1O8X A;  2L4V A;  4R80 A;  1E3R A;  1JN5 A;  4AGS A;  4ULX A;  1YZX A;  2WOH A;  3F6F A;  4O3V A;  3KII A;  2H01 A;  2RLI A;  2K54 A;  4HZB B;  3OR5 A;  4EXJ A;  2B5E A;  1FO5 A;  2ES7 A;  1ZGN A;  2F3M A;  4D73 B;  2E2T A;  1ULI B;  4G0K A;  4MPF A;  4TR3 A;  4KSM A;  3STD A;  3LG6 A;  1W5Z A;  1DMN A;  2WFC A;  3K0Z A;  2WB9 A;  1AQX A;  3HD5 A;  1NSW A;  3RGR A;  4OCE A;  1VQN 3;  5CNW A;  2H19 A;  4AJ6 A;  4MAB A;  1S3C A;  3T0U A;  4DSS A;  2GBW B;  2H1A A;  1HKX A;  1PGT A;  1VQM 3;  3A5I A;  4PNF A;  4EC0 A;  3KCM A;  5GAP D;  1IYY A;  3GA4 A;  4MCU A;  2WJU A;  1FGR A;  16GS A;  4MK3 A;  1VQ6 3;  5LNK e;  1RGE A;  1X0R A;  2PPT A;  3HJP A;  3HZ8 A;  2PER A;  1MWS A;  22GS A;  4XRD A;  4P3Y B;  2CQ9 A;  2QA2 A;  2L4C A;  1GNE A;  2F56 A;  5F8B A;  1US1 A;  1KD1 4;  1W6Y A;  3ZFZ A;  4HU7 A;  1PYL A;  5KP3 A;  4ML1 A;  2R4I A;  1ROV A;  5DRV A;  2OQE A;  4IW9 A;  1TDI A;  2PVO C;  2RII A;  1ZZY A;  2FWG A;  2GSS A;  3HZ4 A;  4NHZ A;  3AMO B;  3ER7 A;  2DKI A;  2Z76 A;  3JUP A;  1M2A A;  5STD A;  1PL2 A;  1TOF A;  4K0N A;  4TXO B;  5FHI A;  2YZH A;  5ELA A;  3CTF A;  1KWI A;  5M1A A;  2CWU A;  2R6K A;  3HKR A;  1T3B A;  4HU9 A;  3GKX A;  4XS1 A;  3I55 3;  2F5M A;  3CQF A;  3N9J A;  1EQK A;  1PA3 A;  1GLP A;  1EUI C;  4V2N A;  1W00 A;  5B8A A;  3LOR A;  1K3O A;  3X40 A;  2EIR A;  1N2A A;  3UL3 A;  3D9R A;  2HSH A;  4GST A;  1B3S A;  4CHS A;  1RQM A;  2IME A;  4HZ9 B;  1Q40 B;  1TU7 A;  4IS0 A;  2XBI A;  1TTZ A;  4K5R A;  3J7Y k;  4YQU A;  1QAK A;  4PUA A;  3L0R A;  2C8U A;  1NW2 A;  1W02 A;  5INY A;  1BSA A;  1BGS A;  17GS A;  2ZDJ A;  1O7U A;  4PXO A;  1KNG A;  1HYF A;  5G5E A;  4FMD A;  1AC1 A;  1D6Z A;  4J5G A;  3EC9 A;  5CRG A;  3BND A;  3CCL 3;  1TRU A;  20GS A;  2O87 A;  2YV7 A;  1ERW A;  3DD3 A;  2B1X B;  1GSQ A;  1CYV A;  1ZYQ B;  4HM6 B;  3GN3 A;  1JB5 A;  2HMM B;  2FHE A;  1WOU A;  3C7M A;  1IK3 A;  1QMA A;  2C3N A;  1AY7 A;  4OD7 A;  1AVK A;  3GX8 A;  1N9J A;  5IOX A;  2YV9 A;  3HY2 A;  4HBR A;  4BIR A;  3KKG A;  2YZU A;  2V6K A;  2P0G A;  4O5U A;  2C80 A;  1GLQ A;  1IV7 A;  1IVV A;  1A2J A;  3WOF B;  4RNY A;  1B2X A;  4HM0 B;  1GD4 A;  3D4T A;  5E4W A;  4POK A;  1CQH A;  1Q81 4;  4DEJ A;  4Z2T A;  3IAM 2;  1I5G A;  2P38 A;  1D6U A;  1TFO A;  3MSO A;  2PNC A;  4ZL8 A;  3JUM A;  5G30 A;  3DIE A;  1T5Y A;  4XRA A;  1UDI I;  2IMJ A;  1XWB A;  3TOU A;  2GT5 A;  2VCT A;  1ZO2 A;  5IEO A;  2MMO A;  3AMO A;  4L8O A;  3ME7 A;  1TUH A;  3KTB A;  3IPZ A;  3EE1 A;  4TXO A;  1E3V A;  3D4A A;  2R3X A;  1WRY A;  4YAP A;  4MJA A;  3CPO A;  2LQV A;  4BL2 A;  7GSP A;  4N6N B;  4MMX B;  2Y74 A;  2F4Y A;  3TJJ A;  3GH6 A;  2CHC A;  1T2I A;  1YKA A;  4MZB A;  4Q5R A;  1RN1 A;  2IFQ A;  2VL9 A;  1CQG A;  3NUV A;  3ZVJ A;  2LJK A;  1PN0 A;  3W8S A;  4DSQ A;  4Z2R A;  2NVL A;  5RNT A;  2WGO A;  4X43 A;  4TR1 B;  3F3Q A;  4QWT A;  5AEW B;  1M0U A;  2L5L A;  2I9W A;  4MMZ B;  3HXS A;  1BRS A;  3MG2 A;  2QSI A;  3FEU A;  1G7O A;  3G4S 3;  1ZCP A;  4NV5 A;  3UMA A;  3EHC A;  1JBR A;  2BU4 A;  2GT6 A;  4O32 A;  2MMZ A;  3D4M A;  3F4R A;  3LYP A;  4OO4 A;  1VQP 3;  2VLV A;  1E2Y A;  1GYB A;  2W6J H;  1ZYN A;  3W6G A;  4WF5 A;  1TI1 A;  1YI2 3;  3FK8 A;  3JUQ A;  1UUV B;  3B8L A;  2VD1 A;  3F8H A;  1GTB A;  4IPB A;  3VFI A;  2CK3 H;  1HQO A;  1X1W A;  3H1N A;  1K3L A;  3DEX A;  1RCK A;  2B7J A;  4O02 B;  1AQW A;  4U13 A;  2HI7 A;  3VSY A;  2CKF B;  1BNE A;  4FYC A;  3GRX A;  3APS A;  3I9V 2;  2RNT A;  4Q5Q A;  2GSP A;  4HJL B;  1BRN L;  4KND A;  5J9B A;  2WCI A;  1LVN A;  4X0X A;  3UVT A;  4GSP A;  3VWX A;  4DVC A;  3F0I A;  2X8C A;  5ECM B;  1MDK A;  4FQU A;  5IMZ A;  1GOU A;  5IF6 A;  1R4W A;  3TKS C;  1GOV A;  1K0A A;  1XVW A;  2K9F A;  4MH2 A;  1UI7 A;  1BX9 A;  2YNX A;  2R0G A;  2B6M A;  4NMU A;  4WR4 A;  4TN8 A;  3KH9 A;  3G8Z A;  4K5S A;  3NM2 A;  1GP1 A;  4IT7 A;  4EC6 A;  2JZR A;  5D9W A;  4JR4 A;  2X99 A;  2P09 A;  1XPV A;  1USB A;  2LEG A;  2DJJ A;  5F0G A;  3CCQ 3;  4K2X A;  2WRT A;  1T2H A;  4F0C A;  1SU9 A;  1ABA A;  1H75 A;  2DJK A;  4GTU A;  4MLY A;  1HNC A;  1PKZ A;  2CW9 A;  2UUG C;  1ASK A;  2ZCT A;  3LTB A;  2VCV A;  5AIX A;  1YHQ 3;  3IJE B;  3AGN A;  1UVZ A;  7GSS A;  3F7S A;  4HM4 B;  4MA9 A;  1V58 A;  3VI5 A;  3FSD A;  4O5R A;  2YOI A;  1Q98 A;  5L71 A;  3WT2 A;  2QGU A;  2BMX A;  2OA7 A;  5JPP A;  3NM7 A;  2PVQ A;  5HFG A;  2AHE A;  4E8E A;  2IJY A;  2C3Q A;  3LFL A;  2AAW A;  4F82 A;  2V41 A;  3RDW A;  1S3D A;  3AGO A;  2CAQ A;  2QGV A;  2MC8 A;  4H86 A;  4K8M A;  2CG0 A;  1BOX A;  1V74 A;  1J0F A;  3ROB A;  1WPI A;  4J57 E;  3GUS A;  3CCV 3;  3WHO A;  3V1W A;  2DKH A;  3CD6 3;  3EVI A;  4HYZ A;  4PUR A;  1UUG B;  3KCH A;  4KFD A;  4V2L A;  3JUO A;  1K0M A;  1BNF A;  1S72 3;  5EQL A;  4KDU A;  2IA7 A;  1OKT A;  3G6E 3;  4WXT A;  2AAE A;  3R2Q A;  1U87 A;  1W6G A;  2R2J A;  2H1G A;  1IYH A;  1SL0 B;  4YKF A;  1I9D A;  1JZD A;  3PGB A;  2WGQ A;  3H3H A;  3TKR A;  3G7I A;  4HSC X;  3CTG A;  1IDP A;  3D21 A;  3P2A A;  3KTL A;  4RNT A;  5HFK A;  5HFI A;  3MPH A;  5AIS A;  3KZQ A;  3ZG5 A;  1M90 4;  2A2R A;  1RN7 A;  1VQQ A;  2LNS A;  3IAS 2;  4FR9 A;  1YVS A;  3ED3 A;  2BO9 B;  1RRH A;  1AW9 A;  4RI7 A;  5D82 A;  3HK4 A;  3UVH A;  3WD6 A;  4GSN A;  3GZX B;  1CQS A;  4ML6 A;  1K0O A;  5H5R A;  1OGX A;  3X3Y A;  2JU5 A;  1Q82 4;  3GX0 A;  2IUK A;  1LRA A;  1M3J A;  1MWT A;  1YEX A;  1R7H A;  3S28 A;  1FAA A;  1IVX A;  1RGG A;  3DGM A;  3ALA A;  3N5O A;  2DJ2 A;  1TU8 A;  1QGV A;  3DXO A;  1A24 A;  1TP9 A;  1BAY A;  1OUN A;  3N8B A;  3FZ5 A;  1S3A A;  11GS A;  3HYP A;  1KSI A;  4GCI A;  3N54 B;  1K9M 4;  4KDY A;  4I2T A;  3RBT A;  3DXB A;  3CCE 3;  3OW2 2;  1B2U A;  3SOA A;  2W56 B;  4NHF A;  4EDZ A;  1NNV A;  3KN4 A;  3CRT A;  3VGN A;  3VF1 A;  5AEU B;  2FWE A;  1HNA A;  1GD3 A;  4CPK A;  2BIR A;  2Z77 A;  1B27 A;  1G0T A;  4BA7 A;  4Z7X A;  3QFB C;  1AR0 A;  1QQ2 A;  1XW5 A;  2XC2 A;  1T00 A;  3QPM A;  2BMR B;  2LRT A;  1BRK A;  2HRF A;  2VL2 A;  3GV1 A;  4WKW A;  2BT3 A;  2HSM A;  1RDS A;  2OAD A;  2ZHX B;  3RPN A;  2CVK A;  2LKU A;  1BRJ A;  3G0K A;  5HR2 A;  1FGM A;  3OWU A;  3HDC A;  2H30 A;  2MBT A;  2KF3 A;  3MYT A;  3GYK A;  2ZL8 A;  4LL1 B;  2E0Q A;  1X5E A;  3A3T A;  3H93 A;  1Z7R A;  4GRF A;  2B1L A;  3EN8 A;  1X5C A;  3GKM A;  1FB0 A;  2P31 A;  2H73 A;  1E6B A;  1YVB I;  4HJ2 A;  4H61 A;  1W4V A;  2LRC A;  3S9F A;  1WQL B;  7RNT A;  3ZTL A;  1LXE A;  2JL4 A;  4XDW A;  5IQY A;  1O85 A;  4JRF A;  3D3L A;  4OFN A;  3ECF A;  4WP5 A;  2PZV A;  3CNM A;  1FYS A;  2K18 A;  3EU4 A;  5D9X A;  1AXD A;  2RSX A;  3TKS E;  3LJR A;  4GXZ A;  2FNO A;  2HRK A;  4FIW A;  1N8Q A;  3TJF A;  4EE0 A;  2CX3 A;  2BMQ B;  6GSW A;  2J9H A;  2KF4 A;  1K41 A;  4XB5 A;  3CNX A;  2HNL A;  1PU4 A;  4AKY A;  1HYU A;  2XPD A;  3PPU A;  3FG4 A;  4MF7 A;  4MMY B;  5DBQ A;  2AAD A;  5DJM A;  5CRE A;  3MSZ A;  3ZFB A;  5D73 A;  2I81 A;  1Z6N A;  1SPU A;  2H76 A;  3NQZ A;  2DLX A;  1X5D A;  3M9J A;  5DAL B;  3QDN A;  2XRX B;  3P7X A;  5IG5 A;  1O73 A;  3K8N A;  4TOP A;  5CRD A;  1Z3E A;  1O7W B;  4MZC A;  3UJ1 A;  2HE3 A;  1WMN A;  1VQ8 3;  2QEX 3;  4ZB8 A;  1UCI A;  1GMR A;  1PMT A;  4DSR A;  1B9Y C;  3O6T A;  3GTU B;  3LWA A;  4MJE A;  1OCV A;  2XEP A;  1J9B A;  4PTS A;  1GRX A;  4I5Q A;  1UI8 A;  2SAR A;  2LS5 A;  3FKA A;  3NX0 A;  2VM1 A;  1O7M B;  3CCJ 3;  2Z6B A;  3LXU X;  1A8L A;  1UGI A;  1HU9 A;  5AIH A;  3H51 A;  3VPT A;  1N5H A;  3IMA B;  3DVW A;  5IOW A;  1T1V A;  5BMU A;  2XSO B;  2NBS A;  4RQR A;  2PGT A;  3MWH A;  2CC3 A;  3CME 3;  1YJN 3;  2BNG A;  4K90 B;  2IN3 A;  5ELJ A;  3A76 A;  1O6J A;  2HZF A;  2CFD A;  1UCL A;  4RQX A;  4G10 A;  3F6D A;  5ECL B;  1CH0 A;  5ID2 A;  2HXK A;  1MD4 A;  2GDR A;  3ZL5 A;  2FY6 A;  5DCH A;  2QA1 A;  3C1R A;  1VRS D;  4L0W A;  5D83 A;  3GH9 A;  2KHP A;  3GWR A;  1AUC A;  1Q7Y 4;  1MTC A;  4ZIL A;  2KP1 A;  3DML A;  1XW6 A;  3GMF A;  5IIZ A;  3ZMK A;  5BXQ A;  1YJW 3;  5D96 A;  1BNJ A;  2RFR A;  3CMI A;  5GSS A;  5KOW A;  2LUS A;  1X1U A;  3DGY A;  1K28 A;  5FW5 A;  1B20 A;  4I6X A;  5B7C A;  1LOY A;  5DAL A;  3KGK A;  8GSS A;  1BSB A;  4J5K A;  4N3V A;  1JBS A;  2AJQ B;  4HOJ A;  4KAE A;  1JZO A;  2HSY A;  6STD A;  1T4Y A;  3QMX A;  4AJ8 A;  3US3 A;  4BPY A;  2C0D A;  3HZP A;  1OHS A;  1IQY A;  1SJW A;  2LYX A;  4ECC A;  1A0R P;  2L57 A;  3GTU A;  1EKM A;  5BRT A;  2C10 A;  2W03 A;  3MDK A;  3AY8 A;  1YNV X;  2YWN A;  1W2Z A;  5KN2 A;  1TJD A;  5D9T A;  3SBC A;  3Q18 A;  1GSP A;  2H0H A;  2RGQ A;  1ERV A;  4YQM A;  3OX9 A;  1ERT A;  1THX A;  3C73 A;  3A5E A;  1AQV A;  1YIJ 3;  2JZS A;  5LC7 A;  4N6V 0;  2CA8 A;  3DKS A;  1YJ9 3;  2I4A A;  1SYX A;  3IC8 A;  4Q5F A;  4RUV A;  1BNG A;  2B7K A;  2D1W A;  1YIT 3;  6GST A;  1PX7 A;  2LQQ A;  1SEN A;  5KP4 A;  5A4V A;  2E7P A;  3GSS A;  4TKY A;  5IM9 A;  4HM8 B;  3FY7 A;  2IMD A;  2GQM A;  4MJD A;  2D2Z A;  3BLZ A;  1F3B A;  3GZR A;  4ZIJ A;  3QD9 A;  1I2E A;  2ZUP A;  1T8E B;  2OQE C;  3RGA A;  2Q07 A;  3AHW A;  2AYT A;  5J41 A;  4YQV A;  1FUW A;  1WIK A;  2YFI B;  4RZM A;  2X49 A;  1K0D A;  2FNQ A;  1FVJ A;  4ILF A;  3LQ7 A;  2IFQ B;  1K0C A;  4MPG A;  1MEK A;  2FD3 A;  2C4B A;  3MIX A;  4BTY A;  2XBQ A;  4BTX A;  1SD8 A;  4XBX A;  4IBP A;  3DWV A;  4FCZ A;  2X4A A;  4BU4 A;  2DML A;  5IO2 A;  3HJO A;  5AYR B;  2Z7A A;  2VCQ A;  3IC4 A;  1IVW A;  2YP6 A;  3D22 A;  3BJ5 A;  4FH8 A;  1FOV A;  5ABR A;  3S67 A;  5IG0 A;  3ZVJ D;  2KRT A;  2DJ1 A;  2ALB A;  2ZNM A;  5H5S A;  1DBY A;  3FZ4 A;  3ZIJ A;  2V6O A;  4KF9 A;  4IN0 A;  4EBG A;  3IBH A;  2NDO A;  3NOF A;  4F03 A;  2FA8 A;  2GBX B;  2L1S A;  1XOB A;  2E2M A;  3G9B A;  4BIK A;  2IMI A;  1GS3 A;  5IMA A;  3K5T A;  3APO A;  4OFT A;  4PX1 A;  2M7O A;  3KMO A;  3TCO A;  4KZ1 A;  1TK5 B;  3DYR A;  3V99 A;  3RAZ A;  1A2K A;  1N5P A;  4EVM A;  1BRI A;  3K63 A;  4I8B A;  4F9Z A;  2OAC A;  5DQY A;  2P0X A;  3HHV A;  4KE3 A;  1FA3 A;  3WYW A;  4MF6 A;  2BHM A;  3PR8 A;  2GQL A;  1F2E A;  3ZIT A;  1QVF 2;  1GTI A;  4PNG A; 
#chains in the Genus database with same CATH homology
 1VF3 A;  2LTK A;  1GUL A;  1JZW A;  3F9U A;  2DIY A;  1M9A A;  4K0G A;  3ZRE A;  4ZXG A;  1EV4 A;  4JRR A;  2MZC A;  2FLS A;  2WS2 A;  3VPQ A;  4NV2 A;  4TR0 A;  2YN1 A;  2A4V A;  4XHM A;  5ECN B;  5CP1 A;  1XCC A;  2AUV A;  1YEP A;  2M46 A;  1XBS A;  3KEB A;  2MYG A;  2TRX A;  3IV4 A;  3R3E A;  1EEJ A;  5DQS A;  3KXO A;  1EP7 A;  1FOH A;  4JZQ A;  1H4O A;  3DVX A;  4I97 A;  3TRQ A;  4YKG A;  3M9K A;  2KLX A;  2A2P A;  4TVE A;  3GNJ A;  1GSU A;  2CV4 A;  2XHF A;  5J9C A;  4ZB6 A;  4BWQ A;  3C1S A;  5EPF A;  3G7J A;  5H5Q A;  2GZZ A;  3LGC A;  5FT3 A;  2A4H A;  2O85 A;  2TRC P;  4LA1 A;  1TRS A;  1GNW A;  5ECH B;  3CXG A;  4G0L A;  2ON5 A;  4G0I A;  1TXX A;  3TKS A;  4G19 A;  5E59 A;  1G6Y A;  2CZ2 A;  4IQA A;  3FMW A;  1W89 A;  5HQP A;  3E3E A;  2VM2 A;  5JWR B;  4AJ7 A;  5IO0 A;  5G5F A;  3FRC A;  2LRN A;  1B9X C;  4HZ4 A;  1OC9 A;  1UC7 A;  19GS A;  2L59 A;  4JED A;  1M2B A;  1ILO A;  2JZT A;  3TUE A;  3IR4 A;  4EDY A;  1EOG A;  3FR3 A;  1VF2 A;  2C4J A;  4GSS A;  4PGT A;  5F05 A;  1SD9 A;  3KIJ A;  1ACV A;  1YKC A;  2FGX A;  2H72 A;  4XIH A;  1EP8 A;  1SJZ A;  2PN8 A;  3UIW A;  1OYJ A;  2JSZ A;  1YQ1 A;  5DDL A;  2PU9 C;  1M7T A;  3VWV A;  3E9J B;  3H8Q A;  3NIV A;  3M8N A;  5DAK B;  5ECK B;  3QAG A;  2N5B A;  3ISO A;  4N0Z A;  4YH2 A;  3EU3 A;  2VIM A;  4KGI A;  1YJ6 A;  2B5X A;  2OE3 A;  4EIQ A;  5DCG A;  5JCW A;  1U6T A;  2R4V A;  4KUN A;  3VLN A;  3J7Y b;  1QK8 A;  2DJ0 A;  3LSZ A;  4TW5 A;  1BG5 A;  3ZIV A;  4ZB9 A;  4BL7 A;  2F8A A;  4WBJ A;  2R0C A;  3I6A A;  4IGJ A;  4N30 A;  4LLR A;  3H4K A;  4GLT A;  1MD3 A;  2EIQ A;  2DSA A;  2C0G A;  1SJI A;  3IHQ A;  5CO3 A;  1ZYE A;  2Z9S A;  1SKS B;  2FUG 2;  4WF4 A;  1TI3 A;  5ECO B;  3UBL A;  1G7E A;  3QAW A;  3M3M A;  3A2W A;  3L78 A;  3FZ9 A;  2PBJ A;  2DBC A;  2IL3 A;  2CX4 A;  4EO3 A;  3FKF A;  3IK9 A;  3P90 A;  2O8V B;  3O3T A;  4NWY A;  2O89 A;  4IP1 A;  4IJI A;  3ME8 A;  4XS4 B;  4KW6 A;  2OE1 A;  3FW2 A;  1WMJ A;  1URM A;  2H0I A;  5DAK A;  3L0H A;  3SWL A;  1EEM A;  2JAD A;  2I3Y A;  5A5K A;  4EL1 A;  2KOK A;  1F6M C;  2H70 A;  3DRN A;  3DGQ A;  2IIY A;  4N11 A;  3TGZ A;  2HRA A;  3CSJ A;  2G0F A;  2H74 A;  2L4Q A;  5KOX A;  1PD2 1;  2GLR A;  3MAK A;  2NPB A;  2X8H A;  3ERW A;  3F4S A;  2C0F A;  1GSF A;  2I1U A;  1K0B A;  1T4Z A;  4QL9 A;  1MDI A;  5ID2 B;  1F37 A;  2GGT A;  2IWT A;  5HR1 A;  4CY6 A;  2IMK A;  2YWI A;  4BVX B;  3EMX A;  2CAI A;  3HA9 A;  1XW9 A;  3VWU A;  4MP4 A;  2HLS A;  3D0Z A;  4NXI A;  4V1A g;  3TJB A;  3TOT A;  2PWJ A;  1XFL A;  4X1U A;  3MYD A;  3VWW A;  3ZYW A;  3LXZ A;  4F2I A;  5ECR B;  3MNG A;  1YDK A;  2YPM A;  1X9S B;  5IMF A;  1KTE A;  3KM6 A;  1DUG A;  5DJL A;  2X64 A;  4MH3 A;  1EZK A;  5HR3 A;  4XS4 A;  4X4J A;  3TKQ A;  1TK8 B;  2JSY A;  2YWO A;  1PL1 A;  3BBY A;  4V2M A;  2FCH A;  4EIP A;  4KA0 A;  2QKE A;  3TB2 A;  2CVD A;  4K2D A;  5F06 A;  2OKA A;  4K7I A;  3RHB A;  1VF1 A;  1A2M A;  5ECI B;  2KUC A;  1XWG A;  4OWY A;  5HR0 A;  3QAV A;  1OC8 A;  4POB A;  3LW9 A;  5ECQ B;  2H1D A;  2L6D A;  3F63 A;  4CW9 A;  2GTU A;  3GKK A;  4HZ2 A;  1XWA A;  3IXR A;  2V2G A;  2P5Q A;  2X8G A;  3UBK A;  1SKR B;  3ZML A;  4IEL A;  2PMT A;  1NM3 A;  1J08 A;  1WJK A;  6GSX A;  2BTO T;  3BD2 A;  4BVX A;  2GVP A;  2YWM A;  1Q4J A;  4OFM A;  2VL3 A;  4ZL9 A;  1G6W A;  3TRP A;  4GQC A;  4NPB A;  1HD2 A;  1LJR A;  3QOU A;  4E8H A;  2H8L A;  4NHW A;  1SL1 B;  4CDO A;  3CRU A;  5IMV A;  3EIN A;  5IMC A;  1Z5Y E;  1U88 A;  2H0G A;  3ERF A;  4FYB A;  1A23 A;  4PUF C;  2H6Y A;  2UZ8 A;  5GST A;  2RM5 A;  2K6V A;  4ID0 A;  3IRA A;  1LBK A;  2DMM A;  1V98 A;  3ZZX A;  3G7Y A;  2NTO A;  4WR5 A;  3LXT A;  1SK2 A;  3APQ A;  3BCK A;  1PQN A;  4IVF A;  2H6Z A;  3A5W A;  2VLU A;  2CT6 A;  4BVY A;  3L9V A;  3U5R E;  1K0N A;  4LMW A;  1B8X A;  5B6M A;  4MZW A;  4EUY A;  1OVN A;  1ST9 A;  3IOS A;  1XVQ A;  5EY6 A;  3UEM A;  1GSD A;  5ENU A;  3IE3 A;  2IYJ A;  1OE7 A;  3F8U A;  4KCE A;  5KN0 A;  3TJK A;  4L0U A;  3W8J A;  4QL7 A;  5B8B A;  2B5Y A;  2OBK A;  3FYG A;  4PQH A;  5C04 A;  1B48 A;  1T7P B;  3GHA A;  3EE2 A;  2H66 A;  2C3T A;  4HQZ A;  1PRX A;  1XWC A;  1QFN A;  5JWQ B;  2OJL A;  3EPT A;  3HVX A;  1Z6M A;  3ZFL A;  2B3S A;  5A4W A;  1V57 A;  5KN3 A;  4HUA A;  2GZP A;  1AAZ A;  2F8F A;  5ECS A;  5CYY A;  1RK4 A;  2HFD A;  3BOA A;  3UAP A;  3UOM A;  1ZYP A;  1WE0 A;  1RW1 A;  5F07 A;  5J4U A;  1QMV A;  4GF0 A;  4WET A;  3M1G A;  2GSQ A;  1U3I A;  3UAR A;  2BJX A;  4YAV A;  5J3R A;  2VO4 A;  1V9W A;  2VCW A;  2LNT A;  1JFU A;  3QCP A;  3I69 A;  4D73 A;  4MNN A;  5CAX A;  1DE2 A;  3NZN A;  5A4U A;  2WUL A;  1MDJ A;  1ML6 A;  3KH7 A;  1PN9 A;  4KH7 A;  2R5G A;  5C00 A;  2IY2 A;  2GST A;  3GL3 A;  2HT9 A;  3FZA A;  2P5R A;  4ACS A;  5IMD A;  2AB6 A;  4A5P A;  2LJR A;  2J23 A;  4ZBD A;  2RUE A;  5LD0 A;  3WGE A;  2E2G A;  4USS A;  4J56 E;  3HCZ A;  4ECB A;  3KD0 A;  2C1Y A;  4PQI A;  2XPE A;  3WGX A;  4ISD A;  1SK0 A;  5JCG A;  1IYI A;  2OE0 A;  4IQ1 A;  1OC9 B;  1Y6E A;  2PUK C;  3M0F A;  1A8Y A;  1XXU A;  3IHG A;  1LU4 A;  4POL A;  1Y25 A;  4KB3 A;  6GSS A;  2R37 A;  5ELG A;  2M80 A;  4BWS A;  4G9H A;  1V40 A;  1B4Q A;  1FG4 A;  3L4N A;  3GFK A;  3PIN A;  1M2D A;  4ICY A;  1SJ6 A;  5AIV A;  3TRX A;  2LV3 A;  2EIO A;  2G2Q A;  1ON4 A;  3EMP A;  4N0V A;  5B6N A;  2R0P A;  2VUP A;  4IHU A;  1OKD A;  1R26 A;  1A2L A;  1WP0 A;  3RPP A;  5GAN D;  1ZMA A;  4GWR A;  5FWG A;  2OBI A;  2LJA A;  1UN2 A;  4I2U A;  2YAN A;  2YJH A;  4RI6 A;  5EVO A;  3GST A;  4TXV A;  1OAZ A;  4CY8 A;  3CSH A;  1ZL9 A;  1UA5 A;  2CVB A;  1GUM A;  1PX6 A;  4O92 A;  2CZ3 A;  1R5P A;  4K1F A;  2F51 A;  5GZZ B;  4BL7 B;  2GSR A;  4IP6 A;  1BJX A;  3HVV A;  1NHY A;  2B1K A;  3FR9 A;  4OMV A;  2YJ7 A;  4JR6 A;  4HQS A;  4QQ7 A;  2DJ3 A;  2L5O A;  1YF1 A;  4EF0 A;  4MJB A;  4HEA 2;  4ECI A;  4K7N A;  3A2V A;  5JWO B;  3CSI A;  3EWL A;  3PH9 A;  1B4P A;  4TR1 A;  13GS A;  5KN1 A;  3U6V A;  2V1M A;  5EL8 A;  4ECJ A;  4HJM A;  1XOA A;  4ZL7 A;  1ZOF A;  3C8E A;  5ECP B;  1TK0 B;  3KP9 A;  3TDG A;  3Q19 A;  4MMM A;  3A2X A;  1PSQ A;  2HZE B;  3QR6 A;  5IPG A;  5IPH A;  1TW9 A;  4N10 A;  3ERG A;  3RHC A;  1VF4 A;  1TRV A;  2FA4 A;  3C71 A;  4ZBA A;  4L5O A;  2RM6 A;  2GQK A;  2IPA A;  4MJC A;  5G1L A;  1X9W B;  4LL4 B;  6GSY A;  2VCX A;  2VAF A;  1DSB A;  4POM A;  1GTA A;  4L5L A;  3GUR A;  9GSS A;  2V32 A;  4JBB A;  2WZ9 A;  3IA1 A;  3Q74 A;  1HNB A;  2ON7 A;  2FWH A;  2VCZ A;  3HJM A;  2VOC A;  4OO5 A;  1K3Y A;  4HS1 A;  3L9S A;  3QFA C;  3VK9 A;  2WGR A;  3LYK A;  1OC3 A;  12GS A;  4WEY A;  3E0U A;  3FR6 A;  2IMF A;  4ZBB A;  2H75 A;  4V1A p;  3L9U A;  4GQF A;  1R5A A;  1OE8 A;  4XCS A;  3WGD A;  3FHK A;  4MDC A;  3JCM L;  2HRN A;  1GSY A;  4G2E A;  4K7O A;  2HYX A;  3VUR A;  1ERU A;  4HI7 A;  5G2Z A;  2K8S A;  3CBU A;  1C72 A;  1M9B A;  2HZE A;  1GTU A;  5COH A;  2MBS A;  2MMA A;  6GSU A;  3LEF A;  1SKW B;  5DVB A;  5J5N A;  1JLV A;  2C0E A;  1SL2 B;  18GS A;  1XIY A;  1Z7P A;  5CRW A;  3PGT A;  2VL2 C;  4JU5 A;  1BED A;  1TRW A;  4KDX A;  4K6X A;  1FHE A;  3ZRD A;  5G1K A;  3EC3 A;  3GL5 A;  1XZO A;  1DE1 A;  4XS6 A;  4KSO A;  1WWJ A;  4FYU A;  3IDV A;  4O5Q A;  5AGY A;  2O7K A;  1FB6 A;  1SYR A;  3P8W A;  2GS3 A;  2VD0 A;  1JLW A;  1KEB A;  2YCD A;  2DC5 A;  5D9V A;  3D6I A;  4LMV A;  1EOH A;  14GS A;  4AF2 A;  4KCA A;  1XWK A;  4WBR D;  1GSS A;  5KEJ A;  1EV9 A;  1PKW A;  2M72 A;  3WT1 A;  2RUF A;  1GSE A;  2I9H A;  2LST A;  4JE1 A;  1A0F A;  4TRX A;  4IKH A;  2LQO A;  3GIX A;  1GH2 A;  3D5J A;  1YF0 A;  5CRH A;  3F4T A;  3GKN A;  1F3A A;  2N5F A;  3I43 A;  6GSV A;  1EWX A;  2H6X A;  1O8W A;  2WDU A;  4HDE A;  1GWC A;  2KP2 A;  4K9Z A;  1GUK A;  1M99 A;  1N8J A;  5D93 A;  1QXH A;  1Z9H A;  5D8I A;  2JAC A;  4KX4 A;  3KMN A;  1GUH A;  1AIU A;  1JZR A;  3EYT A;  1FW1 A;  1EGR A;  5JCU A;  2QC7 A;  3Q6O A;  3ZLP A;  2H71 A;  3BCI A;  1X9M B;  3VI7 A;  1SK1 A;  4FO5 A;  4BVY B;  4Q5N A;  1O81 A;  3TJG A;  2A2S A;  1BYE A;  4PQ1 A;  1VGL A;  4OCF A;  3KJY A;  2F9S A;  4DSS B;  1JHB A;  1NHO A;  2REM A;  3IK7 A;  1YY7 A;  5LCZ A;  1TKD B;  1KBN A;  1THO A;  1EGO A;  3H79 A;  2EC4 A;  3F3R A;  4O7H A;  3HVS A;  5G31 A;  2FWF A;  4J2F A;  2L6C A;  3EUR A;  4F0B A;  4EKZ A;  5AN1 A;  2GZY A;  1V2A A;  2K8V A;  4TR4 A;  2VLT A;  4NAX A;  2H1B A;  4MF5 A;  2AV4 A;  3TKP A;  2TIR A;  1U3A A;  1BQ7 A;  3KP8 A;  4L8E A;  2MMN A;  1F9M A;  3CYN A;  4XTS A;  10GS A;  1QUW A;  4Z2U A;  1FVK A;  2DIZ A;  2N5A A;  3O76 A;  4IJ3 A;  1GL8 A;  1O8X A;  4AGS A;  4ULX A;  1YZX A;  3F6F A;  2H01 A;  2RLI A;  3OR5 A;  4EXJ A;  2B5E A;  1FO5 A;  2ES7 A;  1ZGN A;  2F3M A;  4D73 B;  4G0K A;  4MPF A;  4TR3 A;  4KSM A;  3LG6 A;  2WFC A;  2WB9 A;  1AQX A;  3HD5 A;  1NSW A;  4OCE A;  5CNW A;  2H19 A;  4AJ6 A;  4MAB A;  1S3C A;  4DSS A;  2H1A A;  4EC0 A;  1PGT A;  3A5I A;  5GAP D;  4PNF A;  3KCM A;  3GA4 A;  4MCU A;  2WJU A;  16GS A;  4MK3 A;  5LNK e;  1X0R A;  2PPT A;  3HJP A;  3HZ8 A;  2PER A;  22GS A;  4XRD A;  4P3Y B;  2CQ9 A;  2QA2 A;  2L4C A;  1GNE A;  5F8B A;  4HU7 A;  4ML1 A;  4IW9 A;  1TDI A;  2PVO C;  2RII A;  1ZZY A;  2FWG A;  4NHZ A;  2GSS A;  3HZ4 A;  2DKI A;  1M2A A;  1PL2 A;  1TOF A;  4K0N A;  4TXO B;  5FHI A;  2YZH A;  5ELA A;  3CTF A;  2R6K A;  3HKR A;  1T3B A;  4HU9 A;  3GKX A;  4XS1 A;  3N9J A;  1PA3 A;  4V2N A;  1GLP A;  5B8A A;  3LOR A;  1K3O A;  2EIR A;  1N2A A;  3UL3 A;  2HSH A;  4GST A;  4CHS A;  1RQM A;  2IME A;  1TU7 A;  4IS0 A;  2XBI A;  1TTZ A;  4K5R A;  3J7Y k;  4YQU A;  4PUA A;  2C8U A;  1NW2 A;  5INY A;  17GS A;  1O7U A;  4PXO A;  1KNG A;  5G5E A;  1AC1 A;  5CRG A;  1TRU A;  20GS A;  2O87 A;  2YV7 A;  1ERW A;  3DD3 A;  1GSQ A;  1ZYQ B;  3GN3 A;  2FHE A;  1WOU A;  3C7M A;  4OD7 A;  2C3N A;  5IOX A;  3GX8 A;  2YV9 A;  3HY2 A;  2YZU A;  2V6K A;  2P0G A;  4O5U A;  2C80 A;  1GLQ A;  1A2J A;  3D4T A;  5E4W A;  4POK A;  1CQH A;  4DEJ A;  4Z2T A;  3IAM 2;  1I5G A;  4ZL8 A;  5G30 A;  3DIE A;  4XRA A;  1XWB A;  3TOU A;  2GT5 A;  2VCT A;  2MMO A;  3ME7 A;  3KTB A;  3IPZ A;  4TXO A;  2R3X A;  1WRY A;  4YAP A;  4MJA A;  3TJJ A;  3GH6 A;  1YKA A;  4MZB A;  4Q5R A;  2IFQ A;  2VL9 A;  1CQG A;  3ZVJ A;  2LJK A;  1PN0 A;  3W8S A;  4DSQ A;  4Z2R A;  2NVL A;  4X43 A;  4TR1 B;  3F3Q A;  1M0U A;  2L5L A;  3HXS A;  2QSI A;  3FEU A;  1G7O A;  1ZCP A;  4NV5 A;  3UMA A;  4O32 A;  2GT6 A;  2MMZ A;  3D4M A;  3F4R A;  3LYP A;  4OO4 A;  2VLV A;  1E2Y A;  1ZYN A;  3W6G A;  4WF5 A;  1TI1 A;  3FK8 A;  2VD1 A;  1GTB A;  3VFI A;  1HQO A;  3H1N A;  1K3L A;  3DEX A;  2B7J A;  1AQW A;  2HI7 A;  4FYC A;  3GRX A;  3APS A;  3I9V 2;  4Q5Q A;  4KND A;  5J9B A;  2WCI A;  4X0X A;  3UVT A;  3VWX A;  4DVC A;  3F0I A;  2X8C A;  5ECM B;  1MDK A;  4FQU A;  5IMZ A;  1R4W A;  3TKS C;  1K0A A;  1XVW A;  2K9F A;  4MH2 A;  1BX9 A;  2YNX A;  2R0G A;  2B6M A;  4NMU A;  4WR4 A;  4TN8 A;  3KH9 A;  4K5S A;  1GP1 A;  2JZR A;  5D9W A;  4JR4 A;  2X99 A;  1XPV A;  1USB A;  2LEG A;  2DJJ A;  5F0G A;  4K2X A;  2WRT A;  4F0C A;  1SU9 A;  1ABA A;  1H75 A;  2DJK A;  4GTU A;  4MLY A;  1HNC A;  1PKZ A;  2ZCT A;  2VCV A;  5AIX A;  7GSS A;  1UVZ A;  4MA9 A;  1V58 A;  3VI5 A;  4O5R A;  2YOI A;  1Q98 A;  5L71 A;  3WT2 A;  2BMX A;  2OA7 A;  2PVQ A;  5HFG A;  2AHE A;  4E8E A;  2IJY A;  2C3Q A;  3LFL A;  2AAW A;  4F82 A;  2V41 A;  3RDW A;  1S3D A;  2CAQ A;  2QGV A;  4H86 A;  4K8M A;  1J0F A;  1WPI A;  4J57 E;  3GUS A;  3V1W A;  2DKH A;  3EVI A;  4PUR A;  4V2L A;  1K0M A;  4KDU A;  1OKT A;  4WXT A;  3R2Q A;  1U87 A;  2R2J A;  2H1G A;  1IYH A;  1SL0 B;  4YKF A;  1I9D A;  1JZD A;  3TKR A;  3G7I A;  3CTG A;  3D21 A;  3P2A A;  3KTL A;  5HFK A;  5HFI A;  5AIS A;  3KZQ A;  2A2R A;  2LNS A;  3IAS 2;  4RI7 A;  3ED3 A;  3UVH A;  1AW9 A;  3WD6 A;  4GSN A;  4ML6 A;  1K0O A;  5H5R A;  2JU5 A;  3GX0 A;  1YEX A;  1R7H A;  1FAA A;  3N5O A;  1A24 A;  2DJ2 A;  1TU8 A;  1QGV A;  1TP9 A;  1BAY A;  3FZ5 A;  1S3A A;  11GS A;  3HYP A;  4GCI A;  4KDY A;  4I2T A;  3RBT A;  3DXB A;  4EDZ A;  3CRT A;  2FWE A;  1HNA A;  1G0T A;  4BA7 A;  4Z7X A;  3QFB C;  1QQ2 A;  1XW5 A;  2XC2 A;  1T00 A;  3QPM A;  2LRT A;  2HRF A;  2VL2 A;  3GV1 A;  4WKW A;  2HSM A;  3RPN A;  2OAD A;  2CVK A;  2LKU A;  5HR2 A;  3HDC A;  2H30 A;  2MBT A;  3GYK A;  4LL1 B;  2E0Q A;  1X5E A;  3A3T A;  3H93 A;  1Z7R A;  4GRF A;  2B1L A;  1X5C A;  3GKM A;  1FB0 A;  2P31 A;  2H73 A;  1E6B A;  4HJ2 A;  1W4V A;  2LRC A;  3S9F A;  3ZTL A;  2JL4 A;  5IQY A;  1O85 A;  4OFN A;  2K18 A;  3EU4 A;  5D9X A;  1AXD A;  3TKS E;  3LJR A;  4GXZ A;  2FNO A;  2HRK A;  4FIW A;  3TJF A;  4EE0 A;  2CX3 A;  6GSW A;  2J9H A;  2XPD A;  2HNL A;  1HYU A;  3PPU A;  4MF7 A;  5DBQ A;  5DJM A;  5CRE A;  3MSZ A;  3ZFB A;  5D73 A;  2I81 A;  1Z6N A;  2H76 A;  3M9J A;  1X5D A;  2DLX A;  5DAL B;  3QDN A;  3P7X A;  1O73 A;  3K8N A;  4TOP A;  5CRD A;  1Z3E A;  3UJ1 A;  4MZC A;  2HE3 A;  4ZB8 A;  1PMT A;  4DSR A;  1B9Y C;  3O6T A;  3GTU B;  3LWA A;  4MJE A;  1GRX A;  1J9B A;  4PTS A;  4I5Q A;  2LS5 A;  2VM1 A;  1A8L A;  3VPT A;  3DVW A;  5IOW A;  1T1V A;  5BMU A;  2NBS A;  4RQR A;  2PGT A;  3MWH A;  2IN3 A;  1O6J A;  2HZF A;  4RQX A;  4G10 A;  3F6D A;  5ECL B;  5ID2 A;  2HXK A;  1MD4 A;  2GDR A;  3ZL5 A;  2FY6 A;  5DCH A;  2QA1 A;  3C1R A;  1VRS D;  4L0W A;  3GH9 A;  2KHP A;  1AUC A;  1MTC A;  4ZIL A;  2KP1 A;  3DML A;  1XW6 A;  3GMF A;  5IIZ A;  3ZMK A;  5D96 A;  3CMI A;  5GSS A;  5KOW A;  2LUS A;  4I6X A;  5B7C A;  5DAL A;  3KGK A;  8GSS A;  2AJQ B;  4HOJ A;  4KAE A;  1JZO A;  2HSY A;  1T4Y A;  3QMX A;  4AJ8 A;  3US3 A;  4BPY A;  2C0D A;  4ECC A;  1A0R P;  2L57 A;  3GTU A;  5BRT A;  3MDK A;  3AY8 A;  2YWN A;  5KN2 A;  1TJD A;  5D9T A;  3SBC A;  3Q18 A;  2H0H A;  1ERV A;  4YQM A;  1ERT A;  1THX A;  3C73 A;  1AQV A;  2JZS A;  2CA8 A;  3DKS A;  2I4A A;  1SYX A;  3IC8 A;  4Q5F A;  4RUV A;  2B7K A;  6GST A;  1PX7 A;  2LQQ A;  1SEN A;  5A4V A;  2E7P A;  3GSS A;  4TKY A;  5IM9 A;  3FY7 A;  2IMD A;  2GQM A;  2D2Z A;  1F3B A;  4ZIJ A;  3QD9 A;  2ZUP A;  1T8E B;  5J41 A;  2AYT A;  4YQV A;  1WIK A;  2X49 A;  1K0D A;  1FVJ A;  4ILF A;  3LQ7 A;  2IFQ B;  1K0C A;  4MPG A;  1MEK A;  2FD3 A;  3MIX A;  2XBQ A;  1SD8 A;  4IBP A;  3DWV A;  2X4A A;  2DML A;  5IO2 A;  3HJO A;  2VCQ A;  3IC4 A;  2YP6 A;  3D22 A;  3BJ5 A;  4FH8 A;  1FOV A;  5ABR A;  3ZVJ D;  2DJ1 A;  2ALB A;  2ZNM A;  5H5S A;  1DBY A;  3FZ4 A;  3ZIJ A;  2V6O A;  4KF9 A;  4IN0 A;  3IBH A;  2NDO A;  3NOF A;  4F03 A;  2FA8 A;  1XOB A;  2E2M A;  3G9B A;  2IMI A;  5IMA A;  3APO A;  4OFT A;  4PX1 A;  3KMO A;  3TCO A;  1TK5 B;  3DYR A;  3RAZ A;  4EVM A;  4I8B A;  4F9Z A;  2OAC A;  5DQY A;  3HHV A;  4KE3 A;  3WYW A;  4MF6 A;  3PR8 A;  2GQL A;  1F2E A;  3ZIT A;  1GTI A;  4PNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...