4ILFA

Crystal structure of dsbc r125a from salmonella enterica serovar typhimurium
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
AMDPEFMDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPAQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the periplasmic disulfide-bond isomerase DsbC from Salmonella enterica serovar Typhimurium and the mechanistic implications.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein DsbC
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 4ilfA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ilfA02
2OKAA 3RPPA 2P0GA 1FVKA 3GIXA 1M9BA 1YY7A 5IMVA 1EP8A 5B8AA 1IYHA 2B5YA 1AQWA 4GSTA 3TRPA 3ZRDA 4J2FA 5F05A 4MZBA 3IAS2 1V98A 4EDZA 1YF0A 5ENUA 3H1NA 5DQSA 3TJBA 3RBTA 3IOSA 4F0BA 1K3YA 1XFLA 1Z9HA 3GL5A 2MMOA 2D2ZA 3EWLA 1GUKA 3F8UA 3HJMA 3I43A 4TN8A 3E0UA 2V1MA 2I9HA 4FYCA 4MZWA 1QMVA 3ERFA 1K0NA 1F2EA 3KTBA 1SK2A 1F37A 2JL4A 2HLSA 4P3YB 3W8SA 1G6YA 4ML6A 4JBBA 2YOIA 3GKNA 4ZXGA 1GL8A 2VUPA 4K0NA 1U6TA 3DVXA 3NOFA 6GSXA 2HFDA 3IXRA 1H75A 3M0FA 3US3A 5LD0A 3VPTA 4IHUA 5HQPA 1ST9A 4N11A 2PPTA 4Q5QA 3UIWA 2OBIA 4IJIA 4IJ3A 2VL9A 3RAZA 3D6IA 4WBRD 4MF7A 3F63A 1PSQA 3I69A 3M3MA 4BWSA 2O87A 5ELGA 1AW9A 2CAQA 1M2DA 2LRTA 1WRYA 4V2LA 4LA1A 2L4QA 6GSYA 3L78A 3PH9A 4E8HA 2KUCA 1XWAA 5JWRB 3O6TA 3WT2A 2RUEA 11GSA 2CVBA 4BL7A 1PX7A 1U88A 1J08A 2XBIA 5IO2A 2I4AA 1PKWA 2H72A 2V41A 3GN3A 1ZCPA 2JZSA 1GSDA 1EGOA 1YDKA 1QGVA 2IJYA 2X8GA 2VM1A 2H8LA 1V2AA 2HZEA 4IQ1A 3IK7A 2IFQA 1O8WA 2I81A 4DEJA 3V1WA 4GXZA 2VCZA 3IDVA 22GSA 1K0BA 1MTCA 3HVSA 1HNBA 4H86A 2LEGA 5E59A 3TRXA 3H93A 2YNXA 3HKRA 4MH3A 3MSZA 3TJKA 2YV9A 4PNGA 4O5RA 5DCHA 4AJ6A 2HI7A 3K8NA 4IW9A 1PA3A 5J9BA 2LJRA 1TK8B 4JZQA 2ZNMA 1SKRB 2JZTA 3HXSA 1ZYEA 2VCWA 3QMXA 1FG4A 5DAKB 3ZZXA 3J7Yk 5IIZA 4RQRA 2DMLA 3DD3A 5G31A 3L9UA 1GTUA 5C00A 4XS4A 1GSEA 5CREA 1U3AA 2YCDA 2B5XA 4MDCA 1OKTA 3FZ5A 3Q6OA 1G6WA 5A5KA 3QD9A 4MH2A 3CTGA 3FZ9A 1MDIA 1TOFA 1TKDB 1PMTA 3Q74A 3GH9A 1M9AA 5G2ZA 1M99A 5G5FA 4I5QA 5HR3A 1BX9A 2L5LA 3OR5A 3EINA 1XZOA 2E2MA 2RM5A 2YANA 3M1GA 3M8NA 1LBKA 5AIXA 1X5EA 2B1KA 2DJ3A 4QL7A 4N10A 3H4KA 2K18A 1RK4A 2HRFA 4ZBDA 5DDLA 1E2YA 4V2NA 4FO5A 3GA4A 4GWRA 5ELAA 2IMDA 2P5RA 4Q5RA 3ZMKA 4ZBBA 4DSSA 4ZL8A 1QQ2A 4PQHA 4HQSA 1V9WA 2C3QA 5JCGA 3QAGA 2WGRA 1XWGA 4IS0A 1TJDA 2AHEA 1AQVA 3FR3A 5D9TA 6GSWA 4D73B 2VD0A 2H19A 5B6MA 3TRQA 4ZB8A 2VIMA 3GTUB 4L0UA 4HS1A 2DBCA 5G30A 4F0CA 5DALB 10GSA 4KGIA 4MABA 1OC9A 4N0ZA 1RW1A 3TKSE 3U5RE 3EE2A 4ZL9A 3VWVA 1A8YA 3TJJA 1ZOFA 4AF2A 4V1Ap 8GSSA 2IMEA 2JADA 5J9CA 4RI7A 3F6FA 3FZAA 1GSYA 2E7PA 3VFIA 4OFTA 1K0OA 4YAVA 1Z3EA 3BOAA 1MD4A 3F9UA 1O73A 4HOJA 3M9KA 1SU9A 1AQXA 4MCUA 4NHZA 4TOPA 5EVOA 4KW6A 5CRDA 2H76A 2L59A 4HEA2 6GSVA 1SYXA 2OE3A 4KCEA 3UBKA 3LG6A 3WGXA 2FGXA 5B8BA 2QC7A 1SD8A 3WGEA 4KB3A 3TKSA 5D9VA 4CW9A 3QAWA 1AXDA 1VF4A 2X99A 1A23A 3EMPA 3M9JA 3IC4A 3C1RA 2H66A 2PBJA 3GRXA 1M0UA 1GSSA 1MEKA 2B7JA 2H0HA 2OE0A 3ZFLA 4XS4B 2OA7A 1GTAA 2F9SA 1G7OA 3LQ7A 2C0EA 4L0WA 3I9V2 1GH2A 4GSSA 1G0TA 4RQXA 4KDXA 2O7KA 4ECBA 2L57A 2R4VA 3BJ5A 2K9FA 3KJYA 2CT6A 2XPDA 2GZZA 4WF5A 1XOAA 5CRGA 1GRXA 1YQ1A 2RUFA 1JLWA 1I5GA 2N5BA 3ZTLA 3ME8A 4PUFC 3TKSC 3KP9A 3UARA 4X1UA 3C7MA 2GSTA 3CXGA 2ON5A 2IY2A 2GDRA 5GSSA 4HZ2A 2NTOA 3DRNA 3A3TA 1PD21 1W89A 1K0CA 2ON7A 2FWHA 3APQA 3D4TA 2KOKA 4WKWA 2C8UA 3APOA 2YWMA 2LQOA 3HZ4A 1JZRA 3ZITA 3HHVA 2M80A 2WULA 2DLXA 4L5OA 4EL1A 3GKKA 2M72A 2DJ1A 2H1AA 3ZLPA 3VWUA 2EIOA 3FHKA 1TTZA 3LXTA 2AJQB 2VM2A 1X9SB 1GLPA 5IO0A 1XPVA 2PVQA 3QCPA 1OC8A 1Z7PA 2IMKA 2L6CA 3F6DA 3IK9A 4I2TA 1TXXA 2H01A 3A2VA 1XWBA 4IP1A 1GUMA 2PERA 1X9MB 2HSYA 4EO3A 4F82A 2WS2A 4NWYA 4HU7A 1N2AA 2YZUA 20GSA 1V58A 2VO4A 3GTUA 1W4VA 5ECOB 3VI7A 5G5EA 3BCIA 4NMUA 4LMWA 3R2QA 4ZBAA 5FHIA 2O85A 4JR4A 1VRSD 2DJKA 2VCXA 4N0VA 4BVXA 2PN8A 2GZYA 5D9WA 2FA8A 3WT1A 1M7TA 3NZNA 1B48A 2AB6A 3ZMLA 4AJ8A 4OD7A 2LUSA 5HFKA 2VCTA 4NV5A 5D73A 2ES7A 4O32A 1T1VA 5KN1A 3O3TA 4MJAA 1FHEA 4KH7A 3KGKA 1GNEA 1WIKA 1JFUA 1WE0A 4IELA 4NXIA 5EPFA 4X0XA 1UC7A 3CSIA 1XW5A 2OADA 5D9XA 2R6KA 4F03A 5J41A 3TUEA 1G7EA 3VPQA 3FZ4A 1SJIA 5HFIA 2A2RA 4YH2A 2CVDA 3LSZA 2XPEA 4MF6A 2VL2A 3QAVA 1PL1A 2C0GA 2CQ9A 2EIQA 2VL2C 1YZXA 2WCIA 2L6DA 4TXOA 3IPZA 1GNWA 2GT6A 1GUHA 2KP1A 4IBPA 4K9ZA 2FWFA 4WEYA 4XIHA 4TR1B 2GZPA 3GYKA 3CRUA 2MMNA 3HVVA 2XC2A 5C04A 1X9WB 2H6ZA 1E6BA 2GSSA 3LORA 2DSAA 2HZFA 2NBSA 1XW6A 3KEBA 1F9MA 3KM6A 2N5AA 1Y6EA 1PKZA 2P31A 4I97A 5ECLB 3IR4A 4JU5A 2VCQA 1GTIA 1TRWA 1Z6NA 2G0FA 1VGLA 2H75A 3Q19A 5H5RA 3TB2A 5H5SA 1GSUA 4MK3A 2VLUA 3DYRA 1XVWA 2HSHA 4TR0A 2I3YA 2H74A 1QFNA 2GT5A 2IN3A 1OC9B 2LS5A 1ZYQB 4WBJA 2DC5A 1DBYA 4EC0A 2NDOA 1YF1A 3ZIJA 1DE2A 3P8WA 2IPAA 4KCAA 1V40A 1ERVA 2IMIA 1EOHA 4FYBA 4E8EA 3KIJA 1HNAA 5CRHA 1CQGA 1KNGA 1AUCA 5F0GA 3IBHA 3UEMA 1U87A 2J23A 1XW9A 1B4PA 5KN3A 1GULA 3VURA 2O8VB 3DIEA 3C71A 1THOA 4L5LA 4MP4A 2LNTA 3GV1A 3HJOA 3LYKA 1R4WA 4KAEA 5IOWA 4FYUA 5FT3A 1UA5A 3DWVA 3G7IA 5HR0A 4YQVA 5D93A 4EVMA 1A2MA 4ECIA 2H71A 1EV9A 3LEFA 3AY8A 3FK8A 5KN2A 1MDKA 3ED3A 3TDGA 3JCML 4I6XA 1A2JA 5L71A 2TIRA 3QOUA 3N5OA 2OJLA 1FOVA 5ECSA 1S3AA 5DVBA 5LNKe 3SWLA 2KP2A 2AYTA 1OKDA 2BMXA 4BA7A 4TXOB 5F07A 1EOGA 2WFCA 3HY2A 1GTBA 3TKPA 3L9VA 4POBA 2F3MA 2HXKA 1KBNA 2EC4A 4Z7XA 1F3BA 3DGQA 12GSA 3F3QA 1NHYA 1ZGNA 1F6MC 2MBSA 1SD9A 5DQYA 2X8CA 4JRRA 4FH8A 1OE7A 1FB0A 1I9DA 2C4JA 4MPFA 4EXJA 2YJ7A 1SJZA 1PGTA 4F2IA 5D96A 4BPYA 1JZWA 2LJAA 1JLVA 3ERWA 4K7NA 3TOUA 1TK0B 4G9HA 2R2JA 4HQZA 4DSSB 3DVWA 5J5NA 3MNGA 4ISDA 5HFGA 1T7PB 3HYPA 4BWQA 5ECPB 3HVXA 4PXOA 3TOTA 2ZUPA 3CRTA 3ZVJD 2FD3A 3W8JA 3WYWA 2FY6A 1Q4JA 2B3SA 1FB6A 2CAIA 2Z9SA 3GNJA 3FR9A 2A4VA 5JCWA 4AJ7A 4KX4A 4XS6A 1AIUA 4PQ1A 3D4MA 3KZQA 3E9JB 2J9HA 4Q5NA 5CNWA 2H6YA 1PQNA 2V6KA 4OO5A 1EGRA 2IL3A 2VCVA 2VLVA 1K3LA 2IWTA 2F51A 2H1GA 1WOUA 4HZ4A 1K0DA 5ECKB 3EVIA 5DJLA 3A2WA 3KH7A 4GTUA 5E4WA 1ERUA 2LRCA 2CX3A 3KXOA 3ZFBA 4LLRA 2OACA 3D22A 1XBSA 1KEBA 1VF3A 2GGTA 5D8IA 4X43A 1PX6A 3DMLA 3GX8A 2LRNA 3UL3A 1N8JA 2IYJA 3BD2A 5INYA 3W6GA 3HA9A 2YZHA 2H30A 2RM6A 3GKXA 5DCGA 4HJMA 4TR3A 3FRCA 5JWOB 3UJ1A 3SBCA 3APSA 1S3DA 2YWOA 2GTUA 1VF1A 2V6OA 2HNLA 5GAND 1MDJA 3MAKA 4POMA 4ZB9A 5KEJA 2H0IA 1ON4A 1BG5A 3F3RA 2VOCA 1V57A 1U3IA 1XVQA 1FVJA 4IVFA 4NPBA 4V1Ag 3HJPA 3F4SA 1SK1A 5IM9A 2AV4A 2I1UA 2E2GA 2B5EA 2R3XA 1XOBA 5DALA 2EIRA 2H70A 4WR5A 3DXBA 5J4UA 1BYEA 4PURA 3C73A 5EY6A 2WB9A 2NPBA 4L8EA 4EUYA 2VLTA 1SYRA 1YEPA 1EZKA 3D21A 3G7YA 1XWCA 2G2QA 2QGVA 3VWXA 3HZ8A 4OMVA 4TR1A 4POKA 4GQFA 2AAWA 3IV4A 3LYPA 3UMAA 5G1LA 3UOMA 2B6MA 4TRXA 3RHCA 4CHSA 3QDNA 3PR8A 1SJ6A 5ECIB 2HE3A 4GRFA 1A24A 2YWIA 5B6NA 4HUAA 4J57E 4MJCA 3FW2A 1SL1B 4JE1A 2V2GA 2H0GA 4J56E 3E3EA 3LXZA 3IHQA 2DIZA 2LTKA 3A5WA 2YWNA 4HJ2A 1X5CA 5ECMB 2GLRA 4KNDA 1R26A 5CRWA 3U6VA 5IQYA 4IKHA 5J3RA 1ZZYA 2C80A 1XCCA 3VLNA 4BVYA 3BBYA 1GP1A 1TI1A 4XRAA 2XBQA 1HD2A 2JU5A 4TVEA 4DSQA 1VF2A 3BCKA 4ZIJA 4QQ7A 2DMMA 3CSJA 3GKMA 2K6VA 2GQLA 2PMTA 1O81A 4WETA 4HU9A 4YAPA 4GQCA 1NHOA 2TRXA 2C3NA 2M46A 2MZCA 4LL1B 1IYIA 5HR1A 4NV2A 1O85A 1H4OA 5ECRB 4F9ZA 1X0RA 4ZILA 4GLTA 3D5JA 1A8LA 4EDYA 5IMFA 2KHPA 2LQQA 4KUNA 4ILFA 1NM3A 1GLQA 3G7JA 1BQ7A 4LMVA 4PX1A 4NHWA 3WD6A 3IE3A 1EEJA 3L4NA 2R37A 3RPNA 2H6XA 1JZOA 1O6JA 2F8FA 4XCSA 1TRVA 3FR6A 1KTEA 4XTSA 2MBTA 1UN2A 5CAXA 3H79A 4ID0A 4KSMA 2LSTA 2WRTA 2L4CA 2E0QA 2GSRA 4GCIA 4EF0A 1S3CA 4V2MA 1FW1A 2IFQB 3P7XA 1T00A 1YJ6A 4RI6A 2GSQA 2QKEA 1R7HA 4PUAA 4ECCA 4IP6A 4KSOA 1DUGA 3GL3A 3J7Yb 1TI3A 2OBKA 1AAZA 2GS3A 2B1LA 3O76A 1A0RP 4YQMA 1JZDA 2GQKA 1T8EB 3HDCA 3FEUA 5COHA 1HQOA 3EMXA 4PGTA 3IRAA 2FA4A 1MD3A 3TKRA 5IPGA 1CQHA 6GSSA 1Z7RA 1OAZA 1Q98A 3IA1A 1BJXA 3KMNA 1SK0A 4MZCA 4KA0A 3C1SA 4YQUA 1TRUA 4MJBA 3UVHA 1SL2B 2FLSA 1K0AA 2FCHA 1URMA 1GSFA 1WMJA 1O8XA 5F06A 4MPGA 2CZ3A 1T4ZA 1NSWA 5G1KA 3CYNA 4EE0A 4N30A 2LKUA 4TW5A 1OE8A 3EC3A 4AGSA 1USBA 4WXTA 5KN0A 4GSNA 3EU4A 2R5GA 5ABRA 2YV7A 3RHBA 1PL2A 1TU7A 5ID2B 1TK5B 16GSA 2CA8A 18GSA 4OO4A 1OC3A 2YP6A 1WPIA 1J9BA 4FIWA 1LJRA 2L5OA 1B9XC 2F8AA 4MMMA 1SKSB 4IN0A 4HDEA 4XRDA 1ACVA 3ZIVA 4ECJA 3L9SA 5GSTA 14GSA 2YN1A 2NVLA 1EEMA 2K8VA 4KDUA 3ZREA 2MMAA 2C3TA 3P90A 4TR4A 2JSZA 5DAKA 4OWYA 5AIVA 4EKZA 5ID2A 3FYGA 1BEDA 3LWAA 1EV4A 2X8HA 2VD1A 5JWQB 3KP8A 4ZL7A 2BJXA 1M2AA 1LU4A 3GUSA 2C0FA 4ACSA 1ILOA 4LL4B 2LJKA 4POLA 3TGZA 4TKYA 5A4WA 1T4YA 5A4VA 2O89A 1ERTA 2H1BA 1Y25A 5FWGA 3MWHA 3EU3A 3QPMA 5ECHB 19GSA 1OYJA 3ZL5A 2CV4A 1THXA 2CX4A 5CO3A 1PRXA 2H1DA 5IPHA 1Z5YE 1B9YC 6GSUA 5AN1A 1DSBA 1A2LA 3GSTA 3QFBC 3P2AA 3L0HA 1F3AA 1XIYA 2HZEB 4OFNA 1TRSA 2YPMA 5B7CA 1SKWB 17GSA 3UVTA 5AGYA 2RIIA 2HYXA 3H8QA 3DKSA 4IGJA 3DEXA 2PU9C 4K2DA 4K8MA 2FWEA 4JEDA 1BAYA 2FUG2 4CDOA 1HNCA 1UVZA 1J0FA 2WDUA 2JACA 4G10A 2ALBA 4I2UA 1EWXA 3ZVJA 1K0MA 1DE1A 2IMFA 4O7HA 2RLIA 2VAFA 4OFMA 2C1YA 2CZ2A 3QR6A 2ZCTA 2PGTA 4XS1A 2A2SA 3VK9A 3TJGA 5DBQA 4NAXA 4TXVA 3GX0A 3ZYWA 3CBUA 4RUVA 3KD0A 4MJEA 1R5AA 3UBLA 3D0ZA 3QFAC 2QSIA 3G9BA 1A0FA 1M2BA 1QK8A 3NIVA 1QXHA 2DIYA 5AISA 5IMDA 3GURA 2K8SA 2AUVA 2DJ2A 1XWKA 2V32A 5IMZA 1PN9A 1ABAA 3N9JA 2N5FA 4Q5FA 3VWWA 2OE1A 3HD5A 5DJMA 3KH9A 3Q18A 3WGDA 2FWGA 1TW9A 1WJKA 3LFLA 1QUWA 2B7KA 2BTOT 1SENA 4MLYA 3VI5A 4WR4A 3FY7A 3EURA 5IMAA 1ZL9A 1NW2A 2JZRA 1YKAA 2X64A 4D73A 6GSTA 2GVPA 5F8BA 3TCOA 2REMA 1WP0A 3S9FA 3CTFA 2TRCP 3F0IA 1R5PA 1HYUA 5CYYA 5IMCA 3F4TA 1TDIA 4ZB6A 3TJFA 2VL3A 3ERGA 2DJ0A 3PGTA 3TKQA 1YEXA 2XHFA 3ISOA 3FKFA 2CVKA 3EYTA 3KTLA 5JCUA 4WF4A 3GSSA 1OVNA 2LV3A 1ML6A 1GSQA 3HCZA 1ZMAA 4PQIA 3UAPA 2KLXA 2LNSA 4KE3A 4G19A 2DJJA 1TU8A 4IQAA 4K1FA 2H73A 13GSA 1RQMA 1FAAA 3CSHA 1AC1A 4JR6A 1C72A 3LGCA 3KCMA 4HI7A 1Z6MA 1WWJA 2MMZA 2WJUA 3F4RA 4DVCA 1O7UA 5HR2A 5LCZA 3LJRA 3CMIA 9GSSA 5IOXA 3I6AA 4QL9A 5GZZB 1GWCA 3GHAA 3A2XA 5A4UA 4ULXA 5GAPD 2FHEA 3IAM2 2C0DA 1XXUA 4K6XA 4MA9A 4GF0A 3GH6A 3GFKA 1B4QA 2HT9A 4OCFA 3RDWA 1B8XA 5CP1A 2YJHA 1YKCA 4K7OA 5ECQB 1ERWA 4O92A 7GSSA 1SL0B 2PWJA 1T3BA 2IIYA 3PINA 2PUKC 2MYGA 4XHMA 2JSYA 4OCEA 2GQMA 1X5DA 3MDKA 1TP9A 4I8BA 4K0GA 3ME7A 2WZ9A 2P5QA 4PNFA 4KDYA 2HRNA 2PVOC 5EL8A 4MF5A 4ML1A 3C8EA 4G2EA 1JHBA 2FNOA 5ECNB 5H5QA 3GMFA 1EP7A 4DSRA 1FO5A 3KMOA 4K7IA 1K3OA
chains in the Genus database with same CATH superfamily
2OKAA 3RPPA 2P0GA 1FVKA 3GIXA 1M9BA 1YY7A 5IMVA 4FMCA 1EP8A 5B8AA 3UL5A 1IYHA 2B5YA 4WWUC 1AQWA 4GSTA 3TRPA 3I563 3ZRDA 1BVIA 4J2FA 3DGMA 4K1UA 5F05A 4MZBA 3IAS2 1V98A 4EDZA 1YF0A 5ENUA 1JB5A 3S28A 3H1NA 5DQSA 3TJBA 1BSEA 3RBTA 3IOSA 4F0BA 3EE1A 1K3YA 3WHOA 1XFLA 1Z9HA 1NB5I 1BSCA 2MMOA 2D2ZA 3EWLA 3GL5A 5IF6A 1GUKA 3F8UA 3HJMA 3I43A 4TN8A 3EQQB 4Z2TA 1LVNA 3E0UA 2V1MA 2I9HA 4FYCA 3WR2A 4MZWA 1QMVA 1FGMA 3ERFA 1K0NA 3GAXA 1F2EA 3KTBA 1JV2B 1SK2A 1F37A 2JL4A 2HLSA 3IJEB 4P3YB 3W8SA 1M1XB 2Z6BA 1G6YA 4ML6A 5HGRA 1KQS2 4JBBA 2YOIA 3GKNA 4ZXGA 1GL8A 4K90B 2CG0A 1A67A 2VUPA 4K0NA 1F8NA 1U6TA 3I553 2F86B 3DVXA 3AMOA 3NOFA 6GSXA 2HFDA 2UUGC 3IXRA 1H75A 3HIGA 1SJWA 6STDA 3M0FA 1FUTA 1IT8A 3US3A 5LD0A 3VPTA 2Y73A 4KT3B 4IHUA 5HQPA 1ST9A 4N11A 5JPPA 2PPTA 1BSDA 3EJVA 1RGEA 2OTJ3 4N3VA 4Q5QA 2W9PA 1VQ53 3UIWA 3GZYB 2OBIA 4G0LA 4MMZB 4IJIA 2CC3A 1RCLA 4IJ3A 2VL9A 4EXRA 3RAZA 3D6IA 4WBRD 4MF7A 3F63A 1PSQA 2LYXA 3I69A 3M3MA 4BWSA 3JUOA 5D81A 1LOYA 2O87A 5ELGA 1AW9A 5IERA 2CAQA 2CFLA 4HSCX 4IT7A 1OPYA 1MWTA 1M2DA 2LRTA 1WRYA 4XBXA 4V2LA 4LA1A 5LC6A 2L4QA 6GSYA 1Q7HA 2I9WA 3L78A 2E2VA 1YGWA 5JPUA 1L5GB 2W9QA 3VSYA 2KUCA 3CCU3 3PH9A 1XWAA 4E8HA 5KOWA 1IVUA 5JWRB 2SBLA 1K41A 3O6TA 3WT2A 2RUEA 11GSA 1UW1A 2CVBA 5IEPA 4BL7A 1PX7A 5KP4A 1W00A 2O3OA 3LTBA 3EHCA 2CWVA 1U88A 4EV2A 1J08A 2XBIA 5IO2A 5IG3A 2ML6A 2I4AA 1MGWA 1PKWA 2H72A 2V41A 3F8HA 2W56A 3GN3A 1ZCPA 2JZSA 2FXTA 1GSDA 1B27A 1EGOA 3RDEA 3LXUX 1YDKA 1YIJ3 1QGVA 2IJYA 2X8GA 2VM1A 1M3JA 2H8LA 1V2AA 2HZEA 3OV4A 2IUKA 4IQ1A 1KD14 3IK7A 2IFQA 1IQXA 1O8WA 2I81A 4DEJA 5EEOA 3V1WA 4GXZA 4LEHA 2GEXA 2VCZA 3IDVA 5KP1A 1UI7A 2GU3A 22GSA 1K0BA 3CCS3 4R1KA 2BT3A 1MTCA 3HVSA 1HNBA 3G8ZA 2XGLA 4H86A 2LEGA 5E59A 3MIXA 1AVLA 3TRXA 5AYSC 2XH9A 3H93A 3NHXA 2YNXA 3HKRA 1X1YA 3HI7A 3G16A 1Q7Y4 4MH3A 3MSZA 4BVXB 2CX0A 1ZX2A 4AKYA 3TJKA 1EA2A 2YV9A 3DGLA 3GSPA 4EIQA 4PNGA 4O5RA 5DCHA 2CX1A 3UL6A 4AJ6A 1IYYA 3LMLA 4L8PA 2XF3A 2HI7A 3K8NA 1RN7A 1YJ93 4IW9A 1PA3A 5J9BA 1ASKA 2LJRA 1TK8B 4JZQA 3RNTA 2ZNMA 1PYLA 1RN4A 1SKRB 2JZTA 1SIHA 3ROBA 3HXSA 1ZYEA 4XDWA 2VCWA 3QMXA 2A4HA 1FG4A 5DAKB 3ZZXA 3J7Yk 5IIZA 4QWTA 4RQRA 2DMLA 3DD3A 5G31A 3HVNA 1BRIA 3L9UA 2ZA4A 3AHSA 2K0MA 1N8R4 1GTUA 5C00A 4XS4A 1GSEA 1IDPA 5CREA 3A5IA 1U3AA 4DKIA 2YCDA 2B5XA 4MDCA 1OKTA 3FZ5A 3Q6OA 1G6WA 5A5KA 2R0GA 3QD9A 4MH2A 2AAEA 3CTGA 3FZ9A 1MDIA 1TOFA 1IK3A 1TKDB 1MWRA 1PMTA 3Q74A 3IHGA 3GH9A 1IVVA 1M9AA 5G2ZA 1M99A 5G5FA 3UB1A 4I5QA 5HR3A 3Q1CA 1GMPA 1BX9A 2L5LA 3OR5A 1UCIA 4CDLA 3FF2A 3EINA 4G0KA 3J7Yd 1XZOA 2E2MA 2RM5A 2YANA 3M1GA 4BIKA 3M8NA 3GZBA 3JUPA 1UCLA 2WOHA 1VQ73 1LBKA 1Q40A 5AIXA 1X5EA 3DY5A 1GYBA 2B1KA 2DJ3A 4QL7A 4N10A 1NWWA 3SLUA 3H4KA 2K18A 1JB4A 1RK4A 2HRFA 4ZBDA 3GZXB 3JUNA 5DDLA 1E2YA 4V2NA 4FO5A 3GA4A 4GWRA 5ELAA 2IMDA 4XBYA 2P5RA 4Q5RA 3ZMKA 1Q9EA 4ZBBA 4DSSA 4ZL8A 1QQ2A 1W4NA 4PQHA 4HQSA 3DGOA 1V9WA 1JN5B 2C3QA 5JCGA 3QAGA 2WGRA 1XWGA 2BIRA 1EG9B 3ZG0A 3NQYA 4IS0A 1TJDA 2AHEA 1AQVA 3FR3A 5D9TA 6GSWA 1QVG2 1VQ43 5M1AA 4D73B 2VD0A 2H19A 4OVMA 5B6MA 1AVKA 3TRQA 1WMPA 4ZB8A 2VIMA 3AMOB 5CF2A 1IQYA 1TRPA 3GTUB 1B3SA 1DMQA 1AV4A 4L0UA 1I2FA 2STDA 1OGXA 2Z77A 3VF1A 1AR0A 1FGTA 1JBTA 2O9UX 2DBCA 4HS1A 5G30A 4F0CA 3OWUA 5IG0A 1PU4A 5DALB 5ELJA 4KZ1A 10GSA 4KGIA 4MABA 4N6V0 1OC9A 1RW1A 4N0ZA 3TKSE 2RSXA 3U5RE 3EE2A 4ZL9A 3VWVA 1A8YA 1K9M4 3TJJA 1ZOFA 4AF2A 1GMQA 4V1Ap 8GSSA 1RGFA 2IMEA 1B2UA 1B2MA 1GMRA 2JADA 5J9CA 4RI7A 3F6FA 4N6NB 1U5OA 3FZAA 1W6YA 1GSYA 2QA43 2E7PA 3VFIA 2OQEA 4OFTA 1U8CB 1K0OA 4YAVA 1Z3EA 3CNMA 3BOAA 2CFKA 3CXC2 1MD4A 3F9UA 4O3VA 3OW22 1O73A 2YX9A 1Q864 4HOJA 3M9KA 3CC73 2XSOB 1SU9A 3UNLA 4MEIA 4N6TA 1UI8A 1AQXA 3NM7A 1M3IA 4MCUA 4NHZA 4TOPA 5EVOA 4GSPA 3FMWA 4KW6A 5CRDA 2H76A 4GL6A 2L59A 4HEA2 6GSVA 1RCKA 1SYXA 4J9AA 5D82A 1HZ1A 1NU3A 3BNBA 2OE3A 4KCEA 3CCJ3 3LG6A 3UBKA 3WGXA 2FGXA 2W04A 5B8BA 3MPHA 2QC7A 1SD8A 3WGEA 2KF6A 1UDII 5CF1A 4KB3A 3TKSA 5D9VA 4CW9A 1EUIC 3QAWA 2E2UA 1AXDA 4O02B 1OUNA 3FZWA 4WP5A 1VF4A 2X99A 4CPKA 1A23A 3EMPA 3M9JA 3IC4A 3DH2A 3URPA 3C1RA 2H66A 2PBJA 1BRSA 3IPTA 4CCVA 1M0UA 3GRXA 1GSSA 1MEKA 2B7JA 2WGQA 2H0HA 2OE0A 3ZFLA 4XS4B 2OA7A 1GTAA 3CPOA 2F9SA 2RGQA 1G7OA 1NJI4 3LQ7A 3ER7A 5LC7A 2C0EA 4L0WA 1FW7A 3I9V2 2XGNA 1K28A 1GH2A 4GSSA 1G0TA 3CD63 4RQXA 4KDXA 2O7KA 4ECBA 3B4OA 3N9HA 2L57A 1V74A 4TX4A 2R4VA 4AEQA 3BJ5A 1A2KA 2K9FA 3KJYA 4BL7B 2CT6A 3D3LA 1STFI 2XPDA 1I2EA 2B24B 2GZZA 2L1SA 4WF5A 1ROVA 1XOAA 5CRGA 3FKAA 1GRXA 1YQ1A 2RUFA 2XFSA 1JLWA 4R9LA 3DUKA 1YNVX 1RDSA 1PY3A 4H3UA 1I5GA 2N5BA 3F7XA 3ZTLA 1RGCA 3ME8A 4PUFC 3TKSC 4N6OB 5STDA 2CIUA 3KP9A 3UARA 7RNTA 3PZWA 3C7MA 4X1UA 4IPBA 2GSTA 1BIRA 3CXGA 2ON5A 5BVBA 1PFOA 2IY2A 2GDRA 1BNIA 3A76A 3V92A 1RGKA 5GSSA 4HZ2A 2NTOA 3DRNA 1VQQA 3R3EA 3A3TA 1PD21 1CEWI 1W89A 1K0CA 2BMRB 3CMA3 2ON7A 3KSPA 2Q07A 5AEUB 2FWHA 3APQA 3D4TA 2KOKA 2CFWA 1FGOA 4WKWA 2C8UA 1UGIA 3GZRA 3APOA 2YWMA 2LQOA 1D6UA 3LW9A 1GOYA 1Q824 3HZ4A 1JZRA 1GS3A 3WODG 3ZITA 3HHVA 2M80A 1RSNA 1QMAA 2WULA 2DLXA 4L5OA 4EL1A 1IT7A 3K63A 3GKKA 2M72A 1T5YA 2DJ1A 3ALAA 2H1AA 3ZLPA 4I4KA 3VWUA 2EIOA 1FA3A 3FHKA 1TTZA 3LXTA 5CK6A 2VM2A 2AJQB 1X9SB 1Z1SA 1GLPA 2DKHA 5IO0A 1EQKA 1XPVA 1TU5A 1WQLB 3HOHA 4FQUA 3QRDA 4CY8A 4BU4A 2QIYA 2PVQA 3MSOA 3QCPA 1RNTA 1OC8A 1Z7PA 2IMKA 2L6CA 3F6DA 3IK9A 4MJDA 4I2TA 4FCMA 1TXXA 2H01A 1DVCA 3A2VA 1XWBA 4IP1A 3KCHA 1GUMA 2P0XA 2PERA 1X9MB 2HSYA 1X1WA 4O2HA 4EO3A 2ZL8A 4F82A 2WS2A 3OWYA 4ZM8A 4NWYA 4HU7A 1N2AA 2YZUA 2XSHB 4BTYA 20GSA 1V58A 2VO4A 3GTUA 1W4VA 1A2VA 2K54A 5ECOB 2CWTA 3VI7A 5G5EA 4KVHA 3BCIA 3BB9A 1S723 4NMUA 4LMWA 3R2QA 4ZBAA 1FUSA 5FHIA 2O85A 4JR4A 3NX0A 2OOVC 1VRSD 2WOFA 2DJKA 2VCXA 4N0VA 4BVXA 2P38A 2PN8A 2GZYA 2FNQA 1BGSA 5D9WA 2FA8A 3WT1A 1M7TA 3NZNA 4HOHA 1B48A 2AB6A 3ZMLA 4AJ8A 4OD7A 2LUSA 1CQSA 5HFKA 2VCTA 4NV5A 5D73A 2KF3A 2ES7A 5FW5A 7GSPA 4O32A 1T1VA 3PYJA 5KN1A 3O3TA 4MJAA 1FHEA 4KH7A 3KGKA 1GNEA 4L8OA 1WIKA 1JFUA 1WE0A 4IELA 4NXIA 5EPFA 3SOYA 4X0XA 1UC7A 3CSIA 5KOXA 1XW5A 2OADA 2RCDA 5D9XA 3SOAA 2R6KA 4F03A 4G1MB 1BRJA 3TUEA 5J41A 3VPQA 1G7EA 3FZ4A 1SJIA 5HFIA 3NV0B 2A2RA 3EPTA 4PTSA 4YH2A 1VQL3 2CVDA 3LSZA 2XPEA 4MF6A 4IIAA 2VL2A 1M904 3QAVA 4KFFA 1PL1A 1SARA 2C0GA 2CQ9A 2EIQA 2VL2C 3BLZA 1YZXA 2WCIA 2HMNB 2L6DA 4TXOA 1YVBI 3SX1A 1HU9A 3D79A 3SVAA 3OXAA 3T0UA 3IPZA 1GNWA 3MHEA 1FGQA 3ECFA 3T8UA 2GT6A 2C11A 1GUHA 2KP1A 4IBPA 1MWSA 2Z76A 2F56A 2FWFA 4K9ZA 4WEYA 4XIHA 4TR1B 2GZPA 3Q90A 3GYKA 3CRUA 2MMNA 3HVVA 1VQN3 3CCQ3 2XC2A 5C04A 3LYGA 1ULIB 1X9WB 2H6ZA 4K61A 1ISKA 1DETA 4HM8B 1E6BA 1VQ63 2GSSA 2OCTA 1DMMA 3LORA 1O7HB 2DSAA 2HZFA 2NBSA 1XW6A 3KEBA 1F9MA 3KM6A 2N5AA 1Y6EA 2HOHA 1PKZA 2P31A 4I97A 5ECLB 3IR4A 4JU5A 4CY6A 1SQWA 2VCQA 1GTIA 1TRWA 3SEDA 1Z6NA 3HIIA 2G0FA 1VGLA 2H75A 1BANA 3Q19A 5H5RA 1OF5A 4ORLA 5AIFA 4MMYB 5IEOA 3TB2A 5H5SA 1GSUA 4MK3A 2VLUA 3DYRA 1XVWA 1BRKA 2OWPA 2HSHA 4TR0A 2I3YA 2H74A 1W2ZA 1TFKA 1QFNA 2GT5A 2IN3A 1OC9B 2LS5A 1ZYQB 3WOFB 1FZUA 4WBJA 2IUJA 4BIRA 2DC5A 1DBYA 1QVF2 4EC0A 2NDOA 1YF1A 1VQP3 3ZIJA 1JBRA 1DE2A 3P8WA 3LT9A 2IPAA 4KCAA 1W6CA 3G0KA 1V40A 1N8QA 1ERVA 2IMIA 1EOHA 4FYBA 4E8EA 3CCR3 1M1K4 3KIJA 1HNAA 1LNHA 4WYKB 4HM7B 4EYCA 5CRHA 1RGAA 1CQGA 1KNGA 3M8CA 1AUCA 5F0GA 4HM2B 3H3HA 4U13A 3IBHA 3UEMA 1U87A 2J23A 1XW9A 3CME3 1Y4KA 1B4PA 1UUVB 1BRNL 5KN3A 1RRLA 1GULA 5RNTA 3VURA 2O8VB 4YKFA 3DIEA 3QK9A 2QGUA 3I0YA 3C71A 1THOA 4L5LA 3BNEA 3NBBA 1WMOA 4MP4A 2LNTA 3GV1A 3HJOA 1RN1A 3LYKA 1K8A4 1R4WA 4KAEA 4MNNA 5IOWA 3F14A 4FYUA 1O7WB 5FT3A 1UA5A 3H51A 3DWVA 3G7IA 1CYUA 3EN1B 4O5QA 5HR0A 4YQVA 5D93A 4EVMA 2Z7AA 3BIRA 1SPUA 1ZGXA 1A2MA 3CC23 4ECIA 2H71A 1EV9A 3LEFA 3AY8A 3HX8A 3FK8A 1NO3A 3DGYA 2RBIA 1JB2A 5KN2A 1MDKA 3ED3A 1NDOB 1OHPA 4X4JA 1GY5A 3TDGA 3JCML 4I6XA 8CHOA 1A2JA 5L71A 1LQMB 2TIRA 3SXXA 3N5OA 3QOUA 3KFQC 2OJLA 1FOVA 1TRQA 5ECSA 1S3AA 5DVBA 4FMDA 3K5TA 1LXEA 5LNKe 2KP2A 3SWLA 2KRTA 2AYTA 3MYDA 4GB5A 3F7SA 1OKDA 2BMXA 4BA7A 3X3XA 4TXOB 1IVWA 5F07A 3LZAA 1EOGA 2WFCA 3HY2A 2R41A 1GTBA 3TKPA 3L9VA 1CH0A 3FSDA 4POBA 3D4AA 2UX0A 2F3MA 2HXKA 1KBNA 1OHOA 2EC4A 2X49A 1E3VA 4Z7XA 5FGOA 1F3BA 3DGQA 3ZFZA 4BL3A 12GSA 1MOLA 3F3QA 1NHYA 1ZGNA 1F6MC 2CFDA 3B7CA 2MBSA 1SD9A 1GSPA 1C54A 5DQYA 2X8CA 4JRRA 4FH8A 3CU3A 1TFOA 1OE7A 1CYVA 3D5GA 1VQM3 1FB0A 2CHCA 1I9DA 2C4JA 2P05A 2F98A 1RGHA 3B8LA 4MPFA 4EXJA 2YJ7A 1VQ83 1SJZA 1PGTA 2RNTA 4PEJA 4F2IA 3HZPA 5D96A 4BPYA 1M9GA 1JZWA 2IA7A 1RRHA 3U97A 2LJAA 1O7MB 4FCJA 7STDA 1JLVA 3ERWA 4K7NA 3TOUA 1TK0B 3WMDA 4G9HA 2GXFA 1VQ93 2R2JA 4HQZA 4DSSB 4HM4B 2UGIA 3DVWA 5J5NA 3MNGA 4ISDA 5HFGA 1T7PB 4LZIA 3HYPA 2F5MA 4BWQA 1JN5A 5ECPB 3HVXA 4PXOA 1QAFA 3TOTA 2ZUPA 4J5GA 3CRTA 1QJGA 3ZVJD 2FD3A 2D42A 3W8JA 3WYWA 2FY6A 1Q4JA 2B3SA 1FB6A 2CAIA 3S29A 2Z9SA 3GNJA 3FG4A 3FR9A 2A4VA 5JCWA 4AJ7A 4KX4A 4XS6A 2XEPA 1B21A 1AIUA 4PQ1A 3D4MA 3KZQA 3E9JB 1JJ22 1R4CA 1RTUA 3X42A 2J9HA 1JNQA 4Q5NA 5CNWA 1LRAA 3X40A 2H6YA 2PZVA 2UZ8A 2FGTA 1PQNA 3HK4A 6RNTA 5I97A 2V6KA 4OO5A 1I3IA 1EGRA 1ZS7A 3LOYA 4JRFA 1RMSA 3KIIA 2IL3A 2HMKB 2VCVA 2VLVA 3GWRA 1K3LA 2C10A 2IWTA 2F51A 2H1GA 1WOUA 4HZ4A 1Q814 3G6E3 1K0DA 5ECKB 1LNIA 3EVIA 5DJLA 1LOXA 4R4KA 3A2WA 3KH7A 4WHAA 4GTUA 5E4WA 4HAAA 1ERUA 2LRCA 2CX3A 2OQEC 1D6YA 3KXOA 3G4S3 3ZFBA 8RNTA 1YGEA 4LLRA 2OACA 3D22A 1QALA 1XBSA 1WMNA 5IG5A 1AQZA 1KEBA 1VF3A 2GGTA 5D8IA 4X43A 4Q53A 1PX6A 3DMLA 2C4BA 3GX8A 2LRNA 3EX9A 3UL3A 1N8JA 2IYJA 3BD2A 5INYA 3E99A 3W6GA 1Q40B 1EKMA 2YZHA 3HA9A 2H30A 2RM6A 3GKXA 5DCGA 4HJMA 4TR3A 2CFGA 3FRCA 5JWOB 4OUQA 3UJ1A 3SBCA 3APSA 2MC8A 1S3DA 2YWOA 2GTUA 1VF1A 2V6OA 2HNLA 2HMJB 2GBWB 5GAND 1B2XA 1MDJA 3MAKA 1UCJA 4POMA 2BHMA 2CKFB 4ZB9A 5KEJA 2H0IA 1ON4A 1BG5A 3F3RA 2VOCA 1V57A 1U3IA 1G02A 2CH9A 4WFOA 1XVQA 1FVJA 4IVFA 4NPBA 5BXQA 4V1Ag 3HJPA 4FCZA 4K5SA 1YIT3 5EVHA 3Q3FA 3F4SA 4CJNA 2HMOB 1JRQA 1SK1A 5IM9A 2AV4A 2I1UA 2E2GA 2B5EA 2HRAA 2R3XA 1XOBA 1DVDA 3EF8A 5DALA 2EIRA 2H70A 4WR5A 1G96A 3DXBA 5J4UA 1BYEA 4PURA 3C73A 5EY6A 5BU4A 2WB9A 2NPBA 4L8EA 1BNFA 3OWSA 4EUYA 2VLTA 1RLSA 1LQGC 3CNXA 1SYRA 1YEPA 1EZKA 3D21A 3G7YA 2BMOB 1XWCA 2G2QA 2QGVA 5BMUA 3VWXA 2GSPA 4HM0B 3HZ8A 3AGOA 3CCL3 4OMVA 1DYUA 1OH0A 1RGLA 4TR1A 3EN8A 4POKA 2IMJA 4GQFA 2AAWA 3K0ZA 5M18A 3IV4A 1ROAA 3LYPA 3B4PA 5IG4A 1O7GB 3UMAA 5G1LA 3UOMA 4GHOA 2YFLB 2B6MA 4TRXA 3RHCA 4CHSA 1N5PA 3QDNA 2KCDA 3PR8A 1SJ6A 5ECIB 3DZLA 4FR9A 2HE3A 4GRFA 1A24A 2YWIA 1IV9A 5B6NA 4HUAA 4J57E 5AIGA 5BRTA 5A0OB 4MJCA 3O8YA 2R0CA 3FW2A 1SL1B 4HM5B 4JE1A 3F9SA 2V2GA 2H0GA 4J56E 4HM1B 1W2B2 2GU1A 3E3EA 4Z2RA 3LXZA 3IHQA 2DIZA 2LTKA 2B1XB 3WDGB 3A5WA 2YWNA 4NHFA 4HJ2A 2J8XB 1FUWA 1BNSA 1X5CA 5ECMB 2GLRA 4KNDA 1QAKA 1R26A 3DGNA 5CRWA 3U6VA 1I0VA 5IQYA 4IKHA 5J3RA 1XG8A 3CC43 1ZZYA 2C80A 1XCCA 1E3RA 4BL2A 4EIPA 5DREA 3VLNA 4BVYA 3PPUA 4KFDA 2K3DA 3BBYA 1GP1A 1TI1A 2XBQA 4XRAA 1HD2A 2JU5A 4TVEA 4DSQA 1VF2A 3BCKA 4ZIJA 4QQ7A 1OACA 2DMMA 3CSJA 2DKIA 3GKMA 2K6VA 2GQLA 2PMTA 1BU4A 1O81A 4WETA 4HU9A 3KN4A 2X4AA 1K734 1OGZA 4YAPA 4RZMA 4GQCA 3FG1A 2WO0A 1NHOA 2TRXA 2C3NA 1MNLA 2M46A 2MZCA 2KF4A 4LL1B 3V99A 1IQ8A 5CLKA 1IYIA 3X3YA 5HR1A 4NV2A 1NNVA 1O85A 3EB8A 1H4OA 5ECRB 4F9ZA 4FMBA 1X0RA 4ZILA 3NUVA 4GLTA 3D5JA 1A8LA 4EDYA 1BAOA 1US1A 3PGBA 4X2OA 5IMFA 2CW9A 2KHPA 2LQQA 1RKYA 3MKIA 4KUNA 3LTCA 3WA3A 4R9KA 4ILFA 1NM3A 1GLQA 3G7JA 2CWUA 1BQ7A 4LMVA 1BNJA 4PX1A 1BNRA 4NHWA 3WD6A 3WA2X 5IW9A 2ZDJA 1OHSA 3IE3A 1EEJA 3L4NA 2R37A 3RPNA 2H6XA 1JZOA 1O6JA 3FLJA 2F8FA 4XCSA 1TRVA 3FR6A 1KTEA 1O7NB 4XTSA 4EW5A 1GOUA 1HKXA 3PCRA 5JBSA 3STDA 2MBTA 1UN2A 5CAXA 3H79A 1BNGA 4ID0A 4OK0A 4KSMA 1YHQ3 2LSTA 2WRTA 2L4CA 2E0QA 2GSRA 1VQO3 2HRKA 2R0PA 4GCIA 4EF0A 1S3CA 4V2MA 1ZO2A 1FW1A 2IFQB 3P7XA 3FG3A 1T00A 1YJ6A 3L0RA 2BMQB 5TGNA 1X1UA 2XR8B 2QA2A 4RI6A 2GSQA 2QKEA 4XDVA 1R7HA 4PUAA 4ECCA 4IP6A 1W5ZA 1N5HA 2PNCA 1DUGA 3GL3A 4KSOA 3J7Yb 1TI3A 2OBKA 1AAZA 1YJW3 2GS3A 2B1LA 4K5RA 3IC8A 3O76A 1A0RP 4YQMA 1JZDA 2GQKA 3NBRA 1T8EB 3CCM3 3HDCA 3FEUA 5COHA 1HQOA 3EMXA 4PGTA 4HM6B 1B2SA 1BRHA 1W7CA 4RBNA 3IRAA 3Q2PA 1I3FA 1UUWB 2FA4A 1J2BA 1MD3A 3TKRA 1FYSA 2HMMB 5IPGA 1CQHA 6GSSA 1Z7RA 1RHLA 1OAZA 4RNZA 3MYTA 1Q98A 5IENA 1WTHA 3IA1A 1IU7A 1BJXA 2WGOA 1A90A 3KMNA 1SK0A 4MZCA 4KA0A 3C1SA 1HYFA 4YQUA 1TRUA 4MJBA 5GSPA 1R4YA 4EV5A 3UVHA 1SL2B 3UJMA 2FLSA 4EC6A 1K0AA 3OX9A 2YFIB 2FCHA 4BTWA 5ELUA 1URMA 1GSFA 1WMJA 1O8XA 2P0MA 2KXGA 3VGNA 4MPGA 2CZ3A 5F06A 1T4ZA 1NSWA 5G1KA 4LYLB 4L7KA 3CYNA 4EE0A 4N30A 2LKUA 2RFRA 4TW5A 1OE8A 3EC3A 4AGSA 1BUQA 1OF5B 1USBA 4WXTA 5KN0A 4GSNA 2OOVA 2R5GA 3EU4A 5ABRA 2YV7A 3AHWA 3RHBA 1PL2A 1TU7A 5ID2B 1PN0A 1TK5B 16GSA 2CA8A 5AEWB 18GSA 4OO4A 1OC3A 2CK3H 2YP6A 1WPIA 1J9BA 3CCV3 4FIWA 1LJRA 2L5OA 1B9XC 2F8AA 4MMMA 4O8SA 4R80A 1SKSB 4IN0A 4HDEA 4XRDA 1ACVA 1PFPA 1VZZA 3ZIVA 3JVCA 4ECJA 3MWZA 2GBXB 3L9SA 5GSTA 2MF7A 2BO9B 4J5KA 14GSA 2F5WA 2YN1A 2NVLA 1EEMA 2K8VA 4KDUA 3FCSB 3ZREA 3CQFA 5EQLA 2MMAA 2C3TA 5D83A 3P90A 4TR4A 2JSZA 5DAKA 4OWYA 5AIVA 2JQ5A 4EKZA 2HMLB 4HZBB 4LMIA 3FYGA 5ID2A 1BEDA 1UCKA 3LWAA 1EV4A 2X8HA 3PCSA 2VD1A 3KP8A 5JWQB 4ZL7A 2BJXA 1GY7A 3K7CA 1M2AA 1LU4A 3GUSA 3EBTA 1ZYNA 2C0FA 4ACSA 1T2HA 1ILOA 5AIHA 1ULJB 1C7HA 4LL4B 2LJKA 4POLA 3TGZA 4TKYA 5A4WA 1T4YA 4HZ9B 3CPW2 5A4VA 1BOXA 4Z2UA 5AIIA 2O89A 1ERTA 2H1BA 3PS8A 5G2GA 3S5CA 4LSOA 1Y25A 5FWGA 3MWHA 3EU3A 3QPMA 5ECHB 19GSA 1X1XA 1OYJA 3ZL5A 2CV4A 1THXA 2CX4A 1GD3A 5CO3A 1PRXA 3MG1A 2H1DA 5IPHA 1Z5YE 1B9YC 3FF0A 1AY7A 2INXA 6GSUA 5AN1A 3LT8A 1DSBA 3KSED 1A2LA 4J8TA 4HJLB 1W02A 3GSTA 2W56B 4KFEA 3QFBC 3NV0A 3P2AA 4HVNA 1RJOA 2ML5A 3L0HA 1F3AA 1YVSA 2SARA 1XIYA 2HZEB 4OFNA 2YFJB 1TRSA 4HBRA 4NREA 2YPMA 5B7CA 1SKWB 1JBSA 17GSA 3X3ZA 3UVTA 4N6UA 1TP6A 5AGYA 2RIIA 2HYXA 3H8QA 3FH1A 3DKSA 1IVXA 1RNBA 4IGJA 3DEXA 2PU9C 4K2DA 1Q42A 4K8MA 2KAAA 2FWEA 4JEDA 4FMAA 1BAYA 2FUG2 4CDOA 1HNCA 1UVZA 1J0FA 4BTXA 2WDUA 4EBGA 2JACA 4G10A 2KF5A 2A15A 2ALBA 1S3RA 4I2UA 1EWXA 1T2IA 3ZVJA 1K0MA 1DE1A 4RNYA 3S27A 2IMFA 4O7HA 2RLIA 2VAFA 2HSMA 4OFMA 4A5PA 2C1YA 1WNHA 2W0QA 2BNGA 2L4VA 2CZ2A 3LTAA 3D5IA 2ZCTA 3QR6A 4STDA 2PGTA 4XS1A 3MG3A 1N9JA 3RGAA 3BU4A 2A2SA 3VK9A 3TJGA 5DBQA 4K2XA 4RNTA 4NAXA 4TXVA 3GX0A 3ZYWA 3CBUA 4RUVA 3DM8A 1BRGA 3X41A 4XBTA 1BUJA 2JDIH 3KD0A 4MJEA 1R5AA 2CG1A 3UBLA 1KC84 2F4YA 1I70A 5CXOA 3D0ZA 1KWIA 3QFAC 1A2PA 2V1LA 2QSIA 3G9BA 3JUQA 1A0FA 1QK8A 1M2BA 2GEYA 4HM3B 2F99A 3NIVA 4USSA 4N6MA 1QXHA 2DIYA 5AISA 3ZG5A 2P09A 3WOEB 5IMDA 3GURA 1DMNA 2K8SA 2AUVA 3JUMA 4O5UA 2DJ2A 1GY6A 3NM2A 4HYZA 1XWKA 2V32A 4BVYB 1IV7A 1JKGB 1DE3A 1SIIA 5IMZA 3IMAB 4K1VA 1PN9A 1ABAA 3N9JA 2N5FA 1O7PB 4Q5FA 3VWWA 2OE1A 3HD5A 5DJMA 4XB5A 3S67A 3KH9A 3D9RA 3Q18A 3WGDA 2FWGA 2R4IA 3NXJA 1TW9A 1WJKA 3LFLA 3LH4A 1UGHI 3MG2A 1QUWA 1N9EA 3N54B 2B7KA 2M7OA 2BTOT 4YKGA 2D1WA 1SENA 4MLYA 3VI5A 4WR4A 1VQK3 3FY7A 3EURA 1RGGA 3U1WA 5IMAA 2XRXB 1ZL9A 1NW2A 2JZRA 1YKAA 2X64A 4D73A 6GSTA 2GVPA 5F8BA 3TCOA 2REMA 3EBYA 1I8VA 5AYRB 1WP0A 3S9FA 3CTFA 1W6GA 5HOHA 2TRCP 3F0IA 1R5PA 1HYUA 5CYYA 5IMCA 1GOVA 1B2ZA 1NB3I 4H61A 2QEX3 1TDIA 3F4TA 4G0IA 4ZB6A 3TJFA 2VL3A 3ERGA 2QA1A 2DJ0A 3PGTA 4LGQA 1FOHA 2BU4A 3TKQA 9RNTA 3N8BA 1FGRA 1YEXA 2XHFA 3ISOA 3FKFA 3SYUA 2CVKA 1W01A 5DRVA 1TIJA 1ZYPA 3EYTA 3KTLA 4WF4A 5JCUA 1MWUA 3GSSA 1OVNA 4KF9A 2LV3A 2AADA 3EC9A 3LTDA 1B20A 1ML6A 1GSQA 3HCZA 1ZMAA 2LQVA 4PQIA 2W2CA 3UAPA 2KLXA 2LNSA 4KE3A 4G19A 4X2HA 2DJJA 1TU8A 1BSAA 4IQAA 4K1FA 5AI1A 2H73A 13GSA 1RQMA 1FAAA 3CSHA 2ZHXB 1AC1A 4JR6A 1C72A 3V98A 3LGCA 3KCMA 1S5AA 3FGYA 1I0XA 4HI7A 4HKVB 2OTL3 2Y74A 3F8XA 1Z6MA 2W03A 1LOVA 1E97A 1WWJA 2MMZA 2WJUA 1BNEA 3F4RA 5KP3A 3NBJA 3T8NA 4DVCA 1O7UA 5M19A 5HR2A 5LCZA 3LJRA 4WYKA 3CMIA 3CCE3 3DMCA 9GSSA 5IOXA 1GD4A 3I6AA 4ICYA 3DXOA 4QL9A 3NQZA 1TTOA 5GZZB 1GWCA 3GHAA 3A2XA 1JKGA 3BNCA 4ULXA 2FHEA 5A4UA 5GAPD 3IAM2 2C0DA 3RGRA 3AGNA 1XXUA 4K6XA 4MA9A 2W6JH 4N6LA 4GF0A 1D6ZA 3GH6A 3GFKA 1B4QA 2HT9A 2XFTA 4OCFA 3RDWA 3BNDA 1B8XA 3KZTA 2YJHA 5CP1A 1MGRA 1YKCA 1YJN3 4K7OA 5ECQB 1ERWA 5BIRA 4O92A 1KSIA 7GSSA 1SL0B 2PWJA 1T3BA 3GRDA 3F40A 4JF8A 2IIYA 3PINA 2PUKC 2MYGA 4XHMA 6GSPA 2JSYA 3K9MC 2E2TA 4OCEA 1UUGB 2GQMA 1STDA 1X5DA 3MDKA 1TP9A 4I8BA 4K0GA 1I2GA 3ME7A 2WZ9A 2P5QA 3KKGA 1LOWA 4PNFA 1OCVA 1TUHA 3KE7A 2A2PA 4KDYA 2HRNA 1BSBA 2PVOC 5EL8A 3G713 4MF5A 4ML1A 3C8EA 4G2EA 4AKZA 1JHBA 2FNOA 5ECNB 5H5QA 3A5EA 3GMFA 1YI23 1EP7A 4DSRA 1FO5A 4MMXB 3KMOA 3PXMA 4K7IA 4XM4A 1K3OA
chains in the Genus database with same CATH topology
2OKAA 3RPPA 2P0GA 1FVKA 3GIXA 1M9BA 1YY7A 5IMVA 1EP8A 5B8AA 1IYHA 2B5YA 1AQWA 4GSTA 3TRPA 3ZRDA 4J2FA 5F05A 4MZBA 3IAS2 1V98A 4EDZA 1YF0A 5ENUA 3H1NA 5DQSA 3TJBA 3RBTA 3IOSA 4F0BA 1K3YA 1XFLA 1Z9HA 3GL5A 2MMOA 2D2ZA 3EWLA 1GUKA 3F8UA 3HJMA 3I43A 4TN8A 4Z2TA 3E0UA 2V1MA 2I9HA 4FYCA 4MZWA 1QMVA 3ERFA 1K0NA 1F2EA 3KTBA 1SK2A 1F37A 2JL4A 2HLSA 4P3YB 3W8SA 1G6YA 4ML6A 4JBBA 2YOIA 3GKNA 4ZXGA 1GL8A 2VUPA 4K0NA 1U6TA 3DVXA 3NOFA 6GSXA 2HFDA 3IXRA 1H75A 3M0FA 3US3A 5LD0A 3VPTA 4IHUA 5HQPA 1ST9A 4N11A 2PPTA 4Q5QA 3UIWA 2OBIA 4G0LA 4IJIA 4IJ3A 2VL9A 3RAZA 3D6IA 4WBRD 4MF7A 3F63A 1PSQA 3I69A 3M3MA 4BWSA 2O87A 5ELGA 1AW9A 2CAQA 1M2DA 2LRTA 1WRYA 4V2LA 4LA1A 2L4QA 6GSYA 3L78A 3PH9A 4E8HA 2KUCA 1XWAA 5KOWA 5JWRB 3O6TA 3WT2A 2RUEA 11GSA 2CVBA 4BL7A 1PX7A 1U88A 1J08A 2XBIA 5IO2A 2I4AA 1PKWA 2H72A 2V41A 3GN3A 1ZCPA 2JZSA 1GSDA 1EGOA 1YDKA 1QGVA 2IJYA 2X8GA 2VM1A 2H8LA 1V2AA 2HZEA 4IQ1A 3IK7A 2IFQA 1O8WA 2I81A 4DEJA 3V1WA 4GXZA 2VCZA 3IDVA 22GSA 1K0BA 1MTCA 3HVSA 1HNBA 4H86A 2LEGA 5E59A 3MIXA 3TRXA 3H93A 2YNXA 3HKRA 4MH3A 3MSZA 4BVXB 3TJKA 2YV9A 4EIQA 4PNGA 4O5RA 5DCHA 4AJ6A 2HI7A 3K8NA 4IW9A 1PA3A 5J9BA 2LJRA 1TK8B 4JZQA 2ZNMA 1SKRB 2JZTA 3HXSA 1ZYEA 2VCWA 3QMXA 2A4HA 1FG4A 5DAKB 3ZZXA 3J7Yk 5IIZA 4RQRA 2DMLA 3DD3A 5G31A 3L9UA 1GTUA 5C00A 4XS4A 1GSEA 5CREA 3A5IA 1U3AA 2YCDA 2B5XA 4MDCA 1OKTA 3FZ5A 3Q6OA 1G6WA 5A5KA 2R0GA 3QD9A 4MH2A 3CTGA 3FZ9A 1MDIA 1TOFA 1TKDB 1PMTA 3Q74A 3IHGA 3GH9A 1M9AA 5G2ZA 1M99A 5G5FA 4I5QA 5HR3A 1BX9A 2L5LA 3OR5A 3EINA 4G0KA 1XZOA 2E2MA 2RM5A 2YANA 3M1GA 3M8NA 1LBKA 5AIXA 1X5EA 2B1KA 2DJ3A 4QL7A 4N10A 3H4KA 2K18A 1RK4A 2HRFA 4ZBDA 5DDLA 1E2YA 4V2NA 4FO5A 3GA4A 4GWRA 5ELAA 2IMDA 2P5RA 4Q5RA 3ZMKA 4ZBBA 4DSSA 4ZL8A 1QQ2A 4PQHA 4HQSA 1V9WA 2C3QA 5JCGA 3QAGA 2WGRA 1XWGA 4IS0A 1TJDA 2AHEA 1AQVA 3FR3A 5D9TA 6GSWA 4D73B 2VD0A 2H19A 5B6MA 3TRQA 4ZB8A 2VIMA 3GTUB 4L0UA 4HS1A 2DBCA 5G30A 4F0CA 5DALB 10GSA 4KGIA 4MABA 1OC9A 4N0ZA 1RW1A 3TKSE 3U5RE 3EE2A 4ZL9A 3VWVA 1A8YA 3TJJA 1ZOFA 4AF2A 4V1Ap 8GSSA 2IMEA 2JADA 5J9CA 4RI7A 3F6FA 3FZAA 1GSYA 2E7PA 3VFIA 4OFTA 1K0OA 4YAVA 1Z3EA 3BOAA 1MD4A 3F9UA 1O73A 4HOJA 3M9KA 1SU9A 1AQXA 4MCUA 4NHZA 4TOPA 5EVOA 3FMWA 4KW6A 5CRDA 2H76A 2L59A 4HEA2 6GSVA 1SYXA 2OE3A 4KCEA 3UBKA 3LG6A 3WGXA 2FGXA 5B8BA 2QC7A 1SD8A 3WGEA 4KB3A 3TKSA 5D9VA 4CW9A 3QAWA 1AXDA 1VF4A 2X99A 1A23A 3EMPA 3M9JA 3IC4A 3C1RA 2H66A 2PBJA 3GRXA 1M0UA 1GSSA 1MEKA 2B7JA 2H0HA 2OE0A 3ZFLA 4XS4B 2OA7A 1GTAA 2F9SA 1G7OA 3LQ7A 2C0EA 4L0WA 3I9V2 1GH2A 4GSSA 1G0TA 4RQXA 4KDXA 2O7KA 4ECBA 2L57A 2R4VA 3BJ5A 2K9FA 3KJYA 4BL7B 2CT6A 2XPDA 2GZZA 4WF5A 1XOAA 5CRGA 1GRXA 1YQ1A 2RUFA 1JLWA 1I5GA 2N5BA 3ZTLA 3ME8A 4PUFC 3TKSC 3KP9A 3UARA 4X1UA 3C7MA 2GSTA 3CXGA 2ON5A 2IY2A 2GDRA 5GSSA 4HZ2A 2NTOA 3DRNA 3R3EA 3A3TA 1PD21 1W89A 1K0CA 2ON7A 2FWHA 3APQA 3D4TA 2KOKA 4WKWA 2C8UA 3APOA 2YWMA 2LQOA 3LW9A 3HZ4A 1JZRA 3ZITA 3HHVA 2M80A 2WULA 2DLXA 4L5OA 4EL1A 3GKKA 2M72A 2DJ1A 2H1AA 3ZLPA 3VWUA 2EIOA 3FHKA 1TTZA 3LXTA 2AJQB 2VM2A 1X9SB 1GLPA 2DKHA 5IO0A 1XPVA 4FQUA 4CY8A 2PVQA 3QCPA 1OC8A 1Z7PA 2IMKA 2L6CA 3F6DA 3IK9A 4I2TA 1TXXA 2H01A 3A2VA 1XWBA 4IP1A 1GUMA 2PERA 1X9MB 2HSYA 4EO3A 4F82A 2WS2A 4NWYA 4HU7A 1N2AA 2YZUA 20GSA 1V58A 2VO4A 3GTUA 1W4VA 5ECOB 3VI7A 5G5EA 3BCIA 4NMUA 4LMWA 3R2QA 4ZBAA 5FHIA 2O85A 4JR4A 1VRSD 2DJKA 2VCXA 4N0VA 4BVXA 2PN8A 2GZYA 5D9WA 2FA8A 3WT1A 1M7TA 3NZNA 1B48A 2AB6A 3ZMLA 4AJ8A 4OD7A 2LUSA 5HFKA 2VCTA 4NV5A 5D73A 2ES7A 4O32A 1T1VA 5KN1A 3O3TA 4MJAA 1FHEA 4KH7A 3KGKA 1GNEA 1WIKA 1JFUA 1WE0A 4IELA 4NXIA 5EPFA 4X0XA 1UC7A 3CSIA 5KOXA 1XW5A 2OADA 5D9XA 2R6KA 4F03A 5J41A 3TUEA 1G7EA 3VPQA 3FZ4A 1SJIA 5HFIA 2A2RA 3EPTA 4PTSA 4YH2A 2CVDA 3LSZA 2XPEA 4MF6A 2VL2A 3QAVA 1PL1A 2C0GA 2CQ9A 2EIQA 2VL2C 1YZXA 2WCIA 2L6DA 4TXOA 3IPZA 1GNWA 2GT6A 1GUHA 2KP1A 4IBPA 4K9ZA 2FWFA 4WEYA 4XIHA 4TR1B 2GZPA 3GYKA 3CRUA 2MMNA 3HVVA 2XC2A 5C04A 1X9WB 2H6ZA 1E6BA 2GSSA 3LORA 2DSAA 2HZFA 2NBSA 1XW6A 3KEBA 1F9MA 3KM6A 2N5AA 1Y6EA 1PKZA 2P31A 4I97A 5ECLB 3IR4A 4JU5A 4CY6A 2VCQA 1GTIA 1TRWA 1Z6NA 2G0FA 1VGLA 2H75A 3Q19A 5H5RA 3TB2A 5H5SA 1GSUA 4MK3A 2VLUA 3DYRA 1XVWA 2HSHA 4TR0A 2I3YA 2H74A 1QFNA 2GT5A 2IN3A 1OC9B 2LS5A 1ZYQB 4WBJA 2DC5A 1DBYA 4EC0A 2NDOA 1YF1A 3ZIJA 1DE2A 3P8WA 2IPAA 4KCAA 1V40A 1ERVA 2IMIA 1EOHA 4FYBA 4E8EA 3KIJA 1HNAA 5CRHA 1CQGA 1KNGA 1AUCA 5F0GA 3IBHA 3UEMA 1U87A 2J23A 1XW9A 1B4PA 5KN3A 1GULA 3VURA 2O8VB 4YKFA 3DIEA 3C71A 1THOA 4L5LA 4MP4A 2LNTA 3GV1A 3HJOA 3LYKA 1R4WA 4KAEA 4MNNA 5IOWA 4FYUA 5FT3A 1UA5A 3DWVA 3G7IA 4O5QA 5HR0A 4YQVA 5D93A 4EVMA 1A2MA 4ECIA 2H71A 1EV9A 3LEFA 3AY8A 3FK8A 5KN2A 1MDKA 3ED3A 4X4JA 3TDGA 3JCML 4I6XA 1A2JA 5L71A 2TIRA 3QOUA 3N5OA 2OJLA 1FOVA 5ECSA 1S3AA 5DVBA 5LNKe 3SWLA 2KP2A 2AYTA 3MYDA 1OKDA 2BMXA 4BA7A 4TXOB 5F07A 1EOGA 2WFCA 3HY2A 1GTBA 3TKPA 3L9VA 4POBA 2F3MA 2HXKA 1KBNA 2EC4A 2X49A 4Z7XA 1F3BA 3DGQA 12GSA 3F3QA 1NHYA 1ZGNA 1F6MC 2MBSA 1SD9A 5DQYA 2X8CA 4JRRA 4FH8A 1OE7A 1FB0A 1I9DA 2C4JA 4MPFA 4EXJA 2YJ7A 1SJZA 1PGTA 4F2IA 5D96A 4BPYA 1JZWA 2LJAA 1JLVA 3ERWA 4K7NA 3TOUA 1TK0B 4G9HA 2R2JA 4HQZA 4DSSB 3DVWA 5J5NA 3MNGA 4ISDA 5HFGA 1T7PB 3HYPA 4BWQA 5ECPB 3HVXA 4PXOA 3TOTA 2ZUPA 3CRTA 3ZVJD 2FD3A 3W8JA 3WYWA 2FY6A 1Q4JA 2B3SA 1FB6A 2CAIA 2Z9SA 3GNJA 3FR9A 2A4VA 5JCWA 4AJ7A 4KX4A 4XS6A 1AIUA 4PQ1A 3D4MA 3KZQA 3E9JB 2J9HA 4Q5NA 5CNWA 2H6YA 2UZ8A 1PQNA 2V6KA 4OO5A 1EGRA 2IL3A 2VCVA 2VLVA 1K3LA 2IWTA 2F51A 2H1GA 1WOUA 4HZ4A 1K0DA 5ECKB 3EVIA 5DJLA 3A2WA 3KH7A 4GTUA 5E4WA 1ERUA 2LRCA 2CX3A 3KXOA 3ZFBA 4LLRA 2OACA 3D22A 1XBSA 1KEBA 1VF3A 2GGTA 5D8IA 4X43A 1PX6A 3DMLA 3GX8A 2LRNA 3UL3A 1N8JA 2IYJA 3BD2A 5INYA 3W6GA 3HA9A 2YZHA 2H30A 2RM6A 3GKXA 5DCGA 4HJMA 4TR3A 3FRCA 5JWOB 3UJ1A 3SBCA 3APSA 1S3DA 2YWOA 2GTUA 1VF1A 2V6OA 2HNLA 5GAND 1MDJA 3MAKA 4POMA 4ZB9A 5KEJA 2H0IA 1ON4A 1BG5A 3F3RA 2VOCA 1V57A 1U3IA 1XVQA 1FVJA 4IVFA 4NPBA 4V1Ag 3HJPA 4K5SA 3F4SA 1SK1A 5IM9A 2AV4A 2I1UA 2E2GA 2B5EA 2HRAA 2R3XA 1XOBA 5DALA 2EIRA 2H70A 4WR5A 3DXBA 5J4UA 1BYEA 4PURA 3C73A 5EY6A 2WB9A 2NPBA 4L8EA 4EUYA 2VLTA 1SYRA 1YEPA 1EZKA 3D21A 3G7YA 1XWCA 2G2QA 2QGVA 5BMUA 3VWXA 3HZ8A 4OMVA 4TR1A 4POKA 4GQFA 2AAWA 3IV4A 3LYPA 3UMAA 5G1LA 3UOMA 2B6MA 4TRXA 3RHCA 4CHSA 3QDNA 3PR8A 1SJ6A 5ECIB 2HE3A 4GRFA 1A24A 2YWIA 5B6NA 4HUAA 4J57E 5BRTA 4MJCA 2R0CA 3FW2A 1SL1B 4JE1A 2V2GA 2H0GA 4J56E 3E3EA 4Z2RA 3LXZA 3IHQA 2DIZA 2LTKA 3A5WA 2YWNA 4HJ2A 1X5CA 5ECMB 2GLRA 4KNDA 1R26A 5CRWA 3U6VA 5IQYA 4IKHA 5J3RA 1ZZYA 2C80A 1XCCA 4EIPA 3VLNA 4BVYA 3PPUA 3BBYA 1GP1A 1TI1A 4XRAA 2XBQA 1HD2A 2JU5A 4TVEA 4DSQA 1VF2A 3BCKA 4ZIJA 4QQ7A 2DMMA 3CSJA 2DKIA 3GKMA 2K6VA 2GQLA 2PMTA 1O81A 4WETA 4HU9A 2X4AA 4YAPA 4GQCA 1NHOA 2TRXA 2C3NA 2M46A 2MZCA 4LL1B 1IYIA 5HR1A 4NV2A 1O85A 1H4OA 5ECRB 4F9ZA 1X0RA 4ZILA 4GLTA 3D5JA 1A8LA 4EDYA 5IMFA 2KHPA 2LQQA 4KUNA 4ILFA 1NM3A 1GLQA 3G7JA 1BQ7A 4LMVA 4PX1A 4NHWA 3WD6A 3IE3A 1EEJA 3L4NA 2R37A 3RPNA 2H6XA 1JZOA 1O6JA 2F8FA 4XCSA 1TRVA 3FR6A 1KTEA 4XTSA 2MBTA 1UN2A 5CAXA 3H79A 4ID0A 4KSMA 2LSTA 2WRTA 2L4CA 2E0QA 2GSRA 2HRKA 2R0PA 4GCIA 4EF0A 1S3CA 4V2MA 1FW1A 2IFQB 3P7XA 1T00A 1YJ6A 2QA2A 4RI6A 2GSQA 2QKEA 1R7HA 4PUAA 4ECCA 4IP6A 4KSOA 1DUGA 3GL3A 3J7Yb 1TI3A 2OBKA 1AAZA 2GS3A 2B1LA 4K5RA 3IC8A 3O76A 1A0RP 4YQMA 1JZDA 2GQKA 1T8EB 3HDCA 3FEUA 5COHA 1HQOA 3EMXA 4PGTA 3IRAA 2FA4A 1MD3A 3TKRA 5IPGA 1CQHA 6GSSA 1Z7RA 1OAZA 1Q98A 3IA1A 1BJXA 3KMNA 1SK0A 4MZCA 4KA0A 3C1SA 4YQUA 1TRUA 4MJBA 3UVHA 1SL2B 2FLSA 1K0AA 2FCHA 1URMA 1GSFA 1WMJA 1O8XA 5F06A 4MPGA 2CZ3A 1T4ZA 1NSWA 5G1KA 3CYNA 4EE0A 4N30A 2LKUA 4TW5A 1OE8A 3EC3A 4AGSA 1USBA 4WXTA 5KN0A 4GSNA 3EU4A 2R5GA 5ABRA 2YV7A 3RHBA 1PL2A 1TU7A 5ID2B 1PN0A 1TK5B 16GSA 2CA8A 18GSA 4OO4A 1OC3A 2YP6A 1WPIA 1J9BA 4FIWA 1LJRA 2L5OA 1B9XC 2F8AA 4MMMA 1SKSB 4IN0A 4HDEA 4XRDA 1ACVA 3ZIVA 4ECJA 3L9SA 5GSTA 14GSA 2YN1A 2NVLA 1EEMA 2K8VA 4KDUA 3ZREA 2MMAA 2C3TA 3P90A 4TR4A 2JSZA 5DAKA 4OWYA 5AIVA 4EKZA 5ID2A 3FYGA 1BEDA 3LWAA 1EV4A 2X8HA 2VD1A 5JWQB 3KP8A 4ZL7A 2BJXA 1M2AA 1LU4A 3GUSA 1ZYNA 2C0FA 4ACSA 1ILOA 4LL4B 2LJKA 4POLA 3TGZA 4TKYA 5A4WA 1T4YA 5A4VA 4Z2UA 2O89A 1ERTA 2H1BA 1Y25A 5FWGA 3MWHA 3EU3A 3QPMA 5ECHB 19GSA 1OYJA 3ZL5A 2CV4A 1THXA 2CX4A 5CO3A 1PRXA 2H1DA 5IPHA 1Z5YE 1B9YC 6GSUA 5AN1A 1DSBA 1A2LA 3GSTA 3QFBC 3P2AA 3L0HA 1F3AA 1XIYA 2HZEB 4OFNA 1TRSA 2YPMA 5B7CA 1SKWB 17GSA 3UVTA 5AGYA 2RIIA 2HYXA 3H8QA 3DKSA 4IGJA 3DEXA 2PU9C 4K2DA 4K8MA 2FWEA 4JEDA 1BAYA 2FUG2 4CDOA 1HNCA 1UVZA 1J0FA 2WDUA 2JACA 4G10A 2ALBA 4I2UA 1EWXA 3ZVJA 1K0MA 1DE1A 2IMFA 4O7HA 2RLIA 2VAFA 2HSMA 4OFMA 4A5PA 2C1YA 2CZ2A 3QR6A 2ZCTA 2PGTA 4XS1A 2A2SA 3VK9A 3TJGA 5DBQA 4K2XA 4NAXA 4TXVA 3GX0A 3ZYWA 3CBUA 4RUVA 3KD0A 4MJEA 1R5AA 3UBLA 3D0ZA 3QFAC 2QSIA 3G9BA 1A0FA 1M2BA 1QK8A 3NIVA 4USSA 1QXHA 2DIYA 5AISA 5IMDA 3GURA 2K8SA 2AUVA 4O5UA 2DJ2A 1XWKA 2V32A 4BVYB 5IMZA 1PN9A 1ABAA 3N9JA 2N5FA 4Q5FA 3VWWA 2OE1A 3HD5A 5DJMA 3KH9A 3Q18A 3WGDA 2FWGA 1TW9A 1WJKA 3LFLA 1QUWA 2B7KA 2BTOT 4YKGA 1SENA 4MLYA 3VI5A 4WR4A 3FY7A 3EURA 5IMAA 1ZL9A 1NW2A 2JZRA 1YKAA 2X64A 4D73A 6GSTA 2GVPA 5F8BA 3TCOA 2REMA 1WP0A 3S9FA 3CTFA 2TRCP 3F0IA 1R5PA 1HYUA 5CYYA 5IMCA 4G0IA 3F4TA 1TDIA 4ZB6A 3TJFA 2VL3A 3ERGA 2QA1A 2DJ0A 3PGTA 1FOHA 3TKQA 1YEXA 2XHFA 3ISOA 3FKFA 2CVKA 1ZYPA 3EYTA 5JCUA 3KTLA 4WF4A 3GSSA 1OVNA 4KF9A 2LV3A 1ML6A 1GSQA 3HCZA 1ZMAA 4PQIA 3UAPA 2KLXA 2LNSA 4KE3A 4G19A 2DJJA 1TU8A 4IQAA 4K1FA 2H73A 13GSA 1RQMA 1FAAA 3CSHA 1AC1A 4JR6A 1C72A 3LGCA 3KCMA 4HI7A 1Z6MA 1WWJA 2MMZA 2WJUA 3F4RA 4DVCA 1O7UA 5HR2A 5LCZA 3LJRA 3CMIA 9GSSA 5IOXA 3I6AA 4ICYA 4QL9A 5GZZB 1GWCA 3GHAA 3A2XA 5A4UA 4ULXA 5GAPD 2FHEA 3IAM2 2C0DA 1XXUA 4K6XA 4MA9A 4GF0A 3GH6A 3GFKA 1B4QA 2HT9A 4OCFA 3RDWA 1B8XA 5CP1A 2YJHA 1YKCA 4K7OA 5ECQB 1ERWA 4O92A 7GSSA 1SL0B 2PWJA 1T3BA 2IIYA 3PINA 2PUKC 2MYGA 4XHMA 2JSYA 4OCEA 2GQMA 1X5DA 3MDKA 1TP9A 4I8BA 4K0GA 3ME7A 2WZ9A 2P5QA 4PNFA 2A2PA 4KDYA 2HRNA 2PVOC 5EL8A 4MF5A 4ML1A 3C8EA 4G2EA 1JHBA 2FNOA 5ECNB 5H5QA 3GMFA 1EP7A 4DSRA 1FO5A 3KMOA 4K7IA 1K3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OKA A;  3RPP A;  2P0G A;  1FVK A;  3GIX A;  1M9B A;  1YY7 A;  5IMV A;  1EP8 A;  5B8A A;  1IYH A;  2B5Y A;  1AQW A;  4GST A;  3TRP A;  3ZRD A;  4J2F A;  5F05 A;  4MZB A;  3IAS 2;  1V98 A;  4EDZ A;  1YF0 A;  5ENU A;  3H1N A;  5DQS A;  3TJB A;  3RBT A;  3IOS A;  4F0B A;  1K3Y A;  1XFL A;  1Z9H A;  3GL5 A;  2MMO A;  2D2Z A;  3EWL A;  1GUK A;  3F8U A;  3HJM A;  3I43 A;  4TN8 A;  3E0U A;  2V1M A;  2I9H A;  4FYC A;  4MZW A;  1QMV A;  3ERF A;  1K0N A;  1F2E A;  3KTB A;  1SK2 A;  1F37 A;  2JL4 A;  2HLS A;  4P3Y B;  3W8S A;  1G6Y A;  4ML6 A;  4JBB A;  2YOI A;  3GKN A;  4ZXG A;  1GL8 A;  2VUP A;  4K0N A;  1U6T A;  3DVX A;  3NOF A;  6GSX A;  2HFD A;  3IXR A;  1H75 A;  3M0F A;  3US3 A;  5LD0 A;  3VPT A;  4IHU A;  5HQP A;  1ST9 A;  4N11 A;  2PPT A;  4Q5Q A;  3UIW A;  2OBI A;  4IJI A;  4IJ3 A;  2VL9 A;  3RAZ A;  3D6I A;  4WBR D;  4MF7 A;  3F63 A;  1PSQ A;  3I69 A;  3M3M A;  4BWS A;  2O87 A;  5ELG A;  1AW9 A;  2CAQ A;  1M2D A;  2LRT A;  1WRY A;  4V2L A;  4LA1 A;  2L4Q A;  6GSY A;  3L78 A;  3PH9 A;  4E8H A;  2KUC A;  1XWA A;  5JWR B;  3O6T A;  3WT2 A;  2RUE A;  11GS A;  2CVB A;  4BL7 A;  1PX7 A;  1U88 A;  1J08 A;  2XBI A;  5IO2 A;  2I4A A;  1PKW A;  2H72 A;  2V41 A;  3GN3 A;  1ZCP A;  2JZS A;  1GSD A;  1EGO A;  1YDK A;  1QGV A;  2IJY A;  2X8G A;  2VM1 A;  2H8L A;  1V2A A;  2HZE A;  4IQ1 A;  3IK7 A;  2IFQ A;  1O8W A;  2I81 A;  4DEJ A;  3V1W A;  4GXZ A;  2VCZ A;  3IDV A;  22GS A;  1K0B A;  1MTC A;  3HVS A;  1HNB A;  4H86 A;  2LEG A;  5E59 A;  3TRX A;  3H93 A;  2YNX A;  3HKR A;  4MH3 A;  3MSZ A;  3TJK A;  2YV9 A;  4PNG A;  4O5R A;  5DCH A;  4AJ6 A;  2HI7 A;  3K8N A;  4IW9 A;  1PA3 A;  5J9B A;  2LJR A;  1TK8 B;  4JZQ A;  2ZNM A;  1SKR B;  2JZT A;  3HXS A;  1ZYE A;  2VCW A;  3QMX A;  1FG4 A;  5DAK B;  3ZZX A;  3J7Y k;  5IIZ A;  4RQR A;  2DML A;  3DD3 A;  5G31 A;  3L9U A;  1GTU A;  5C00 A;  4XS4 A;  1GSE A;  5CRE A;  1U3A A;  2YCD A;  2B5X A;  4MDC A;  1OKT A;  3FZ5 A;  3Q6O A;  1G6W A;  5A5K A;  3QD9 A;  4MH2 A;  3CTG A;  3FZ9 A;  1MDI A;  1TOF A;  1TKD B;  1PMT A;  3Q74 A;  3GH9 A;  1M9A A;  5G2Z A;  1M99 A;  5G5F A;  4I5Q A;  5HR3 A;  1BX9 A;  2L5L A;  3OR5 A;  3EIN A;  1XZO A;  2E2M A;  2RM5 A;  2YAN A;  3M1G A;  3M8N A;  1LBK A;  5AIX A;  1X5E A;  2B1K A;  2DJ3 A;  4QL7 A;  4N10 A;  3H4K A;  2K18 A;  1RK4 A;  2HRF A;  4ZBD A;  5DDL A;  1E2Y A;  4V2N A;  4FO5 A;  3GA4 A;  4GWR A;  5ELA A;  2IMD A;  2P5R A;  4Q5R A;  3ZMK A;  4ZBB A;  4DSS A;  4ZL8 A;  1QQ2 A;  4PQH A;  4HQS A;  1V9W A;  2C3Q A;  5JCG A;  3QAG A;  2WGR A;  1XWG A;  4IS0 A;  1TJD A;  2AHE A;  1AQV A;  3FR3 A;  5D9T A;  6GSW A;  4D73 B;  2VD0 A;  2H19 A;  5B6M A;  3TRQ A;  4ZB8 A;  2VIM A;  3GTU B;  4L0U A;  4HS1 A;  2DBC A;  5G30 A;  4F0C A;  5DAL B;  10GS A;  4KGI A;  4MAB A;  1OC9 A;  4N0Z A;  1RW1 A;  3TKS E;  3U5R E;  3EE2 A;  4ZL9 A;  3VWV A;  1A8Y A;  3TJJ A;  1ZOF A;  4AF2 A;  4V1A p;  8GSS A;  2IME A;  2JAD A;  5J9C A;  4RI7 A;  3F6F A;  3FZA A;  1GSY A;  2E7P A;  3VFI A;  4OFT A;  1K0O A;  4YAV A;  1Z3E A;  3BOA A;  1MD4 A;  3F9U A;  1O73 A;  4HOJ A;  3M9K A;  1SU9 A;  1AQX A;  4MCU A;  4NHZ A;  4TOP A;  5EVO A;  4KW6 A;  5CRD A;  2H76 A;  2L59 A;  4HEA 2;  6GSV A;  1SYX A;  2OE3 A;  4KCE A;  3UBK A;  3LG6 A;  3WGX A;  2FGX A;  5B8B A;  2QC7 A;  1SD8 A;  3WGE A;  4KB3 A;  3TKS A;  5D9V A;  4CW9 A;  3QAW A;  1AXD A;  1VF4 A;  2X99 A;  1A23 A;  3EMP A;  3M9J A;  3IC4 A;  3C1R A;  2H66 A;  2PBJ A;  3GRX A;  1M0U A;  1GSS A;  1MEK A;  2B7J A;  2H0H A;  2OE0 A;  3ZFL A;  4XS4 B;  2OA7 A;  1GTA A;  2F9S A;  1G7O A;  3LQ7 A;  2C0E A;  4L0W A;  3I9V 2;  1GH2 A;  4GSS A;  1G0T A;  4RQX A;  4KDX A;  2O7K A;  4ECB A;  2L57 A;  2R4V A;  3BJ5 A;  2K9F A;  3KJY A;  2CT6 A;  2XPD A;  2GZZ A;  4WF5 A;  1XOA A;  5CRG A;  1GRX A;  1YQ1 A;  2RUF A;  1JLW A;  1I5G A;  2N5B A;  3ZTL A;  3ME8 A;  4PUF C;  3TKS C;  3KP9 A;  3UAR A;  4X1U A;  3C7M A;  2GST A;  3CXG A;  2ON5 A;  2IY2 A;  2GDR A;  5GSS A;  4HZ2 A;  2NTO A;  3DRN A;  3A3T A;  1PD2 1;  1W89 A;  1K0C A;  2ON7 A;  2FWH A;  3APQ A;  3D4T A;  2KOK A;  4WKW A;  2C8U A;  3APO A;  2YWM A;  2LQO A;  3HZ4 A;  1JZR A;  3ZIT A;  3HHV A;  2M80 A;  2WUL A;  2DLX A;  4L5O A;  4EL1 A;  3GKK A;  2M72 A;  2DJ1 A;  2H1A A;  3ZLP A;  3VWU A;  2EIO A;  3FHK A;  1TTZ A;  3LXT A;  2AJQ B;  2VM2 A;  1X9S B;  1GLP A;  5IO0 A;  1XPV A;  2PVQ A;  3QCP A;  1OC8 A;  1Z7P A;  2IMK A;  2L6C A;  3F6D A;  3IK9 A;  4I2T A;  1TXX A;  2H01 A;  3A2V A;  1XWB A;  4IP1 A;  1GUM A;  2PER A;  1X9M B;  2HSY A;  4EO3 A;  4F82 A;  2WS2 A;  4NWY A;  4HU7 A;  1N2A A;  2YZU A;  20GS A;  1V58 A;  2VO4 A;  3GTU A;  1W4V A;  5ECO B;  3VI7 A;  5G5E A;  3BCI A;  4NMU A;  4LMW A;  3R2Q A;  4ZBA A;  5FHI A;  2O85 A;  4JR4 A;  1VRS D;  2DJK A;  2VCX A;  4N0V A;  4BVX A;  2PN8 A;  2GZY A;  5D9W A;  2FA8 A;  3WT1 A;  1M7T A;  3NZN A;  1B48 A;  2AB6 A;  3ZML A;  4AJ8 A;  4OD7 A;  2LUS A;  5HFK A;  2VCT A;  4NV5 A;  5D73 A;  2ES7 A;  4O32 A;  1T1V A;  5KN1 A;  3O3T A;  4MJA A;  1FHE A;  4KH7 A;  3KGK A;  1GNE A;  1WIK A;  1JFU A;  1WE0 A;  4IEL A;  4NXI A;  5EPF A;  4X0X A;  1UC7 A;  3CSI A;  1XW5 A;  2OAD A;  5D9X A;  2R6K A;  4F03 A;  5J41 A;  3TUE A;  1G7E A;  3VPQ A;  3FZ4 A;  1SJI A;  5HFI A;  2A2R A;  4YH2 A;  2CVD A;  3LSZ A;  2XPE A;  4MF6 A;  2VL2 A;  3QAV A;  1PL1 A;  2C0G A;  2CQ9 A;  2EIQ A;  2VL2 C;  1YZX A;  2WCI A;  2L6D A;  4TXO A;  3IPZ A;  1GNW A;  2GT6 A;  1GUH A;  2KP1 A;  4IBP A;  4K9Z A;  2FWF A;  4WEY A;  4XIH A;  4TR1 B;  2GZP A;  3GYK A;  3CRU A;  2MMN A;  3HVV A;  2XC2 A;  5C04 A;  1X9W B;  2H6Z A;  1E6B A;  2GSS A;  3LOR A;  2DSA A;  2HZF A;  2NBS A;  1XW6 A;  3KEB A;  1F9M A;  3KM6 A;  2N5A A;  1Y6E A;  1PKZ A;  2P31 A;  4I97 A;  5ECL B;  3IR4 A;  4JU5 A;  2VCQ A;  1GTI A;  1TRW A;  1Z6N A;  2G0F A;  1VGL A;  2H75 A;  3Q19 A;  5H5R A;  3TB2 A;  5H5S A;  1GSU A;  4MK3 A;  2VLU A;  3DYR A;  1XVW A;  2HSH A;  4TR0 A;  2I3Y A;  2H74 A;  1QFN A;  2GT5 A;  2IN3 A;  1OC9 B;  2LS5 A;  1ZYQ B;  4WBJ A;  2DC5 A;  1DBY A;  4EC0 A;  2NDO A;  1YF1 A;  3ZIJ A;  1DE2 A;  3P8W A;  2IPA A;  4KCA A;  1V40 A;  1ERV A;  2IMI A;  1EOH A;  4FYB A;  4E8E A;  3KIJ A;  1HNA A;  5CRH A;  1CQG A;  1KNG A;  1AUC A;  5F0G A;  3IBH A;  3UEM A;  1U87 A;  2J23 A;  1XW9 A;  1B4P A;  5KN3 A;  1GUL A;  3VUR A;  2O8V B;  3DIE A;  3C71 A;  1THO A;  4L5L A;  4MP4 A;  2LNT A;  3GV1 A;  3HJO A;  3LYK A;  1R4W A;  4KAE A;  5IOW A;  4FYU A;  5FT3 A;  1UA5 A;  3DWV A;  3G7I A;  5HR0 A;  4YQV A;  5D93 A;  4EVM A;  1A2M A;  4ECI A;  2H71 A;  1EV9 A;  3LEF A;  3AY8 A;  3FK8 A;  5KN2 A;  1MDK A;  3ED3 A;  3TDG A;  3JCM L;  4I6X A;  1A2J A;  5L71 A;  2TIR A;  3QOU A;  3N5O A;  2OJL A;  1FOV A;  5ECS A;  1S3A A;  5DVB A;  5LNK e;  3SWL A;  2KP2 A;  2AYT A;  1OKD A;  2BMX A;  4BA7 A;  4TXO B;  5F07 A;  1EOG A;  2WFC A;  3HY2 A;  1GTB A;  3TKP A;  3L9V A;  4POB A;  2F3M A;  2HXK A;  1KBN A;  2EC4 A;  4Z7X A;  1F3B A;  3DGQ A;  12GS A;  3F3Q A;  1NHY A;  1ZGN A;  1F6M C;  2MBS A;  1SD9 A;  5DQY A;  2X8C A;  4JRR A;  4FH8 A;  1OE7 A;  1FB0 A;  1I9D A;  2C4J A;  4MPF A;  4EXJ A;  2YJ7 A;  1SJZ A;  1PGT A;  4F2I A;  5D96 A;  4BPY A;  1JZW A;  2LJA A;  1JLV A;  3ERW A;  4K7N A;  3TOU A;  1TK0 B;  4G9H A;  2R2J A;  4HQZ A;  4DSS B;  3DVW A;  5J5N A;  3MNG A;  4ISD A;  5HFG A;  1T7P B;  3HYP A;  4BWQ A;  5ECP B;  3HVX A;  4PXO A;  3TOT A;  2ZUP A;  3CRT A;  3ZVJ D;  2FD3 A;  3W8J A;  3WYW A;  2FY6 A;  1Q4J A;  2B3S A;  1FB6 A;  2CAI A;  2Z9S A;  3GNJ A;  3FR9 A;  2A4V A;  5JCW A;  4AJ7 A;  4KX4 A;  4XS6 A;  1AIU A;  4PQ1 A;  3D4M A;  3KZQ A;  3E9J B;  2J9H A;  4Q5N A;  5CNW A;  2H6Y A;  1PQN A;  2V6K A;  4OO5 A;  1EGR A;  2IL3 A;  2VCV A;  2VLV A;  1K3L A;  2IWT A;  2F51 A;  2H1G A;  1WOU A;  4HZ4 A;  1K0D A;  5ECK B;  3EVI A;  5DJL A;  3A2W A;  3KH7 A;  4GTU A;  5E4W A;  1ERU A;  2LRC A;  2CX3 A;  3KXO A;  3ZFB A;  4LLR A;  2OAC A;  3D22 A;  1XBS A;  1KEB A;  1VF3 A;  2GGT A;  5D8I A;  4X43 A;  1PX6 A;  3DML A;  3GX8 A;  2LRN A;  3UL3 A;  1N8J A;  2IYJ A;  3BD2 A;  5INY A;  3W6G A;  3HA9 A;  2YZH A;  2H30 A;  2RM6 A;  3GKX A;  5DCG A;  4HJM A;  4TR3 A;  3FRC A;  5JWO B;  3UJ1 A;  3SBC A;  3APS A;  1S3D A;  2YWO A;  2GTU A;  1VF1 A;  2V6O A;  2HNL A;  5GAN D;  1MDJ A;  3MAK A;  4POM A;  4ZB9 A;  5KEJ A;  2H0I A;  1ON4 A;  1BG5 A;  3F3R A;  2VOC A;  1V57 A;  1U3I A;  1XVQ A;  1FVJ A;  4IVF A;  4NPB A;  4V1A g;  3HJP A;  3F4S A;  1SK1 A;  5IM9 A;  2AV4 A;  2I1U A;  2E2G A;  2B5E A;  2R3X A;  1XOB A;  5DAL A;  2EIR A;  2H70 A;  4WR5 A;  3DXB A;  5J4U A;  1BYE A;  4PUR A;  3C73 A;  5EY6 A;  2WB9 A;  2NPB A;  4L8E A;  4EUY A;  2VLT A;  1SYR A;  1YEP A;  1EZK A;  3D21 A;  3G7Y A;  1XWC A;  2G2Q A;  2QGV A;  3VWX A;  3HZ8 A;  4OMV A;  4TR1 A;  4POK A;  4GQF A;  2AAW A;  3IV4 A;  3LYP A;  3UMA A;  5G1L A;  3UOM A;  2B6M A;  4TRX A;  3RHC A;  4CHS A;  3QDN A;  3PR8 A;  1SJ6 A;  5ECI B;  2HE3 A;  4GRF A;  1A24 A;  2YWI A;  5B6N A;  4HUA A;  4J57 E;  4MJC A;  3FW2 A;  1SL1 B;  4JE1 A;  2V2G A;  2H0G A;  4J56 E;  3E3E A;  3LXZ A;  3IHQ A;  2DIZ A;  2LTK A;  3A5W A;  2YWN A;  4HJ2 A;  1X5C A;  5ECM B;  2GLR A;  4KND A;  1R26 A;  5CRW A;  3U6V A;  5IQY A;  4IKH A;  5J3R A;  1ZZY A;  2C80 A;  1XCC A;  3VLN A;  4BVY A;  3BBY A;  1GP1 A;  1TI1 A;  4XRA A;  2XBQ A;  1HD2 A;  2JU5 A;  4TVE A;  4DSQ A;  1VF2 A;  3BCK A;  4ZIJ A;  4QQ7 A;  2DMM A;  3CSJ A;  3GKM A;  2K6V A;  2GQL A;  2PMT A;  1O81 A;  4WET A;  4HU9 A;  4YAP A;  4GQC A;  1NHO A;  2TRX A;  2C3N A;  2M46 A;  2MZC A;  4LL1 B;  1IYI A;  5HR1 A;  4NV2 A;  1O85 A;  1H4O A;  5ECR B;  4F9Z A;  1X0R A;  4ZIL A;  4GLT A;  3D5J A;  1A8L A;  4EDY A;  5IMF A;  2KHP A;  2LQQ A;  4KUN A;  4ILF A;  1NM3 A;  1GLQ A;  3G7J A;  1BQ7 A;  4LMV A;  4PX1 A;  4NHW A;  3WD6 A;  3IE3 A;  1EEJ A;  3L4N A;  2R37 A;  3RPN A;  2H6X A;  1JZO A;  1O6J A;  2F8F A;  4XCS A;  1TRV A;  3FR6 A;  1KTE A;  4XTS A;  2MBT A;  1UN2 A;  5CAX A;  3H79 A;  4ID0 A;  4KSM A;  2LST A;  2WRT A;  2L4C A;  2E0Q A;  2GSR A;  4GCI A;  4EF0 A;  1S3C A;  4V2M A;  1FW1 A;  2IFQ B;  3P7X A;  1T00 A;  1YJ6 A;  4RI6 A;  2GSQ A;  2QKE A;  1R7H A;  4PUA A;  4ECC A;  4IP6 A;  4KSO A;  1DUG A;  3GL3 A;  3J7Y b;  1TI3 A;  2OBK A;  1AAZ A;  2GS3 A;  2B1L A;  3O76 A;  1A0R P;  4YQM A;  1JZD A;  2GQK A;  1T8E B;  3HDC A;  3FEU A;  5COH A;  1HQO A;  3EMX A;  4PGT A;  3IRA A;  2FA4 A;  1MD3 A;  3TKR A;  5IPG A;  1CQH A;  6GSS A;  1Z7R A;  1OAZ A;  1Q98 A;  3IA1 A;  1BJX A;  3KMN A;  1SK0 A;  4MZC A;  4KA0 A;  3C1S A;  4YQU A;  1TRU A;  4MJB A;  3UVH A;  1SL2 B;  2FLS A;  1K0A A;  2FCH A;  1URM A;  1GSF A;  1WMJ A;  1O8X A;  5F06 A;  4MPG A;  2CZ3 A;  1T4Z A;  1NSW A;  5G1K A;  3CYN A;  4EE0 A;  4N30 A;  2LKU A;  4TW5 A;  1OE8 A;  3EC3 A;  4AGS A;  1USB A;  4WXT A;  5KN0 A;  4GSN A;  3EU4 A;  2R5G A;  5ABR A;  2YV7 A;  3RHB A;  1PL2 A;  1TU7 A;  5ID2 B;  1TK5 B;  16GS A;  2CA8 A;  18GS A;  4OO4 A;  1OC3 A;  2YP6 A;  1WPI A;  1J9B A;  4FIW A;  1LJR A;  2L5O A;  1B9X C;  2F8A A;  4MMM A;  1SKS B;  4IN0 A;  4HDE A;  4XRD A;  1ACV A;  3ZIV A;  4ECJ A;  3L9S A;  5GST A;  14GS A;  2YN1 A;  2NVL A;  1EEM A;  2K8V A;  4KDU A;  3ZRE A;  2MMA A;  2C3T A;  3P90 A;  4TR4 A;  2JSZ A;  5DAK A;  4OWY A;  5AIV A;  4EKZ A;  5ID2 A;  3FYG A;  1BED A;  3LWA A;  1EV4 A;  2X8H A;  2VD1 A;  5JWQ B;  3KP8 A;  4ZL7 A;  2BJX A;  1M2A A;  1LU4 A;  3GUS A;  2C0F A;  4ACS A;  1ILO A;  4LL4 B;  2LJK A;  4POL A;  3TGZ A;  4TKY A;  5A4W A;  1T4Y A;  5A4V A;  2O89 A;  1ERT A;  2H1B A;  1Y25 A;  5FWG A;  3MWH A;  3EU3 A;  3QPM A;  5ECH B;  19GS A;  1OYJ A;  3ZL5 A;  2CV4 A;  1THX A;  2CX4 A;  5CO3 A;  1PRX A;  2H1D A;  5IPH A;  1Z5Y E;  1B9Y C;  6GSU A;  5AN1 A;  1DSB A;  1A2L A;  3GST A;  3QFB C;  3P2A A;  3L0H A;  1F3A A;  1XIY A;  2HZE B;  4OFN A;  1TRS A;  2YPM A;  5B7C A;  1SKW B;  17GS A;  3UVT A;  5AGY A;  2RII A;  2HYX A;  3H8Q A;  3DKS A;  4IGJ A;  3DEX A;  2PU9 C;  4K2D A;  4K8M A;  2FWE A;  4JED A;  1BAY A;  2FUG 2;  4CDO A;  1HNC A;  1UVZ A;  1J0F A;  2WDU A;  2JAC A;  4G10 A;  2ALB A;  4I2U A;  1EWX A;  3ZVJ A;  1K0M A;  1DE1 A;  2IMF A;  4O7H A;  2RLI A;  2VAF A;  4OFM A;  2C1Y A;  2CZ2 A;  3QR6 A;  2ZCT A;  2PGT A;  4XS1 A;  2A2S A;  3VK9 A;  3TJG A;  5DBQ A;  4NAX A;  4TXV A;  3GX0 A;  3ZYW A;  3CBU A;  4RUV A;  3KD0 A;  4MJE A;  1R5A A;  3UBL A;  3D0Z A;  3QFA C;  2QSI A;  3G9B A;  1A0F A;  1M2B A;  1QK8 A;  3NIV A;  1QXH A;  2DIY A;  5AIS A;  5IMD A;  3GUR A;  2K8S A;  2AUV A;  2DJ2 A;  1XWK A;  2V32 A;  5IMZ A;  1PN9 A;  1ABA A;  3N9J A;  2N5F A;  4Q5F A;  3VWW A;  2OE1 A;  3HD5 A;  5DJM A;  3KH9 A;  3Q18 A;  3WGD A;  2FWG A;  1TW9 A;  1WJK A;  3LFL A;  1QUW A;  2B7K A;  2BTO T;  1SEN A;  4MLY A;  3VI5 A;  4WR4 A;  3FY7 A;  3EUR A;  5IMA A;  1ZL9 A;  1NW2 A;  2JZR A;  1YKA A;  2X64 A;  4D73 A;  6GST A;  2GVP A;  5F8B A;  3TCO A;  2REM A;  1WP0 A;  3S9F A;  3CTF A;  2TRC P;  3F0I A;  1R5P A;  1HYU A;  5CYY A;  5IMC A;  3F4T A;  1TDI A;  4ZB6 A;  3TJF A;  2VL3 A;  3ERG A;  2DJ0 A;  3PGT A;  3TKQ A;  1YEX A;  2XHF A;  3ISO A;  3FKF A;  2CVK A;  3EYT A;  3KTL A;  5JCU A;  4WF4 A;  3GSS A;  1OVN A;  2LV3 A;  1ML6 A;  1GSQ A;  3HCZ A;  1ZMA A;  4PQI A;  3UAP A;  2KLX A;  2LNS A;  4KE3 A;  4G19 A;  2DJJ A;  1TU8 A;  4IQA A;  4K1F A;  2H73 A;  13GS A;  1RQM A;  1FAA A;  3CSH A;  1AC1 A;  4JR6 A;  1C72 A;  3LGC A;  3KCM A;  4HI7 A;  1Z6M A;  1WWJ A;  2MMZ A;  2WJU A;  3F4R A;  4DVC A;  1O7U A;  5HR2 A;  5LCZ A;  3LJR A;  3CMI A;  9GSS A;  5IOX A;  3I6A A;  4QL9 A;  5GZZ B;  1GWC A;  3GHA A;  3A2X A;  5A4U A;  4ULX A;  5GAP D;  2FHE A;  3IAM 2;  2C0D A;  1XXU A;  4K6X A;  4MA9 A;  4GF0 A;  3GH6 A;  3GFK A;  1B4Q A;  2HT9 A;  4OCF A;  3RDW A;  1B8X A;  5CP1 A;  2YJH A;  1YKC A;  4K7O A;  5ECQ B;  1ERW A;  4O92 A;  7GSS A;  1SL0 B;  2PWJ A;  1T3B A;  2IIY A;  3PIN A;  2PUK C;  2MYG A;  4XHM A;  2JSY A;  4OCE A;  2GQM A;  1X5D A;  3MDK A;  1TP9 A;  4I8B A;  4K0G A;  3ME7 A;  2WZ9 A;  2P5Q A;  4PNF A;  4KDY A;  2HRN A;  2PVO C;  5EL8 A;  4MF5 A;  4ML1 A;  3C8E A;  4G2E A;  1JHB A;  2FNO A;  5ECN B;  5H5Q A;  3GMF A;  1EP7 A;  4DSR A;  1FO5 A;  3KMO A;  4K7I A;  1K3O A; 
#chains in the Genus database with same CATH topology
 2OKA A;  3RPP A;  2P0G A;  1FVK A;  3GIX A;  1M9B A;  1YY7 A;  5IMV A;  4FMC A;  1EP8 A;  5B8A A;  3UL5 A;  1IYH A;  2B5Y A;  4WWU C;  1AQW A;  4GST A;  3TRP A;  3I56 3;  3ZRD A;  1BVI A;  4J2F A;  3DGM A;  4K1U A;  5F05 A;  4MZB A;  3IAS 2;  1V98 A;  4EDZ A;  1YF0 A;  5ENU A;  1JB5 A;  3S28 A;  3H1N A;  5DQS A;  3TJB A;  1BSE A;  3RBT A;  3IOS A;  4F0B A;  3EE1 A;  1K3Y A;  3WHO A;  1XFL A;  1Z9H A;  1NB5 I;  1BSC A;  2MMO A;  2D2Z A;  3EWL A;  3GL5 A;  5IF6 A;  1GUK A;  3F8U A;  3HJM A;  3I43 A;  4TN8 A;  3EQQ B;  4Z2T A;  1LVN A;  3E0U A;  2V1M A;  2I9H A;  4FYC A;  3WR2 A;  4MZW A;  1QMV A;  1FGM A;  3ERF A;  1K0N A;  3GAX A;  1F2E A;  3KTB A;  1JV2 B;  1SK2 A;  1F37 A;  2JL4 A;  2HLS A;  3IJE B;  4P3Y B;  3W8S A;  1M1X B;  2Z6B A;  1G6Y A;  4ML6 A;  5HGR A;  1KQS 2;  4JBB A;  2YOI A;  3GKN A;  4ZXG A;  1GL8 A;  4K90 B;  2CG0 A;  1A67 A;  2VUP A;  4K0N A;  1F8N A;  1U6T A;  3I55 3;  2F86 B;  3DVX A;  3AMO A;  3NOF A;  6GSX A;  2HFD A;  2UUG C;  3IXR A;  1H75 A;  3HIG A;  1SJW A;  6STD A;  3M0F A;  1FUT A;  1IT8 A;  3US3 A;  5LD0 A;  3VPT A;  2Y73 A;  4KT3 B;  4IHU A;  5HQP A;  1ST9 A;  4N11 A;  5JPP A;  2PPT A;  1BSD A;  3EJV A;  1RGE A;  2OTJ 3;  4N3V A;  4Q5Q A;  2W9P A;  1VQ5 3;  3UIW A;  3GZY B;  2OBI A;  4G0L A;  4MMZ B;  4IJI A;  2CC3 A;  1RCL A;  4IJ3 A;  2VL9 A;  4EXR A;  3RAZ A;  3D6I A;  4WBR D;  4MF7 A;  3F63 A;  1PSQ A;  2LYX A;  3I69 A;  3M3M A;  4BWS A;  3JUO A;  5D81 A;  1LOY A;  2O87 A;  5ELG A;  1AW9 A;  5IER A;  2CAQ A;  2CFL A;  4HSC X;  4IT7 A;  1OPY A;  1MWT A;  1M2D A;  2LRT A;  1WRY A;  4XBX A;  4V2L A;  4LA1 A;  5LC6 A;  2L4Q A;  6GSY A;  1Q7H A;  2I9W A;  3L78 A;  2E2V A;  1YGW A;  5JPU A;  1L5G B;  2W9Q A;  3VSY A;  2KUC A;  3CCU 3;  3PH9 A;  1XWA A;  4E8H A;  5KOW A;  1IVU A;  5JWR B;  2SBL A;  1K41 A;  3O6T A;  3WT2 A;  2RUE A;  11GS A;  1UW1 A;  2CVB A;  5IEP A;  4BL7 A;  1PX7 A;  5KP4 A;  1W00 A;  2O3O A;  3LTB A;  3EHC A;  2CWV A;  1U88 A;  4EV2 A;  1J08 A;  2XBI A;  5IO2 A;  5IG3 A;  2ML6 A;  2I4A A;  1MGW A;  1PKW A;  2H72 A;  2V41 A;  3F8H A;  2W56 A;  3GN3 A;  1ZCP A;  2JZS A;  2FXT A;  1GSD A;  1B27 A;  1EGO A;  3RDE A;  3LXU X;  1YDK A;  1YIJ 3;  1QGV A;  2IJY A;  2X8G A;  2VM1 A;  1M3J A;  2H8L A;  1V2A A;  2HZE A;  3OV4 A;  2IUK A;  4IQ1 A;  1KD1 4;  3IK7 A;  2IFQ A;  1IQX A;  1O8W A;  2I81 A;  4DEJ A;  5EEO A;  3V1W A;  4GXZ A;  4LEH A;  2GEX A;  2VCZ A;  3IDV A;  5KP1 A;  1UI7 A;  2GU3 A;  22GS A;  1K0B A;  3CCS 3;  4R1K A;  2BT3 A;  1MTC A;  3HVS A;  1HNB A;  3G8Z A;  2XGL A;  4H86 A;  2LEG A;  5E59 A;  3MIX A;  1AVL A;  3TRX A;  5AYS C;  2XH9 A;  3H93 A;  3NHX A;  2YNX A;  3HKR A;  1X1Y A;  3HI7 A;  3G16 A;  1Q7Y 4;  4MH3 A;  3MSZ A;  4BVX B;  2CX0 A;  1ZX2 A;  4AKY A;  3TJK A;  1EA2 A;  2YV9 A;  3DGL A;  3GSP A;  4EIQ A;  4PNG A;  4O5R A;  5DCH A;  2CX1 A;  3UL6 A;  4AJ6 A;  1IYY A;  3LML A;  4L8P A;  2XF3 A;  2HI7 A;  3K8N A;  1RN7 A;  1YJ9 3;  4IW9 A;  1PA3 A;  5J9B A;  1ASK A;  2LJR A;  1TK8 B;  4JZQ A;  3RNT A;  2ZNM A;  1PYL A;  1RN4 A;  1SKR B;  2JZT A;  1SIH A;  3ROB A;  3HXS A;  1ZYE A;  4XDW A;  2VCW A;  3QMX A;  2A4H A;  1FG4 A;  5DAK B;  3ZZX A;  3J7Y k;  5IIZ A;  4QWT A;  4RQR A;  2DML A;  3DD3 A;  5G31 A;  3HVN A;  1BRI A;  3L9U A;  2ZA4 A;  3AHS A;  2K0M A;  1N8R 4;  1GTU A;  5C00 A;  4XS4 A;  1GSE A;  1IDP A;  5CRE A;  3A5I A;  1U3A A;  4DKI A;  2YCD A;  2B5X A;  4MDC A;  1OKT A;  3FZ5 A;  3Q6O A;  1G6W A;  5A5K A;  2R0G A;  3QD9 A;  4MH2 A;  2AAE A;  3CTG A;  3FZ9 A;  1MDI A;  1TOF A;  1IK3 A;  1TKD B;  1MWR A;  1PMT A;  3Q74 A;  3IHG A;  3GH9 A;  1IVV A;  1M9A A;  5G2Z A;  1M99 A;  5G5F A;  3UB1 A;  4I5Q A;  5HR3 A;  3Q1C A;  1GMP A;  1BX9 A;  2L5L A;  3OR5 A;  1UCI A;  4CDL A;  3FF2 A;  3EIN A;  4G0K A;  3J7Y d;  1XZO A;  2E2M A;  2RM5 A;  2YAN A;  3M1G A;  4BIK A;  3M8N A;  3GZB A;  3JUP A;  1UCL A;  2WOH A;  1VQ7 3;  1LBK A;  1Q40 A;  5AIX A;  1X5E A;  3DY5 A;  1GYB A;  2B1K A;  2DJ3 A;  4QL7 A;  4N10 A;  1NWW A;  3SLU A;  3H4K A;  2K18 A;  1JB4 A;  1RK4 A;  2HRF A;  4ZBD A;  3GZX B;  3JUN A;  5DDL A;  1E2Y A;  4V2N A;  4FO5 A;  3GA4 A;  4GWR A;  5ELA A;  2IMD A;  4XBY A;  2P5R A;  4Q5R A;  3ZMK A;  1Q9E A;  4ZBB A;  4DSS A;  4ZL8 A;  1QQ2 A;  1W4N A;  4PQH A;  4HQS A;  3DGO A;  1V9W A;  1JN5 B;  2C3Q A;  5JCG A;  3QAG A;  2WGR A;  1XWG A;  2BIR A;  1EG9 B;  3ZG0 A;  3NQY A;  4IS0 A;  1TJD A;  2AHE A;  1AQV A;  3FR3 A;  5D9T A;  6GSW A;  1QVG 2;  1VQ4 3;  5M1A A;  4D73 B;  2VD0 A;  2H19 A;  4OVM A;  5B6M A;  1AVK A;  3TRQ A;  1WMP A;  4ZB8 A;  2VIM A;  3AMO B;  5CF2 A;  1IQY A;  1TRP A;  3GTU B;  1B3S A;  1DMQ A;  1AV4 A;  4L0U A;  1I2F A;  2STD A;  1OGX A;  2Z77 A;  3VF1 A;  1AR0 A;  1FGT A;  1JBT A;  2O9U X;  2DBC A;  4HS1 A;  5G30 A;  4F0C A;  3OWU A;  5IG0 A;  1PU4 A;  5DAL B;  5ELJ A;  4KZ1 A;  10GS A;  4KGI A;  4MAB A;  4N6V 0;  1OC9 A;  1RW1 A;  4N0Z A;  3TKS E;  2RSX A;  3U5R E;  3EE2 A;  4ZL9 A;  3VWV A;  1A8Y A;  1K9M 4;  3TJJ A;  1ZOF A;  4AF2 A;  1GMQ A;  4V1A p;  8GSS A;  1RGF A;  2IME A;  1B2U A;  1B2M A;  1GMR A;  2JAD A;  5J9C A;  4RI7 A;  3F6F A;  4N6N B;  1U5O A;  3FZA A;  1W6Y A;  1GSY A;  2QA4 3;  2E7P A;  3VFI A;  2OQE A;  4OFT A;  1U8C B;  1K0O A;  4YAV A;  1Z3E A;  3CNM A;  3BOA A;  2CFK A;  3CXC 2;  1MD4 A;  3F9U A;  4O3V A;  3OW2 2;  1O73 A;  2YX9 A;  1Q86 4;  4HOJ A;  3M9K A;  3CC7 3;  2XSO B;  1SU9 A;  3UNL A;  4MEI A;  4N6T A;  1UI8 A;  1AQX A;  3NM7 A;  1M3I A;  4MCU A;  4NHZ A;  4TOP A;  5EVO A;  4GSP A;  3FMW A;  4KW6 A;  5CRD A;  2H76 A;  4GL6 A;  2L59 A;  4HEA 2;  6GSV A;  1RCK A;  1SYX A;  4J9A A;  5D82 A;  1HZ1 A;  1NU3 A;  3BNB A;  2OE3 A;  4KCE A;  3CCJ 3;  3LG6 A;  3UBK A;  3WGX A;  2FGX A;  2W04 A;  5B8B A;  3MPH A;  2QC7 A;  1SD8 A;  3WGE A;  2KF6 A;  1UDI I;  5CF1 A;  4KB3 A;  3TKS A;  5D9V A;  4CW9 A;  1EUI C;  3QAW A;  2E2U A;  1AXD A;  4O02 B;  1OUN A;  3FZW A;  4WP5 A;  1VF4 A;  2X99 A;  4CPK A;  1A23 A;  3EMP A;  3M9J A;  3IC4 A;  3DH2 A;  3URP A;  3C1R A;  2H66 A;  2PBJ A;  1BRS A;  3IPT A;  4CCV A;  1M0U A;  3GRX A;  1GSS A;  1MEK A;  2B7J A;  2WGQ A;  2H0H A;  2OE0 A;  3ZFL A;  4XS4 B;  2OA7 A;  1GTA A;  3CPO A;  2F9S A;  2RGQ A;  1G7O A;  1NJI 4;  3LQ7 A;  3ER7 A;  5LC7 A;  2C0E A;  4L0W A;  1FW7 A;  3I9V 2;  2XGN A;  1K28 A;  1GH2 A;  4GSS A;  1G0T A;  3CD6 3;  4RQX A;  4KDX A;  2O7K A;  4ECB A;  3B4O A;  3N9H A;  2L57 A;  1V74 A;  4TX4 A;  2R4V A;  4AEQ A;  3BJ5 A;  1A2K A;  2K9F A;  3KJY A;  4BL7 B;  2CT6 A;  3D3L A;  1STF I;  2XPD A;  1I2E A;  2B24 B;  2GZZ A;  2L1S A;  4WF5 A;  1ROV A;  1XOA A;  5CRG A;  3FKA A;  1GRX A;  1YQ1 A;  2RUF A;  2XFS A;  1JLW A;  4R9L A;  3DUK A;  1YNV X;  1RDS A;  1PY3 A;  4H3U A;  1I5G A;  2N5B A;  3F7X A;  3ZTL A;  1RGC A;  3ME8 A;  4PUF C;  3TKS C;  4N6O B;  5STD A;  2CIU A;  3KP9 A;  3UAR A;  7RNT A;  3PZW A;  3C7M A;  4X1U A;  4IPB A;  2GST A;  1BIR A;  3CXG A;  2ON5 A;  5BVB A;  1PFO A;  2IY2 A;  2GDR A;  1BNI A;  3A76 A;  3V92 A;  1RGK A;  5GSS A;  4HZ2 A;  2NTO A;  3DRN A;  1VQQ A;  3R3E A;  3A3T A;  1PD2 1;  1CEW I;  1W89 A;  1K0C A;  2BMR B;  3CMA 3;  2ON7 A;  3KSP A;  2Q07 A;  5AEU B;  2FWH A;  3APQ A;  3D4T A;  2KOK A;  2CFW A;  1FGO A;  4WKW A;  2C8U A;  1UGI A;  3GZR A;  3APO A;  2YWM A;  2LQO A;  1D6U A;  3LW9 A;  1GOY A;  1Q82 4;  3HZ4 A;  1JZR A;  1GS3 A;  3WOD G;  3ZIT A;  3HHV A;  2M80 A;  1RSN A;  1QMA A;  2WUL A;  2DLX A;  4L5O A;  4EL1 A;  1IT7 A;  3K63 A;  3GKK A;  2M72 A;  1T5Y A;  2DJ1 A;  3ALA A;  2H1A A;  3ZLP A;  4I4K A;  3VWU A;  2EIO A;  1FA3 A;  3FHK A;  1TTZ A;  3LXT A;  5CK6 A;  2VM2 A;  2AJQ B;  1X9S B;  1Z1S A;  1GLP A;  2DKH A;  5IO0 A;  1EQK A;  1XPV A;  1TU5 A;  1WQL B;  3HOH A;  4FQU A;  3QRD A;  4CY8 A;  4BU4 A;  2QIY A;  2PVQ A;  3MSO A;  3QCP A;  1RNT A;  1OC8 A;  1Z7P A;  2IMK A;  2L6C A;  3F6D A;  3IK9 A;  4MJD A;  4I2T A;  4FCM A;  1TXX A;  2H01 A;  1DVC A;  3A2V A;  1XWB A;  4IP1 A;  3KCH A;  1GUM A;  2P0X A;  2PER A;  1X9M B;  2HSY A;  1X1W A;  4O2H A;  4EO3 A;  2ZL8 A;  4F82 A;  2WS2 A;  3OWY A;  4ZM8 A;  4NWY A;  4HU7 A;  1N2A A;  2YZU A;  2XSH B;  4BTY A;  20GS A;  1V58 A;  2VO4 A;  3GTU A;  1W4V A;  1A2V A;  2K54 A;  5ECO B;  2CWT A;  3VI7 A;  5G5E A;  4KVH A;  3BCI A;  3BB9 A;  1S72 3;  4NMU A;  4LMW A;  3R2Q A;  4ZBA A;  1FUS A;  5FHI A;  2O85 A;  4JR4 A;  3NX0 A;  2OOV C;  1VRS D;  2WOF A;  2DJK A;  2VCX A;  4N0V A;  4BVX A;  2P38 A;  2PN8 A;  2GZY A;  2FNQ A;  1BGS A;  5D9W A;  2FA8 A;  3WT1 A;  1M7T A;  3NZN A;  4HOH A;  1B48 A;  2AB6 A;  3ZML A;  4AJ8 A;  4OD7 A;  2LUS A;  1CQS A;  5HFK A;  2VCT A;  4NV5 A;  5D73 A;  2KF3 A;  2ES7 A;  5FW5 A;  7GSP A;  4O32 A;  1T1V A;  3PYJ A;  5KN1 A;  3O3T A;  4MJA A;  1FHE A;  4KH7 A;  3KGK A;  1GNE A;  4L8O A;  1WIK A;  1JFU A;  1WE0 A;  4IEL A;  4NXI A;  5EPF A;  3SOY A;  4X0X A;  1UC7 A;  3CSI A;  5KOX A;  1XW5 A;  2OAD A;  2RCD A;  5D9X A;  3SOA A;  2R6K A;  4F03 A;  4G1M B;  1BRJ A;  3TUE A;  5J41 A;  3VPQ A;  1G7E A;  3FZ4 A;  1SJI A;  5HFI A;  3NV0 B;  2A2R A;  3EPT A;  4PTS A;  4YH2 A;  1VQL 3;  2CVD A;  3LSZ A;  2XPE A;  4MF6 A;  4IIA A;  2VL2 A;  1M90 4;  3QAV A;  4KFF A;  1PL1 A;  1SAR A;  2C0G A;  2CQ9 A;  2EIQ A;  2VL2 C;  3BLZ A;  1YZX A;  2WCI A;  2HMN B;  2L6D A;  4TXO A;  1YVB I;  3SX1 A;  1HU9 A;  3D79 A;  3SVA A;  3OXA A;  3T0U A;  3IPZ A;  1GNW A;  3MHE A;  1FGQ A;  3ECF A;  3T8U A;  2GT6 A;  2C11 A;  1GUH A;  2KP1 A;  4IBP A;  1MWS A;  2Z76 A;  2F56 A;  2FWF A;  4K9Z A;  4WEY A;  4XIH A;  4TR1 B;  2GZP A;  3Q90 A;  3GYK A;  3CRU A;  2MMN A;  3HVV A;  1VQN 3;  3CCQ 3;  2XC2 A;  5C04 A;  3LYG A;  1ULI B;  1X9W B;  2H6Z A;  4K61 A;  1ISK A;  1DET A;  4HM8 B;  1E6B A;  1VQ6 3;  2GSS A;  2OCT A;  1DMM A;  3LOR A;  1O7H B;  2DSA A;  2HZF A;  2NBS A;  1XW6 A;  3KEB A;  1F9M A;  3KM6 A;  2N5A A;  1Y6E A;  2HOH A;  1PKZ A;  2P31 A;  4I97 A;  5ECL B;  3IR4 A;  4JU5 A;  4CY6 A;  1SQW A;  2VCQ A;  1GTI A;  1TRW A;  3SED A;  1Z6N A;  3HII A;  2G0F A;  1VGL A;  2H75 A;  1BAN A;  3Q19 A;  5H5R A;  1OF5 A;  4ORL A;  5AIF A;  4MMY B;  5IEO A;  3TB2 A;  5H5S A;  1GSU A;  4MK3 A;  2VLU A;  3DYR A;  1XVW A;  1BRK A;  2OWP A;  2HSH A;  4TR0 A;  2I3Y A;  2H74 A;  1W2Z A;  1TFK A;  1QFN A;  2GT5 A;  2IN3 A;  1OC9 B;  2LS5 A;  1ZYQ B;  3WOF B;  1FZU A;  4WBJ A;  2IUJ A;  4BIR A;  2DC5 A;  1DBY A;  1QVF 2;  4EC0 A;  2NDO A;  1YF1 A;  1VQP 3;  3ZIJ A;  1JBR A;  1DE2 A;  3P8W A;  3LT9 A;  2IPA A;  4KCA A;  1W6C A;  3G0K A;  1V40 A;  1N8Q A;  1ERV A;  2IMI A;  1EOH A;  4FYB A;  4E8E A;  3CCR 3;  1M1K 4;  3KIJ A;  1HNA A;  1LNH A;  4WYK B;  4HM7 B;  4EYC A;  5CRH A;  1RGA A;  1CQG A;  1KNG A;  3M8C A;  1AUC A;  5F0G A;  4HM2 B;  3H3H A;  4U13 A;  3IBH A;  3UEM A;  1U87 A;  2J23 A;  1XW9 A;  3CME 3;  1Y4K A;  1B4P A;  1UUV B;  1BRN L;  5KN3 A;  1RRL A;  1GUL A;  5RNT A;  3VUR A;  2O8V B;  4YKF A;  3DIE A;  3QK9 A;  2QGU A;  3I0Y A;  3C71 A;  1THO A;  4L5L A;  3BNE A;  3NBB A;  1WMO A;  4MP4 A;  2LNT A;  3GV1 A;  3HJO A;  1RN1 A;  3LYK A;  1K8A 4;  1R4W A;  4KAE A;  4MNN A;  5IOW A;  3F14 A;  4FYU A;  1O7W B;  5FT3 A;  1UA5 A;  3H51 A;  3DWV A;  3G7I A;  1CYU A;  3EN1 B;  4O5Q A;  5HR0 A;  4YQV A;  5D93 A;  4EVM A;  2Z7A A;  3BIR A;  1SPU A;  1ZGX A;  1A2M A;  3CC2 3;  4ECI A;  2H71 A;  1EV9 A;  3LEF A;  3AY8 A;  3HX8 A;  3FK8 A;  1NO3 A;  3DGY A;  2RBI A;  1JB2 A;  5KN2 A;  1MDK A;  3ED3 A;  1NDO B;  1OHP A;  4X4J A;  1GY5 A;  3TDG A;  3JCM L;  4I6X A;  8CHO A;  1A2J A;  5L71 A;  1LQM B;  2TIR A;  3SXX A;  3N5O A;  3QOU A;  3KFQ C;  2OJL A;  1FOV A;  1TRQ A;  5ECS A;  1S3A A;  5DVB A;  4FMD A;  3K5T A;  1LXE A;  5LNK e;  2KP2 A;  3SWL A;  2KRT A;  2AYT A;  3MYD A;  4GB5 A;  3F7S A;  1OKD A;  2BMX A;  4BA7 A;  3X3X A;  4TXO B;  1IVW A;  5F07 A;  3LZA A;  1EOG A;  2WFC A;  3HY2 A;  2R41 A;  1GTB A;  3TKP A;  3L9V A;  1CH0 A;  3FSD A;  4POB A;  3D4A A;  2UX0 A;  2F3M A;  2HXK A;  1KBN A;  1OHO A;  2EC4 A;  2X49 A;  1E3V A;  4Z7X A;  5FGO A;  1F3B A;  3DGQ A;  3ZFZ A;  4BL3 A;  12GS A;  1MOL A;  3F3Q A;  1NHY A;  1ZGN A;  1F6M C;  2CFD A;  3B7C A;  2MBS A;  1SD9 A;  1GSP A;  1C54 A;  5DQY A;  2X8C A;  4JRR A;  4FH8 A;  3CU3 A;  1TFO A;  1OE7 A;  1CYV A;  3D5G A;  1VQM 3;  1FB0 A;  2CHC A;  1I9D A;  2C4J A;  2P05 A;  2F98 A;  1RGH A;  3B8L A;  4MPF A;  4EXJ A;  2YJ7 A;  1VQ8 3;  1SJZ A;  1PGT A;  2RNT A;  4PEJ A;  4F2I A;  3HZP A;  5D96 A;  4BPY A;  1M9G A;  1JZW A;  2IA7 A;  1RRH A;  3U97 A;  2LJA A;  1O7M B;  4FCJ A;  7STD A;  1JLV A;  3ERW A;  4K7N A;  3TOU A;  1TK0 B;  3WMD A;  4G9H A;  2GXF A;  1VQ9 3;  2R2J A;  4HQZ A;  4DSS B;  4HM4 B;  2UGI A;  3DVW A;  5J5N A;  3MNG A;  4ISD A;  5HFG A;  1T7P B;  4LZI A;  3HYP A;  2F5M A;  4BWQ A;  1JN5 A;  5ECP B;  3HVX A;  4PXO A;  1QAF A;  3TOT A;  2ZUP A;  4J5G A;  3CRT A;  1QJG A;  3ZVJ D;  2FD3 A;  2D42 A;  3W8J A;  3WYW A;  2FY6 A;  1Q4J A;  2B3S A;  1FB6 A;  2CAI A;  3S29 A;  2Z9S A;  3GNJ A;  3FG4 A;  3FR9 A;  2A4V A;  5JCW A;  4AJ7 A;  4KX4 A;  4XS6 A;  2XEP A;  1B21 A;  1AIU A;  4PQ1 A;  3D4M A;  3KZQ A;  3E9J B;  1JJ2 2;  1R4C A;  1RTU A;  3X42 A;  2J9H A;  1JNQ A;  4Q5N A;  5CNW A;  1LRA A;  3X40 A;  2H6Y A;  2PZV A;  2UZ8 A;  2FGT A;  1PQN A;  3HK4 A;  6RNT A;  5I97 A;  2V6K A;  4OO5 A;  1I3I A;  1EGR A;  1ZS7 A;  3LOY A;  4JRF A;  1RMS A;  3KII A;  2IL3 A;  2HMK B;  2VCV A;  2VLV A;  3GWR A;  1K3L A;  2C10 A;  2IWT A;  2F51 A;  2H1G A;  1WOU A;  4HZ4 A;  1Q81 4;  3G6E 3;  1K0D A;  5ECK B;  1LNI A;  3EVI A;  5DJL A;  1LOX A;  4R4K A;  3A2W A;  3KH7 A;  4WHA A;  4GTU A;  5E4W A;  4HAA A;  1ERU A;  2LRC A;  2CX3 A;  2OQE C;  1D6Y A;  3KXO A;  3G4S 3;  3ZFB A;  8RNT A;  1YGE A;  4LLR A;  2OAC A;  3D22 A;  1QAL A;  1XBS A;  1WMN A;  5IG5 A;  1AQZ A;  1KEB A;  1VF3 A;  2GGT A;  5D8I A;  4X43 A;  4Q53 A;  1PX6 A;  3DML A;  2C4B A;  3GX8 A;  2LRN A;  3EX9 A;  3UL3 A;  1N8J A;  2IYJ A;  3BD2 A;  5INY A;  3E99 A;  3W6G A;  1Q40 B;  1EKM A;  2YZH A;  3HA9 A;  2H30 A;  2RM6 A;  3GKX A;  5DCG A;  4HJM A;  4TR3 A;  2CFG A;  3FRC A;  5JWO B;  4OUQ A;  3UJ1 A;  3SBC A;  3APS A;  2MC8 A;  1S3D A;  2YWO A;  2GTU A;  1VF1 A;  2V6O A;  2HNL A;  2HMJ B;  2GBW B;  5GAN D;  1B2X A;  1MDJ A;  3MAK A;  1UCJ A;  4POM A;  2BHM A;  2CKF B;  4ZB9 A;  5KEJ A;  2H0I A;  1ON4 A;  1BG5 A;  3F3R A;  2VOC A;  1V57 A;  1U3I A;  1G02 A;  2CH9 A;  4WFO A;  1XVQ A;  1FVJ A;  4IVF A;  4NPB A;  5BXQ A;  4V1A g;  3HJP A;  4FCZ A;  4K5S A;  1YIT 3;  5EVH A;  3Q3F A;  3F4S A;  4CJN A;  2HMO B;  1JRQ A;  1SK1 A;  5IM9 A;  2AV4 A;  2I1U A;  2E2G A;  2B5E A;  2HRA A;  2R3X A;  1XOB A;  1DVD A;  3EF8 A;  5DAL A;  2EIR A;  2H70 A;  4WR5 A;  1G96 A;  3DXB A;  5J4U A;  1BYE A;  4PUR A;  3C73 A;  5EY6 A;  5BU4 A;  2WB9 A;  2NPB A;  4L8E A;  1BNF A;  3OWS A;  4EUY A;  2VLT A;  1RLS A;  1LQG C;  3CNX A;  1SYR A;  1YEP A;  1EZK A;  3D21 A;  3G7Y A;  2BMO B;  1XWC A;  2G2Q A;  2QGV A;  5BMU A;  3VWX A;  2GSP A;  4HM0 B;  3HZ8 A;  3AGO A;  3CCL 3;  4OMV A;  1DYU A;  1OH0 A;  1RGL A;  4TR1 A;  3EN8 A;  4POK A;  2IMJ A;  4GQF A;  2AAW A;  3K0Z A;  5M18 A;  3IV4 A;  1ROA A;  3LYP A;  3B4P A;  5IG4 A;  1O7G B;  3UMA A;  5G1L A;  3UOM A;  4GHO A;  2YFL B;  2B6M A;  4TRX A;  3RHC A;  4CHS A;  1N5P A;  3QDN A;  2KCD A;  3PR8 A;  1SJ6 A;  5ECI B;  3DZL A;  4FR9 A;  2HE3 A;  4GRF A;  1A24 A;  2YWI A;  1IV9 A;  5B6N A;  4HUA A;  4J57 E;  5AIG A;  5BRT A;  5A0O B;  4MJC A;  3O8Y A;  2R0C A;  3FW2 A;  1SL1 B;  4HM5 B;  4JE1 A;  3F9S A;  2V2G A;  2H0G A;  4J56 E;  4HM1 B;  1W2B 2;  2GU1 A;  3E3E A;  4Z2R A;  3LXZ A;  3IHQ A;  2DIZ A;  2LTK A;  2B1X B;  3WDG B;  3A5W A;  2YWN A;  4NHF A;  4HJ2 A;  2J8X B;  1FUW A;  1BNS A;  1X5C A;  5ECM B;  2GLR A;  4KND A;  1QAK A;  1R26 A;  3DGN A;  5CRW A;  3U6V A;  1I0V A;  5IQY A;  4IKH A;  5J3R A;  1XG8 A;  3CC4 3;  1ZZY A;  2C80 A;  1XCC A;  1E3R A;  4BL2 A;  4EIP A;  5DRE A;  3VLN A;  4BVY A;  3PPU A;  4KFD A;  2K3D A;  3BBY A;  1GP1 A;  1TI1 A;  2XBQ A;  4XRA A;  1HD2 A;  2JU5 A;  4TVE A;  4DSQ A;  1VF2 A;  3BCK A;  4ZIJ A;  4QQ7 A;  1OAC A;  2DMM A;  3CSJ A;  2DKI A;  3GKM A;  2K6V A;  2GQL A;  2PMT A;  1BU4 A;  1O81 A;  4WET A;  4HU9 A;  3KN4 A;  2X4A A;  1K73 4;  1OGZ A;  4YAP A;  4RZM A;  4GQC A;  3FG1 A;  2WO0 A;  1NHO A;  2TRX A;  2C3N A;  1MNL A;  2M46 A;  2MZC A;  2KF4 A;  4LL1 B;  3V99 A;  1IQ8 A;  5CLK A;  1IYI A;  3X3Y A;  5HR1 A;  4NV2 A;  1NNV A;  1O85 A;  3EB8 A;  1H4O A;  5ECR B;  4F9Z A;  4FMB A;  1X0R A;  4ZIL A;  3NUV A;  4GLT A;  3D5J A;  1A8L A;  4EDY A;  1BAO A;  1US1 A;  3PGB A;  4X2O A;  5IMF A;  2CW9 A;  2KHP A;  2LQQ A;  1RKY A;  3MKI A;  4KUN A;  3LTC A;  3WA3 A;  4R9K A;  4ILF A;  1NM3 A;  1GLQ A;  3G7J A;  2CWU A;  1BQ7 A;  4LMV A;  1BNJ A;  4PX1 A;  1BNR A;  4NHW A;  3WD6 A;  3WA2 X;  5IW9 A;  2ZDJ A;  1OHS A;  3IE3 A;  1EEJ A;  3L4N A;  2R37 A;  3RPN A;  2H6X A;  1JZO A;  1O6J A;  3FLJ A;  2F8F A;  4XCS A;  1TRV A;  3FR6 A;  1KTE A;  1O7N B;  4XTS A;  4EW5 A;  1GOU A;  1HKX A;  3PCR A;  5JBS A;  3STD A;  2MBT A;  1UN2 A;  5CAX A;  3H79 A;  1BNG A;  4ID0 A;  4OK0 A;  4KSM A;  1YHQ 3;  2LST A;  2WRT A;  2L4C A;  2E0Q A;  2GSR A;  1VQO 3;  2HRK A;  2R0P A;  4GCI A;  4EF0 A;  1S3C A;  4V2M A;  1ZO2 A;  1FW1 A;  2IFQ B;  3P7X A;  3FG3 A;  1T00 A;  1YJ6 A;  3L0R A;  2BMQ B;  5TGN A;  1X1U A;  2XR8 B;  2QA2 A;  4RI6 A;  2GSQ A;  2QKE A;  4XDV A;  1R7H A;  4PUA A;  4ECC A;  4IP6 A;  1W5Z A;  1N5H A;  2PNC A;  1DUG A;  3GL3 A;  4KSO A;  3J7Y b;  1TI3 A;  2OBK A;  1AAZ A;  1YJW 3;  2GS3 A;  2B1L A;  4K5R A;  3IC8 A;  3O76 A;  1A0R P;  4YQM A;  1JZD A;  2GQK A;  3NBR A;  1T8E B;  3CCM 3;  3HDC A;  3FEU A;  5COH A;  1HQO A;  3EMX A;  4PGT A;  4HM6 B;  1B2S A;  1BRH A;  1W7C A;  4RBN A;  3IRA A;  3Q2P A;  1I3F A;  1UUW B;  2FA4 A;  1J2B A;  1MD3 A;  3TKR A;  1FYS A;  2HMM B;  5IPG A;  1CQH A;  6GSS A;  1Z7R A;  1RHL A;  1OAZ A;  4RNZ A;  3MYT A;  1Q98 A;  5IEN A;  1WTH A;  3IA1 A;  1IU7 A;  1BJX A;  2WGO A;  1A90 A;  3KMN A;  1SK0 A;  4MZC A;  4KA0 A;  3C1S A;  1HYF A;  4YQU A;  1TRU A;  4MJB A;  5GSP A;  1R4Y A;  4EV5 A;  3UVH A;  1SL2 B;  3UJM A;  2FLS A;  4EC6 A;  1K0A A;  3OX9 A;  2YFI B;  2FCH A;  4BTW A;  5ELU A;  1URM A;  1GSF A;  1WMJ A;  1O8X A;  2P0M A;  2KXG A;  3VGN A;  4MPG A;  2CZ3 A;  5F06 A;  1T4Z A;  1NSW A;  5G1K A;  4LYL B;  4L7K A;  3CYN A;  4EE0 A;  4N30 A;  2LKU A;  2RFR A;  4TW5 A;  1OE8 A;  3EC3 A;  4AGS A;  1BUQ A;  1OF5 B;  1USB A;  4WXT A;  5KN0 A;  4GSN A;  2OOV A;  2R5G A;  3EU4 A;  5ABR A;  2YV7 A;  3AHW A;  3RHB A;  1PL2 A;  1TU7 A;  5ID2 B;  1PN0 A;  1TK5 B;  16GS A;  2CA8 A;  5AEW B;  18GS A;  4OO4 A;  1OC3 A;  2CK3 H;  2YP6 A;  1WPI A;  1J9B A;  3CCV 3;  4FIW A;  1LJR A;  2L5O A;  1B9X C;  2F8A A;  4MMM A;  4O8S A;  4R80 A;  1SKS B;  4IN0 A;  4HDE A;  4XRD A;  1ACV A;  1PFP A;  1VZZ A;  3ZIV A;  3JVC A;  4ECJ A;  3MWZ A;  2GBX B;  3L9S A;  5GST A;  2MF7 A;  2BO9 B;  4J5K A;  14GS A;  2F5W A;  2YN1 A;  2NVL A;  1EEM A;  2K8V A;  4KDU A;  3FCS B;  3ZRE A;  3CQF A;  5EQL A;  2MMA A;  2C3T A;  5D83 A;  3P90 A;  4TR4 A;  2JSZ A;  5DAK A;  4OWY A;  5AIV A;  2JQ5 A;  4EKZ A;  2HML B;  4HZB B;  4LMI A;  3FYG A;  5ID2 A;  1BED A;  1UCK A;  3LWA A;  1EV4 A;  2X8H A;  3PCS A;  2VD1 A;  3KP8 A;  5JWQ B;  4ZL7 A;  2BJX A;  1GY7 A;  3K7C A;  1M2A A;  1LU4 A;  3GUS A;  3EBT A;  1ZYN A;  2C0F A;  4ACS A;  1T2H A;  1ILO A;  5AIH A;  1ULJ B;  1C7H A;  4LL4 B;  2LJK A;  4POL A;  3TGZ A;  4TKY A;  5A4W A;  1T4Y A;  4HZ9 B;  3CPW 2;  5A4V A;  1BOX A;  4Z2U A;  5AII A;  2O89 A;  1ERT A;  2H1B A;  3PS8 A;  5G2G A;  3S5C A;  4LSO A;  1Y25 A;  5FWG A;  3MWH A;  3EU3 A;  3QPM A;  5ECH B;  19GS A;  1X1X A;  1OYJ A;  3ZL5 A;  2CV4 A;  1THX A;  2CX4 A;  1GD3 A;  5CO3 A;  1PRX A;  3MG1 A;  2H1D A;  5IPH A;  1Z5Y E;  1B9Y C;  3FF0 A;  1AY7 A;  2INX A;  6GSU A;  5AN1 A;  3LT8 A;  1DSB A;  3KSE D;  1A2L A;  4J8T A;  4HJL B;  1W02 A;  3GST A;  2W56 B;  4KFE A;  3QFB C;  3NV0 A;  3P2A A;  4HVN A;  1RJO A;  2ML5 A;  3L0H A;  1F3A A;  1YVS A;  2SAR A;  1XIY A;  2HZE B;  4OFN A;  2YFJ B;  1TRS A;  4HBR A;  4NRE A;  2YPM A;  5B7C A;  1SKW B;  1JBS A;  17GS A;  3X3Z A;  3UVT A;  4N6U A;  1TP6 A;  5AGY A;  2RII A;  2HYX A;  3H8Q A;  3FH1 A;  3DKS A;  1IVX A;  1RNB A;  4IGJ A;  3DEX A;  2PU9 C;  4K2D A;  1Q42 A;  4K8M A;  2KAA A;  2FWE A;  4JED A;  4FMA A;  1BAY A;  2FUG 2;  4CDO A;  1HNC A;  1UVZ A;  1J0F A;  4BTX A;  2WDU A;  4EBG A;  2JAC A;  4G10 A;  2KF5 A;  2A15 A;  2ALB A;  1S3R A;  4I2U A;  1EWX A;  1T2I A;  3ZVJ A;  1K0M A;  1DE1 A;  4RNY A;  3S27 A;  2IMF A;  4O7H A;  2RLI A;  2VAF A;  2HSM A;  4OFM A;  4A5P A;  2C1Y A;  1WNH A;  2W0Q A;  2BNG A;  2L4V A;  2CZ2 A;  3LTA A;  3D5I A;  2ZCT A;  3QR6 A;  4STD A;  2PGT A;  4XS1 A;  3MG3 A;  1N9J A;  3RGA A;  3BU4 A;  2A2S A;  3VK9 A;  3TJG A;  5DBQ A;  4K2X A;  4RNT A;  4NAX A;  4TXV A;  3GX0 A;  3ZYW A;  3CBU A;  4RUV A;  3DM8 A;  1BRG A;  3X41 A;  4XBT A;  1BUJ A;  2JDI H;  3KD0 A;  4MJE A;  1R5A A;  2CG1 A;  3UBL A;  1KC8 4;  2F4Y A;  1I70 A;  5CXO A;  3D0Z A;  1KWI A;  3QFA C;  1A2P A;  2V1L A;  2QSI A;  3G9B A;  3JUQ A;  1A0F A;  1QK8 A;  1M2B A;  2GEY A;  4HM3 B;  2F99 A;  3NIV A;  4USS A;  4N6M A;  1QXH A;  2DIY A;  5AIS A;  3ZG5 A;  2P09 A;  3WOE B;  5IMD A;  3GUR A;  1DMN A;  2K8S A;  2AUV A;  3JUM A;  4O5U A;  2DJ2 A;  1GY6 A;  3NM2 A;  4HYZ A;  1XWK A;  2V32 A;  4BVY B;  1IV7 A;  1JKG B;  1DE3 A;  1SII A;  5IMZ A;  3IMA B;  4K1V A;  1PN9 A;  1ABA A;  3N9J A;  2N5F A;  1O7P B;  4Q5F A;  3VWW A;  2OE1 A;  3HD5 A;  5DJM A;  4XB5 A;  3S67 A;  3KH9 A;  3D9R A;  3Q18 A;  3WGD A;  2FWG A;  2R4I A;  3NXJ A;  1TW9 A;  1WJK A;  3LFL A;  3LH4 A;  1UGH I;  3MG2 A;  1QUW A;  1N9E A;  3N54 B;  2B7K A;  2M7O A;  2BTO T;  4YKG A;  2D1W A;  1SEN A;  4MLY A;  3VI5 A;  4WR4 A;  1VQK 3;  3FY7 A;  3EUR A;  1RGG A;  3U1W A;  5IMA A;  2XRX B;  1ZL9 A;  1NW2 A;  2JZR A;  1YKA A;  2X64 A;  4D73 A;  6GST A;  2GVP A;  5F8B A;  3TCO A;  2REM A;  3EBY A;  1I8V A;  5AYR B;  1WP0 A;  3S9F A;  3CTF A;  1W6G A;  5HOH A;  2TRC P;  3F0I A;  1R5P A;  1HYU A;  5CYY A;  5IMC A;  1GOV A;  1B2Z A;  1NB3 I;  4H61 A;  2QEX 3;  1TDI A;  3F4T A;  4G0I A;  4ZB6 A;  3TJF A;  2VL3 A;  3ERG A;  2QA1 A;  2DJ0 A;  3PGT A;  4LGQ A;  1FOH A;  2BU4 A;  3TKQ A;  9RNT A;  3N8B A;  1FGR A;  1YEX A;  2XHF A;  3ISO A;  3FKF A;  3SYU A;  2CVK A;  1W01 A;  5DRV A;  1TIJ A;  1ZYP A;  3EYT A;  3KTL A;  4WF4 A;  5JCU A;  1MWU A;  3GSS A;  1OVN A;  4KF9 A;  2LV3 A;  2AAD A;  3EC9 A;  3LTD A;  1B20 A;  1ML6 A;  1GSQ A;  3HCZ A;  1ZMA A;  2LQV A;  4PQI A;  2W2C A;  3UAP A;  2KLX A;  2LNS A;  4KE3 A;  4G19 A;  4X2H A;  2DJJ A;  1TU8 A;  1BSA A;  4IQA A;  4K1F A;  5AI1 A;  2H73 A;  13GS A;  1RQM A;  1FAA A;  3CSH A;  2ZHX B;  1AC1 A;  4JR6 A;  1C72 A;  3V98 A;  3LGC A;  3KCM A;  1S5A A;  3FGY A;  1I0X A;  4HI7 A;  4HKV B;  2OTL 3;  2Y74 A;  3F8X A;  1Z6M A;  2W03 A;  1LOV A;  1E97 A;  1WWJ A;  2MMZ A;  2WJU A;  1BNE A;  3F4R A;  5KP3 A;  3NBJ A;  3T8N A;  4DVC A;  1O7U A;  5M19 A;  5HR2 A;  5LCZ A;  3LJR A;  4WYK A;  3CMI A;  3CCE 3;  3DMC A;  9GSS A;  5IOX A;  1GD4 A;  3I6A A;  4ICY A;  3DXO A;  4QL9 A;  3NQZ A;  1TTO A;  5GZZ B;  1GWC A;  3GHA A;  3A2X A;  1JKG A;  3BNC A;  4ULX A;  2FHE A;  5A4U A;  5GAP D;  3IAM 2;  2C0D A;  3RGR A;  3AGN A;  1XXU A;  4K6X A;  4MA9 A;  2W6J H;  4N6L A;  4GF0 A;  1D6Z A;  3GH6 A;  3GFK A;  1B4Q A;  2HT9 A;  2XFT A;  4OCF A;  3RDW A;  3BND A;  1B8X A;  3KZT A;  2YJH A;  5CP1 A;  1MGR A;  1YKC A;  1YJN 3;  4K7O A;  5ECQ B;  1ERW A;  5BIR A;  4O92 A;  1KSI A;  7GSS A;  1SL0 B;  2PWJ A;  1T3B A;  3GRD A;  3F40 A;  4JF8 A;  2IIY A;  3PIN A;  2PUK C;  2MYG A;  4XHM A;  6GSP A;  2JSY A;  3K9M C;  2E2T A;  4OCE A;  1UUG B;  2GQM A;  1STD A;  1X5D A;  3MDK A;  1TP9 A;  4I8B A;  4K0G A;  1I2G A;  3ME7 A;  2WZ9 A;  2P5Q A;  3KKG A;  1LOW A;  4PNF A;  1OCV A;  1TUH A;  3KE7 A;  2A2P A;  4KDY A;  2HRN A;  1BSB A;  2PVO C;  5EL8 A;  3G71 3;  4MF5 A;  4ML1 A;  3C8E A;  4G2E A;  4AKZ A;  1JHB A;  2FNO A;  5ECN B;  5H5Q A;  3A5E A;  3GMF A;  1YI2 3;  1EP7 A;  4DSR A;  1FO5 A;  4MMX B;  3KMO A;  3PXM A;  4K7I A;  4XM4 A;  1K3O A; 
#chains in the Genus database with same CATH homology
 2OKA A;  3RPP A;  2P0G A;  1FVK A;  3GIX A;  1M9B A;  1YY7 A;  5IMV A;  1EP8 A;  5B8A A;  1IYH A;  2B5Y A;  1AQW A;  4GST A;  3TRP A;  3ZRD A;  4J2F A;  5F05 A;  4MZB A;  3IAS 2;  1V98 A;  4EDZ A;  1YF0 A;  5ENU A;  3H1N A;  5DQS A;  3TJB A;  3RBT A;  3IOS A;  4F0B A;  1K3Y A;  1XFL A;  1Z9H A;  3GL5 A;  2MMO A;  2D2Z A;  3EWL A;  1GUK A;  3F8U A;  3HJM A;  3I43 A;  4TN8 A;  4Z2T A;  3E0U A;  2V1M A;  2I9H A;  4FYC A;  4MZW A;  1QMV A;  3ERF A;  1K0N A;  1F2E A;  3KTB A;  1SK2 A;  1F37 A;  2JL4 A;  2HLS A;  4P3Y B;  3W8S A;  1G6Y A;  4ML6 A;  4JBB A;  2YOI A;  3GKN A;  4ZXG A;  1GL8 A;  2VUP A;  4K0N A;  1U6T A;  3DVX A;  3NOF A;  6GSX A;  2HFD A;  3IXR A;  1H75 A;  3M0F A;  3US3 A;  5LD0 A;  3VPT A;  4IHU A;  5HQP A;  1ST9 A;  4N11 A;  2PPT A;  4Q5Q A;  3UIW A;  2OBI A;  4G0L A;  4IJI A;  4IJ3 A;  2VL9 A;  3RAZ A;  3D6I A;  4WBR D;  4MF7 A;  3F63 A;  1PSQ A;  3I69 A;  3M3M A;  4BWS A;  2O87 A;  5ELG A;  1AW9 A;  2CAQ A;  1M2D A;  2LRT A;  1WRY A;  4V2L A;  4LA1 A;  2L4Q A;  6GSY A;  3L78 A;  3PH9 A;  4E8H A;  2KUC A;  1XWA A;  5KOW A;  5JWR B;  3O6T A;  3WT2 A;  2RUE A;  11GS A;  2CVB A;  4BL7 A;  1PX7 A;  1U88 A;  1J08 A;  2XBI A;  5IO2 A;  2I4A A;  1PKW A;  2H72 A;  2V41 A;  3GN3 A;  1ZCP A;  2JZS A;  1GSD A;  1EGO A;  1YDK A;  1QGV A;  2IJY A;  2X8G A;  2VM1 A;  2H8L A;  1V2A A;  2HZE A;  4IQ1 A;  3IK7 A;  2IFQ A;  1O8W A;  2I81 A;  4DEJ A;  3V1W A;  4GXZ A;  2VCZ A;  3IDV A;  22GS A;  1K0B A;  1MTC A;  3HVS A;  1HNB A;  4H86 A;  2LEG A;  5E59 A;  3MIX A;  3TRX A;  3H93 A;  2YNX A;  3HKR A;  4MH3 A;  3MSZ A;  4BVX B;  3TJK A;  2YV9 A;  4EIQ A;  4PNG A;  4O5R A;  5DCH A;  4AJ6 A;  2HI7 A;  3K8N A;  4IW9 A;  1PA3 A;  5J9B A;  2LJR A;  1TK8 B;  4JZQ A;  2ZNM A;  1SKR B;  2JZT A;  3HXS A;  1ZYE A;  2VCW A;  3QMX A;  2A4H A;  1FG4 A;  5DAK B;  3ZZX A;  3J7Y k;  5IIZ A;  4RQR A;  2DML A;  3DD3 A;  5G31 A;  3L9U A;  1GTU A;  5C00 A;  4XS4 A;  1GSE A;  5CRE A;  3A5I A;  1U3A A;  2YCD A;  2B5X A;  4MDC A;  1OKT A;  3FZ5 A;  3Q6O A;  1G6W A;  5A5K A;  2R0G A;  3QD9 A;  4MH2 A;  3CTG A;  3FZ9 A;  1MDI A;  1TOF A;  1TKD B;  1PMT A;  3Q74 A;  3IHG A;  3GH9 A;  1M9A A;  5G2Z A;  1M99 A;  5G5F A;  4I5Q A;  5HR3 A;  1BX9 A;  2L5L A;  3OR5 A;  3EIN A;  4G0K A;  1XZO A;  2E2M A;  2RM5 A;  2YAN A;  3M1G A;  3M8N A;  1LBK A;  5AIX A;  1X5E A;  2B1K A;  2DJ3 A;  4QL7 A;  4N10 A;  3H4K A;  2K18 A;  1RK4 A;  2HRF A;  4ZBD A;  5DDL A;  1E2Y A;  4V2N A;  4FO5 A;  3GA4 A;  4GWR A;  5ELA A;  2IMD A;  2P5R A;  4Q5R A;  3ZMK A;  4ZBB A;  4DSS A;  4ZL8 A;  1QQ2 A;  4PQH A;  4HQS A;  1V9W A;  2C3Q A;  5JCG A;  3QAG A;  2WGR A;  1XWG A;  4IS0 A;  1TJD A;  2AHE A;  1AQV A;  3FR3 A;  5D9T A;  6GSW A;  4D73 B;  2VD0 A;  2H19 A;  5B6M A;  3TRQ A;  4ZB8 A;  2VIM A;  3GTU B;  4L0U A;  4HS1 A;  2DBC A;  5G30 A;  4F0C A;  5DAL B;  10GS A;  4KGI A;  4MAB A;  1OC9 A;  4N0Z A;  1RW1 A;  3TKS E;  3U5R E;  3EE2 A;  4ZL9 A;  3VWV A;  1A8Y A;  3TJJ A;  1ZOF A;  4AF2 A;  4V1A p;  8GSS A;  2IME A;  2JAD A;  5J9C A;  4RI7 A;  3F6F A;  3FZA A;  1GSY A;  2E7P A;  3VFI A;  4OFT A;  1K0O A;  4YAV A;  1Z3E A;  3BOA A;  1MD4 A;  3F9U A;  1O73 A;  4HOJ A;  3M9K A;  1SU9 A;  1AQX A;  4MCU A;  4NHZ A;  4TOP A;  5EVO A;  3FMW A;  4KW6 A;  5CRD A;  2H76 A;  2L59 A;  4HEA 2;  6GSV A;  1SYX A;  2OE3 A;  4KCE A;  3UBK A;  3LG6 A;  3WGX A;  2FGX A;  5B8B A;  2QC7 A;  1SD8 A;  3WGE A;  4KB3 A;  3TKS A;  5D9V A;  4CW9 A;  3QAW A;  1AXD A;  1VF4 A;  2X99 A;  1A23 A;  3EMP A;  3M9J A;  3IC4 A;  3C1R A;  2H66 A;  2PBJ A;  3GRX A;  1M0U A;  1GSS A;  1MEK A;  2B7J A;  2H0H A;  2OE0 A;  3ZFL A;  4XS4 B;  2OA7 A;  1GTA A;  2F9S A;  1G7O A;  3LQ7 A;  2C0E A;  4L0W A;  3I9V 2;  1GH2 A;  4GSS A;  1G0T A;  4RQX A;  4KDX A;  2O7K A;  4ECB A;  2L57 A;  2R4V A;  3BJ5 A;  2K9F A;  3KJY A;  4BL7 B;  2CT6 A;  2XPD A;  2GZZ A;  4WF5 A;  1XOA A;  5CRG A;  1GRX A;  1YQ1 A;  2RUF A;  1JLW A;  1I5G A;  2N5B A;  3ZTL A;  3ME8 A;  4PUF C;  3TKS C;  3KP9 A;  3UAR A;  4X1U A;  3C7M A;  2GST A;  3CXG A;  2ON5 A;  2IY2 A;  2GDR A;  5GSS A;  4HZ2 A;  2NTO A;  3DRN A;  3R3E A;  3A3T A;  1PD2 1;  1W89 A;  1K0C A;  2ON7 A;  2FWH A;  3APQ A;  3D4T A;  2KOK A;  4WKW A;  2C8U A;  3APO A;  2YWM A;  2LQO A;  3LW9 A;  3HZ4 A;  1JZR A;  3ZIT A;  3HHV A;  2M80 A;  2WUL A;  2DLX A;  4L5O A;  4EL1 A;  3GKK A;  2M72 A;  2DJ1 A;  2H1A A;  3ZLP A;  3VWU A;  2EIO A;  3FHK A;  1TTZ A;  3LXT A;  2AJQ B;  2VM2 A;  1X9S B;  1GLP A;  2DKH A;  5IO0 A;  1XPV A;  4FQU A;  4CY8 A;  2PVQ A;  3QCP A;  1OC8 A;  1Z7P A;  2IMK A;  2L6C A;  3F6D A;  3IK9 A;  4I2T A;  1TXX A;  2H01 A;  3A2V A;  1XWB A;  4IP1 A;  1GUM A;  2PER A;  1X9M B;  2HSY A;  4EO3 A;  4F82 A;  2WS2 A;  4NWY A;  4HU7 A;  1N2A A;  2YZU A;  20GS A;  1V58 A;  2VO4 A;  3GTU A;  1W4V A;  5ECO B;  3VI7 A;  5G5E A;  3BCI A;  4NMU A;  4LMW A;  3R2Q A;  4ZBA A;  5FHI A;  2O85 A;  4JR4 A;  1VRS D;  2DJK A;  2VCX A;  4N0V A;  4BVX A;  2PN8 A;  2GZY A;  5D9W A;  2FA8 A;  3WT1 A;  1M7T A;  3NZN A;  1B48 A;  2AB6 A;  3ZML A;  4AJ8 A;  4OD7 A;  2LUS A;  5HFK A;  2VCT A;  4NV5 A;  5D73 A;  2ES7 A;  4O32 A;  1T1V A;  5KN1 A;  3O3T A;  4MJA A;  1FHE A;  4KH7 A;  3KGK A;  1GNE A;  1WIK A;  1JFU A;  1WE0 A;  4IEL A;  4NXI A;  5EPF A;  4X0X A;  1UC7 A;  3CSI A;  5KOX A;  1XW5 A;  2OAD A;  5D9X A;  2R6K A;  4F03 A;  5J41 A;  3TUE A;  1G7E A;  3VPQ A;  3FZ4 A;  1SJI A;  5HFI A;  2A2R A;  3EPT A;  4PTS A;  4YH2 A;  2CVD A;  3LSZ A;  2XPE A;  4MF6 A;  2VL2 A;  3QAV A;  1PL1 A;  2C0G A;  2CQ9 A;  2EIQ A;  2VL2 C;  1YZX A;  2WCI A;  2L6D A;  4TXO A;  3IPZ A;  1GNW A;  2GT6 A;  1GUH A;  2KP1 A;  4IBP A;  4K9Z A;  2FWF A;  4WEY A;  4XIH A;  4TR1 B;  2GZP A;  3GYK A;  3CRU A;  2MMN A;  3HVV A;  2XC2 A;  5C04 A;  1X9W B;  2H6Z A;  1E6B A;  2GSS A;  3LOR A;  2DSA A;  2HZF A;  2NBS A;  1XW6 A;  3KEB A;  1F9M A;  3KM6 A;  2N5A A;  1Y6E A;  1PKZ A;  2P31 A;  4I97 A;  5ECL B;  3IR4 A;  4JU5 A;  4CY6 A;  2VCQ A;  1GTI A;  1TRW A;  1Z6N A;  2G0F A;  1VGL A;  2H75 A;  3Q19 A;  5H5R A;  3TB2 A;  5H5S A;  1GSU A;  4MK3 A;  2VLU A;  3DYR A;  1XVW A;  2HSH A;  4TR0 A;  2I3Y A;  2H74 A;  1QFN A;  2GT5 A;  2IN3 A;  1OC9 B;  2LS5 A;  1ZYQ B;  4WBJ A;  2DC5 A;  1DBY A;  4EC0 A;  2NDO A;  1YF1 A;  3ZIJ A;  1DE2 A;  3P8W A;  2IPA A;  4KCA A;  1V40 A;  1ERV A;  2IMI A;  1EOH A;  4FYB A;  4E8E A;  3KIJ A;  1HNA A;  5CRH A;  1CQG A;  1KNG A;  1AUC A;  5F0G A;  3IBH A;  3UEM A;  1U87 A;  2J23 A;  1XW9 A;  1B4P A;  5KN3 A;  1GUL A;  3VUR A;  2O8V B;  4YKF A;  3DIE A;  3C71 A;  1THO A;  4L5L A;  4MP4 A;  2LNT A;  3GV1 A;  3HJO A;  3LYK A;  1R4W A;  4KAE A;  4MNN A;  5IOW A;  4FYU A;  5FT3 A;  1UA5 A;  3DWV A;  3G7I A;  4O5Q A;  5HR0 A;  4YQV A;  5D93 A;  4EVM A;  1A2M A;  4ECI A;  2H71 A;  1EV9 A;  3LEF A;  3AY8 A;  3FK8 A;  5KN2 A;  1MDK A;  3ED3 A;  4X4J A;  3TDG A;  3JCM L;  4I6X A;  1A2J A;  5L71 A;  2TIR A;  3QOU A;  3N5O A;  2OJL A;  1FOV A;  5ECS A;  1S3A A;  5DVB A;  5LNK e;  3SWL A;  2KP2 A;  2AYT A;  3MYD A;  1OKD A;  2BMX A;  4BA7 A;  4TXO B;  5F07 A;  1EOG A;  2WFC A;  3HY2 A;  1GTB A;  3TKP A;  3L9V A;  4POB A;  2F3M A;  2HXK A;  1KBN A;  2EC4 A;  2X49 A;  4Z7X A;  1F3B A;  3DGQ A;  12GS A;  3F3Q A;  1NHY A;  1ZGN A;  1F6M C;  2MBS A;  1SD9 A;  5DQY A;  2X8C A;  4JRR A;  4FH8 A;  1OE7 A;  1FB0 A;  1I9D A;  2C4J A;  4MPF A;  4EXJ A;  2YJ7 A;  1SJZ A;  1PGT A;  4F2I A;  5D96 A;  4BPY A;  1JZW A;  2LJA A;  1JLV A;  3ERW A;  4K7N A;  3TOU A;  1TK0 B;  4G9H A;  2R2J A;  4HQZ A;  4DSS B;  3DVW A;  5J5N A;  3MNG A;  4ISD A;  5HFG A;  1T7P B;  3HYP A;  4BWQ A;  5ECP B;  3HVX A;  4PXO A;  3TOT A;  2ZUP A;  3CRT A;  3ZVJ D;  2FD3 A;  3W8J A;  3WYW A;  2FY6 A;  1Q4J A;  2B3S A;  1FB6 A;  2CAI A;  2Z9S A;  3GNJ A;  3FR9 A;  2A4V A;  5JCW A;  4AJ7 A;  4KX4 A;  4XS6 A;  1AIU A;  4PQ1 A;  3D4M A;  3KZQ A;  3E9J B;  2J9H A;  4Q5N A;  5CNW A;  2H6Y A;  2UZ8 A;  1PQN A;  2V6K A;  4OO5 A;  1EGR A;  2IL3 A;  2VCV A;  2VLV A;  1K3L A;  2IWT A;  2F51 A;  2H1G A;  1WOU A;  4HZ4 A;  1K0D A;  5ECK B;  3EVI A;  5DJL A;  3A2W A;  3KH7 A;  4GTU A;  5E4W A;  1ERU A;  2LRC A;  2CX3 A;  3KXO A;  3ZFB A;  4LLR A;  2OAC A;  3D22 A;  1XBS A;  1KEB A;  1VF3 A;  2GGT A;  5D8I A;  4X43 A;  1PX6 A;  3DML A;  3GX8 A;  2LRN A;  3UL3 A;  1N8J A;  2IYJ A;  3BD2 A;  5INY A;  3W6G A;  3HA9 A;  2YZH A;  2H30 A;  2RM6 A;  3GKX A;  5DCG A;  4HJM A;  4TR3 A;  3FRC A;  5JWO B;  3UJ1 A;  3SBC A;  3APS A;  1S3D A;  2YWO A;  2GTU A;  1VF1 A;  2V6O A;  2HNL A;  5GAN D;  1MDJ A;  3MAK A;  4POM A;  4ZB9 A;  5KEJ A;  2H0I A;  1ON4 A;  1BG5 A;  3F3R A;  2VOC A;  1V57 A;  1U3I A;  1XVQ A;  1FVJ A;  4IVF A;  4NPB A;  4V1A g;  3HJP A;  4K5S A;  3F4S A;  1SK1 A;  5IM9 A;  2AV4 A;  2I1U A;  2E2G A;  2B5E A;  2HRA A;  2R3X A;  1XOB A;  5DAL A;  2EIR A;  2H70 A;  4WR5 A;  3DXB A;  5J4U A;  1BYE A;  4PUR A;  3C73 A;  5EY6 A;  2WB9 A;  2NPB A;  4L8E A;  4EUY A;  2VLT A;  1SYR A;  1YEP A;  1EZK A;  3D21 A;  3G7Y A;  1XWC A;  2G2Q A;  2QGV A;  5BMU A;  3VWX A;  3HZ8 A;  4OMV A;  4TR1 A;  4POK A;  4GQF A;  2AAW A;  3IV4 A;  3LYP A;  3UMA A;  5G1L A;  3UOM A;  2B6M A;  4TRX A;  3RHC A;  4CHS A;  3QDN A;  3PR8 A;  1SJ6 A;  5ECI B;  2HE3 A;  4GRF A;  1A24 A;  2YWI A;  5B6N A;  4HUA A;  4J57 E;  5BRT A;  4MJC A;  2R0C A;  3FW2 A;  1SL1 B;  4JE1 A;  2V2G A;  2H0G A;  4J56 E;  3E3E A;  4Z2R A;  3LXZ A;  3IHQ A;  2DIZ A;  2LTK A;  3A5W A;  2YWN A;  4HJ2 A;  1X5C A;  5ECM B;  2GLR A;  4KND A;  1R26 A;  5CRW A;  3U6V A;  5IQY A;  4IKH A;  5J3R A;  1ZZY A;  2C80 A;  1XCC A;  4EIP A;  3VLN A;  4BVY A;  3PPU A;  3BBY A;  1GP1 A;  1TI1 A;  4XRA A;  2XBQ A;  1HD2 A;  2JU5 A;  4TVE A;  4DSQ A;  1VF2 A;  3BCK A;  4ZIJ A;  4QQ7 A;  2DMM A;  3CSJ A;  2DKI A;  3GKM A;  2K6V A;  2GQL A;  2PMT A;  1O81 A;  4WET A;  4HU9 A;  2X4A A;  4YAP A;  4GQC A;  1NHO A;  2TRX A;  2C3N A;  2M46 A;  2MZC A;  4LL1 B;  1IYI A;  5HR1 A;  4NV2 A;  1O85 A;  1H4O A;  5ECR B;  4F9Z A;  1X0R A;  4ZIL A;  4GLT A;  3D5J A;  1A8L A;  4EDY A;  5IMF A;  2KHP A;  2LQQ A;  4KUN A;  4ILF A;  1NM3 A;  1GLQ A;  3G7J A;  1BQ7 A;  4LMV A;  4PX1 A;  4NHW A;  3WD6 A;  3IE3 A;  1EEJ A;  3L4N A;  2R37 A;  3RPN A;  2H6X A;  1JZO A;  1O6J A;  2F8F A;  4XCS A;  1TRV A;  3FR6 A;  1KTE A;  4XTS A;  2MBT A;  1UN2 A;  5CAX A;  3H79 A;  4ID0 A;  4KSM A;  2LST A;  2WRT A;  2L4C A;  2E0Q A;  2GSR A;  2HRK A;  2R0P A;  4GCI A;  4EF0 A;  1S3C A;  4V2M A;  1FW1 A;  2IFQ B;  3P7X A;  1T00 A;  1YJ6 A;  2QA2 A;  4RI6 A;  2GSQ A;  2QKE A;  1R7H A;  4PUA A;  4ECC A;  4IP6 A;  4KSO A;  1DUG A;  3GL3 A;  3J7Y b;  1TI3 A;  2OBK A;  1AAZ A;  2GS3 A;  2B1L A;  4K5R A;  3IC8 A;  3O76 A;  1A0R P;  4YQM A;  1JZD A;  2GQK A;  1T8E B;  3HDC A;  3FEU A;  5COH A;  1HQO A;  3EMX A;  4PGT A;  3IRA A;  2FA4 A;  1MD3 A;  3TKR A;  5IPG A;  1CQH A;  6GSS A;  1Z7R A;  1OAZ A;  1Q98 A;  3IA1 A;  1BJX A;  3KMN A;  1SK0 A;  4MZC A;  4KA0 A;  3C1S A;  4YQU A;  1TRU A;  4MJB A;  3UVH A;  1SL2 B;  2FLS A;  1K0A A;  2FCH A;  1URM A;  1GSF A;  1WMJ A;  1O8X A;  5F06 A;  4MPG A;  2CZ3 A;  1T4Z A;  1NSW A;  5G1K A;  3CYN A;  4EE0 A;  4N30 A;  2LKU A;  4TW5 A;  1OE8 A;  3EC3 A;  4AGS A;  1USB A;  4WXT A;  5KN0 A;  4GSN A;  3EU4 A;  2R5G A;  5ABR A;  2YV7 A;  3RHB A;  1PL2 A;  1TU7 A;  5ID2 B;  1PN0 A;  1TK5 B;  16GS A;  2CA8 A;  18GS A;  4OO4 A;  1OC3 A;  2YP6 A;  1WPI A;  1J9B A;  4FIW A;  1LJR A;  2L5O A;  1B9X C;  2F8A A;  4MMM A;  1SKS B;  4IN0 A;  4HDE A;  4XRD A;  1ACV A;  3ZIV A;  4ECJ A;  3L9S A;  5GST A;  14GS A;  2YN1 A;  2NVL A;  1EEM A;  2K8V A;  4KDU A;  3ZRE A;  2MMA A;  2C3T A;  3P90 A;  4TR4 A;  2JSZ A;  5DAK A;  4OWY A;  5AIV A;  4EKZ A;  5ID2 A;  3FYG A;  1BED A;  3LWA A;  1EV4 A;  2X8H A;  2VD1 A;  5JWQ B;  3KP8 A;  4ZL7 A;  2BJX A;  1M2A A;  1LU4 A;  3GUS A;  1ZYN A;  2C0F A;  4ACS A;  1ILO A;  4LL4 B;  2LJK A;  4POL A;  3TGZ A;  4TKY A;  5A4W A;  1T4Y A;  5A4V A;  4Z2U A;  2O89 A;  1ERT A;  2H1B A;  1Y25 A;  5FWG A;  3MWH A;  3EU3 A;  3QPM A;  5ECH B;  19GS A;  1OYJ A;  3ZL5 A;  2CV4 A;  1THX A;  2CX4 A;  5CO3 A;  1PRX A;  2H1D A;  5IPH A;  1Z5Y E;  1B9Y C;  6GSU A;  5AN1 A;  1DSB A;  1A2L A;  3GST A;  3QFB C;  3P2A A;  3L0H A;  1F3A A;  1XIY A;  2HZE B;  4OFN A;  1TRS A;  2YPM A;  5B7C A;  1SKW B;  17GS A;  3UVT A;  5AGY A;  2RII A;  2HYX A;  3H8Q A;  3DKS A;  4IGJ A;  3DEX A;  2PU9 C;  4K2D A;  4K8M A;  2FWE A;  4JED A;  1BAY A;  2FUG 2;  4CDO A;  1HNC A;  1UVZ A;  1J0F A;  2WDU A;  2JAC A;  4G10 A;  2ALB A;  4I2U A;  1EWX A;  3ZVJ A;  1K0M A;  1DE1 A;  2IMF A;  4O7H A;  2RLI A;  2VAF A;  2HSM A;  4OFM A;  4A5P A;  2C1Y A;  2CZ2 A;  3QR6 A;  2ZCT A;  2PGT A;  4XS1 A;  2A2S A;  3VK9 A;  3TJG A;  5DBQ A;  4K2X A;  4NAX A;  4TXV A;  3GX0 A;  3ZYW A;  3CBU A;  4RUV A;  3KD0 A;  4MJE A;  1R5A A;  3UBL A;  3D0Z A;  3QFA C;  2QSI A;  3G9B A;  1A0F A;  1M2B A;  1QK8 A;  3NIV A;  4USS A;  1QXH A;  2DIY A;  5AIS A;  5IMD A;  3GUR A;  2K8S A;  2AUV A;  4O5U A;  2DJ2 A;  1XWK A;  2V32 A;  4BVY B;  5IMZ A;  1PN9 A;  1ABA A;  3N9J A;  2N5F A;  4Q5F A;  3VWW A;  2OE1 A;  3HD5 A;  5DJM A;  3KH9 A;  3Q18 A;  3WGD A;  2FWG A;  1TW9 A;  1WJK A;  3LFL A;  1QUW A;  2B7K A;  2BTO T;  4YKG A;  1SEN A;  4MLY A;  3VI5 A;  4WR4 A;  3FY7 A;  3EUR A;  5IMA A;  1ZL9 A;  1NW2 A;  2JZR A;  1YKA A;  2X64 A;  4D73 A;  6GST A;  2GVP A;  5F8B A;  3TCO A;  2REM A;  1WP0 A;  3S9F A;  3CTF A;  2TRC P;  3F0I A;  1R5P A;  1HYU A;  5CYY A;  5IMC A;  4G0I A;  3F4T A;  1TDI A;  4ZB6 A;  3TJF A;  2VL3 A;  3ERG A;  2QA1 A;  2DJ0 A;  3PGT A;  1FOH A;  3TKQ A;  1YEX A;  2XHF A;  3ISO A;  3FKF A;  2CVK A;  1ZYP A;  3EYT A;  5JCU A;  3KTL A;  4WF4 A;  3GSS A;  1OVN A;  4KF9 A;  2LV3 A;  1ML6 A;  1GSQ A;  3HCZ A;  1ZMA A;  4PQI A;  3UAP A;  2KLX A;  2LNS A;  4KE3 A;  4G19 A;  2DJJ A;  1TU8 A;  4IQA A;  4K1F A;  2H73 A;  13GS A;  1RQM A;  1FAA A;  3CSH A;  1AC1 A;  4JR6 A;  1C72 A;  3LGC A;  3KCM A;  4HI7 A;  1Z6M A;  1WWJ A;  2MMZ A;  2WJU A;  3F4R A;  4DVC A;  1O7U A;  5HR2 A;  5LCZ A;  3LJR A;  3CMI A;  9GSS A;  5IOX A;  3I6A A;  4ICY A;  4QL9 A;  5GZZ B;  1GWC A;  3GHA A;  3A2X A;  5A4U A;  4ULX A;  5GAP D;  2FHE A;  3IAM 2;  2C0D A;  1XXU A;  4K6X A;  4MA9 A;  4GF0 A;  3GH6 A;  3GFK A;  1B4Q A;  2HT9 A;  4OCF A;  3RDW A;  1B8X A;  5CP1 A;  2YJH A;  1YKC A;  4K7O A;  5ECQ B;  1ERW A;  4O92 A;  7GSS A;  1SL0 B;  2PWJ A;  1T3B A;  2IIY A;  3PIN A;  2PUK C;  2MYG A;  4XHM A;  2JSY A;  4OCE A;  2GQM A;  1X5D A;  3MDK A;  1TP9 A;  4I8B A;  4K0G A;  3ME7 A;  2WZ9 A;  2P5Q A;  4PNF A;  2A2P A;  4KDY A;  2HRN A;  2PVO C;  5EL8 A;  4MF5 A;  4ML1 A;  3C8E A;  4G2E A;  1JHB A;  2FNO A;  5ECN B;  5H5Q A;  3GMF A;  1EP7 A;  4DSR A;  1FO5 A;  3KMO A;  4K7I A;  1K3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...