4ILFA

Crystal structure of dsbc r125a from salmonella enterica serovar typhimurium
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
AMDPEFMDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPAQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the periplasmic disulfide-bond isomerase DsbC from Salmonella enterica serovar Typhimurium and the mechanistic implications.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein DsbC
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 4ilfA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ilfA02
1T4ZA 4X43A 1KTEA 2P5RA 3IV4A 3F6FA 1ERTA 2LJAA 1GSUA 2O89A 3I9V2 3MAKA 2C0GA 3IPZA 5CAXA 3D5JA 1PGTA 2OKAA 2I9HA 5ECIB 5ELGA 2FWFA 4FYUA 5GAND 1ZCPA 4WR5A 1ACVA 4V2MA 1JLVA 3D4MA 1J0FA 2AAWA 1O8XA 2PN8A 1GNEA 4NHZA 3G7IA 4KSOA 3BBYA 3HVSA 2WZ9A 2DJ1A 4WBJA 1K3OA 4F2IA 3WD6A 2PU9C 3A2WA 1XW6A 2YJ7A 3D4TA 3D6IA 3APQA 4IN0A 5ECSA 3PH9A 2IPAA 2AB6A 3GFKA 3DD3A 5FWGA 2XPEA 4WR4A 5IQYA 3FR3A 1B9XC 4ZBBA 3GYKA 1VF1A 5GSSA 4OCEA 2KLXA 5IMAA 5GZZB 1GTIA 5ID2B 3WGEA 1WP0A 2TIRA 3CRTA 4HZ2A 4ILFA 1T00A 1EEMA 2GDRA 3GH6A 3A2VA 2LQOA 1XXUA 3LYKA 3N5OA 5J9CA 2GSSA 1MDIA 2LV3A 4MP4A 3DWVA 5AIXA 2PBJA 3RHBA 5G5FA 1UC7A 2YPMA 1HD2A 3TOTA 1AW9A 1B4QA 5JWRB 2C0DA 3QR6A 3ZZXA 2VCVA 4IJIA 1XPVA 5D8IA 3APSA 5DJLA 4XCSA 3US3A 5ECLB 3GV1A 1XIYA 5F8BA 4JR6A 3HZ4A 1SL0B 3MDKA 3GX0A 2KUCA 2CX3A 1YEPA 1HNBA 1H75A 4FO5A 1FVJA 1GRXA 1JZDA 19GSA 1OAZA 2R3XA 4N0VA 2RLIA 5IO0A 1X0RA 1YDKA 1GL8A 4NMUA 3WT1A 6GSUA 2C80A 4K9ZA 2VCWA 2H74A 3TB2A 1SYRA 1Y6EA 4MH2A 3EMPA 3FK8A 3P90A 6GSTA 5HFKA 3UBLA 3VWVA 4K6XA 5D9VA 2YWIA 5GAPD 3IOSA 1GSSA 5A5KA 2H70A 1THXA 2XBQA 3ZFLA 4AJ7A 5IMFA 2GQMA 1EV9A 2DIYA 1UN2A 5F07A 1S3DA 2H8LA 4MLYA 2GVPA 1M7TA 5IOWA 1X5DA 5DALA 2RM6A 3UVHA 2H73A 1XWBA 13GSA 1WJKA 2CZ3A 2HYXA 22GSA 4YAPA 4G10A 2GLRA 3IE3A 3LEFA 1GSEA 3QD9A 2HNLA 2ON5A 4V1Ag 4I2TA 1XVQA 1ZYEA 3UVTA 3ZYWA 2HE3A 4OO5A 1NM3A 1OE8A 3M9JA 4GCIA 5A4UA 2F51A 1HYUA 1X5CA 2G0FA 2IFQA 3FKFA 3GKKA 4CDOA 3KTLA 5KN2A 2YJHA 1TRUA 5ECRB 1OE7A 3NIVA 3QAVA 3KP8A 5ABRA 4IHUA 2HZEA 2V1MA 4K7IA 3L78A 2IMFA 1XWCA 1YF1A 1PN9A 5DBQA 1DUGA 4MJEA 3FR6A 2V2GA 2L57A 3TJBA 2CX4A 4HI7A 2H75A 3O3TA 1Z7PA 5CYYA 2ZCTA 3FHKA 5AN1A 4D73B 3L4NA 5A4VA 2HRFA 5CRDA 4KCEA 5INYA 1B48A 3LORA 3BD2A 5G1KA 3APOA 4OFTA 1V98A 1ST9A 1TRSA 2K8SA 4N11A 1USBA 1SYXA 5B7CA 1SK1A 4PNFA 5F0GA 3KGKA 5E4WA 4GQCA 5F06A 3CTFA 3IXRA 4Q5QA 4FIWA 4XRAA 1GUMA 4POBA 5ID2A 4YQUA 16GSA 1SU9A 3D21A 2AJQB 1WPIA 1GSQA 10GSA 4MMMA 5G5EA 4OD7A 1TKDB 1TRWA 2R4VA 3VK9A 3HA9A 1EGRA 2M72A 1CQHA 4PQHA 3TKRA 3GTUB 4IQAA 3NZNA 3IK7A 4XS1A 3GKXA 4GWRA 1YQ1A 2GQKA 4KH7A 2GZZA 2VO4A 1TK5B 2K18A 2LKUA 4AGSA 4Z7XA 3H8QA 5JWOB 5H5RA 2FHEA 4BL7A 3FY7A 11GSA 2LUSA 1TP9A 1A0RP 4IGJA 2LJRA 1OKDA 1DBYA 2YCDA 3FZ4A 4XRDA 4WEYA 1TI1A 1G7OA 4TR0A 5B8AA 1A2LA 2YV9A 1MEKA 1M2DA 3VLNA 3VWWA 1M9AA 3D0ZA 2VCQA 2OE1A 1CQGA 2YWMA 3VI7A 2N5AA 1XZOA 1NW2A 1U3AA 3NOFA 2N5BA 2NTOA 4MF6A 3LJRA 1XWAA 3F4SA 3GH9A 1N2AA 2VLUA 3QFAC 4QQ7A 1J9BA 2MMOA 4OCFA 2RUEA 2JZTA 5J3RA 2GT6A 3IAS2 3R2QA 5ELAA 4YQMA 4NXIA 1A2JA 1YKCA 5EVOA 4WETA 3GSTA 4O32A 3ZREA 3DXBA 2OA7A 3PGTA 2GT5A 4BVXA 1SJ6A 2B5XA 3IR4A 1M99A 1UVZA 1RK4A 4K7NA 2ON7A 3WYWA 3H4KA 2DMLA 3DRNA 3FR9A 4IQ1A 1UA5A 2MBTA 4LL4B 1AIUA 2B1LA 2KP2A 5DVBA 3ERFA 2B7JA 4F03A 4GQFA 3P8WA 3LXZA 2GTUA 1VF2A 4HJ2A 4ZL8A 3CSJA 2L59A 2FGXA 2F9SA 3F3QA 3QPMA 1PL2A 4KB3A 3L9VA 2NPBA 4POMA 5F05A 2FWEA 1X9MB 4DVCA 5KEJA 1VRSD 2DBCA 5HR0A 4EDZA 3WT2A 4KDXA 2L5OA 5ECQB 1R7HA 2VAFA 3CYNA 3ERWA 3QCPA 3WGDA 2H66A 2LQQA 1A2MA 3GIXA 2H71A 3GURA 3F63A 1OKTA 4K2DA 1Z7RA 4MF5A 1SJIA 1V9WA 3J7Yb 5FT3A 1DSBA 4YAVA 4I97A 4MJCA 1K0MA 2HSYA 4LA1A 3CBUA 1C72A 1GSDA 17GSA 4MZWA 4KW6A 1T1VA 5DQSA 3KEBA 3TKSC 3GMFA 5D9XA 5FHIA 3AY8A 4KGIA 4L0WA 2P31A 2I81A 4HQZA 4E8HA 3CSHA 3W8SA 4OWYA 1PRXA 4JBBA 2JACA 3EE2A 5HFIA 1O6JA 3K8NA 5C00A 3EINA 1X9SB 4EF0A 4L0UA 1BAYA 2EIQA 4RI6A 4KDUA 1X5EA 3TJKA 2DIZA 3ED3A 4MPGA 2RUFA 2B1KA 2D2ZA 3TKSE 6GSSA 3ZFBA 2GS3A 4JU5A 1H4OA 3GKMA 1ZL9A 3TJFA 5EPFA 2TRCP 3HJMA 4MDCA 2O85A 1XBSA 1R4WA 4ZL9A 3VWUA 3DVXA 1ABAA 2H76A 2FCHA 9GSSA 1LJRA 2JSZA 2IMEA 2XPDA 3GX8A 3M1GA 1XOAA 1O8WA 3F4RA 1TW9A 2VD1A 1FAAA 2L4QA 5A4WA 1EZKA 2QKEA 4NPBA 2VIMA 2HZEB 4HEA2 5ECOB 4KCAA 1XWGA 2H30A 2GQLA 3RPPA 1OC9B 2HT9A 2DC5A 4XS4B 3C1RA 5IMCA 2R6KA 2OADA 1ZZYA 4BVYA 4MJAA 2F8FA 2CVDA 1Z6MA 5J5NA 1G6YA 4TR3A 5J9BA 5LCZA 2AV4A 1Z5YE 4BA7A 1TJDA 1E6BA 1K0DA 4EE0A 4ACSA 4MCUA 1E2YA 5HR1A 4EDYA 5J4UA 2IFQB 4WF5A 1SKSB 1SK0A 1ERWA 3KTBA 4DSSB 2GSRA 1LU4A 3VI5A 2R37A 2DJ2A 4GSTA 4MA9A 1IYIA 3S9FA 4V2NA 2ES7A 2REMA 3LQ7A 1GLQA 5HR2A 2VM1A 4MH3A 1XW9A 4QL7A 5CREA 5ECPB 4TW5A 18GSA 3CTGA 2C3QA 3QOUA 2FA4A 2LRCA 3EWLA 5DAKA 20GSA 2FLSA 2C0FA 2IWTA 2YZUA 1FB0A 1FG4A 1B8XA 3DEXA 4HZ4A 3EU3A 4KX4A 2C3NA 3VURA 3HD5A 3MNGA 2VD0A 4TVEA 5DALB 1PKWA 1ZGNA 1GTUA 2H0IA 2M80A 3LYPA 2V6OA 2FWHA 2B7KA 2WGRA 2OJLA 5KN3A 2FA8A 2HFDA 4IP1A 4N30A 3QFBC 1U6TA 3E9JB 2H0HA 1QUWA 2P5QA 1TOFA 2F8AA 4HQSA 3GN3A 1M2BA 1MDJA 3A3TA 6GSXA 3VWXA 2L4CA 4KA0A 3ZMLA 5JCUA 2YWNA 3E3EA 2YN1A 4CW9A 4FYBA 2YZHA 4ULXA 1AUCA 1OYJA 1YKAA 1T7PB 3MWHA 2B3SA 5ECNB 3I69A 2G2QA 4G2EA 2VUPA 2X8CA 3HHVA 4JEDA 2H1DA 2HZFA 3WGXA 1DE1A 2CZ2A 2CVKA 1M2AA 3IAM2 4TXOA 4KE3A 2KP1A 1YF0A 4KNDA 1Y25A 5KN1A 2WDUA 2YWOA 2OE3A 2WS2A 1BEDA 2WFCA 1GP1A 4OFNA 4IS0A 1A0FA 3JCML 4F82A 4GF0A 4J56E 3LWAA 2HI7A 4HDEA 4I8BA 4EKZA 4V2LA 1O7UA 2L6CA 3N9JA 5JCGA 1SL1B 1TU7A 1SD9A 1K0CA 3TOUA 3RHCA 5IPHA 5IO2A 3IK9A 1YEXA 1F6MC 1MDKA 2CVBA 4POLA 1EV4A 5LD0A 3EVIA 1N8JA 2E0QA 3FRCA 4PQIA 4ML1A 3DKSA 4Q5FA 1F2EA 1Q4JA 4I2UA 4K0NA 3FZ5A 1VF3A 2JZSA 4AF2A 2KHPA 3H93A 1Z6NA 2DJ0A 2GGTA 2WRTA 3DMLA 3KD0A 2OACA 5JWQB 4ECIA 3IDVA 1SKRB 2R5GA 5D9WA 1MTCA 4X1UA 1WWJA 1IYHA 1T4YA 3HVXA 3HYPA 2PPTA 3GA4A 2RIIA 1JZOA 3HDCA 3UJ1A 3KH9A 2DJKA 5AIVA 4ZILA 1SENA 4AJ8A 4GSSA 4EUYA 5B6NA 3I43A 2K6VA 4DSRA 4K7OA 2AUVA 3UL3A 1K3LA 1V40A 3DVWA 5DDLA 1AC1A 3KMNA 1ON4A 2XC2A 1WE0A 4EVMA 4NAXA 4V1Ap 1FO5A 2V6KA 2NVLA 6GSWA 1G7EA 4L5OA 2H1GA 2H6YA 4HS1A 4MZBA 2MZCA 1F37A 1GNWA 4F0CA 4PQ1A 4GRFA 1Z9HA 3HXSA 3MSZA 4JE1A 1B9YC 3LFLA 2YANA 3DYRA 5DQYA 2V41A 2XBIA 5HFGA 3F3RA 4NWYA 2I3YA 4TR1B 5IMVA 3KMOA 4QL9A 4NHWA 6GSVA 3RBTA 1AAZA 1F9MA 1M0UA 4ZBDA 2K9FA 2YNXA 1G0TA 1TU8A 1GH2A 3FYGA 2ALBA 3W6GA 3C73A 5DCHA 1T3BA 3DGQA 1S3CA 3LG6A 4EC0A 2CQ9A 4K1FA 3ZRDA 4BPYA 2MYGA 3RDWA 4L8EA 3FZAA 1BJXA 5ENUA 5H5QA 4HU7A 2H1AA 5G1LA 5B8BA 3P2AA 4KAEA 3E0UA 3TJGA 2LSTA 3ME7A 4XS4A 3ZVJD 3LGCA 2MBSA 1KNGA 3SBCA 1PMTA 3IRAA 2X99A 4EO3A 4G9HA 4XS6A 4MZCA 1K0OA 3TRQA 3EU4A 4O5RA 5IMZA 1XVWA 4ZIJA 1XOBA 3VFIA 2GZPA 4LLRA 1OC8A 4HU9A 4ZBAA 5KN0A 3EURA 2IL3A 2HLSA 2QC7A 4PURA 4JZQA 1EEJA 3GRXA 2H6XA 1V57A 1YY7A 4DSQA 1WRYA 1EOGA 2X64A 1K3YA 5H5SA 4TRXA 3TDGA 3FW2A 3IHQA 3TRPA 5CNWA 4POKA 2LNSA 5CP1A 3GL5A 4CHSA 5EY6A 1EP7A 1THOA 5ECKB 1AQWA 1R26A 2DMMA 1A24A 3IC4A 4HJMA 3GKNA 1B4PA 4D73A 3HVVA 1BYEA 2EC4A 3UBKA 3O6TA 4GTUA 3ME8A 1QFNA 3O76A 4WKWA 2A2SA 3KM6A 4AJ6A 3RPNA 3Q74A 1W4VA 2CV4A 1KBNA 2JADA 3KH7A 2RM5A 1R5AA 1HNAA 4MJBA 2E2GA 4OMVA 5COHA 2C4JA 2LRTA 4I5QA 3ERGA 3VPTA 1T8EB 2O7KA 3TJJA 3IA1A 2LRNA 2PMTA 1SL2B 1U88A 2IMKA 1XW5A 3EC3A 1I9DA 1MD3A 3HKRA 4H86A 1O81A 5AISA 2MMNA 5J41A 1YJ6A 3H79A 3RAZA 5IMDA 2IMIA 3UIWA 3GTUA 3CRUA 4F9ZA 5D9TA 4PUAA 1OC3A 1FW1A 1K0BA 4WBRD 2I4AA 1J08A 4PNGA 3HJPA 2GSTA 1QK8A 3C1SA 4IBPA 2OBKA 2GZYA 5G30A 4Q5NA 2DJJA 2FUG2 2FNOA 2LNTA 2PERA 2K8VA 3BJ5A 3F8UA 4RUVA 2DSAA 2B6MA 3FEUA 2WULA 1XFLA 2M46A 5DAKB 1JHBA 3BCKA 1VF4A 1Q98A 2LTKA 4KUNA 4TR1A 3CMIA 2WJUA 2CT6A 1G6WA 5D93A 4YQVA 1PA3A 12GSA 3P7XA 2CAIA 3TRXA 4MABA 3G7YA 5CRGA 1ZMAA 2IN3A 5AGYA 1O73A 3C7MA 1TK8B 4ZB8A 2O8VB 2QSIA 4X0XA 3ZIJA 3TKSA 1WMJA 2CA8A 1EWXA 2VLVA 5IPGA 14GSA 2MMZA 2VLTA 3LXTA 1PX7A 4KSMA 1JZWA 2YP6A 3Q18A 3TCOA 2VL2C 2IIYA 1ERVA 3BCIA 5C04A 3ZTLA 2BMXA 2VM2A 4PUFC 2LEGA 2GSQA 3VPQA 2NBSA 1PD21 3GNJA 1PQNA 1MD4A 1TXXA 4IVFA 4IW9A 3PR8A 1EOHA 2H1BA 5JCWA 2L6DA 2B5YA 1URMA 3M9KA 2C8UA 4K0GA 3KIJA 1OC9A 4RQRA 1PSQA 3G7JA 2H19A 3I6AA 3ZVJA 3ZMKA 1K0AA 1WIKA 3W8JA 2E2MA 4LL1B 2VL9A 3C71A 4GLTA 3DIEA 4TN8A 1JFUA 2VCZA 2XHFA 3OR5A 1JZRA 2JSYA 1RW1A 3GL3A 4N0ZA 1SKWB 4MK3A 2H0GA 4O92A 3QAGA 1R5PA 3GUSA 1GLPA 1GTBA 4BWQA 2CAQA 3F0IA 4MF7A 4DSSA 3TGZA 2Z9SA 3ZIVA 2I1UA 1GUHA 2VCTA 2J23A 5G2ZA 1XCCA 3UARA 1LBKA 2P0GA 1RQMA 4TR4A 1PL1A 1VGLA 2ZNMA 4K8MA 2VL2A 1W89A 7GSSA 3V1WA 3D22A 3M8NA 4RQXA 3ZL5A 2AHEA 3HZ8A 4GSNA 4IP6A 2X8GA 3M0FA 4XHMA 4XTSA 3GHAA 4IELA 1HQOA 4XIHA 5IM9A 2C1YA 1A23A 1WOUA 2FD3A 3F6DA 4J57E 2OE0A 4WXTA 4KDYA 2BJXA 4P3YB 1O85A 1TRVA 1SD8A 4F0BA 2WCIA 1A8YA 2HXKA 1F3BA 3Q19A 1GSFA 5EL8A 1YZXA 2L5LA 1GULA 4ZL7A 1ZYQB 5L71A 1V2AA 1TDIA 2HRNA 3KZQA 1AQXA 4YH2A 2DLXA 1FOVA 5IOXA 4FH8A 3G9BA 4EXJA 1BG5A 1AQVA 4ZXGA 5G31A 1V58A 2VL3A 2IYJA 2C0EA 4JRRA 5DCGA 1FHEA 3H1NA 4GXZA 5ECMB 4PX1A 4E8EA 3CSIA 2C3TA 1QGVA 3C8EA 5E59A 4IJ3A 5HR3A 4ECJA 3QAWA 3HJOA 3ZLPA 2MMAA 1EP8A 2IY2A 1PX6A 2AYTA 2PVQA 2X8HA 3QDNA 2IJYA 1TK0B 3F9UA 5D96A 1PKZA 2H72A 3GSSA 4PGTA 1ML6A 2VOCA 2A4VA 2B5EA 2YOIA 4ECBA 1DE2A 4Q5RA 1U87A 1ZOFA 4ZB6A 2HSHA 2JU5A 3CXGA 2JZRA 3A5WA 4HOJA 4BWSA 4RI7A 5IIZA 4NV2A 4NV5A 1FVKA 4TKYA 4TOPA 4OO4A 4JR4A 4HUAA 3EMXA 5GSTA 1ERUA 2ZUPA 1M9BA 5CRHA 1QXHA 6GSYA 5LNKe 1JLWA 3L0HA 4ZB9A 1KEBA 2VCXA 3A2XA 4J2FA 5D73A 2E7PA 8GSSA 2QGVA 5CRWA 2LS5A 4O7HA 3TKQA 2R2JA 3HY2A 2PWJA 2TRXA 3PINA 2BTOT 3Q6OA 5CO3A 3HCZA 2F3MA 3U5RE 3TKPA 2OBIA 1K0NA 4MPFA 2H6ZA 4EL1A 1EGOA 4ISDA 4TXVA 3L9UA 2H01A 3SWLA 3TUEA 3UMAA 5B6MA 2V32A 1QQ2A 4L5LA 1ILOA 1SJZA 3KJYA 2PVOC 5DJMA 2FWGA 4LMVA 4PXOA 2A2RA 3KP9A 2N5FA 2O87A 1GWCA 4I6XA 3KCMA 3U6VA 3BOAA 1QMVA 1GUKA 2DJ3A 1GTAA 3IBHA 2KOKA 4G19A 4DEJA 2JL4A 3LSZA 4ML6A 3QMXA 1U3IA 1TI3A 3M3MA 3UOMA 2LJKA 2EIOA 3KXOA 4ECCA 1TTZA 2EIRA 2NDOA 4FYCA 1XWKA 4LMWA 4TXOB 1AXDA 1F3AA 1HNCA 3J7Yk 3FZ9A 1FB6A 3UEMA 1A8LA 4OFMA 1S3AA 4ID0A 1SK2A 3EYTA 1BQ7A 2WB9A 1NHYA 4N10A 1BX9A 1Z3EA 3ZITA 1I5GA 2J9HA 2PUKC 3ISOA 4WF4A 2YV7A 1NSWA 1NHOA 1OVNA 2PGTA 5ECHB 2IMDA 4IKHA 3UAPA 3L9SA 5HQPA 1X9WB 2FY6A 3F4TA 1GSYA
chains in the Genus database with same CATH superfamily
4KF9A 1T4ZA 4X43A 1KTEA 2P5RA 3IV4A 2P0XA 1BRSA 1WMNA 3F6FA 1ERTA 2LJAA 1GSUA 5EVHA 2O89A 3I9V2 3MAKA 2C0GA 4FCZA 3IPZA 5CAXA 1RN4A 3D5JA 4USSA 1PGTA 2OKAA 4Z2RA 3FMWA 4KFEA 5JPPA 4LSOA 3DGLA 2I9HA 5ECIB 5ELGA 2FWFA 1UCJA 4FYUA 1TRPA 2HRKA 5GAND 1ZCPA 1DVCA 4WR5A 1ACVA 3CQFA 4V2MA 1JLVA 3D4MA 1J0FA 2AAWA 1UI7A 2BO9B 3HZPA 1O8XA 3IPTA 2PN8A 1GNEA 4NHZA 3G7IA 1IK3A 4KSOA 4RNYA 3BBYA 3HVSA 2WZ9A 1IV9A 2DJ1A 1TUHA 4WBJA 3X3YA 1K3OA 3JUOA 4F2IA 1JJ22 3WD6A 2B1XB 5DRVA 2PU9C 3A2WA 1XW6A 1B27A 5AEWB 2YJ7A 3D4TA 3D6IA 3APQA 3JUMA 3DGMA 4IN0A 2WO0A 3NX0A 5ECSA 1MGRA 3NV0A 3PH9A 4CY6A 2ZDJA 2AB6A 2IPAA 3GFKA 1O7HB 3DD3A 5FWGA 2XPEA 4WR4A 5IQYA 1RN7A 1ROAA 5JPUA 3FR3A 1B9XC 4ZBBA 3GYKA 1VF1A 5STDA 5GSSA 1Z1SA 4CPKA 4OCEA 2KLXA 5IMAA 1IDPA 5GZZB 1GTIA 5ID2B 3WGEA 1IV7A 1WP0A 2TIRA 4HM2B 3CRTA 3G8ZA 4HZ2A 1VZZA 4ORLA 4ILFA 1T00A 1QVF2 5IG3A 1PFPA 2F98A 1GOYA 1EEMA 3BNDA 3FCSB 4WYKA 2GDRA 2P05A 3GH6A 1PY3A 3A2VA 2LQOA 1VQ43 3H51A 1XXUA 1BRHA 3LYKA 3SYUA 3N5OA 5J9CA 2GSSA 1BUQA 1MDIA 5LC6A 2LV3A 1IYYA 2E2UA 1EA2A 4MP4A 1SIIA 1RGAA 3AHWA 3DWVA 2KAAA 3BB9A 1ZYNA 1I3IA 5AIXA 2PBJA 3RHBA 5G5FA 1UC7A 1E97A 2YPMA 1HD2A 3TOTA 1JKGA 4G0KA 1QALA 1AW9A 1B4QA 1AY7A 5JWRB 2C0DA 3QR6A 3ZZXA 3EQQB 2VCVA 6STDA 2GBXB 1XPVA 4IJIA 1ISKA 3CCE3 5D8IA 1U8CB 3APSA 5DJLA 1ZX2A 4XCSA 3US3A 1GYBA 3UL6A 5ECLB 5HOHA 3GV1A 1S3RA 1XIYA 5F8BA 2ZHXB 4JR6A 3FKAA 3MPHA 3HZ4A 1SL0B 3MDKA 3GX0A 1LVNA 2KUCA 4N3VA 2CX3A 1YEPA 1X1YA 1LQMB 1TP6A 4K61A 1HNBA 1H75A 2Y73A 1IQYA 1FVJA 4FO5A 1GRXA 1JZDA 19GSA 1OAZA 2R3XA 2IMJA 1GOVA 2AADA 4N0VA 2RLIA 4K2XA 3OX9A 5IO0A 1X0RA 1YDKA 3MYDA 1GL8A 2UX0A 1ZO2A 4O5QA 1CQSA 3CU3A 4NMUA 3WT1A 6GSUA 3EN8A 3LH4A 2CHCA 3B4PA 2C80A 4STDA 4K9ZA 2VCWA 2H74A 3TB2A 1W02A 1SYRA 1Y6EA 4MH2A 3EMPA 3FK8A 3P90A 6GSTA 1QJGA 5HFKA 3UBLA 3VWVA 3B4OA 4K6XA 5D9VA 1VQ83 2YWIA 5GAPD 3IOSA 1YJ93 1GSSA 2QA1A 5A5KA 1MWTA 3CCQ3 3WR2A 2H70A 1THXA 2XBQA 3ZFLA 4AJ7A 5AIIA 1DVDA 5IMFA 2GQMA 4N6OB 1EV9A 2DIYA 1D6YA 1UN2A 5F07A 1S3DA 3SXXA 3B7CA 2H8LA 4MLYA 2M7OA 4HZ9B 2GVPA 1M7TA 5AEUB 5AYRB 3U1WA 5IOWA 3D4AA 8RNTA 3EJVA 1X5DA 5DALA 2GEYA 1RTUA 2RM6A 3UVHA 2CW9A 2H73A 4HM0B 1XWBA 13GSA 1WJKA 1UW1A 1VQO3 1Y4KA 2CZ3A 2HYXA 2YFLB 22GSA 4YAPA 1KC84 3X41A 4G0LA 4G10A 2GLRA 1W5ZA 3LOYA 3IE3A 3LEFA 1GSEA 3QD9A 2Z6BA 2HNLA 2ON5A 4V1Ag 4I2TA 3FG1A 1XVQA 1ZYEA 3UVTA 3ZYWA 1UUWB 2HE3A 4OO5A 1NM3A 1OE8A 2CG0A 3M9JA 1PYLA 4GCIA 5A4UA 2F51A 1HYUA 3D79A 3KSPA 1X5CA 3EBTA 2GU1A 1N5PA 3CC23 2G0FA 1STFI 2IFQA 3FKFA 2W03A 3GKKA 1AQZA 4CDOA 3KTLA 1DMNA 2QEX3 5KN2A 2YJHA 3QK9A 1TRUA 1EKMA 5ECRB 3NXJA 3MHEA 4ZM8A 1OE7A 2XF3A 3NIVA 3QAVA 1Q40B 3KP8A 5ABRA 4IHUA 2HZEA 2V1MA 4K7IA 3L78A 2IMFA 5KP3A 1XWCA 1YF1A 1PN9A 5DBQA 1DUGA 4MJEA 1B2ZA 3IMAB 3FR6A 1SIHA 5I97A 2V2GA 2L57A 3TJBA 1CH0A 2O9UX 3BNCA 1YIT3 2CX4A 4HI7A 1A90A 5CLKA 1MGWA 1N5HA 2J8XB 2H75A 2R0GA 1Z7PA 3O3TA 5CYYA 3X42A 5IF6A 2ZCTA 3FHKA 5AN1A 1EG9B 4D73B 1W2ZA 2F4YA 3L4NA 5A4VA 1VQP3 2HRFA 2WGOA 5CRDA 4BTWA 3DZLA 4KCEA 5INYA 1B48A 2CC3A 3LORA 3BD2A 5G1KA 2GXFA 1N8R4 3APOA 4OFTA 3F40A 3OWSA 1V98A 1BRGA 1V74A 3FF0A 1ST9A 1YVSA 1TRSA 2K8SA 4N11A 1BIRA 1USBA 1SYXA 4LGQA 1SK1A 5B7CA 4PNFA 3NV0B 5F0GA 3KGKA 5E4WA 5KOXA 4GQCA 5F06A 3CTFA 3IXRA 4Q5QA 4FIWA 4XRAA 1GUMA 4POBA 5ID2A 4YQUA 16GSA 1SU9A 3D21A 2AJQB 3G713 2XEPA 1WPIA 4TX4A 2WGQA 1GSQA 10GSA 1I2GA 1BNRA 4MMMA 5G5EA 1BNIA 4EW5A 4OD7A 3FGYA 1TKDB 1TRWA 4MMXB 2R4VA 3VK9A 3CC43 4I4KA 1K8A4 1RCLA 3M8CA 3S5CA 2KRTA 5M19A 3HA9A 1EGRA 2M72A 5LC7A 1CQHA 4L7KA 4PQHA 3TKRA 3GTUB 4IQAA 3NZNA 3DGYA 3E99A 3IK7A 4XS1A 3GKXA 1J2BA 4GWRA 1JBSA 1YQ1A 2GQKA 4KH7A 4K5SA 2GZZA 2VO4A 1X1WA 3LT8A 1BSBA 1TK5B 2K18A 2LKUA 4AGSA 4Z7XA 3H8QA 5JWOB 2F56A 2QA2A 5H5RA 4IPBA 2FHEA 1OH0A 2HOHA 3EB8A 4BL7A 3FY7A 1LNHA 11GSA 1FUWA 2LUSA 1TP9A 1A2PA 1A0RP 4IGJA 2LJRA 3JUPA 3CCL3 4ICYA 1PFOA 1OKDA 1DBYA 1KQS2 2YCDA 3FZ4A 3MG1A 4R9KA 4XRDA 4WEYA 1TI1A 4BVYB 4HM5B 4TR0A 5B8AA 1G7OA 1A2LA 2YV9A 1MEKA 1M2DA 3VLNA 3VWWA 1M9AA 3D0ZA 2VCQA 2OE1A 1CQGA 2KXGA 2YWMA 1RRLA 3VI7A 2N5AA 1STDA 5HGRA 1XZOA 1X1XA 3EF8A 1NW2A 4YKFA 1U3AA 3CCM3 3NOFA 4X2OA 1RGEA 2N5BA 2NTOA 4MF6A 3U97A 2P09A 3LJRA 2CFWA 4XDVA 1IQ8A 3N8BA 1XWAA 2P0MA 3F4SA 1N2AA 2VLUA 1BUJA 3GH9A 3QFAC 2DKHA 4QQ7A 1J9BA 2MMOA 1O7NB 1JB5A 1JNQA 4OCFA 2RUEA 2JZTA 5J3RA 1GMQA 4Z2UA 2GT6A 3IAS2 2CFLA 3R2QA 5ELAA 4YQMA 4NXIA 1A2JA 1YKCA 5EVOA 4WETA 3GSTA 4O32A 3ZREA 3DXBA 2OA7A 3PGTA 1BANA 2GT5A 4BVXA 4L8OA 3BNBA 1SJ6A 2B5XA 3IR4A 1M99A 4HAAA 3T8UA 1UVZA 1RK4A 4K7NA 2ON7A 3WYWA 3H4KA 2DMLA 3DRNA 3FR9A 1BNSA 4IQ1A 4BIKA 1UA5A 2MBTA 4LL4B 1AIUA 2B1LA 2KP2A 5DVBA 3ERFA 3RGAA 4RNTA 2B7JA 3AGNA 1UGHI 4F03A 4GQFA 3P8WA 3LXZA 2GTUA 1VF2A 4HJ2A 4ZL8A 5JBSA 4O5UA 3CSJA 2ML5A 3PYJA 2FGXA 2L59A 2F9SA 3F3QA 2YFJB 1T5YA 3QPMA 3MYTA 1PL2A 1CYVA 4KB3A 3L9VA 2RSXA 5M1AA 2NPBA 4POMA 5F05A 2FWEA 1I0XA 1A2KA 4EYCA 1X9MB 4DVCA 5KEJA 1VRSD 1QMAA 5CK6A 2DBCA 4H61A 5HR0A 4EDZA 5IG0A 1KD14 4KDXA 3WT2A 2L5OA 5ECQB 1R7HA 2VAFA 3CYNA 5CXOA 3ERWA 4QWTA 2WOFA 1B2SA 1YI23 3QCPA 3WGDA 2H66A 2LQQA 1A2MA 3GIXA 2H71A 3GSPA 3GURA 3JVCA 3F63A 2MC8A 1OKTA 1YGWA 4K2DA 1Z7RA 4MF5A 1SJIA 2K0MA 1V9WA 6RNTA 2Q07A 5FT3A 3J7Yb 1DSBA 4YAVA 3PPUA 1G02A 4I97A 4MJCA 1K0MA 2OCTA 2HSYA 4LA1A 1FUTA 3CBUA 1IT7A 1C72A 1GSDA 1M3JA 4XBXA 1B2MA 17GSA 2HMLB 4MZWA 4KW6A 1T1VA 1T2HA 5DQSA 3KEBA 3TKSC 3GMFA 5D9XA 5FHIA 7STDA 3AY8A 4KGIA 4L0WA 2P31A 3AHSA 1QAKA 2I81A 2R0CA 4HQZA 4E8HA 3CSHA 3W8SA 4OWYA 1PRXA 4JBBA 1AVLA 2JACA 3EE2A 5HFIA 1UUVB 1B21A 1O6JA 3K8NA 5C00A 3EINA 1OACA 3NQYA 3D9RA 1X9SB 4EF0A 4CJNA 4BL2A 4EV2A 4L0UA 1BAYA 1M1K4 2EIQA 2HRAA 4RI6A 4KDUA 1HU9A 3DGOA 4XBTA 1X5EA 3ZG0A 2ZA4A 3TJKA 2DIZA 3PCRA 8CHOA 3ED3A 4MPGA 3ALAA 2WOHA 2RUFA 2B1KA 2D2ZA 2QIYA 3TKSE 6GSSA 3ZFBA 2GS3A 4JU5A 1H4OA 3GKMA 3QRDA 1ZL9A 5EPFA 3TJFA 2QA43 1RDSA 2TRCP 3HJMA 4G1MB 4MDCA 2O85A 1XBSA 1R4WA 4ZL9A 1BNGA 3VWUA 3DVXA 4RZMA 1ABAA 1ULIB 2H76A 1M904 2FCHA 1D6ZA 9GSSA 1LJRA 2OWPA 3PZWA 2HMOB 3AMOA 4KVHA 2JSZA 4X2HA 2BIRA 2IMEA 2XPDA 3GX8A 3M1GA 1W6GA 1MWSA 1XOAA 3LTDA 1O8WA 3F4RA 1TW9A 2VD1A 4BTYA 1FAAA 2L4QA 2MF7A 1LQGC 5A4WA 4PEJA 1EZKA 2QKEA 4NPBA 5ELUA 1LRAA 2VIMA 1FGQA 3F9SA 3KIIA 2HZEB 4HEA2 5ECOB 3CCU3 1RGKA 2ML6A 3Q1CA 4HKVB 1PN0A 1HKXA 4KCAA 1XWGA 2H30A 1FW7A 4CY8A 2GQLA 3RPPA 1OC9B 1OPYA 2I9WA 2HT9A 2DC5A 4XS4B 3S28A 1I0VA 3C1RA 1K734 5IMCA 2R6KA 2BMQB 3DMCA 1FGTA 3X40A 2OADA 1NNVA 1ZZYA 2W56A 4O8SA 3S67A 4BVYA 4MJAA 2F8FA 2CVDA 1Z6MA 5J5NA 1Q864 1G6YA 4TR3A 5J9BA 4LEHA 5LCZA 4O3VA 2AV4A 1O7GB 1I3FA 1Z5YE 4BA7A 1VQM3 1TJDA 4WYKB 1E6BA 1K0DA 4EE0A 4ACSA 1DMMA 1Q7HA 2HMMB 2SBLA 4MCUA 1E2YA 5HR1A 4FMDA 2KCDA 4EDYA 2IFQB 4WF5A 5J4UA 1SKSB 1SK0A 1ERWA 3KTBA 4DSSB 2GSRA 4AKZA 3DGNA 1LU4A 3VI5A 2R37A 2DJ2A 3IHGA 4GSTA 4MA9A 1IYIA 3S9FA 4V2NA 2ES7A 4WFOA 2REMA 3LQ7A 1GS3A 3UL5A 1GLQA 1YGEA 2ZL8A 1IVVA 2GEXA 5HR2A 2VM1A 4MH3A 3CNXA 1XW9A 4QL7A 3CD63 7RNTA 3ZG5A 5CREA 5ECPB 4TW5A 3WOEB 1BVIA 3F7SA 18GSA 1NO3A 2P38A 2L4VA 1HZ1A 3CTGA 2C3QA 3QOUA 2FA4A 2LRCA 3EWLA 5DAKA 3EPTA 5BU4A 20GSA 2CIUA 2FGTA 2FLSA 1RGHA 1DE3A 2C0FA 3NM2A 2IWTA 2YZUA 1FB0A 1FG4A 1B8XA 3DEXA 4HZ4A 3EU3A 4KX4A 2C3NA 3MNGA 3HD5A 4TVEA 2VD0A 3VURA 1B20A 5DALB 5D81A 1PKWA 1MOLA 1ZGNA 1GTUA 1BSDA 2H0IA 4EBGA 2X4AA 2M80A 3GRDA 3ER7A 1YHQ3 3LYPA 2V6OA 2FWHA 2B7KA 1BNJA 2WGRA 3NQZA 2OJLA 5KN3A 3T0UA 2FA8A 2HFDA 4IP1A 4N30A 5IEOA 3QFBC 1U6TA 4HM6B 2QGUA 3E9JB 2H0HA 1QUWA 4OVMA 2A2PA 2P5QA 1TOFA 2F8AA 3DH2A 5IW9A 4HQSA 3H3HA 4FCJA 3GN3A 2C4BA 1M2BA 2XGNA 1MDJA 4J5GA 3A3TA 6GSXA 3VWXA 1BSCA 2L4CA 2XGLA 4KZ1A 4N6NB 1NU3A 4KA0A 1GY6A 3ZMLA 3BU4A 3F14A 3SX1A 1OGZA 5JCUA 2YWNA 3E3EA 2YN1A 1T2IA 4CW9A 2IUKA 1RNBA 4FYBA 1Q40A 2YZHA 2CG1A 4ULXA 1WTHA 1RKYA 3RDEA 1AUCA 1OYJA 1YKAA 1T7PB 3MWHA 2B3SA 5ECNB 5IEPA 3I69A 2G2QA 1IVUA 4G2EA 2VUPA 2X8CA 2X49A 3HHVA 1GY7A 1I70A 1ZS7A 1OHSA 4JEDA 2H1DA 4HM3B 2HZFA 3WGXA 1DE1A 2CZ2A 2CVKA 4N6TA 1M2AA 3IAM2 4GB5A 4TXOA 4HBRA 4KE3A 2KP1A 1YF0A 4KNDA 2C11A 1FUSA 1Y25A 1B3SA 5KN1A 2WDUA 2YWOA 5EEOA 1LOVA 1AVKA 2GU3A 2KF6A 3HIGA 2OE3A 2WS2A 3KZTA 1BEDA 2WFCA 3LTAA 4U13A 2XSHB 1GP1A 1NB5I 4OFNA 4IS0A 1A0FA 1RMSA 3JCML 4F82A 4GF0A 4J56E 3G6E3 3LWAA 2HI7A 1ZYPA 4HDEA 4I8BA 4EKZA 3IC8A 4V2LA 1O7UA 1GD3A 2L6CA 3N9JA 5JCGA 1SL1B 1JN5B 1TU7A 1SD9A 1K0CA 4G0IA 2CFDA 1BAOA 3TOUA 3RHCA 5IPHA 5IO2A 1GD4A 3WODG 1VQL3 1UUGB 3IK9A 1YEXA 1F6MC 2E2TA 1A67A 5BMUA 1MDKA 3MWZA 2CVBA 4POLA 3T8NA 1EV4A 5LD0A 3EVIA 1FGRA 5AYSC 1N8JA 2AAEA 2E0QA 3FRCA 4FMAA 4PQIA 1GMPA 3DKSA 4ML1A 1F2EA 4Q5FA 1Q4JA 4I2UA 2C10A 1NDOB 4K0NA 3FZ5A 4LZIA 2HMNB 1VF3A 2JZSA 2PNCA 4AF2A 2KHPA 3BLZA 3H93A 1Z6NA 2DJ0A 3S27A 2GGTA 2WRTA 4CCVA 3DMLA 1U5OA 3CCS3 3KD0A 2OACA 1M3IA 4HOHA 1TTOA 1B2UA 5JWQB 4ECIA 3NHXA 3IDVA 1SKRB 1RSNA 3UJMA 5DREA 2R5GA 5D9WA 4JF8A 1MTCA 4X1UA 3RGRA 3K0ZA 3I553 4XDWA 5FGOA 3OWUA 1WWJA 1BGSA 1IYHA 1Q42A 1T4YA 3HVXA 3HYPA 3MG2A 3PS8A 2PPTA 4HJLB 3GA4A 2RIIA 1RGGA 3OXAA 4BTXA 3GZRA 1W2B2 5KOWA 1JZOA 3HDCA 4MNNA 2E2VA 3CCJ3 3UJ1A 4DKIA 3KH9A 2OOVA 2DJKA 2BMOB 4HVNA 5AIVA 5AIHA 4ZILA 1SENA 4AJ8A 4GSSA 1X1UA 4EUYA 5B6NA 3I43A 2K6VA 4DSRA 4FMCA 4K7OA 2AUVA 3LTCA 3UL3A 1K3LA 1SQWA 1V40A 3FSDA 3DVWA 5DDLA 1AC1A 3KMNA 2HMJB 1ON4A 2XC2A 1WE0A 4EVMA 4NAXA 4V1Ap 3F7XA 1K28A 1FO5A 2V6KA 2SARA 3NBJA 1VQ63 3KN4A 2NVLA 6GSWA 1G7EA 1L5GB 4L5OA 1YVBI 2H1GA 2H6YA 4HS1A 4MZBA 2MZCA 1F37A 1GNWA 2W9PA 1CEWI 4K1VA 4F0CA 4RNZA 4PQ1A 1MNLA 4R9LA 4GRFA 1DYUA 2CK3H 1Z9HA 3HXSA 3MSZA 3CC73 4JE1A 1B9YC 3LXUX 4LMIA 3LFLA 2YANA 3DYRA 3V98A 5DQYA 4OK0A 2V41A 3SOYA 2XBIA 5HFGA 3F3RA 4EV5A 4NWYA 1YIJ3 2I3YA 4TR1B 5IMVA 1JB2A 3KMOA 3AGOA 4QL9A 1SARA 2R41A 4NHWA 6GSVA 4XB5A 3RBTA 1AAZA 2F5MA 2STDA 3WDGB 1F9MA 1M0UA 4ZBDA 2K9FA 1M9GA 2YNXA 1W6YA 5G2GA 1G0TA 3WOFB 1TU8A 1ZGXA 1VQK3 1GH2A 3FYGA 2ALBA 5BVBA 3W6GA 4A5PA 4MJDA 3RNTA 2RFRA 3K63A 1ULJB 2HSMA 3C73A 5DCHA 1KWIA 3WMDA 1T3BA 4R1KA 3DGQA 4N6LA 1S3CA 3LG6A 4FMBA 4EC0A 1ASKA 2CQ9A 4K1FA 3ZRDA 4BPYA 1FA3A 2MYGA 1FOHA 2Z77A 3RDWA 4L8EA 4EIPA 3FZAA 1BJXA 1QAFA 2GBWB 5IG4A 3EC9A 1I2FA 5ENUA 5H5QA 4MEIA 4WWUC 4HU7A 2LQVA 2H1AA 5G1LA 5B8BA 2Z7AA 3P2AA 4KAEA 3E0UA 4K90B 3TJGA 1GOUA 4IT7A 2LSTA 3ME7A 1TIJA 1WMOA 4XS4A 3ZVJD 1IQXA 3LGCA 1UCLA 2MBSA 2PZVA 4XBYA 1KNGA 2XFTA 1VQQA 3S29A 3SBCA 5KP1A 4O2HA 1PMTA 3IRAA 2CWTA 4KFFA 2X99A 4EO3A 4G9HA 4XS6A 1RLSA 4MZCA 2INXA 1K0OA 2JDIH 3TRQA 3EU4A 3R3EA 4O5RA 2CWVA 5IMZA 1XVWA 3HIIA 2D1WA 2W2CA 3KE7A 1XOBA 4ZIJA 3VFIA 3FF2A 2GZPA 4LLRA 1OC8A 3EN1B 3X3XA 4HU9A 4ZBAA 5KN0A 2BHMA 4RBNA 3EURA 2IL3A 2HLSA 2QC7A 4PURA 4JZQA 1EEJA 3GRXA 5GSPA 2H6XA 1V57A 1GMRA 1YY7A 4DSQA 1WRYA 1EOGA 2X64A 1K3YA 5H5SA 3WA2X 4TRXA 4EIQA 3TDGA 3FW2A 3HVNA 3PGBA 2D42A 1I2EA 3IHQA 3TRPA 3DM8A 5CNWA 4POKA 2LNSA 5CP1A 2YX9A 3GL5A 1W6CA 4CHSA 4NREA 2XH9A 5EY6A 1EP7A 1FGOA 1THOA 1OF5B 1BU4A 5ECKB 1AQWA 3K5TA 1R26A 3N54B 2DMMA 1A24A 3IC4A 4HJMA 3GKNA 1MWUA 1B4PA 4D73A 3HVVA 1BYEA 1I8VA 1W7CA 5CF2A 2EC4A 3UBKA 3O6TA 4GTUA 3ME8A 1QFNA 3O76A 1JRQA 4WKWA 2A4HA 2A2SA 3KM6A 4AJ6A 3RPNA 3Q74A 3OWYA 1W4VA 2CV4A 1UI8A 3ROBA 2F5WA 1KBNA 1EQKA 2JADA 1NB3I 3KH7A 3V92A 2RM5A 4HM8B 1R5AA 3LTBA 1HNAA 3DY5A 4MJBA 4MMYB 2E2GA 4OMVA 5COHA 2C4JA 2LRTA 4I5QA 3ERGA 3VPTA 1T8EB 2O7KA 3TJJA 3IA1A 2LRNA 2PMTA 1SL2B 2CKFB 1U88A 2IMKA 3GZBA 4BL3A 1XW5A 2CX0A 3EC3A 1S723 1I9DA 1MD3A 3HKRA 4H86A 3HK4A 3CXC2 1O81A 5AISA 1N9EA 2MMNA 1TRQA 5J41A 1YJ6A 3H79A 3RAZA 1SJWA 3JUNA 5IMDA 2IMIA 4LYLB 2BT3A 3CPW2 4JRFA 2BU4A 3UIWA 1UCIA 3GTUA 3CRUA 4F9ZA 5D9TA 4PUAA 2CFKA 3NUVA 1FW1A 1K0BA 1OC3A 4WBRD 2I4AA 1J08A 1KSIA 4PNGA 3HJPA 1BRJA 2O3OA 9RNTA 2GSTA 1QK8A 3C1SA 4IBPA 4FQUA 2OBKA 2XRXB 4GHOA 2GZYA 5G30A 4Q5NA 2DJJA 3VGNA 2FUG2 2FNOA 4NHFA 1QVG2 2LNTA 2PERA 2K8VA 3KCHA 3BJ5A 3JUQA 2W56B 3F8UA 4RUVA 2DSAA 1RGLA 2B6MA 3FEUA 1TU5A 2WULA 1XFLA 2M46A 2CH9A 4KFDA 1AV4A 5DAKB 1TFOA 2LYXA 1JHBA 3BCKA 1VF4A 1Q98A 2LTKA 4KUNA 2BNGA 3NM7A 4TR1A 3CMIA 2WJUA 2CT6A 1G6WA 2DKIA 4WP5A 5D93A 1PA3A 4YQVA 12GSA 3P7XA 4BIRA 2CAIA 1F8NA 3TRXA 4MABA 5FW5A 3G7YA 5CRGA 3CME3 3OW22 1ZMAA 2IN3A 5AGYA 2CFGA 1O73A 3C7MA 3VF1A 1TK8B 5KP4A 4ZB8A 2K3DA 2O8VB 2QSIA 5IENA 4X0XA 3ZIJA 3TKSA 1LOYA 1WMJA 2CA8A 1EWXA 2VLVA 5IPGA 14GSA 2MMZA 1RGCA 2VLTA 3LXTA 1PX7A 4KSMA 1JZWA 2YP6A 2XSOB 3Q18A 1MWRA 3K7CA 2VL2C 1OHPA 3SLUA 2IIYA 3TCOA 1ERVA 4KT3B 1YNVX 5AIGA 3BCIA 1PU4A 1BRKA 2Y74A 5C04A 3ZTLA 1VQ73 5A0OB 2BMXA 1WMPA 2VM2A 4PUFC 2LEGA 2GSQA 3VPQA 3GZXB 2NBSA 1PD21 3GNJA 1PQNA 1CYUA 1MD4A 1TXXA 1JKGB 4IVFA 1VQN3 4IW9A 3PR8A 1EOHA 4J8TA 2H1BA 5JCWA 2L6DA 2B5YA 1URMA 3M9KA 2HMKB 2C8UA 3MIXA 4K0GA 3KIJA 2R4IA 1OC9A 1N9JA 3EE1A 3ZFZA 1E3VA 4RQRA 1PSQA 3G7JA 2H19A 3I6AA 3ZVJA 3ZMKA 1K0AA 1WIKA 4AKYA 1GSPA 3W8JA 1K9M4 1IVXA 2E2MA 4LL1B 2VL9A 3C71A 4GLTA 3DIEA 4TN8A 3DUKA 2BMRB 3MSOA 1JFUA 3SVAA 2OTL3 2VCZA 2XHFA 3OR5A 2W9QA 1JZRA 3LYGA 2JSYA 1RW1A 2GSPA 3GL3A 2XFSA 4N0ZA 1SKWB 4MK3A 2H0GA 4O92A 3MG3A 3QAGA 1R5PA 3GUSA 3GWRA 2OQEC 3F8HA 4MMZB 1GLPA 1GTBA 4BWQA 2CAQA 3F0IA 4MF7A 1BNFA 4DSSA 2KF3A 3TGZA 3G4S3 1FZUA 1VQ53 2Z9SA 3ZIVA 2I1UA 1C7HA 3DXOA 1OCVA 3IJEB 2JQ5A 1GUHA 2VCTA 1FGMA 2J23A 5G2ZA 2F99A 1XCCA 3UARA 3CCR3 1LBKA 2P0GA 1DMQA 1JV2B 4BU4A 1S5AA 1RGFA 1RQMA 3LT9A 1XG8A 4TR4A 1PL1A 1VGLA 2ZNMA 4K8MA 2VL2A 1W89A 3FG4A 7GSSA 3V1WA 4Z2TA 2UUGC 2UGIA 3D22A 1BNEA 3M8NA 1BSEA 3L0RA 4RQXA 3ZL5A 2AHEA 3HZ8A 2RGQA 4GSNA 4IP6A 2X8GA 3M0FA 4XHMA 4XTSA 3MKIA 3GHAA 2W04A 4IELA 1HQOA 4XIHA 5IM9A 2C1YA 3CMA3 1A23A 3A76A 1WOUA 2FD3A 3F6DA 3X3ZA 2OTJ3 2OOVC 4J57E 3STDA 2OE0A 3A5EA 2IUJA 3V99A 3WHOA 1W01A 4WXTA 4KDYA 1G96A 2BJXA 4P3YB 4IIAA 1O85A 1TRVA 3D5IA 3FH1A 3UNLA 1GY5A 1SD8A 3LMLA 1Q7Y4 2WCIA 4F0BA 1O7PB 1A8YA 2HXKA 2KF5A 1F3BA 1GSFA 3Q19A 1YZXA 2L5LA 5EL8A 1YJN3 3EBYA 1IVWA 3O8YA 1IU7A 1OUNA 3I0YA 1GULA 1W4NA 4ZL7A 5EQLA 1ZYQB 5L71A 1UDII 1V2AA 3G0KA 1TDIA 2HRNA 3KZQA 1AQXA 2UZ8A 4YH2A 2DLXA 1FOVA 4HM4B 2F86B 3VSYA 5IOXA 4FH8A 3G9BA 2IA7A 4EXJA 1BG5A 1AQVA 4ZXGA 5G31A 1V58A 2VL3A 2IYJA 2C0EA 4JRRA 5DCGA 1RJOA 1FHEA 3I563 3H1NA 1LNIA 4R80A 4GXZA 5ECMB 4PX1A 4YKGA 4E8EA 1JBTA 5CF1A 1Q814 4OUQA 3CSIA 2C3TA 3PCSA 1JB4A 1BRIA 1RRHA 3FLJA 1QGVA 4AEQA 1BRNL 3C8EA 1B2XA 5E59A 2RCDA 4IJ3A 2Z76A 5HR3A 1K41A 5BIRA 3CPOA 1RCKA 4ECJA 3QAWA 2V1LA 1Q824 3KSED 5AIFA 3HJOA 3ZLPA 2MMAA 2FXTA 1EP8A 5IG5A 2IY2A 4GL6A 4HM1B 1PX6A 2AYTA 2PVQA 2X8HA 1EUIC 3QDNA 2IJYA 1TK0B 3HX8A 3F9UA 2YFIB 3FG3A 4EC6A 5D96A 1PKZA 2H72A 3GSSA 4PGTA 3NBBA 1ML6A 2VOCA 2A4VA 1W00A 1AR0A 3LZAA 2B5EA 2YOIA 3N9HA 4ECBA 1DE2A 3SEDA 2OQEA 1US1A 4Q5RA 4K1UA 1U87A 1ZOFA 4ZB6A 4N6UA 2HSHA 2JU5A 3CXGA 4Q53A 1RNTA 1TFKA 2JZRA 1JN5A 3B8LA 3A5WA 4HOJA 4BWSA 4RI7A 3G16A 1C54A 4XM4A 3D3LA 4N6V0 4N6MA 5IIZA 4NV2A 4NV5A 4H3UA 1OHOA 1FVKA 4TKYA 4TOPA 4HM7B 4OO4A 3D5GA 1SPUA 4JR4A 4HSCX 4HUAA 3EMXA 5GSTA 3GAXA 1ERUA 2ZUPA 1OF5A 1M9BA 1R4YA 5CRHA 1QXHA 6GSYA 5LNKe 1R4CA 1JLWA 4K5RA 1N8QA 1M1XB 3L0HA 1NWWA 4ZB9A 5TGNA 1KEBA 2VCXA 3GZYB 5D82A 3A2XA 5AI1A 5D83A 4J2FA 3HOHA 5D73A 2E7PA 8GSSA 1RN1A 1O7WB 3FZWA 2LS5A 2QGVA 5CRWA 1ROVA 4O7HA 3Q3FA 5RNTA 5M18A 4BL7B 1HYFA 2CWUA 3J7Yd 1LOWA 3TKQA 4BVXB 2R2JA 1Q9EA 3HY2A 2PWJA 3EHCA 2W0QA 3KKGA 2TRXA 3PINA 3LW9A 2BTOT 1WNHA 3Q6OA 3HCZA 5CO3A 1BOXA 2F3MA 1O7MB 1NJI4 3U5RE 3TKPA 2OBIA 1K0NA 4MPFA 2H6ZA 4EL1A 1EGOA 4WHAA 4ISDA 4TXVA 3CCV3 7GSPA 4EXRA 3L9UA 5ELJA 3UB1A 2H01A 4HZBB 2RNTA 6GSPA 1YJW3 3SWLA 3TUEA 3UMAA 3K9MC 3URPA 3PXMA 5B6MA 2V32A 4O02B 1QQ2A 1D6UA 2W6JH 4PTSA 4L5LA 1RHLA 1ILOA 1SJZA 3KJYA 2PVOC 5DJMA 3CNMA 2FWGA 3A5IA 4LMVA 4L8PA 1VQ93 4PXOA 3Q2PA 2A2RA 3KP9A 2N5FA 2O87A 3WA3A 4GSPA 1GWCA 3KCMA 4I6XA 3BOAA 3U6VA 2A15A 1QMVA 4FR9A 1LXEA 3F8XA 1GUKA 2DJ3A 1GTAA 3IBHA 2KOKA 2B24B 1JBRA 5BRTA 3HI7A 4G19A 4DEJA 2JL4A 3LSZA 3AMOB 4ML6A 2L1SA 3QMXA 1U3IA 1TI3A 3M3MA 5IERA 1UCKA 3UOMA 2LJKA 4FCMA 1WQLB 2EIOA 3KXOA 4J5KA 4ECCA 1TTZA 2EIRA 4J9AA 2NDOA 4FYCA 1XWKA 3SOAA 2FNQA 4LMWA 1LOXA 2CX1A 1FYSA 4TXOB 1AXDA 4R4KA 3NBRA 2K54A 1F3AA 1HNCA 3Q90A 3J7Yk 3FZ9A 3KFQC 1FB6A 3UEMA 1A8LA 4OFMA 1S3AA 4ID0A 1SK2A 2R0PA 1BSAA 1OGXA 3EYTA 2RBIA 1BQ7A 5BXQA 2WB9A 2XR8B 1NHYA 4N10A 1BX9A 1Z3EA 3ZITA 1I5GA 2J9HA 2PUKC 3ISOA 4WF4A 3EX9A 2YV7A 3BNEA 4X4JA 1DETA 1NSWA 3OV4A 1NHOA 1E3RA 1OVNA 2PGTA 5ECHB 2IMDA 4IKHA 2KF4A 3BIRA 1IT8A 3ECFA 1A2VA 4CDLA 3UAPA 3L9SA 5HQPA 1X9WB 2FY6A 3F4TA 4HYZA 1GSYA 1UGIA
chains in the Genus database with same CATH topology
4KF9A 1T4ZA 4X43A 1KTEA 2P5RA 3IV4A 3F6FA 1ERTA 2LJAA 1GSUA 2O89A 3I9V2 3MAKA 2C0GA 3IPZA 5CAXA 3D5JA 4USSA 1PGTA 2OKAA 4Z2RA 3FMWA 2I9HA 5ECIB 5ELGA 2FWFA 4FYUA 2HRKA 5GAND 1ZCPA 4WR5A 1ACVA 4V2MA 1JLVA 3D4MA 1J0FA 2AAWA 1O8XA 2PN8A 1GNEA 4NHZA 3G7IA 4KSOA 3BBYA 3HVSA 2WZ9A 2DJ1A 4WBJA 1K3OA 4F2IA 3WD6A 2PU9C 3A2WA 1XW6A 2YJ7A 3D4TA 3D6IA 3APQA 4IN0A 5ECSA 3PH9A 4CY6A 2IPAA 2AB6A 3GFKA 3DD3A 5FWGA 2XPEA 4WR4A 5IQYA 3FR3A 1B9XC 4ZBBA 3GYKA 1VF1A 5GSSA 4OCEA 2KLXA 5IMAA 5GZZB 1GTIA 5ID2B 3WGEA 1WP0A 2TIRA 3CRTA 4HZ2A 4ILFA 1T00A 1EEMA 2GDRA 3GH6A 3A2VA 2LQOA 1XXUA 3LYKA 3N5OA 5J9CA 2GSSA 1MDIA 2LV3A 4MP4A 3DWVA 1ZYNA 5AIXA 2PBJA 3RHBA 5G5FA 1UC7A 2YPMA 1HD2A 3TOTA 4G0KA 1AW9A 1B4QA 5JWRB 2C0DA 3QR6A 3ZZXA 2VCVA 4IJIA 1XPVA 5D8IA 3APSA 5DJLA 4XCSA 3US3A 5ECLB 3GV1A 1XIYA 5F8BA 4JR6A 3HZ4A 1SL0B 3MDKA 3GX0A 2KUCA 2CX3A 1YEPA 1HNBA 1H75A 4FO5A 1FVJA 1GRXA 1JZDA 19GSA 1OAZA 2R3XA 4N0VA 2RLIA 4K2XA 5IO0A 1X0RA 1YDKA 3MYDA 1GL8A 4O5QA 4NMUA 3WT1A 6GSUA 2C80A 4K9ZA 2VCWA 2H74A 3TB2A 1SYRA 1Y6EA 4MH2A 3EMPA 3FK8A 3P90A 6GSTA 5HFKA 3UBLA 3VWVA 4K6XA 5D9VA 2YWIA 5GAPD 3IOSA 1GSSA 2QA1A 5A5KA 2H70A 1THXA 2XBQA 3ZFLA 4AJ7A 5IMFA 2GQMA 1EV9A 2DIYA 1UN2A 5F07A 1S3DA 2H8LA 4MLYA 2GVPA 1M7TA 5IOWA 1X5DA 5DALA 2RM6A 3UVHA 2H73A 1XWBA 13GSA 1WJKA 2CZ3A 2HYXA 22GSA 4YAPA 4G0LA 4G10A 2GLRA 3IE3A 3LEFA 1GSEA 3QD9A 2HNLA 2ON5A 4V1Ag 4I2TA 1XVQA 1ZYEA 3UVTA 3ZYWA 2HE3A 4OO5A 1NM3A 1OE8A 3M9JA 4GCIA 5A4UA 2F51A 1HYUA 1X5CA 2G0FA 2IFQA 3FKFA 3GKKA 4CDOA 3KTLA 5KN2A 2YJHA 1TRUA 5ECRB 1OE7A 3NIVA 3QAVA 3KP8A 5ABRA 4IHUA 2HZEA 2V1MA 4K7IA 3L78A 2IMFA 1XWCA 1YF1A 1PN9A 5DBQA 1DUGA 4MJEA 3FR6A 2V2GA 2L57A 3TJBA 2CX4A 4HI7A 2R0GA 2H75A 3O3TA 1Z7PA 5CYYA 2ZCTA 3FHKA 5AN1A 4D73B 3L4NA 5A4VA 2HRFA 5CRDA 4KCEA 5INYA 1B48A 3LORA 3BD2A 5G1KA 3APOA 4OFTA 1V98A 1ST9A 1TRSA 2K8SA 4N11A 1USBA 1SYXA 5B7CA 1SK1A 4PNFA 5F0GA 3KGKA 5E4WA 5KOXA 4GQCA 5F06A 3CTFA 3IXRA 4Q5QA 4FIWA 4XRAA 1GUMA 4POBA 5ID2A 4YQUA 16GSA 1SU9A 3D21A 2AJQB 1WPIA 1GSQA 10GSA 4MMMA 5G5EA 4OD7A 1TKDB 1TRWA 2R4VA 3VK9A 3HA9A 1EGRA 2M72A 1CQHA 3TKRA 4PQHA 3GTUB 4IQAA 3NZNA 3IK7A 4XS1A 3GKXA 4GWRA 1YQ1A 2GQKA 4KH7A 4K5SA 2GZZA 2VO4A 1TK5B 2K18A 2LKUA 4AGSA 4Z7XA 3H8QA 5JWOB 2QA2A 5H5RA 2FHEA 4BL7A 3FY7A 11GSA 2LUSA 4IGJA 1TP9A 1A0RP 2LJRA 4ICYA 1OKDA 1DBYA 2YCDA 3FZ4A 4XRDA 4WEYA 1TI1A 4BVYB 4TR0A 5B8AA 1G7OA 1A2LA 2YV9A 1MEKA 1M2DA 3VLNA 3VWWA 1M9AA 3D0ZA 2VCQA 2OE1A 1CQGA 2YWMA 3VI7A 2N5AA 1XZOA 1NW2A 4YKFA 1U3AA 3NOFA 2N5BA 2NTOA 4MF6A 3LJRA 1XWAA 3F4SA 3GH9A 1N2AA 2VLUA 3QFAC 2DKHA 4QQ7A 1J9BA 2MMOA 4OCFA 2RUEA 2JZTA 5J3RA 4Z2UA 2GT6A 3IAS2 3R2QA 5ELAA 4YQMA 4NXIA 1A2JA 1YKCA 5EVOA 4WETA 3GSTA 4O32A 3ZREA 3DXBA 2OA7A 3PGTA 2GT5A 4BVXA 1SJ6A 2B5XA 3IR4A 1M99A 1UVZA 1RK4A 4K7NA 2ON7A 3WYWA 3H4KA 2DMLA 3DRNA 3FR9A 4IQ1A 1UA5A 2MBTA 4LL4B 1AIUA 2B1LA 2KP2A 5DVBA 3ERFA 2B7JA 4F03A 4GQFA 3P8WA 3LXZA 2GTUA 1VF2A 4HJ2A 4ZL8A 4O5UA 3CSJA 2L59A 2FGXA 2F9SA 3F3QA 3QPMA 1PL2A 4KB3A 3L9VA 2NPBA 4POMA 5F05A 2FWEA 1X9MB 4DVCA 5KEJA 1VRSD 2DBCA 5HR0A 4EDZA 3WT2A 4KDXA 2L5OA 5ECQB 1R7HA 2VAFA 3CYNA 3ERWA 3QCPA 3WGDA 2H66A 2LQQA 1A2MA 3GIXA 2H71A 3GURA 3F63A 1OKTA 4K2DA 1Z7RA 4MF5A 1SJIA 1V9WA 3J7Yb 5FT3A 1DSBA 4YAVA 3PPUA 4I97A 4MJCA 1K0MA 2HSYA 4LA1A 3CBUA 1C72A 1GSDA 17GSA 4MZWA 4KW6A 1T1VA 5DQSA 3KEBA 3TKSC 3GMFA 5D9XA 5FHIA 3AY8A 4KGIA 4L0WA 2P31A 2I81A 2R0CA 4HQZA 4E8HA 3CSHA 3W8SA 4OWYA 1PRXA 4JBBA 2JACA 3EE2A 5HFIA 1O6JA 3K8NA 5C00A 3EINA 1X9SB 4EF0A 4L0UA 1BAYA 2EIQA 2HRAA 4RI6A 4KDUA 1X5EA 3TJKA 2DIZA 3ED3A 4MPGA 2RUFA 2B1KA 2D2ZA 3TKSE 6GSSA 3ZFBA 2GS3A 4JU5A 1H4OA 3GKMA 1ZL9A 3TJFA 5EPFA 2TRCP 3HJMA 4MDCA 2O85A 1XBSA 1R4WA 4ZL9A 3VWUA 3DVXA 1ABAA 2H76A 2FCHA 9GSSA 1LJRA 2JSZA 2IMEA 2XPDA 3GX8A 3M1GA 1XOAA 1O8WA 3F4RA 1TW9A 2VD1A 1FAAA 2L4QA 5A4WA 1EZKA 2QKEA 4NPBA 2VIMA 2HZEB 4HEA2 5ECOB 1PN0A 4KCAA 1XWGA 2H30A 4CY8A 2GQLA 3RPPA 1OC9B 2HT9A 2DC5A 4XS4B 3C1RA 5IMCA 2R6KA 2OADA 1ZZYA 4BVYA 4MJAA 2F8FA 2CVDA 1Z6MA 5J5NA 1G6YA 4TR3A 5J9BA 5LCZA 2AV4A 1Z5YE 4BA7A 1TJDA 1E6BA 1K0DA 4EE0A 4ACSA 4MCUA 1E2YA 5HR1A 4EDYA 5J4UA 2IFQB 4WF5A 1SKSB 1SK0A 1ERWA 3KTBA 4DSSB 2GSRA 1LU4A 3VI5A 2R37A 2DJ2A 3IHGA 4GSTA 4MA9A 1IYIA 3S9FA 4V2NA 2ES7A 2REMA 3LQ7A 1GLQA 5HR2A 2VM1A 4MH3A 1XW9A 4QL7A 5CREA 5ECPB 4TW5A 18GSA 3CTGA 2C3QA 3QOUA 2FA4A 2LRCA 3EWLA 5DAKA 3EPTA 20GSA 2FLSA 2C0FA 2IWTA 2YZUA 1FB0A 1FG4A 1B8XA 3DEXA 4HZ4A 3EU3A 4KX4A 2C3NA 3MNGA 3HD5A 4TVEA 2VD0A 3VURA 5DALB 1PKWA 1ZGNA 1GTUA 2H0IA 2X4AA 2M80A 3LYPA 2V6OA 2FWHA 2B7KA 2WGRA 2OJLA 5KN3A 2FA8A 2HFDA 4IP1A 4N30A 3QFBC 1U6TA 3E9JB 2H0HA 1QUWA 2A2PA 2P5QA 1TOFA 2F8AA 4HQSA 3GN3A 1M2BA 1MDJA 3A3TA 6GSXA 3VWXA 2L4CA 4KA0A 3ZMLA 5JCUA 2YWNA 3E3EA 2YN1A 4CW9A 4FYBA 2YZHA 4ULXA 1AUCA 1OYJA 1YKAA 1T7PB 3MWHA 2B3SA 5ECNB 3I69A 2G2QA 4G2EA 2VUPA 2X8CA 2X49A 3HHVA 4JEDA 2H1DA 2HZFA 3WGXA 1DE1A 2CZ2A 2CVKA 1M2AA 3IAM2 4TXOA 4KE3A 2KP1A 1YF0A 4KNDA 1Y25A 5KN1A 2WDUA 2YWOA 2OE3A 2WS2A 1BEDA 2WFCA 1GP1A 4OFNA 4IS0A 1A0FA 3JCML 4F82A 4GF0A 4J56E 3LWAA 2HI7A 1ZYPA 4HDEA 4I8BA 4EKZA 3IC8A 4V2LA 1O7UA 2L6CA 3N9JA 5JCGA 1SL1B 1TU7A 1SD9A 1K0CA 4G0IA 3TOUA 3RHCA 5IPHA 5IO2A 3IK9A 1YEXA 1F6MC 5BMUA 1MDKA 2CVBA 4POLA 1EV4A 5LD0A 3EVIA 1N8JA 2E0QA 3FRCA 4PQIA 4ML1A 3DKSA 4Q5FA 1F2EA 1Q4JA 4I2UA 4K0NA 3FZ5A 1VF3A 2JZSA 4AF2A 2KHPA 3H93A 1Z6NA 2DJ0A 2GGTA 2WRTA 3DMLA 3KD0A 2OACA 5JWQB 4ECIA 3IDVA 1SKRB 2R5GA 5D9WA 1MTCA 4X1UA 1WWJA 1IYHA 1T4YA 3HVXA 3HYPA 2PPTA 3GA4A 2RIIA 5KOWA 1JZOA 3HDCA 4MNNA 3UJ1A 3KH9A 2DJKA 5AIVA 4ZILA 1SENA 4AJ8A 4GSSA 4EUYA 5B6NA 3I43A 2K6VA 4DSRA 4K7OA 2AUVA 3UL3A 1K3LA 1V40A 3DVWA 5DDLA 1AC1A 3KMNA 1ON4A 2XC2A 1WE0A 4EVMA 4NAXA 4V1Ap 1FO5A 2V6KA 2NVLA 6GSWA 1G7EA 4L5OA 2H1GA 2H6YA 4HS1A 4MZBA 2MZCA 1F37A 1GNWA 4F0CA 4PQ1A 4GRFA 1Z9HA 3HXSA 3MSZA 4JE1A 1B9YC 3LFLA 2YANA 3DYRA 5DQYA 2V41A 2XBIA 5HFGA 3F3RA 4NWYA 2I3YA 4TR1B 5IMVA 3KMOA 4QL9A 4NHWA 6GSVA 3RBTA 1AAZA 1F9MA 1M0UA 4ZBDA 2K9FA 2YNXA 1G0TA 1TU8A 1GH2A 3FYGA 2ALBA 3W6GA 4A5PA 2HSMA 3C73A 5DCHA 1T3BA 3DGQA 1S3CA 3LG6A 4EC0A 2CQ9A 4K1FA 3ZRDA 4BPYA 2MYGA 1FOHA 3RDWA 4L8EA 4EIPA 3FZAA 1BJXA 5ENUA 5H5QA 4HU7A 2H1AA 5G1LA 5B8BA 3P2AA 4KAEA 3E0UA 3TJGA 2LSTA 3ME7A 4XS4A 3ZVJD 3LGCA 2MBSA 1KNGA 3SBCA 1PMTA 3IRAA 2X99A 4EO3A 4G9HA 4XS6A 4MZCA 1K0OA 3TRQA 3EU4A 3R3EA 4O5RA 5IMZA 1XVWA 4ZIJA 1XOBA 3VFIA 2GZPA 4LLRA 1OC8A 4HU9A 4ZBAA 5KN0A 3EURA 2IL3A 2HLSA 2QC7A 4PURA 4JZQA 1EEJA 3GRXA 2H6XA 1V57A 1YY7A 4DSQA 1WRYA 1EOGA 2X64A 1K3YA 5H5SA 4TRXA 4EIQA 3TDGA 3FW2A 3IHQA 3TRPA 5CNWA 4POKA 2LNSA 5CP1A 3GL5A 4CHSA 5EY6A 1EP7A 1THOA 5ECKB 1AQWA 1R26A 2DMMA 1A24A 3IC4A 4HJMA 3GKNA 1B4PA 4D73A 3HVVA 1BYEA 2EC4A 3UBKA 3O6TA 4GTUA 3ME8A 1QFNA 3O76A 4WKWA 2A4HA 2A2SA 3KM6A 4AJ6A 3RPNA 3Q74A 1W4VA 2CV4A 1KBNA 2JADA 3KH7A 2RM5A 1R5AA 1HNAA 4MJBA 2E2GA 4OMVA 5COHA 2C4JA 2LRTA 4I5QA 3ERGA 3VPTA 1T8EB 2O7KA 3TJJA 3IA1A 2LRNA 2PMTA 1SL2B 1U88A 2IMKA 1XW5A 3EC3A 1I9DA 1MD3A 3HKRA 4H86A 1O81A 5AISA 2MMNA 5J41A 1YJ6A 3RAZA 3H79A 5IMDA 2IMIA 3UIWA 3GTUA 3CRUA 4F9ZA 5D9TA 4PUAA 1OC3A 1FW1A 1K0BA 4WBRD 2I4AA 1J08A 4PNGA 3HJPA 2GSTA 1QK8A 3C1SA 4IBPA 4FQUA 2OBKA 2GZYA 5G30A 4Q5NA 2DJJA 2FUG2 2FNOA 2LNTA 2PERA 2K8VA 3BJ5A 3F8UA 4RUVA 2DSAA 2B6MA 3FEUA 2WULA 1XFLA 2M46A 5DAKB 1JHBA 3BCKA 1VF4A 1Q98A 2LTKA 4KUNA 4TR1A 3CMIA 2WJUA 2CT6A 1G6WA 5D93A 2DKIA 4YQVA 1PA3A 12GSA 3P7XA 2CAIA 3TRXA 4MABA 3G7YA 5CRGA 1ZMAA 2IN3A 5AGYA 1O73A 3C7MA 1TK8B 4ZB8A 2O8VB 2QSIA 4X0XA 3ZIJA 3TKSA 1WMJA 2CA8A 1EWXA 2VLVA 5IPGA 14GSA 2MMZA 2VLTA 3LXTA 1PX7A 4KSMA 1JZWA 2YP6A 3Q18A 3TCOA 2VL2C 2IIYA 1ERVA 3BCIA 5C04A 3ZTLA 2BMXA 2VM2A 4PUFC 2LEGA 2GSQA 3VPQA 2NBSA 1PD21 3GNJA 1PQNA 1MD4A 1TXXA 4IVFA 4IW9A 3PR8A 1EOHA 2H1BA 5JCWA 2L6DA 2B5YA 1URMA 3M9KA 2C8UA 3MIXA 4K0GA 3KIJA 1OC9A 4RQRA 1PSQA 3G7JA 2H19A 3I6AA 3ZVJA 3ZMKA 1K0AA 1WIKA 3W8JA 2E2MA 4LL1B 2VL9A 3C71A 4GLTA 3DIEA 4TN8A 1JFUA 2VCZA 2XHFA 3OR5A 1JZRA 2JSYA 1RW1A 3GL3A 4N0ZA 1SKWB 4MK3A 2H0GA 4O92A 3QAGA 1R5PA 3GUSA 1GLPA 1GTBA 4BWQA 2CAQA 3F0IA 4MF7A 4DSSA 3TGZA 2Z9SA 3ZIVA 2I1UA 1GUHA 2VCTA 2J23A 5G2ZA 1XCCA 3UARA 1LBKA 2P0GA 1RQMA 4TR4A 1PL1A 1VGLA 2ZNMA 4K8MA 2VL2A 1W89A 7GSSA 3V1WA 4Z2TA 3D22A 3M8NA 4RQXA 3ZL5A 2AHEA 3HZ8A 4GSNA 4IP6A 2X8GA 3M0FA 4XHMA 4XTSA 3GHAA 4IELA 1HQOA 4XIHA 5IM9A 2C1YA 1A23A 1WOUA 2FD3A 3F6DA 4J57E 2OE0A 4WXTA 4KDYA 2BJXA 4P3YB 1O85A 1TRVA 1SD8A 4F0BA 2WCIA 1A8YA 2HXKA 1F3BA 3Q19A 1GSFA 5EL8A 1YZXA 2L5LA 1GULA 4ZL7A 1ZYQB 5L71A 1V2AA 1TDIA 2HRNA 3KZQA 1AQXA 2UZ8A 4YH2A 2DLXA 1FOVA 5IOXA 4FH8A 3G9BA 4EXJA 1BG5A 1AQVA 4ZXGA 5G31A 1V58A 2VL3A 2IYJA 2C0EA 4JRRA 5DCGA 1FHEA 3H1NA 4GXZA 5ECMB 4PX1A 4YKGA 4E8EA 3CSIA 2C3TA 1QGVA 3C8EA 5E59A 4IJ3A 5HR3A 4ECJA 3QAWA 3HJOA 3ZLPA 2MMAA 1EP8A 2IY2A 1PX6A 2AYTA 2PVQA 2X8HA 3QDNA 2IJYA 1TK0B 3F9UA 5D96A 1PKZA 2H72A 3GSSA 4PGTA 1ML6A 2VOCA 2A4VA 2B5EA 2YOIA 4ECBA 1DE2A 4Q5RA 1U87A 1ZOFA 4ZB6A 2HSHA 2JU5A 3CXGA 2JZRA 3A5WA 4HOJA 4BWSA 4RI7A 5IIZA 4NV2A 4NV5A 1FVKA 4TKYA 4TOPA 4OO4A 4JR4A 4HUAA 3EMXA 5GSTA 1ERUA 2ZUPA 1M9BA 5CRHA 1QXHA 6GSYA 5LNKe 1JLWA 4K5RA 3L0HA 4ZB9A 1KEBA 2VCXA 3A2XA 4J2FA 5D73A 2E7PA 8GSSA 2QGVA 5CRWA 2LS5A 4O7HA 4BL7B 3TKQA 4BVXB 2R2JA 3HY2A 2PWJA 2TRXA 3PINA 3LW9A 2BTOT 3Q6OA 5CO3A 3HCZA 2F3MA 3U5RE 3TKPA 2OBIA 1K0NA 4MPFA 2H6ZA 4EL1A 1EGOA 4ISDA 4TXVA 3L9UA 2H01A 3SWLA 3TUEA 3UMAA 5B6MA 2V32A 1QQ2A 4PTSA 4L5LA 1ILOA 1SJZA 3KJYA 2PVOC 5DJMA 2FWGA 3A5IA 4LMVA 4PXOA 2A2RA 3KP9A 2N5FA 2O87A 1GWCA 4I6XA 3KCMA 3U6VA 3BOAA 1QMVA 1GUKA 2DJ3A 1GTAA 3IBHA 2KOKA 5BRTA 4G19A 4DEJA 2JL4A 3LSZA 4ML6A 3QMXA 1U3IA 1TI3A 3M3MA 3UOMA 2LJKA 2EIOA 3KXOA 4ECCA 1TTZA 2EIRA 2NDOA 4FYCA 1XWKA 4LMWA 4TXOB 1AXDA 1F3AA 1HNCA 3J7Yk 3FZ9A 1FB6A 3UEMA 1A8LA 4OFMA 1S3AA 4ID0A 1SK2A 2R0PA 3EYTA 1BQ7A 2WB9A 1NHYA 4N10A 1BX9A 1Z3EA 3ZITA 1I5GA 2J9HA 2PUKC 3ISOA 4WF4A 2YV7A 4X4JA 1NSWA 1NHOA 1OVNA 2PGTA 5ECHB 2IMDA 4IKHA 3UAPA 3L9SA 5HQPA 1X9WB 2FY6A 3F4TA 1GSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4Z A;  4X43 A;  1KTE A;  2P5R A;  3IV4 A;  3F6F A;  1ERT A;  2LJA A;  1GSU A;  2O89 A;  3I9V 2;  3MAK A;  2C0G A;  3IPZ A;  5CAX A;  3D5J A;  1PGT A;  2OKA A;  2I9H A;  5ECI B;  5ELG A;  2FWF A;  4FYU A;  5GAN D;  1ZCP A;  4WR5 A;  1ACV A;  4V2M A;  1JLV A;  3D4M A;  1J0F A;  2AAW A;  1O8X A;  2PN8 A;  1GNE A;  4NHZ A;  3G7I A;  4KSO A;  3BBY A;  3HVS A;  2WZ9 A;  2DJ1 A;  4WBJ A;  1K3O A;  4F2I A;  3WD6 A;  2PU9 C;  3A2W A;  1XW6 A;  2YJ7 A;  3D4T A;  3D6I A;  3APQ A;  4IN0 A;  5ECS A;  3PH9 A;  2IPA A;  2AB6 A;  3GFK A;  3DD3 A;  5FWG A;  2XPE A;  4WR4 A;  5IQY A;  3FR3 A;  1B9X C;  4ZBB A;  3GYK A;  1VF1 A;  5GSS A;  4OCE A;  2KLX A;  5IMA A;  5GZZ B;  1GTI A;  5ID2 B;  3WGE A;  1WP0 A;  2TIR A;  3CRT A;  4HZ2 A;  4ILF A;  1T00 A;  1EEM A;  2GDR A;  3GH6 A;  3A2V A;  2LQO A;  1XXU A;  3LYK A;  3N5O A;  5J9C A;  2GSS A;  1MDI A;  2LV3 A;  4MP4 A;  3DWV A;  5AIX A;  2PBJ A;  3RHB A;  5G5F A;  1UC7 A;  2YPM A;  1HD2 A;  3TOT A;  1AW9 A;  1B4Q A;  5JWR B;  2C0D A;  3QR6 A;  3ZZX A;  2VCV A;  4IJI A;  1XPV A;  5D8I A;  3APS A;  5DJL A;  4XCS A;  3US3 A;  5ECL B;  3GV1 A;  1XIY A;  5F8B A;  4JR6 A;  3HZ4 A;  1SL0 B;  3MDK A;  3GX0 A;  2KUC A;  2CX3 A;  1YEP A;  1HNB A;  1H75 A;  4FO5 A;  1FVJ A;  1GRX A;  1JZD A;  19GS A;  1OAZ A;  2R3X A;  4N0V A;  2RLI A;  5IO0 A;  1X0R A;  1YDK A;  1GL8 A;  4NMU A;  3WT1 A;  6GSU A;  2C80 A;  4K9Z A;  2VCW A;  2H74 A;  3TB2 A;  1SYR A;  1Y6E A;  4MH2 A;  3EMP A;  3FK8 A;  3P90 A;  6GST A;  5HFK A;  3UBL A;  3VWV A;  4K6X A;  5D9V A;  2YWI A;  5GAP D;  3IOS A;  1GSS A;  5A5K A;  2H70 A;  1THX A;  2XBQ A;  3ZFL A;  4AJ7 A;  5IMF A;  2GQM A;  1EV9 A;  2DIY A;  1UN2 A;  5F07 A;  1S3D A;  2H8L A;  4MLY A;  2GVP A;  1M7T A;  5IOW A;  1X5D A;  5DAL A;  2RM6 A;  3UVH A;  2H73 A;  1XWB A;  13GS A;  1WJK A;  2CZ3 A;  2HYX A;  22GS A;  4YAP A;  4G10 A;  2GLR A;  3IE3 A;  3LEF A;  1GSE A;  3QD9 A;  2HNL A;  2ON5 A;  4V1A g;  4I2T A;  1XVQ A;  1ZYE A;  3UVT A;  3ZYW A;  2HE3 A;  4OO5 A;  1NM3 A;  1OE8 A;  3M9J A;  4GCI A;  5A4U A;  2F51 A;  1HYU A;  1X5C A;  2G0F A;  2IFQ A;  3FKF A;  3GKK A;  4CDO A;  3KTL A;  5KN2 A;  2YJH A;  1TRU A;  5ECR B;  1OE7 A;  3NIV A;  3QAV A;  3KP8 A;  5ABR A;  4IHU A;  2HZE A;  2V1M A;  4K7I A;  3L78 A;  2IMF A;  1XWC A;  1YF1 A;  1PN9 A;  5DBQ A;  1DUG A;  4MJE A;  3FR6 A;  2V2G A;  2L57 A;  3TJB A;  2CX4 A;  4HI7 A;  2H75 A;  3O3T A;  1Z7P A;  5CYY A;  2ZCT A;  3FHK A;  5AN1 A;  4D73 B;  3L4N A;  5A4V A;  2HRF A;  5CRD A;  4KCE A;  5INY A;  1B48 A;  3LOR A;  3BD2 A;  5G1K A;  3APO A;  4OFT A;  1V98 A;  1ST9 A;  1TRS A;  2K8S A;  4N11 A;  1USB A;  1SYX A;  5B7C A;  1SK1 A;  4PNF A;  5F0G A;  3KGK A;  5E4W A;  4GQC A;  5F06 A;  3CTF A;  3IXR A;  4Q5Q A;  4FIW A;  4XRA A;  1GUM A;  4POB A;  5ID2 A;  4YQU A;  16GS A;  1SU9 A;  3D21 A;  2AJQ B;  1WPI A;  1GSQ A;  10GS A;  4MMM A;  5G5E A;  4OD7 A;  1TKD B;  1TRW A;  2R4V A;  3VK9 A;  3HA9 A;  1EGR A;  2M72 A;  1CQH A;  4PQH A;  3TKR A;  3GTU B;  4IQA A;  3NZN A;  3IK7 A;  4XS1 A;  3GKX A;  4GWR A;  1YQ1 A;  2GQK A;  4KH7 A;  2GZZ A;  2VO4 A;  1TK5 B;  2K18 A;  2LKU A;  4AGS A;  4Z7X A;  3H8Q A;  5JWO B;  5H5R A;  2FHE A;  4BL7 A;  3FY7 A;  11GS A;  2LUS A;  1TP9 A;  1A0R P;  4IGJ A;  2LJR A;  1OKD A;  1DBY A;  2YCD A;  3FZ4 A;  4XRD A;  4WEY A;  1TI1 A;  1G7O A;  4TR0 A;  5B8A A;  1A2L A;  2YV9 A;  1MEK A;  1M2D A;  3VLN A;  3VWW A;  1M9A A;  3D0Z A;  2VCQ A;  2OE1 A;  1CQG A;  2YWM A;  3VI7 A;  2N5A A;  1XZO A;  1NW2 A;  1U3A A;  3NOF A;  2N5B A;  2NTO A;  4MF6 A;  3LJR A;  1XWA A;  3F4S A;  3GH9 A;  1N2A A;  2VLU A;  3QFA C;  4QQ7 A;  1J9B A;  2MMO A;  4OCF A;  2RUE A;  2JZT A;  5J3R A;  2GT6 A;  3IAS 2;  3R2Q A;  5ELA A;  4YQM A;  4NXI A;  1A2J A;  1YKC A;  5EVO A;  4WET A;  3GST A;  4O32 A;  3ZRE A;  3DXB A;  2OA7 A;  3PGT A;  2GT5 A;  4BVX A;  1SJ6 A;  2B5X A;  3IR4 A;  1M99 A;  1UVZ A;  1RK4 A;  4K7N A;  2ON7 A;  3WYW A;  3H4K A;  2DML A;  3DRN A;  3FR9 A;  4IQ1 A;  1UA5 A;  2MBT A;  4LL4 B;  1AIU A;  2B1L A;  2KP2 A;  5DVB A;  3ERF A;  2B7J A;  4F03 A;  4GQF A;  3P8W A;  3LXZ A;  2GTU A;  1VF2 A;  4HJ2 A;  4ZL8 A;  3CSJ A;  2L59 A;  2FGX A;  2F9S A;  3F3Q A;  3QPM A;  1PL2 A;  4KB3 A;  3L9V A;  2NPB A;  4POM A;  5F05 A;  2FWE A;  1X9M B;  4DVC A;  5KEJ A;  1VRS D;  2DBC A;  5HR0 A;  4EDZ A;  3WT2 A;  4KDX A;  2L5O A;  5ECQ B;  1R7H A;  2VAF A;  3CYN A;  3ERW A;  3QCP A;  3WGD A;  2H66 A;  2LQQ A;  1A2M A;  3GIX A;  2H71 A;  3GUR A;  3F63 A;  1OKT A;  4K2D A;  1Z7R A;  4MF5 A;  1SJI A;  1V9W A;  3J7Y b;  5FT3 A;  1DSB A;  4YAV A;  4I97 A;  4MJC A;  1K0M A;  2HSY A;  4LA1 A;  3CBU A;  1C72 A;  1GSD A;  17GS A;  4MZW A;  4KW6 A;  1T1V A;  5DQS A;  3KEB A;  3TKS C;  3GMF A;  5D9X A;  5FHI A;  3AY8 A;  4KGI A;  4L0W A;  2P31 A;  2I81 A;  4HQZ A;  4E8H A;  3CSH A;  3W8S A;  4OWY A;  1PRX A;  4JBB A;  2JAC A;  3EE2 A;  5HFI A;  1O6J A;  3K8N A;  5C00 A;  3EIN A;  1X9S B;  4EF0 A;  4L0U A;  1BAY A;  2EIQ A;  4RI6 A;  4KDU A;  1X5E A;  3TJK A;  2DIZ A;  3ED3 A;  4MPG A;  2RUF A;  2B1K A;  2D2Z A;  3TKS E;  6GSS A;  3ZFB A;  2GS3 A;  4JU5 A;  1H4O A;  3GKM A;  1ZL9 A;  3TJF A;  5EPF A;  2TRC P;  3HJM A;  4MDC A;  2O85 A;  1XBS A;  1R4W A;  4ZL9 A;  3VWU A;  3DVX A;  1ABA A;  2H76 A;  2FCH A;  9GSS A;  1LJR A;  2JSZ A;  2IME A;  2XPD A;  3GX8 A;  3M1G A;  1XOA A;  1O8W A;  3F4R A;  1TW9 A;  2VD1 A;  1FAA A;  2L4Q A;  5A4W A;  1EZK A;  2QKE A;  4NPB A;  2VIM A;  2HZE B;  4HEA 2;  5ECO B;  4KCA A;  1XWG A;  2H30 A;  2GQL A;  3RPP A;  1OC9 B;  2HT9 A;  2DC5 A;  4XS4 B;  3C1R A;  5IMC A;  2R6K A;  2OAD A;  1ZZY A;  4BVY A;  4MJA A;  2F8F A;  2CVD A;  1Z6M A;  5J5N A;  1G6Y A;  4TR3 A;  5J9B A;  5LCZ A;  2AV4 A;  1Z5Y E;  4BA7 A;  1TJD A;  1E6B A;  1K0D A;  4EE0 A;  4ACS A;  4MCU A;  1E2Y A;  5HR1 A;  4EDY A;  5J4U A;  2IFQ B;  4WF5 A;  1SKS B;  1SK0 A;  1ERW A;  3KTB A;  4DSS B;  2GSR A;  1LU4 A;  3VI5 A;  2R37 A;  2DJ2 A;  4GST A;  4MA9 A;  1IYI A;  3S9F A;  4V2N A;  2ES7 A;  2REM A;  3LQ7 A;  1GLQ A;  5HR2 A;  2VM1 A;  4MH3 A;  1XW9 A;  4QL7 A;  5CRE A;  5ECP B;  4TW5 A;  18GS A;  3CTG A;  2C3Q A;  3QOU A;  2FA4 A;  2LRC A;  3EWL A;  5DAK A;  20GS A;  2FLS A;  2C0F A;  2IWT A;  2YZU A;  1FB0 A;  1FG4 A;  1B8X A;  3DEX A;  4HZ4 A;  3EU3 A;  4KX4 A;  2C3N A;  3VUR A;  3HD5 A;  3MNG A;  2VD0 A;  4TVE A;  5DAL B;  1PKW A;  1ZGN A;  1GTU A;  2H0I A;  2M80 A;  3LYP A;  2V6O A;  2FWH A;  2B7K A;  2WGR A;  2OJL A;  5KN3 A;  2FA8 A;  2HFD A;  4IP1 A;  4N30 A;  3QFB C;  1U6T A;  3E9J B;  2H0H A;  1QUW A;  2P5Q A;  1TOF A;  2F8A A;  4HQS A;  3GN3 A;  1M2B A;  1MDJ A;  3A3T A;  6GSX A;  3VWX A;  2L4C A;  4KA0 A;  3ZML A;  5JCU A;  2YWN A;  3E3E A;  2YN1 A;  4CW9 A;  4FYB A;  2YZH A;  4ULX A;  1AUC A;  1OYJ A;  1YKA A;  1T7P B;  3MWH A;  2B3S A;  5ECN B;  3I69 A;  2G2Q A;  4G2E A;  2VUP A;  2X8C A;  3HHV A;  4JED A;  2H1D A;  2HZF A;  3WGX A;  1DE1 A;  2CZ2 A;  2CVK A;  1M2A A;  3IAM 2;  4TXO A;  4KE3 A;  2KP1 A;  1YF0 A;  4KND A;  1Y25 A;  5KN1 A;  2WDU A;  2YWO A;  2OE3 A;  2WS2 A;  1BED A;  2WFC A;  1GP1 A;  4OFN A;  4IS0 A;  1A0F A;  3JCM L;  4F82 A;  4GF0 A;  4J56 E;  3LWA A;  2HI7 A;  4HDE A;  4I8B A;  4EKZ A;  4V2L A;  1O7U A;  2L6C A;  3N9J A;  5JCG A;  1SL1 B;  1TU7 A;  1SD9 A;  1K0C A;  3TOU A;  3RHC A;  5IPH A;  5IO2 A;  3IK9 A;  1YEX A;  1F6M C;  1MDK A;  2CVB A;  4POL A;  1EV4 A;  5LD0 A;  3EVI A;  1N8J A;  2E0Q A;  3FRC A;  4PQI A;  4ML1 A;  3DKS A;  4Q5F A;  1F2E A;  1Q4J A;  4I2U A;  4K0N A;  3FZ5 A;  1VF3 A;  2JZS A;  4AF2 A;  2KHP A;  3H93 A;  1Z6N A;  2DJ0 A;  2GGT A;  2WRT A;  3DML A;  3KD0 A;  2OAC A;  5JWQ B;  4ECI A;  3IDV A;  1SKR B;  2R5G A;  5D9W A;  1MTC A;  4X1U A;  1WWJ A;  1IYH A;  1T4Y A;  3HVX A;  3HYP A;  2PPT A;  3GA4 A;  2RII A;  1JZO A;  3HDC A;  3UJ1 A;  3KH9 A;  2DJK A;  5AIV A;  4ZIL A;  1SEN A;  4AJ8 A;  4GSS A;  4EUY A;  5B6N A;  3I43 A;  2K6V A;  4DSR A;  4K7O A;  2AUV A;  3UL3 A;  1K3L A;  1V40 A;  3DVW A;  5DDL A;  1AC1 A;  3KMN A;  1ON4 A;  2XC2 A;  1WE0 A;  4EVM A;  4NAX A;  4V1A p;  1FO5 A;  2V6K A;  2NVL A;  6GSW A;  1G7E A;  4L5O A;  2H1G A;  2H6Y A;  4HS1 A;  4MZB A;  2MZC A;  1F37 A;  1GNW A;  4F0C A;  4PQ1 A;  4GRF A;  1Z9H A;  3HXS A;  3MSZ A;  4JE1 A;  1B9Y C;  3LFL A;  2YAN A;  3DYR A;  5DQY A;  2V41 A;  2XBI A;  5HFG A;  3F3R A;  4NWY A;  2I3Y A;  4TR1 B;  5IMV A;  3KMO A;  4QL9 A;  4NHW A;  6GSV A;  3RBT A;  1AAZ A;  1F9M A;  1M0U A;  4ZBD A;  2K9F A;  2YNX A;  1G0T A;  1TU8 A;  1GH2 A;  3FYG A;  2ALB A;  3W6G A;  3C73 A;  5DCH A;  1T3B A;  3DGQ A;  1S3C A;  3LG6 A;  4EC0 A;  2CQ9 A;  4K1F A;  3ZRD A;  4BPY A;  2MYG A;  3RDW A;  4L8E A;  3FZA A;  1BJX A;  5ENU A;  5H5Q A;  4HU7 A;  2H1A A;  5G1L A;  5B8B A;  3P2A A;  4KAE A;  3E0U A;  3TJG A;  2LST A;  3ME7 A;  4XS4 A;  3ZVJ D;  3LGC A;  2MBS A;  1KNG A;  3SBC A;  1PMT A;  3IRA A;  2X99 A;  4EO3 A;  4G9H A;  4XS6 A;  4MZC A;  1K0O A;  3TRQ A;  3EU4 A;  4O5R A;  5IMZ A;  1XVW A;  4ZIJ A;  1XOB A;  3VFI A;  2GZP A;  4LLR A;  1OC8 A;  4HU9 A;  4ZBA A;  5KN0 A;  3EUR A;  2IL3 A;  2HLS A;  2QC7 A;  4PUR A;  4JZQ A;  1EEJ A;  3GRX A;  2H6X A;  1V57 A;  1YY7 A;  4DSQ A;  1WRY A;  1EOG A;  2X64 A;  1K3Y A;  5H5S A;  4TRX A;  3TDG A;  3FW2 A;  3IHQ A;  3TRP A;  5CNW A;  4POK A;  2LNS A;  5CP1 A;  3GL5 A;  4CHS A;  5EY6 A;  1EP7 A;  1THO A;  5ECK B;  1AQW A;  1R26 A;  2DMM A;  1A24 A;  3IC4 A;  4HJM A;  3GKN A;  1B4P A;  4D73 A;  3HVV A;  1BYE A;  2EC4 A;  3UBK A;  3O6T A;  4GTU A;  3ME8 A;  1QFN A;  3O76 A;  4WKW A;  2A2S A;  3KM6 A;  4AJ6 A;  3RPN A;  3Q74 A;  1W4V A;  2CV4 A;  1KBN A;  2JAD A;  3KH7 A;  2RM5 A;  1R5A A;  1HNA A;  4MJB A;  2E2G A;  4OMV A;  5COH A;  2C4J A;  2LRT A;  4I5Q A;  3ERG A;  3VPT A;  1T8E B;  2O7K A;  3TJJ A;  3IA1 A;  2LRN A;  2PMT A;  1SL2 B;  1U88 A;  2IMK A;  1XW5 A;  3EC3 A;  1I9D A;  1MD3 A;  3HKR A;  4H86 A;  1O81 A;  5AIS A;  2MMN A;  5J41 A;  1YJ6 A;  3H79 A;  3RAZ A;  5IMD A;  2IMI A;  3UIW A;  3GTU A;  3CRU A;  4F9Z A;  5D9T A;  4PUA A;  1OC3 A;  1FW1 A;  1K0B A;  4WBR D;  2I4A A;  1J08 A;  4PNG A;  3HJP A;  2GST A;  1QK8 A;  3C1S A;  4IBP A;  2OBK A;  2GZY A;  5G30 A;  4Q5N A;  2DJJ A;  2FUG 2;  2FNO A;  2LNT A;  2PER A;  2K8V A;  3BJ5 A;  3F8U A;  4RUV A;  2DSA A;  2B6M A;  3FEU A;  2WUL A;  1XFL A;  2M46 A;  5DAK B;  1JHB A;  3BCK A;  1VF4 A;  1Q98 A;  2LTK A;  4KUN A;  4TR1 A;  3CMI A;  2WJU A;  2CT6 A;  1G6W A;  5D93 A;  4YQV A;  1PA3 A;  12GS A;  3P7X A;  2CAI A;  3TRX A;  4MAB A;  3G7Y A;  5CRG A;  1ZMA A;  2IN3 A;  5AGY A;  1O73 A;  3C7M A;  1TK8 B;  4ZB8 A;  2O8V B;  2QSI A;  4X0X A;  3ZIJ A;  3TKS A;  1WMJ A;  2CA8 A;  1EWX A;  2VLV A;  5IPG A;  14GS A;  2MMZ A;  2VLT A;  3LXT A;  1PX7 A;  4KSM A;  1JZW A;  2YP6 A;  3Q18 A;  3TCO A;  2VL2 C;  2IIY A;  1ERV A;  3BCI A;  5C04 A;  3ZTL A;  2BMX A;  2VM2 A;  4PUF C;  2LEG A;  2GSQ A;  3VPQ A;  2NBS A;  1PD2 1;  3GNJ A;  1PQN A;  1MD4 A;  1TXX A;  4IVF A;  4IW9 A;  3PR8 A;  1EOH A;  2H1B A;  5JCW A;  2L6D A;  2B5Y A;  1URM A;  3M9K A;  2C8U A;  4K0G A;  3KIJ A;  1OC9 A;  4RQR A;  1PSQ A;  3G7J A;  2H19 A;  3I6A A;  3ZVJ A;  3ZMK A;  1K0A A;  1WIK A;  3W8J A;  2E2M A;  4LL1 B;  2VL9 A;  3C71 A;  4GLT A;  3DIE A;  4TN8 A;  1JFU A;  2VCZ A;  2XHF A;  3OR5 A;  1JZR A;  2JSY A;  1RW1 A;  3GL3 A;  4N0Z A;  1SKW B;  4MK3 A;  2H0G A;  4O92 A;  3QAG A;  1R5P A;  3GUS A;  1GLP A;  1GTB A;  4BWQ A;  2CAQ A;  3F0I A;  4MF7 A;  4DSS A;  3TGZ A;  2Z9S A;  3ZIV A;  2I1U A;  1GUH A;  2VCT A;  2J23 A;  5G2Z A;  1XCC A;  3UAR A;  1LBK A;  2P0G A;  1RQM A;  4TR4 A;  1PL1 A;  1VGL A;  2ZNM A;  4K8M A;  2VL2 A;  1W89 A;  7GSS A;  3V1W A;  3D22 A;  3M8N A;  4RQX A;  3ZL5 A;  2AHE A;  3HZ8 A;  4GSN A;  4IP6 A;  2X8G A;  3M0F A;  4XHM A;  4XTS A;  3GHA A;  4IEL A;  1HQO A;  4XIH A;  5IM9 A;  2C1Y A;  1A23 A;  1WOU A;  2FD3 A;  3F6D A;  4J57 E;  2OE0 A;  4WXT A;  4KDY A;  2BJX A;  4P3Y B;  1O85 A;  1TRV A;  1SD8 A;  4F0B A;  2WCI A;  1A8Y A;  2HXK A;  1F3B A;  3Q19 A;  1GSF A;  5EL8 A;  1YZX A;  2L5L A;  1GUL A;  4ZL7 A;  1ZYQ B;  5L71 A;  1V2A A;  1TDI A;  2HRN A;  3KZQ A;  1AQX A;  4YH2 A;  2DLX A;  1FOV A;  5IOX A;  4FH8 A;  3G9B A;  4EXJ A;  1BG5 A;  1AQV A;  4ZXG A;  5G31 A;  1V58 A;  2VL3 A;  2IYJ A;  2C0E A;  4JRR A;  5DCG A;  1FHE A;  3H1N A;  4GXZ A;  5ECM B;  4PX1 A;  4E8E A;  3CSI A;  2C3T A;  1QGV A;  3C8E A;  5E59 A;  4IJ3 A;  5HR3 A;  4ECJ A;  3QAW A;  3HJO A;  3ZLP A;  2MMA A;  1EP8 A;  2IY2 A;  1PX6 A;  2AYT A;  2PVQ A;  2X8H A;  3QDN A;  2IJY A;  1TK0 B;  3F9U A;  5D96 A;  1PKZ A;  2H72 A;  3GSS A;  4PGT A;  1ML6 A;  2VOC A;  2A4V A;  2B5E A;  2YOI A;  4ECB A;  1DE2 A;  4Q5R A;  1U87 A;  1ZOF A;  4ZB6 A;  2HSH A;  2JU5 A;  3CXG A;  2JZR A;  3A5W A;  4HOJ A;  4BWS A;  4RI7 A;  5IIZ A;  4NV2 A;  4NV5 A;  1FVK A;  4TKY A;  4TOP A;  4OO4 A;  4JR4 A;  4HUA A;  3EMX A;  5GST A;  1ERU A;  2ZUP A;  1M9B A;  5CRH A;  1QXH A;  6GSY A;  5LNK e;  1JLW A;  3L0H A;  4ZB9 A;  1KEB A;  2VCX A;  3A2X A;  4J2F A;  5D73 A;  2E7P A;  8GSS A;  2QGV A;  5CRW A;  2LS5 A;  4O7H A;  3TKQ A;  2R2J A;  3HY2 A;  2PWJ A;  2TRX A;  3PIN A;  2BTO T;  3Q6O A;  5CO3 A;  3HCZ A;  2F3M A;  3U5R E;  3TKP A;  2OBI A;  1K0N A;  4MPF A;  2H6Z A;  4EL1 A;  1EGO A;  4ISD A;  4TXV A;  3L9U A;  2H01 A;  3SWL A;  3TUE A;  3UMA A;  5B6M A;  2V32 A;  1QQ2 A;  4L5L A;  1ILO A;  1SJZ A;  3KJY A;  2PVO C;  5DJM A;  2FWG A;  4LMV A;  4PXO A;  2A2R A;  3KP9 A;  2N5F A;  2O87 A;  1GWC A;  4I6X A;  3KCM A;  3U6V A;  3BOA A;  1QMV A;  1GUK A;  2DJ3 A;  1GTA A;  3IBH A;  2KOK A;  4G19 A;  4DEJ A;  2JL4 A;  3LSZ A;  4ML6 A;  3QMX A;  1U3I A;  1TI3 A;  3M3M A;  3UOM A;  2LJK A;  2EIO A;  3KXO A;  4ECC A;  1TTZ A;  2EIR A;  2NDO A;  4FYC A;  1XWK A;  4LMW A;  4TXO B;  1AXD A;  1F3A A;  1HNC A;  3J7Y k;  3FZ9 A;  1FB6 A;  3UEM A;  1A8L A;  4OFM A;  1S3A A;  4ID0 A;  1SK2 A;  3EYT A;  1BQ7 A;  2WB9 A;  1NHY A;  4N10 A;  1BX9 A;  1Z3E A;  3ZIT A;  1I5G A;  2J9H A;  2PUK C;  3ISO A;  4WF4 A;  2YV7 A;  1NSW A;  1NHO A;  1OVN A;  2PGT A;  5ECH B;  2IMD A;  4IKH A;  3UAP A;  3L9S A;  5HQP A;  1X9W B;  2FY6 A;  3F4T A;  1GSY A; 
#chains in the Genus database with same CATH topology
 4KF9 A;  1T4Z A;  4X43 A;  1KTE A;  2P5R A;  3IV4 A;  2P0X A;  1BRS A;  1WMN A;  3F6F A;  1ERT A;  2LJA A;  1GSU A;  5EVH A;  2O89 A;  3I9V 2;  3MAK A;  2C0G A;  4FCZ A;  3IPZ A;  5CAX A;  1RN4 A;  3D5J A;  4USS A;  1PGT A;  2OKA A;  4Z2R A;  3FMW A;  4KFE A;  5JPP A;  4LSO A;  3DGL A;  2I9H A;  5ECI B;  5ELG A;  2FWF A;  1UCJ A;  4FYU A;  1TRP A;  2HRK A;  5GAN D;  1ZCP A;  1DVC A;  4WR5 A;  1ACV A;  3CQF A;  4V2M A;  1JLV A;  3D4M A;  1J0F A;  2AAW A;  1UI7 A;  2BO9 B;  3HZP A;  1O8X A;  3IPT A;  2PN8 A;  1GNE A;  4NHZ A;  3G7I A;  1IK3 A;  4KSO A;  4RNY A;  3BBY A;  3HVS A;  2WZ9 A;  1IV9 A;  2DJ1 A;  1TUH A;  4WBJ A;  3X3Y A;  1K3O A;  3JUO A;  4F2I A;  1JJ2 2;  3WD6 A;  2B1X B;  5DRV A;  2PU9 C;  3A2W A;  1XW6 A;  1B27 A;  5AEW B;  2YJ7 A;  3D4T A;  3D6I A;  3APQ A;  3JUM A;  3DGM A;  4IN0 A;  2WO0 A;  3NX0 A;  5ECS A;  1MGR A;  3NV0 A;  3PH9 A;  4CY6 A;  2ZDJ A;  2AB6 A;  2IPA A;  3GFK A;  1O7H B;  3DD3 A;  5FWG A;  2XPE A;  4WR4 A;  5IQY A;  1RN7 A;  1ROA A;  5JPU A;  3FR3 A;  1B9X C;  4ZBB A;  3GYK A;  1VF1 A;  5STD A;  5GSS A;  1Z1S A;  4CPK A;  4OCE A;  2KLX A;  5IMA A;  1IDP A;  5GZZ B;  1GTI A;  5ID2 B;  3WGE A;  1IV7 A;  1WP0 A;  2TIR A;  4HM2 B;  3CRT A;  3G8Z A;  4HZ2 A;  1VZZ A;  4ORL A;  4ILF A;  1T00 A;  1QVF 2;  5IG3 A;  1PFP A;  2F98 A;  1GOY A;  1EEM A;  3BND A;  3FCS B;  4WYK A;  2GDR A;  2P05 A;  3GH6 A;  1PY3 A;  3A2V A;  2LQO A;  1VQ4 3;  3H51 A;  1XXU A;  1BRH A;  3LYK A;  3SYU A;  3N5O A;  5J9C A;  2GSS A;  1BUQ A;  1MDI A;  5LC6 A;  2LV3 A;  1IYY A;  2E2U A;  1EA2 A;  4MP4 A;  1SII A;  1RGA A;  3AHW A;  3DWV A;  2KAA A;  3BB9 A;  1ZYN A;  1I3I A;  5AIX A;  2PBJ A;  3RHB A;  5G5F A;  1UC7 A;  1E97 A;  2YPM A;  1HD2 A;  3TOT A;  1JKG A;  4G0K A;  1QAL A;  1AW9 A;  1B4Q A;  1AY7 A;  5JWR B;  2C0D A;  3QR6 A;  3ZZX A;  3EQQ B;  2VCV A;  6STD A;  2GBX B;  1XPV A;  4IJI A;  1ISK A;  3CCE 3;  5D8I A;  1U8C B;  3APS A;  5DJL A;  1ZX2 A;  4XCS A;  3US3 A;  1GYB A;  3UL6 A;  5ECL B;  5HOH A;  3GV1 A;  1S3R A;  1XIY A;  5F8B A;  2ZHX B;  4JR6 A;  3FKA A;  3MPH A;  3HZ4 A;  1SL0 B;  3MDK A;  3GX0 A;  1LVN A;  2KUC A;  4N3V A;  2CX3 A;  1YEP A;  1X1Y A;  1LQM B;  1TP6 A;  4K61 A;  1HNB A;  1H75 A;  2Y73 A;  1IQY A;  1FVJ A;  4FO5 A;  1GRX A;  1JZD A;  19GS A;  1OAZ A;  2R3X A;  2IMJ A;  1GOV A;  2AAD A;  4N0V A;  2RLI A;  4K2X A;  3OX9 A;  5IO0 A;  1X0R A;  1YDK A;  3MYD A;  1GL8 A;  2UX0 A;  1ZO2 A;  4O5Q A;  1CQS A;  3CU3 A;  4NMU A;  3WT1 A;  6GSU A;  3EN8 A;  3LH4 A;  2CHC A;  3B4P A;  2C80 A;  4STD A;  4K9Z A;  2VCW A;  2H74 A;  3TB2 A;  1W02 A;  1SYR A;  1Y6E A;  4MH2 A;  3EMP A;  3FK8 A;  3P90 A;  6GST A;  1QJG A;  5HFK A;  3UBL A;  3VWV A;  3B4O A;  4K6X A;  5D9V A;  1VQ8 3;  2YWI A;  5GAP D;  3IOS A;  1YJ9 3;  1GSS A;  2QA1 A;  5A5K A;  1MWT A;  3CCQ 3;  3WR2 A;  2H70 A;  1THX A;  2XBQ A;  3ZFL A;  4AJ7 A;  5AII A;  1DVD A;  5IMF A;  2GQM A;  4N6O B;  1EV9 A;  2DIY A;  1D6Y A;  1UN2 A;  5F07 A;  1S3D A;  3SXX A;  3B7C A;  2H8L A;  4MLY A;  2M7O A;  4HZ9 B;  2GVP A;  1M7T A;  5AEU B;  5AYR B;  3U1W A;  5IOW A;  3D4A A;  8RNT A;  3EJV A;  1X5D A;  5DAL A;  2GEY A;  1RTU A;  2RM6 A;  3UVH A;  2CW9 A;  2H73 A;  4HM0 B;  1XWB A;  13GS A;  1WJK A;  1UW1 A;  1VQO 3;  1Y4K A;  2CZ3 A;  2HYX A;  2YFL B;  22GS A;  4YAP A;  1KC8 4;  3X41 A;  4G0L A;  4G10 A;  2GLR A;  1W5Z A;  3LOY A;  3IE3 A;  3LEF A;  1GSE A;  3QD9 A;  2Z6B A;  2HNL A;  2ON5 A;  4V1A g;  4I2T A;  3FG1 A;  1XVQ A;  1ZYE A;  3UVT A;  3ZYW A;  1UUW B;  2HE3 A;  4OO5 A;  1NM3 A;  1OE8 A;  2CG0 A;  3M9J A;  1PYL A;  4GCI A;  5A4U A;  2F51 A;  1HYU A;  3D79 A;  3KSP A;  1X5C A;  3EBT A;  2GU1 A;  1N5P A;  3CC2 3;  2G0F A;  1STF I;  2IFQ A;  3FKF A;  2W03 A;  3GKK A;  1AQZ A;  4CDO A;  3KTL A;  1DMN A;  2QEX 3;  5KN2 A;  2YJH A;  3QK9 A;  1TRU A;  1EKM A;  5ECR B;  3NXJ A;  3MHE A;  4ZM8 A;  1OE7 A;  2XF3 A;  3NIV A;  3QAV A;  1Q40 B;  3KP8 A;  5ABR A;  4IHU A;  2HZE A;  2V1M A;  4K7I A;  3L78 A;  2IMF A;  5KP3 A;  1XWC A;  1YF1 A;  1PN9 A;  5DBQ A;  1DUG A;  4MJE A;  1B2Z A;  3IMA B;  3FR6 A;  1SIH A;  5I97 A;  2V2G A;  2L57 A;  3TJB A;  1CH0 A;  2O9U X;  3BNC A;  1YIT 3;  2CX4 A;  4HI7 A;  1A90 A;  5CLK A;  1MGW A;  1N5H A;  2J8X B;  2H75 A;  2R0G A;  1Z7P A;  3O3T A;  5CYY A;  3X42 A;  5IF6 A;  2ZCT A;  3FHK A;  5AN1 A;  1EG9 B;  4D73 B;  1W2Z A;  2F4Y A;  3L4N A;  5A4V A;  1VQP 3;  2HRF A;  2WGO A;  5CRD A;  4BTW A;  3DZL A;  4KCE A;  5INY A;  1B48 A;  2CC3 A;  3LOR A;  3BD2 A;  5G1K A;  2GXF A;  1N8R 4;  3APO A;  4OFT A;  3F40 A;  3OWS A;  1V98 A;  1BRG A;  1V74 A;  3FF0 A;  1ST9 A;  1YVS A;  1TRS A;  2K8S A;  4N11 A;  1BIR A;  1USB A;  1SYX A;  4LGQ A;  1SK1 A;  5B7C A;  4PNF A;  3NV0 B;  5F0G A;  3KGK A;  5E4W A;  5KOX A;  4GQC A;  5F06 A;  3CTF A;  3IXR A;  4Q5Q A;  4FIW A;  4XRA A;  1GUM A;  4POB A;  5ID2 A;  4YQU A;  16GS A;  1SU9 A;  3D21 A;  2AJQ B;  3G71 3;  2XEP A;  1WPI A;  4TX4 A;  2WGQ A;  1GSQ A;  10GS A;  1I2G A;  1BNR A;  4MMM A;  5G5E A;  1BNI A;  4EW5 A;  4OD7 A;  3FGY A;  1TKD B;  1TRW A;  4MMX B;  2R4V A;  3VK9 A;  3CC4 3;  4I4K A;  1K8A 4;  1RCL A;  3M8C A;  3S5C A;  2KRT A;  5M19 A;  3HA9 A;  1EGR A;  2M72 A;  5LC7 A;  1CQH A;  4L7K A;  4PQH A;  3TKR A;  3GTU B;  4IQA A;  3NZN A;  3DGY A;  3E99 A;  3IK7 A;  4XS1 A;  3GKX A;  1J2B A;  4GWR A;  1JBS A;  1YQ1 A;  2GQK A;  4KH7 A;  4K5S A;  2GZZ A;  2VO4 A;  1X1W A;  3LT8 A;  1BSB A;  1TK5 B;  2K18 A;  2LKU A;  4AGS A;  4Z7X A;  3H8Q A;  5JWO B;  2F56 A;  2QA2 A;  5H5R A;  4IPB A;  2FHE A;  1OH0 A;  2HOH A;  3EB8 A;  4BL7 A;  3FY7 A;  1LNH A;  11GS A;  1FUW A;  2LUS A;  1TP9 A;  1A2P A;  1A0R P;  4IGJ A;  2LJR A;  3JUP A;  3CCL 3;  4ICY A;  1PFO A;  1OKD A;  1DBY A;  1KQS 2;  2YCD A;  3FZ4 A;  3MG1 A;  4R9K A;  4XRD A;  4WEY A;  1TI1 A;  4BVY B;  4HM5 B;  4TR0 A;  5B8A A;  1G7O A;  1A2L A;  2YV9 A;  1MEK A;  1M2D A;  3VLN A;  3VWW A;  1M9A A;  3D0Z A;  2VCQ A;  2OE1 A;  1CQG A;  2KXG A;  2YWM A;  1RRL A;  3VI7 A;  2N5A A;  1STD A;  5HGR A;  1XZO A;  1X1X A;  3EF8 A;  1NW2 A;  4YKF A;  1U3A A;  3CCM 3;  3NOF A;  4X2O A;  1RGE A;  2N5B A;  2NTO A;  4MF6 A;  3U97 A;  2P09 A;  3LJR A;  2CFW A;  4XDV A;  1IQ8 A;  3N8B A;  1XWA A;  2P0M A;  3F4S A;  1N2A A;  2VLU A;  1BUJ A;  3GH9 A;  3QFA C;  2DKH A;  4QQ7 A;  1J9B A;  2MMO A;  1O7N B;  1JB5 A;  1JNQ A;  4OCF A;  2RUE A;  2JZT A;  5J3R A;  1GMQ A;  4Z2U A;  2GT6 A;  3IAS 2;  2CFL A;  3R2Q A;  5ELA A;  4YQM A;  4NXI A;  1A2J A;  1YKC A;  5EVO A;  4WET A;  3GST A;  4O32 A;  3ZRE A;  3DXB A;  2OA7 A;  3PGT A;  1BAN A;  2GT5 A;  4BVX A;  4L8O A;  3BNB A;  1SJ6 A;  2B5X A;  3IR4 A;  1M99 A;  4HAA A;  3T8U A;  1UVZ A;  1RK4 A;  4K7N A;  2ON7 A;  3WYW A;  3H4K A;  2DML A;  3DRN A;  3FR9 A;  1BNS A;  4IQ1 A;  4BIK A;  1UA5 A;  2MBT A;  4LL4 B;  1AIU A;  2B1L A;  2KP2 A;  5DVB A;  3ERF A;  3RGA A;  4RNT A;  2B7J A;  3AGN A;  1UGH I;  4F03 A;  4GQF A;  3P8W A;  3LXZ A;  2GTU A;  1VF2 A;  4HJ2 A;  4ZL8 A;  5JBS A;  4O5U A;  3CSJ A;  2ML5 A;  3PYJ A;  2FGX A;  2L59 A;  2F9S A;  3F3Q A;  2YFJ B;  1T5Y A;  3QPM A;  3MYT A;  1PL2 A;  1CYV A;  4KB3 A;  3L9V A;  2RSX A;  5M1A A;  2NPB A;  4POM A;  5F05 A;  2FWE A;  1I0X A;  1A2K A;  4EYC A;  1X9M B;  4DVC A;  5KEJ A;  1VRS D;  1QMA A;  5CK6 A;  2DBC A;  4H61 A;  5HR0 A;  4EDZ A;  5IG0 A;  1KD1 4;  4KDX A;  3WT2 A;  2L5O A;  5ECQ B;  1R7H A;  2VAF A;  3CYN A;  5CXO A;  3ERW A;  4QWT A;  2WOF A;  1B2S A;  1YI2 3;  3QCP A;  3WGD A;  2H66 A;  2LQQ A;  1A2M A;  3GIX A;  2H71 A;  3GSP A;  3GUR A;  3JVC A;  3F63 A;  2MC8 A;  1OKT A;  1YGW A;  4K2D A;  1Z7R A;  4MF5 A;  1SJI A;  2K0M A;  1V9W A;  6RNT A;  2Q07 A;  5FT3 A;  3J7Y b;  1DSB A;  4YAV A;  3PPU A;  1G02 A;  4I97 A;  4MJC A;  1K0M A;  2OCT A;  2HSY A;  4LA1 A;  1FUT A;  3CBU A;  1IT7 A;  1C72 A;  1GSD A;  1M3J A;  4XBX A;  1B2M A;  17GS A;  2HML B;  4MZW A;  4KW6 A;  1T1V A;  1T2H A;  5DQS A;  3KEB A;  3TKS C;  3GMF A;  5D9X A;  5FHI A;  7STD A;  3AY8 A;  4KGI A;  4L0W A;  2P31 A;  3AHS A;  1QAK A;  2I81 A;  2R0C A;  4HQZ A;  4E8H A;  3CSH A;  3W8S A;  4OWY A;  1PRX A;  4JBB A;  1AVL A;  2JAC A;  3EE2 A;  5HFI A;  1UUV B;  1B21 A;  1O6J A;  3K8N A;  5C00 A;  3EIN A;  1OAC A;  3NQY A;  3D9R A;  1X9S B;  4EF0 A;  4CJN A;  4BL2 A;  4EV2 A;  4L0U A;  1BAY A;  1M1K 4;  2EIQ A;  2HRA A;  4RI6 A;  4KDU A;  1HU9 A;  3DGO A;  4XBT A;  1X5E A;  3ZG0 A;  2ZA4 A;  3TJK A;  2DIZ A;  3PCR A;  8CHO A;  3ED3 A;  4MPG A;  3ALA A;  2WOH A;  2RUF A;  2B1K A;  2D2Z A;  2QIY A;  3TKS E;  6GSS A;  3ZFB A;  2GS3 A;  4JU5 A;  1H4O A;  3GKM A;  3QRD A;  1ZL9 A;  5EPF A;  3TJF A;  2QA4 3;  1RDS A;  2TRC P;  3HJM A;  4G1M B;  4MDC A;  2O85 A;  1XBS A;  1R4W A;  4ZL9 A;  1BNG A;  3VWU A;  3DVX A;  4RZM A;  1ABA A;  1ULI B;  2H76 A;  1M90 4;  2FCH A;  1D6Z A;  9GSS A;  1LJR A;  2OWP A;  3PZW A;  2HMO B;  3AMO A;  4KVH A;  2JSZ A;  4X2H A;  2BIR A;  2IME A;  2XPD A;  3GX8 A;  3M1G A;  1W6G A;  1MWS A;  1XOA A;  3LTD A;  1O8W A;  3F4R A;  1TW9 A;  2VD1 A;  4BTY A;  1FAA A;  2L4Q A;  2MF7 A;  1LQG C;  5A4W A;  4PEJ A;  1EZK A;  2QKE A;  4NPB A;  5ELU A;  1LRA A;  2VIM A;  1FGQ A;  3F9S A;  3KII A;  2HZE B;  4HEA 2;  5ECO B;  3CCU 3;  1RGK A;  2ML6 A;  3Q1C A;  4HKV B;  1PN0 A;  1HKX A;  4KCA A;  1XWG A;  2H30 A;  1FW7 A;  4CY8 A;  2GQL A;  3RPP A;  1OC9 B;  1OPY A;  2I9W A;  2HT9 A;  2DC5 A;  4XS4 B;  3S28 A;  1I0V A;  3C1R A;  1K73 4;  5IMC A;  2R6K A;  2BMQ B;  3DMC A;  1FGT A;  3X40 A;  2OAD A;  1NNV A;  1ZZY A;  2W56 A;  4O8S A;  3S67 A;  4BVY A;  4MJA A;  2F8F A;  2CVD A;  1Z6M A;  5J5N A;  1Q86 4;  1G6Y A;  4TR3 A;  5J9B A;  4LEH A;  5LCZ A;  4O3V A;  2AV4 A;  1O7G B;  1I3F A;  1Z5Y E;  4BA7 A;  1VQM 3;  1TJD A;  4WYK B;  1E6B A;  1K0D A;  4EE0 A;  4ACS A;  1DMM A;  1Q7H A;  2HMM B;  2SBL A;  4MCU A;  1E2Y A;  5HR1 A;  4FMD A;  2KCD A;  4EDY A;  2IFQ B;  4WF5 A;  5J4U A;  1SKS B;  1SK0 A;  1ERW A;  3KTB A;  4DSS B;  2GSR A;  4AKZ A;  3DGN A;  1LU4 A;  3VI5 A;  2R37 A;  2DJ2 A;  3IHG A;  4GST A;  4MA9 A;  1IYI A;  3S9F A;  4V2N A;  2ES7 A;  4WFO A;  2REM A;  3LQ7 A;  1GS3 A;  3UL5 A;  1GLQ A;  1YGE A;  2ZL8 A;  1IVV A;  2GEX A;  5HR2 A;  2VM1 A;  4MH3 A;  3CNX A;  1XW9 A;  4QL7 A;  3CD6 3;  7RNT A;  3ZG5 A;  5CRE A;  5ECP B;  4TW5 A;  3WOE B;  1BVI A;  3F7S A;  18GS A;  1NO3 A;  2P38 A;  2L4V A;  1HZ1 A;  3CTG A;  2C3Q A;  3QOU A;  2FA4 A;  2LRC A;  3EWL A;  5DAK A;  3EPT A;  5BU4 A;  20GS A;  2CIU A;  2FGT A;  2FLS A;  1RGH A;  1DE3 A;  2C0F A;  3NM2 A;  2IWT A;  2YZU A;  1FB0 A;  1FG4 A;  1B8X A;  3DEX A;  4HZ4 A;  3EU3 A;  4KX4 A;  2C3N A;  3MNG A;  3HD5 A;  4TVE A;  2VD0 A;  3VUR A;  1B20 A;  5DAL B;  5D81 A;  1PKW A;  1MOL A;  1ZGN A;  1GTU A;  1BSD A;  2H0I A;  4EBG A;  2X4A A;  2M80 A;  3GRD A;  3ER7 A;  1YHQ 3;  3LYP A;  2V6O A;  2FWH A;  2B7K A;  1BNJ A;  2WGR A;  3NQZ A;  2OJL A;  5KN3 A;  3T0U A;  2FA8 A;  2HFD A;  4IP1 A;  4N30 A;  5IEO A;  3QFB C;  1U6T A;  4HM6 B;  2QGU A;  3E9J B;  2H0H A;  1QUW A;  4OVM A;  2A2P A;  2P5Q A;  1TOF A;  2F8A A;  3DH2 A;  5IW9 A;  4HQS A;  3H3H A;  4FCJ A;  3GN3 A;  2C4B A;  1M2B A;  2XGN A;  1MDJ A;  4J5G A;  3A3T A;  6GSX A;  3VWX A;  1BSC A;  2L4C A;  2XGL A;  4KZ1 A;  4N6N B;  1NU3 A;  4KA0 A;  1GY6 A;  3ZML A;  3BU4 A;  3F14 A;  3SX1 A;  1OGZ A;  5JCU A;  2YWN A;  3E3E A;  2YN1 A;  1T2I A;  4CW9 A;  2IUK A;  1RNB A;  4FYB A;  1Q40 A;  2YZH A;  2CG1 A;  4ULX A;  1WTH A;  1RKY A;  3RDE A;  1AUC A;  1OYJ A;  1YKA A;  1T7P B;  3MWH A;  2B3S A;  5ECN B;  5IEP A;  3I69 A;  2G2Q A;  1IVU A;  4G2E A;  2VUP A;  2X8C A;  2X49 A;  3HHV A;  1GY7 A;  1I70 A;  1ZS7 A;  1OHS A;  4JED A;  2H1D A;  4HM3 B;  2HZF A;  3WGX A;  1DE1 A;  2CZ2 A;  2CVK A;  4N6T A;  1M2A A;  3IAM 2;  4GB5 A;  4TXO A;  4HBR A;  4KE3 A;  2KP1 A;  1YF0 A;  4KND A;  2C11 A;  1FUS A;  1Y25 A;  1B3S A;  5KN1 A;  2WDU A;  2YWO A;  5EEO A;  1LOV A;  1AVK A;  2GU3 A;  2KF6 A;  3HIG A;  2OE3 A;  2WS2 A;  3KZT A;  1BED A;  2WFC A;  3LTA A;  4U13 A;  2XSH B;  1GP1 A;  1NB5 I;  4OFN A;  4IS0 A;  1A0F A;  1RMS A;  3JCM L;  4F82 A;  4GF0 A;  4J56 E;  3G6E 3;  3LWA A;  2HI7 A;  1ZYP A;  4HDE A;  4I8B A;  4EKZ A;  3IC8 A;  4V2L A;  1O7U A;  1GD3 A;  2L6C A;  3N9J A;  5JCG A;  1SL1 B;  1JN5 B;  1TU7 A;  1SD9 A;  1K0C A;  4G0I A;  2CFD A;  1BAO A;  3TOU A;  3RHC A;  5IPH A;  5IO2 A;  1GD4 A;  3WOD G;  1VQL 3;  1UUG B;  3IK9 A;  1YEX A;  1F6M C;  2E2T A;  1A67 A;  5BMU A;  1MDK A;  3MWZ A;  2CVB A;  4POL A;  3T8N A;  1EV4 A;  5LD0 A;  3EVI A;  1FGR A;  5AYS C;  1N8J A;  2AAE A;  2E0Q A;  3FRC A;  4FMA A;  4PQI A;  1GMP A;  3DKS A;  4ML1 A;  1F2E A;  4Q5F A;  1Q4J A;  4I2U A;  2C10 A;  1NDO B;  4K0N A;  3FZ5 A;  4LZI A;  2HMN B;  1VF3 A;  2JZS A;  2PNC A;  4AF2 A;  2KHP A;  3BLZ A;  3H93 A;  1Z6N A;  2DJ0 A;  3S27 A;  2GGT A;  2WRT A;  4CCV A;  3DML A;  1U5O A;  3CCS 3;  3KD0 A;  2OAC A;  1M3I A;  4HOH A;  1TTO A;  1B2U A;  5JWQ B;  4ECI A;  3NHX A;  3IDV A;  1SKR B;  1RSN A;  3UJM A;  5DRE A;  2R5G A;  5D9W A;  4JF8 A;  1MTC A;  4X1U A;  3RGR A;  3K0Z A;  3I55 3;  4XDW A;  5FGO A;  3OWU A;  1WWJ A;  1BGS A;  1IYH A;  1Q42 A;  1T4Y A;  3HVX A;  3HYP A;  3MG2 A;  3PS8 A;  2PPT A;  4HJL B;  3GA4 A;  2RII A;  1RGG A;  3OXA A;  4BTX A;  3GZR A;  1W2B 2;  5KOW A;  1JZO A;  3HDC A;  4MNN A;  2E2V A;  3CCJ 3;  3UJ1 A;  4DKI A;  3KH9 A;  2OOV A;  2DJK A;  2BMO B;  4HVN A;  5AIV A;  5AIH A;  4ZIL A;  1SEN A;  4AJ8 A;  4GSS A;  1X1U A;  4EUY A;  5B6N A;  3I43 A;  2K6V A;  4DSR A;  4FMC A;  4K7O A;  2AUV A;  3LTC A;  3UL3 A;  1K3L A;  1SQW A;  1V40 A;  3FSD A;  3DVW A;  5DDL A;  1AC1 A;  3KMN A;  2HMJ B;  1ON4 A;  2XC2 A;  1WE0 A;  4EVM A;  4NAX A;  4V1A p;  3F7X A;  1K28 A;  1FO5 A;  2V6K A;  2SAR A;  3NBJ A;  1VQ6 3;  3KN4 A;  2NVL A;  6GSW A;  1G7E A;  1L5G B;  4L5O A;  1YVB I;  2H1G A;  2H6Y A;  4HS1 A;  4MZB A;  2MZC A;  1F37 A;  1GNW A;  2W9P A;  1CEW I;  4K1V A;  4F0C A;  4RNZ A;  4PQ1 A;  1MNL A;  4R9L A;  4GRF A;  1DYU A;  2CK3 H;  1Z9H A;  3HXS A;  3MSZ A;  3CC7 3;  4JE1 A;  1B9Y C;  3LXU X;  4LMI A;  3LFL A;  2YAN A;  3DYR A;  3V98 A;  5DQY A;  4OK0 A;  2V41 A;  3SOY A;  2XBI A;  5HFG A;  3F3R A;  4EV5 A;  4NWY A;  1YIJ 3;  2I3Y A;  4TR1 B;  5IMV A;  1JB2 A;  3KMO A;  3AGO A;  4QL9 A;  1SAR A;  2R41 A;  4NHW A;  6GSV A;  4XB5 A;  3RBT A;  1AAZ A;  2F5M A;  2STD A;  3WDG B;  1F9M A;  1M0U A;  4ZBD A;  2K9F A;  1M9G A;  2YNX A;  1W6Y A;  5G2G A;  1G0T A;  3WOF B;  1TU8 A;  1ZGX A;  1VQK 3;  1GH2 A;  3FYG A;  2ALB A;  5BVB A;  3W6G A;  4A5P A;  4MJD A;  3RNT A;  2RFR A;  3K63 A;  1ULJ B;  2HSM A;  3C73 A;  5DCH A;  1KWI A;  3WMD A;  1T3B A;  4R1K A;  3DGQ A;  4N6L A;  1S3C A;  3LG6 A;  4FMB A;  4EC0 A;  1ASK A;  2CQ9 A;  4K1F A;  3ZRD A;  4BPY A;  1FA3 A;  2MYG A;  1FOH A;  2Z77 A;  3RDW A;  4L8E A;  4EIP A;  3FZA A;  1BJX A;  1QAF A;  2GBW B;  5IG4 A;  3EC9 A;  1I2F A;  5ENU A;  5H5Q A;  4MEI A;  4WWU C;  4HU7 A;  2LQV A;  2H1A A;  5G1L A;  5B8B A;  2Z7A A;  3P2A A;  4KAE A;  3E0U A;  4K90 B;  3TJG A;  1GOU A;  4IT7 A;  2LST A;  3ME7 A;  1TIJ A;  1WMO A;  4XS4 A;  3ZVJ D;  1IQX A;  3LGC A;  1UCL A;  2MBS A;  2PZV A;  4XBY A;  1KNG A;  2XFT A;  1VQQ A;  3S29 A;  3SBC A;  5KP1 A;  4O2H A;  1PMT A;  3IRA A;  2CWT A;  4KFF A;  2X99 A;  4EO3 A;  4G9H A;  4XS6 A;  1RLS A;  4MZC A;  2INX A;  1K0O A;  2JDI H;  3TRQ A;  3EU4 A;  3R3E A;  4O5R A;  2CWV A;  5IMZ A;  1XVW A;  3HII A;  2D1W A;  2W2C A;  3KE7 A;  1XOB A;  4ZIJ A;  3VFI A;  3FF2 A;  2GZP A;  4LLR A;  1OC8 A;  3EN1 B;  3X3X A;  4HU9 A;  4ZBA A;  5KN0 A;  2BHM A;  4RBN A;  3EUR A;  2IL3 A;  2HLS A;  2QC7 A;  4PUR A;  4JZQ A;  1EEJ A;  3GRX A;  5GSP A;  2H6X A;  1V57 A;  1GMR A;  1YY7 A;  4DSQ A;  1WRY A;  1EOG A;  2X64 A;  1K3Y A;  5H5S A;  3WA2 X;  4TRX A;  4EIQ A;  3TDG A;  3FW2 A;  3HVN A;  3PGB A;  2D42 A;  1I2E A;  3IHQ A;  3TRP A;  3DM8 A;  5CNW A;  4POK A;  2LNS A;  5CP1 A;  2YX9 A;  3GL5 A;  1W6C A;  4CHS A;  4NRE A;  2XH9 A;  5EY6 A;  1EP7 A;  1FGO A;  1THO A;  1OF5 B;  1BU4 A;  5ECK B;  1AQW A;  3K5T A;  1R26 A;  3N54 B;  2DMM A;  1A24 A;  3IC4 A;  4HJM A;  3GKN A;  1MWU A;  1B4P A;  4D73 A;  3HVV A;  1BYE A;  1I8V A;  1W7C A;  5CF2 A;  2EC4 A;  3UBK A;  3O6T A;  4GTU A;  3ME8 A;  1QFN A;  3O76 A;  1JRQ A;  4WKW A;  2A4H A;  2A2S A;  3KM6 A;  4AJ6 A;  3RPN A;  3Q74 A;  3OWY A;  1W4V A;  2CV4 A;  1UI8 A;  3ROB A;  2F5W A;  1KBN A;  1EQK A;  2JAD A;  1NB3 I;  3KH7 A;  3V92 A;  2RM5 A;  4HM8 B;  1R5A A;  3LTB A;  1HNA A;  3DY5 A;  4MJB A;  4MMY B;  2E2G A;  4OMV A;  5COH A;  2C4J A;  2LRT A;  4I5Q A;  3ERG A;  3VPT A;  1T8E B;  2O7K A;  3TJJ A;  3IA1 A;  2LRN A;  2PMT A;  1SL2 B;  2CKF B;  1U88 A;  2IMK A;  3GZB A;  4BL3 A;  1XW5 A;  2CX0 A;  3EC3 A;  1S72 3;  1I9D A;  1MD3 A;  3HKR A;  4H86 A;  3HK4 A;  3CXC 2;  1O81 A;  5AIS A;  1N9E A;  2MMN A;  1TRQ A;  5J41 A;  1YJ6 A;  3H79 A;  3RAZ A;  1SJW A;  3JUN A;  5IMD A;  2IMI A;  4LYL B;  2BT3 A;  3CPW 2;  4JRF A;  2BU4 A;  3UIW A;  1UCI A;  3GTU A;  3CRU A;  4F9Z A;  5D9T A;  4PUA A;  2CFK A;  3NUV A;  1FW1 A;  1K0B A;  1OC3 A;  4WBR D;  2I4A A;  1J08 A;  1KSI A;  4PNG A;  3HJP A;  1BRJ A;  2O3O A;  9RNT A;  2GST A;  1QK8 A;  3C1S A;  4IBP A;  4FQU A;  2OBK A;  2XRX B;  4GHO A;  2GZY A;  5G30 A;  4Q5N A;  2DJJ A;  3VGN A;  2FUG 2;  2FNO A;  4NHF A;  1QVG 2;  2LNT A;  2PER A;  2K8V A;  3KCH A;  3BJ5 A;  3JUQ A;  2W56 B;  3F8U A;  4RUV A;  2DSA A;  1RGL A;  2B6M A;  3FEU A;  1TU5 A;  2WUL A;  1XFL A;  2M46 A;  2CH9 A;  4KFD A;  1AV4 A;  5DAK B;  1TFO A;  2LYX A;  1JHB A;  3BCK A;  1VF4 A;  1Q98 A;  2LTK A;  4KUN A;  2BNG A;  3NM7 A;  4TR1 A;  3CMI A;  2WJU A;  2CT6 A;  1G6W A;  2DKI A;  4WP5 A;  5D93 A;  1PA3 A;  4YQV A;  12GS A;  3P7X A;  4BIR A;  2CAI A;  1F8N A;  3TRX A;  4MAB A;  5FW5 A;  3G7Y A;  5CRG A;  3CME 3;  3OW2 2;  1ZMA A;  2IN3 A;  5AGY A;  2CFG A;  1O73 A;  3C7M A;  3VF1 A;  1TK8 B;  5KP4 A;  4ZB8 A;  2K3D A;  2O8V B;  2QSI A;  5IEN A;  4X0X A;  3ZIJ A;  3TKS A;  1LOY A;  1WMJ A;  2CA8 A;  1EWX A;  2VLV A;  5IPG A;  14GS A;  2MMZ A;  1RGC A;  2VLT A;  3LXT A;  1PX7 A;  4KSM A;  1JZW A;  2YP6 A;  2XSO B;  3Q18 A;  1MWR A;  3K7C A;  2VL2 C;  1OHP A;  3SLU A;  2IIY A;  3TCO A;  1ERV A;  4KT3 B;  1YNV X;  5AIG A;  3BCI A;  1PU4 A;  1BRK A;  2Y74 A;  5C04 A;  3ZTL A;  1VQ7 3;  5A0O B;  2BMX A;  1WMP A;  2VM2 A;  4PUF C;  2LEG A;  2GSQ A;  3VPQ A;  3GZX B;  2NBS A;  1PD2 1;  3GNJ A;  1PQN A;  1CYU A;  1MD4 A;  1TXX A;  1JKG B;  4IVF A;  1VQN 3;  4IW9 A;  3PR8 A;  1EOH A;  4J8T A;  2H1B A;  5JCW A;  2L6D A;  2B5Y A;  1URM A;  3M9K A;  2HMK B;  2C8U A;  3MIX A;  4K0G A;  3KIJ A;  2R4I A;  1OC9 A;  1N9J A;  3EE1 A;  3ZFZ A;  1E3V A;  4RQR A;  1PSQ A;  3G7J A;  2H19 A;  3I6A A;  3ZVJ A;  3ZMK A;  1K0A A;  1WIK A;  4AKY A;  1GSP A;  3W8J A;  1K9M 4;  1IVX A;  2E2M A;  4LL1 B;  2VL9 A;  3C71 A;  4GLT A;  3DIE A;  4TN8 A;  3DUK A;  2BMR B;  3MSO A;  1JFU A;  3SVA A;  2OTL 3;  2VCZ A;  2XHF A;  3OR5 A;  2W9Q A;  1JZR A;  3LYG A;  2JSY A;  1RW1 A;  2GSP A;  3GL3 A;  2XFS A;  4N0Z A;  1SKW B;  4MK3 A;  2H0G A;  4O92 A;  3MG3 A;  3QAG A;  1R5P A;  3GUS A;  3GWR A;  2OQE C;  3F8H A;  4MMZ B;  1GLP A;  1GTB A;  4BWQ A;  2CAQ A;  3F0I A;  4MF7 A;  1BNF A;  4DSS A;  2KF3 A;  3TGZ A;  3G4S 3;  1FZU A;  1VQ5 3;  2Z9S A;  3ZIV A;  2I1U A;  1C7H A;  3DXO A;  1OCV A;  3IJE B;  2JQ5 A;  1GUH A;  2VCT A;  1FGM A;  2J23 A;  5G2Z A;  2F99 A;  1XCC A;  3UAR A;  3CCR 3;  1LBK A;  2P0G A;  1DMQ A;  1JV2 B;  4BU4 A;  1S5A A;  1RGF A;  1RQM A;  3LT9 A;  1XG8 A;  4TR4 A;  1PL1 A;  1VGL A;  2ZNM A;  4K8M A;  2VL2 A;  1W89 A;  3FG4 A;  7GSS A;  3V1W A;  4Z2T A;  2UUG C;  2UGI A;  3D22 A;  1BNE A;  3M8N A;  1BSE A;  3L0R A;  4RQX A;  3ZL5 A;  2AHE A;  3HZ8 A;  2RGQ A;  4GSN A;  4IP6 A;  2X8G A;  3M0F A;  4XHM A;  4XTS A;  3MKI A;  3GHA A;  2W04 A;  4IEL A;  1HQO A;  4XIH A;  5IM9 A;  2C1Y A;  3CMA 3;  1A23 A;  3A76 A;  1WOU A;  2FD3 A;  3F6D A;  3X3Z A;  2OTJ 3;  2OOV C;  4J57 E;  3STD A;  2OE0 A;  3A5E A;  2IUJ A;  3V99 A;  3WHO A;  1W01 A;  4WXT A;  4KDY A;  1G96 A;  2BJX A;  4P3Y B;  4IIA A;  1O85 A;  1TRV A;  3D5I A;  3FH1 A;  3UNL A;  1GY5 A;  1SD8 A;  3LML A;  1Q7Y 4;  2WCI A;  4F0B A;  1O7P B;  1A8Y A;  2HXK A;  2KF5 A;  1F3B A;  1GSF A;  3Q19 A;  1YZX A;  2L5L A;  5EL8 A;  1YJN 3;  3EBY A;  1IVW A;  3O8Y A;  1IU7 A;  1OUN A;  3I0Y A;  1GUL A;  1W4N A;  4ZL7 A;  5EQL A;  1ZYQ B;  5L71 A;  1UDI I;  1V2A A;  3G0K A;  1TDI A;  2HRN A;  3KZQ A;  1AQX A;  2UZ8 A;  4YH2 A;  2DLX A;  1FOV A;  4HM4 B;  2F86 B;  3VSY A;  5IOX A;  4FH8 A;  3G9B A;  2IA7 A;  4EXJ A;  1BG5 A;  1AQV A;  4ZXG A;  5G31 A;  1V58 A;  2VL3 A;  2IYJ A;  2C0E A;  4JRR A;  5DCG A;  1RJO A;  1FHE A;  3I56 3;  3H1N A;  1LNI A;  4R80 A;  4GXZ A;  5ECM B;  4PX1 A;  4YKG A;  4E8E A;  1JBT A;  5CF1 A;  1Q81 4;  4OUQ A;  3CSI A;  2C3T A;  3PCS A;  1JB4 A;  1BRI A;  1RRH A;  3FLJ A;  1QGV A;  4AEQ A;  1BRN L;  3C8E A;  1B2X A;  5E59 A;  2RCD A;  4IJ3 A;  2Z76 A;  5HR3 A;  1K41 A;  5BIR A;  3CPO A;  1RCK A;  4ECJ A;  3QAW A;  2V1L A;  1Q82 4;  3KSE D;  5AIF A;  3HJO A;  3ZLP A;  2MMA A;  2FXT A;  1EP8 A;  5IG5 A;  2IY2 A;  4GL6 A;  4HM1 B;  1PX6 A;  2AYT A;  2PVQ A;  2X8H A;  1EUI C;  3QDN A;  2IJY A;  1TK0 B;  3HX8 A;  3F9U A;  2YFI B;  3FG3 A;  4EC6 A;  5D96 A;  1PKZ A;  2H72 A;  3GSS A;  4PGT A;  3NBB A;  1ML6 A;  2VOC A;  2A4V A;  1W00 A;  1AR0 A;  3LZA A;  2B5E A;  2YOI A;  3N9H A;  4ECB A;  1DE2 A;  3SED A;  2OQE A;  1US1 A;  4Q5R A;  4K1U A;  1U87 A;  1ZOF A;  4ZB6 A;  4N6U A;  2HSH A;  2JU5 A;  3CXG A;  4Q53 A;  1RNT A;  1TFK A;  2JZR A;  1JN5 A;  3B8L A;  3A5W A;  4HOJ A;  4BWS A;  4RI7 A;  3G16 A;  1C54 A;  4XM4 A;  3D3L A;  4N6V 0;  4N6M A;  5IIZ A;  4NV2 A;  4NV5 A;  4H3U A;  1OHO A;  1FVK A;  4TKY A;  4TOP A;  4HM7 B;  4OO4 A;  3D5G A;  1SPU A;  4JR4 A;  4HSC X;  4HUA A;  3EMX A;  5GST A;  3GAX A;  1ERU A;  2ZUP A;  1OF5 A;  1M9B A;  1R4Y A;  5CRH A;  1QXH A;  6GSY A;  5LNK e;  1R4C A;  1JLW A;  4K5R A;  1N8Q A;  1M1X B;  3L0H A;  1NWW A;  4ZB9 A;  5TGN A;  1KEB A;  2VCX A;  3GZY B;  5D82 A;  3A2X A;  5AI1 A;  5D83 A;  4J2F A;  3HOH A;  5D73 A;  2E7P A;  8GSS A;  1RN1 A;  1O7W B;  3FZW A;  2LS5 A;  2QGV A;  5CRW A;  1ROV A;  4O7H A;  3Q3F A;  5RNT A;  5M18 A;  4BL7 B;  1HYF A;  2CWU A;  3J7Y d;  1LOW A;  3TKQ A;  4BVX B;  2R2J A;  1Q9E A;  3HY2 A;  2PWJ A;  3EHC A;  2W0Q A;  3KKG A;  2TRX A;  3PIN A;  3LW9 A;  2BTO T;  1WNH A;  3Q6O A;  3HCZ A;  5CO3 A;  1BOX A;  2F3M A;  1O7M B;  1NJI 4;  3U5R E;  3TKP A;  2OBI A;  1K0N A;  4MPF A;  2H6Z A;  4EL1 A;  1EGO A;  4WHA A;  4ISD A;  4TXV A;  3CCV 3;  7GSP A;  4EXR A;  3L9U A;  5ELJ A;  3UB1 A;  2H01 A;  4HZB B;  2RNT A;  6GSP A;  1YJW 3;  3SWL A;  3TUE A;  3UMA A;  3K9M C;  3URP A;  3PXM A;  5B6M A;  2V32 A;  4O02 B;  1QQ2 A;  1D6U A;  2W6J H;  4PTS A;  4L5L A;  1RHL A;  1ILO A;  1SJZ A;  3KJY A;  2PVO C;  5DJM A;  3CNM A;  2FWG A;  3A5I A;  4LMV A;  4L8P A;  1VQ9 3;  4PXO A;  3Q2P A;  2A2R A;  3KP9 A;  2N5F A;  2O87 A;  3WA3 A;  4GSP A;  1GWC A;  3KCM A;  4I6X A;  3BOA A;  3U6V A;  2A15 A;  1QMV A;  4FR9 A;  1LXE A;  3F8X A;  1GUK A;  2DJ3 A;  1GTA A;  3IBH A;  2KOK A;  2B24 B;  1JBR A;  5BRT A;  3HI7 A;  4G19 A;  4DEJ A;  2JL4 A;  3LSZ A;  3AMO B;  4ML6 A;  2L1S A;  3QMX A;  1U3I A;  1TI3 A;  3M3M A;  5IER A;  1UCK A;  3UOM A;  2LJK A;  4FCM A;  1WQL B;  2EIO A;  3KXO A;  4J5K A;  4ECC A;  1TTZ A;  2EIR A;  4J9A A;  2NDO A;  4FYC A;  1XWK A;  3SOA A;  2FNQ A;  4LMW A;  1LOX A;  2CX1 A;  1FYS A;  4TXO B;  1AXD A;  4R4K A;  3NBR A;  2K54 A;  1F3A A;  1HNC A;  3Q90 A;  3J7Y k;  3FZ9 A;  3KFQ C;  1FB6 A;  3UEM A;  1A8L A;  4OFM A;  1S3A A;  4ID0 A;  1SK2 A;  2R0P A;  1BSA A;  1OGX A;  3EYT A;  2RBI A;  1BQ7 A;  5BXQ A;  2WB9 A;  2XR8 B;  1NHY A;  4N10 A;  1BX9 A;  1Z3E A;  3ZIT A;  1I5G A;  2J9H A;  2PUK C;  3ISO A;  4WF4 A;  3EX9 A;  2YV7 A;  3BNE A;  4X4J A;  1DET A;  1NSW A;  3OV4 A;  1NHO A;  1E3R A;  1OVN A;  2PGT A;  5ECH B;  2IMD A;  4IKH A;  2KF4 A;  3BIR A;  1IT8 A;  3ECF A;  1A2V A;  4CDL A;  3UAP A;  3L9S A;  5HQP A;  1X9W B;  2FY6 A;  3F4T A;  4HYZ A;  1GSY A;  1UGI A; 
#chains in the Genus database with same CATH homology
 4KF9 A;  1T4Z A;  4X43 A;  1KTE A;  2P5R A;  3IV4 A;  3F6F A;  1ERT A;  2LJA A;  1GSU A;  2O89 A;  3I9V 2;  3MAK A;  2C0G A;  3IPZ A;  5CAX A;  3D5J A;  4USS A;  1PGT A;  2OKA A;  4Z2R A;  3FMW A;  2I9H A;  5ECI B;  5ELG A;  2FWF A;  4FYU A;  2HRK A;  5GAN D;  1ZCP A;  4WR5 A;  1ACV A;  4V2M A;  1JLV A;  3D4M A;  1J0F A;  2AAW A;  1O8X A;  2PN8 A;  1GNE A;  4NHZ A;  3G7I A;  4KSO A;  3BBY A;  3HVS A;  2WZ9 A;  2DJ1 A;  4WBJ A;  1K3O A;  4F2I A;  3WD6 A;  2PU9 C;  3A2W A;  1XW6 A;  2YJ7 A;  3D4T A;  3D6I A;  3APQ A;  4IN0 A;  5ECS A;  3PH9 A;  4CY6 A;  2IPA A;  2AB6 A;  3GFK A;  3DD3 A;  5FWG A;  2XPE A;  4WR4 A;  5IQY A;  3FR3 A;  1B9X C;  4ZBB A;  3GYK A;  1VF1 A;  5GSS A;  4OCE A;  2KLX A;  5IMA A;  5GZZ B;  1GTI A;  5ID2 B;  3WGE A;  1WP0 A;  2TIR A;  3CRT A;  4HZ2 A;  4ILF A;  1T00 A;  1EEM A;  2GDR A;  3GH6 A;  3A2V A;  2LQO A;  1XXU A;  3LYK A;  3N5O A;  5J9C A;  2GSS A;  1MDI A;  2LV3 A;  4MP4 A;  3DWV A;  1ZYN A;  5AIX A;  2PBJ A;  3RHB A;  5G5F A;  1UC7 A;  2YPM A;  1HD2 A;  3TOT A;  4G0K A;  1AW9 A;  1B4Q A;  5JWR B;  2C0D A;  3QR6 A;  3ZZX A;  2VCV A;  4IJI A;  1XPV A;  5D8I A;  3APS A;  5DJL A;  4XCS A;  3US3 A;  5ECL B;  3GV1 A;  1XIY A;  5F8B A;  4JR6 A;  3HZ4 A;  1SL0 B;  3MDK A;  3GX0 A;  2KUC A;  2CX3 A;  1YEP A;  1HNB A;  1H75 A;  4FO5 A;  1FVJ A;  1GRX A;  1JZD A;  19GS A;  1OAZ A;  2R3X A;  4N0V A;  2RLI A;  4K2X A;  5IO0 A;  1X0R A;  1YDK A;  3MYD A;  1GL8 A;  4O5Q A;  4NMU A;  3WT1 A;  6GSU A;  2C80 A;  4K9Z A;  2VCW A;  2H74 A;  3TB2 A;  1SYR A;  1Y6E A;  4MH2 A;  3EMP A;  3FK8 A;  3P90 A;  6GST A;  5HFK A;  3UBL A;  3VWV A;  4K6X A;  5D9V A;  2YWI A;  5GAP D;  3IOS A;  1GSS A;  2QA1 A;  5A5K A;  2H70 A;  1THX A;  2XBQ A;  3ZFL A;  4AJ7 A;  5IMF A;  2GQM A;  1EV9 A;  2DIY A;  1UN2 A;  5F07 A;  1S3D A;  2H8L A;  4MLY A;  2GVP A;  1M7T A;  5IOW A;  1X5D A;  5DAL A;  2RM6 A;  3UVH A;  2H73 A;  1XWB A;  13GS A;  1WJK A;  2CZ3 A;  2HYX A;  22GS A;  4YAP A;  4G0L A;  4G10 A;  2GLR A;  3IE3 A;  3LEF A;  1GSE A;  3QD9 A;  2HNL A;  2ON5 A;  4V1A g;  4I2T A;  1XVQ A;  1ZYE A;  3UVT A;  3ZYW A;  2HE3 A;  4OO5 A;  1NM3 A;  1OE8 A;  3M9J A;  4GCI A;  5A4U A;  2F51 A;  1HYU A;  1X5C A;  2G0F A;  2IFQ A;  3FKF A;  3GKK A;  4CDO A;  3KTL A;  5KN2 A;  2YJH A;  1TRU A;  5ECR B;  1OE7 A;  3NIV A;  3QAV A;  3KP8 A;  5ABR A;  4IHU A;  2HZE A;  2V1M A;  4K7I A;  3L78 A;  2IMF A;  1XWC A;  1YF1 A;  1PN9 A;  5DBQ A;  1DUG A;  4MJE A;  3FR6 A;  2V2G A;  2L57 A;  3TJB A;  2CX4 A;  4HI7 A;  2R0G A;  2H75 A;  3O3T A;  1Z7P A;  5CYY A;  2ZCT A;  3FHK A;  5AN1 A;  4D73 B;  3L4N A;  5A4V A;  2HRF A;  5CRD A;  4KCE A;  5INY A;  1B48 A;  3LOR A;  3BD2 A;  5G1K A;  3APO A;  4OFT A;  1V98 A;  1ST9 A;  1TRS A;  2K8S A;  4N11 A;  1USB A;  1SYX A;  5B7C A;  1SK1 A;  4PNF A;  5F0G A;  3KGK A;  5E4W A;  5KOX A;  4GQC A;  5F06 A;  3CTF A;  3IXR A;  4Q5Q A;  4FIW A;  4XRA A;  1GUM A;  4POB A;  5ID2 A;  4YQU A;  16GS A;  1SU9 A;  3D21 A;  2AJQ B;  1WPI A;  1GSQ A;  10GS A;  4MMM A;  5G5E A;  4OD7 A;  1TKD B;  1TRW A;  2R4V A;  3VK9 A;  3HA9 A;  1EGR A;  2M72 A;  1CQH A;  3TKR A;  4PQH A;  3GTU B;  4IQA A;  3NZN A;  3IK7 A;  4XS1 A;  3GKX A;  4GWR A;  1YQ1 A;  2GQK A;  4KH7 A;  4K5S A;  2GZZ A;  2VO4 A;  1TK5 B;  2K18 A;  2LKU A;  4AGS A;  4Z7X A;  3H8Q A;  5JWO B;  2QA2 A;  5H5R A;  2FHE A;  4BL7 A;  3FY7 A;  11GS A;  2LUS A;  4IGJ A;  1TP9 A;  1A0R P;  2LJR A;  4ICY A;  1OKD A;  1DBY A;  2YCD A;  3FZ4 A;  4XRD A;  4WEY A;  1TI1 A;  4BVY B;  4TR0 A;  5B8A A;  1G7O A;  1A2L A;  2YV9 A;  1MEK A;  1M2D A;  3VLN A;  3VWW A;  1M9A A;  3D0Z A;  2VCQ A;  2OE1 A;  1CQG A;  2YWM A;  3VI7 A;  2N5A A;  1XZO A;  1NW2 A;  4YKF A;  1U3A A;  3NOF A;  2N5B A;  2NTO A;  4MF6 A;  3LJR A;  1XWA A;  3F4S A;  3GH9 A;  1N2A A;  2VLU A;  3QFA C;  2DKH A;  4QQ7 A;  1J9B A;  2MMO A;  4OCF A;  2RUE A;  2JZT A;  5J3R A;  4Z2U A;  2GT6 A;  3IAS 2;  3R2Q A;  5ELA A;  4YQM A;  4NXI A;  1A2J A;  1YKC A;  5EVO A;  4WET A;  3GST A;  4O32 A;  3ZRE A;  3DXB A;  2OA7 A;  3PGT A;  2GT5 A;  4BVX A;  1SJ6 A;  2B5X A;  3IR4 A;  1M99 A;  1UVZ A;  1RK4 A;  4K7N A;  2ON7 A;  3WYW A;  3H4K A;  2DML A;  3DRN A;  3FR9 A;  4IQ1 A;  1UA5 A;  2MBT A;  4LL4 B;  1AIU A;  2B1L A;  2KP2 A;  5DVB A;  3ERF A;  2B7J A;  4F03 A;  4GQF A;  3P8W A;  3LXZ A;  2GTU A;  1VF2 A;  4HJ2 A;  4ZL8 A;  4O5U A;  3CSJ A;  2L59 A;  2FGX A;  2F9S A;  3F3Q A;  3QPM A;  1PL2 A;  4KB3 A;  3L9V A;  2NPB A;  4POM A;  5F05 A;  2FWE A;  1X9M B;  4DVC A;  5KEJ A;  1VRS D;  2DBC A;  5HR0 A;  4EDZ A;  3WT2 A;  4KDX A;  2L5O A;  5ECQ B;  1R7H A;  2VAF A;  3CYN A;  3ERW A;  3QCP A;  3WGD A;  2H66 A;  2LQQ A;  1A2M A;  3GIX A;  2H71 A;  3GUR A;  3F63 A;  1OKT A;  4K2D A;  1Z7R A;  4MF5 A;  1SJI A;  1V9W A;  3J7Y b;  5FT3 A;  1DSB A;  4YAV A;  3PPU A;  4I97 A;  4MJC A;  1K0M A;  2HSY A;  4LA1 A;  3CBU A;  1C72 A;  1GSD A;  17GS A;  4MZW A;  4KW6 A;  1T1V A;  5DQS A;  3KEB A;  3TKS C;  3GMF A;  5D9X A;  5FHI A;  3AY8 A;  4KGI A;  4L0W A;  2P31 A;  2I81 A;  2R0C A;  4HQZ A;  4E8H A;  3CSH A;  3W8S A;  4OWY A;  1PRX A;  4JBB A;  2JAC A;  3EE2 A;  5HFI A;  1O6J A;  3K8N A;  5C00 A;  3EIN A;  1X9S B;  4EF0 A;  4L0U A;  1BAY A;  2EIQ A;  2HRA A;  4RI6 A;  4KDU A;  1X5E A;  3TJK A;  2DIZ A;  3ED3 A;  4MPG A;  2RUF A;  2B1K A;  2D2Z A;  3TKS E;  6GSS A;  3ZFB A;  2GS3 A;  4JU5 A;  1H4O A;  3GKM A;  1ZL9 A;  3TJF A;  5EPF A;  2TRC P;  3HJM A;  4MDC A;  2O85 A;  1XBS A;  1R4W A;  4ZL9 A;  3VWU A;  3DVX A;  1ABA A;  2H76 A;  2FCH A;  9GSS A;  1LJR A;  2JSZ A;  2IME A;  2XPD A;  3GX8 A;  3M1G A;  1XOA A;  1O8W A;  3F4R A;  1TW9 A;  2VD1 A;  1FAA A;  2L4Q A;  5A4W A;  1EZK A;  2QKE A;  4NPB A;  2VIM A;  2HZE B;  4HEA 2;  5ECO B;  1PN0 A;  4KCA A;  1XWG A;  2H30 A;  4CY8 A;  2GQL A;  3RPP A;  1OC9 B;  2HT9 A;  2DC5 A;  4XS4 B;  3C1R A;  5IMC A;  2R6K A;  2OAD A;  1ZZY A;  4BVY A;  4MJA A;  2F8F A;  2CVD A;  1Z6M A;  5J5N A;  1G6Y A;  4TR3 A;  5J9B A;  5LCZ A;  2AV4 A;  1Z5Y E;  4BA7 A;  1TJD A;  1E6B A;  1K0D A;  4EE0 A;  4ACS A;  4MCU A;  1E2Y A;  5HR1 A;  4EDY A;  5J4U A;  2IFQ B;  4WF5 A;  1SKS B;  1SK0 A;  1ERW A;  3KTB A;  4DSS B;  2GSR A;  1LU4 A;  3VI5 A;  2R37 A;  2DJ2 A;  3IHG A;  4GST A;  4MA9 A;  1IYI A;  3S9F A;  4V2N A;  2ES7 A;  2REM A;  3LQ7 A;  1GLQ A;  5HR2 A;  2VM1 A;  4MH3 A;  1XW9 A;  4QL7 A;  5CRE A;  5ECP B;  4TW5 A;  18GS A;  3CTG A;  2C3Q A;  3QOU A;  2FA4 A;  2LRC A;  3EWL A;  5DAK A;  3EPT A;  20GS A;  2FLS A;  2C0F A;  2IWT A;  2YZU A;  1FB0 A;  1FG4 A;  1B8X A;  3DEX A;  4HZ4 A;  3EU3 A;  4KX4 A;  2C3N A;  3MNG A;  3HD5 A;  4TVE A;  2VD0 A;  3VUR A;  5DAL B;  1PKW A;  1ZGN A;  1GTU A;  2H0I A;  2X4A A;  2M80 A;  3LYP A;  2V6O A;  2FWH A;  2B7K A;  2WGR A;  2OJL A;  5KN3 A;  2FA8 A;  2HFD A;  4IP1 A;  4N30 A;  3QFB C;  1U6T A;  3E9J B;  2H0H A;  1QUW A;  2A2P A;  2P5Q A;  1TOF A;  2F8A A;  4HQS A;  3GN3 A;  1M2B A;  1MDJ A;  3A3T A;  6GSX A;  3VWX A;  2L4C A;  4KA0 A;  3ZML A;  5JCU A;  2YWN A;  3E3E A;  2YN1 A;  4CW9 A;  4FYB A;  2YZH A;  4ULX A;  1AUC A;  1OYJ A;  1YKA A;  1T7P B;  3MWH A;  2B3S A;  5ECN B;  3I69 A;  2G2Q A;  4G2E A;  2VUP A;  2X8C A;  2X49 A;  3HHV A;  4JED A;  2H1D A;  2HZF A;  3WGX A;  1DE1 A;  2CZ2 A;  2CVK A;  1M2A A;  3IAM 2;  4TXO A;  4KE3 A;  2KP1 A;  1YF0 A;  4KND A;  1Y25 A;  5KN1 A;  2WDU A;  2YWO A;  2OE3 A;  2WS2 A;  1BED A;  2WFC A;  1GP1 A;  4OFN A;  4IS0 A;  1A0F A;  3JCM L;  4F82 A;  4GF0 A;  4J56 E;  3LWA A;  2HI7 A;  1ZYP A;  4HDE A;  4I8B A;  4EKZ A;  3IC8 A;  4V2L A;  1O7U A;  2L6C A;  3N9J A;  5JCG A;  1SL1 B;  1TU7 A;  1SD9 A;  1K0C A;  4G0I A;  3TOU A;  3RHC A;  5IPH A;  5IO2 A;  3IK9 A;  1YEX A;  1F6M C;  5BMU A;  1MDK A;  2CVB A;  4POL A;  1EV4 A;  5LD0 A;  3EVI A;  1N8J A;  2E0Q A;  3FRC A;  4PQI A;  4ML1 A;  3DKS A;  4Q5F A;  1F2E A;  1Q4J A;  4I2U A;  4K0N A;  3FZ5 A;  1VF3 A;  2JZS A;  4AF2 A;  2KHP A;  3H93 A;  1Z6N A;  2DJ0 A;  2GGT A;  2WRT A;  3DML A;  3KD0 A;  2OAC A;  5JWQ B;  4ECI A;  3IDV A;  1SKR B;  2R5G A;  5D9W A;  1MTC A;  4X1U A;  1WWJ A;  1IYH A;  1T4Y A;  3HVX A;  3HYP A;  2PPT A;  3GA4 A;  2RII A;  5KOW A;  1JZO A;  3HDC A;  4MNN A;  3UJ1 A;  3KH9 A;  2DJK A;  5AIV A;  4ZIL A;  1SEN A;  4AJ8 A;  4GSS A;  4EUY A;  5B6N A;  3I43 A;  2K6V A;  4DSR A;  4K7O A;  2AUV A;  3UL3 A;  1K3L A;  1V40 A;  3DVW A;  5DDL A;  1AC1 A;  3KMN A;  1ON4 A;  2XC2 A;  1WE0 A;  4EVM A;  4NAX A;  4V1A p;  1FO5 A;  2V6K A;  2NVL A;  6GSW A;  1G7E A;  4L5O A;  2H1G A;  2H6Y A;  4HS1 A;  4MZB A;  2MZC A;  1F37 A;  1GNW A;  4F0C A;  4PQ1 A;  4GRF A;  1Z9H A;  3HXS A;  3MSZ A;  4JE1 A;  1B9Y C;  3LFL A;  2YAN A;  3DYR A;  5DQY A;  2V41 A;  2XBI A;  5HFG A;  3F3R A;  4NWY A;  2I3Y A;  4TR1 B;  5IMV A;  3KMO A;  4QL9 A;  4NHW A;  6GSV A;  3RBT A;  1AAZ A;  1F9M A;  1M0U A;  4ZBD A;  2K9F A;  2YNX A;  1G0T A;  1TU8 A;  1GH2 A;  3FYG A;  2ALB A;  3W6G A;  4A5P A;  2HSM A;  3C73 A;  5DCH A;  1T3B A;  3DGQ A;  1S3C A;  3LG6 A;  4EC0 A;  2CQ9 A;  4K1F A;  3ZRD A;  4BPY A;  2MYG A;  1FOH A;  3RDW A;  4L8E A;  4EIP A;  3FZA A;  1BJX A;  5ENU A;  5H5Q A;  4HU7 A;  2H1A A;  5G1L A;  5B8B A;  3P2A A;  4KAE A;  3E0U A;  3TJG A;  2LST A;  3ME7 A;  4XS4 A;  3ZVJ D;  3LGC A;  2MBS A;  1KNG A;  3SBC A;  1PMT A;  3IRA A;  2X99 A;  4EO3 A;  4G9H A;  4XS6 A;  4MZC A;  1K0O A;  3TRQ A;  3EU4 A;  3R3E A;  4O5R A;  5IMZ A;  1XVW A;  4ZIJ A;  1XOB A;  3VFI A;  2GZP A;  4LLR A;  1OC8 A;  4HU9 A;  4ZBA A;  5KN0 A;  3EUR A;  2IL3 A;  2HLS A;  2QC7 A;  4PUR A;  4JZQ A;  1EEJ A;  3GRX A;  2H6X A;  1V57 A;  1YY7 A;  4DSQ A;  1WRY A;  1EOG A;  2X64 A;  1K3Y A;  5H5S A;  4TRX A;  4EIQ A;  3TDG A;  3FW2 A;  3IHQ A;  3TRP A;  5CNW A;  4POK A;  2LNS A;  5CP1 A;  3GL5 A;  4CHS A;  5EY6 A;  1EP7 A;  1THO A;  5ECK B;  1AQW A;  1R26 A;  2DMM A;  1A24 A;  3IC4 A;  4HJM A;  3GKN A;  1B4P A;  4D73 A;  3HVV A;  1BYE A;  2EC4 A;  3UBK A;  3O6T A;  4GTU A;  3ME8 A;  1QFN A;  3O76 A;  4WKW A;  2A4H A;  2A2S A;  3KM6 A;  4AJ6 A;  3RPN A;  3Q74 A;  1W4V A;  2CV4 A;  1KBN A;  2JAD A;  3KH7 A;  2RM5 A;  1R5A A;  1HNA A;  4MJB A;  2E2G A;  4OMV A;  5COH A;  2C4J A;  2LRT A;  4I5Q A;  3ERG A;  3VPT A;  1T8E B;  2O7K A;  3TJJ A;  3IA1 A;  2LRN A;  2PMT A;  1SL2 B;  1U88 A;  2IMK A;  1XW5 A;  3EC3 A;  1I9D A;  1MD3 A;  3HKR A;  4H86 A;  1O81 A;  5AIS A;  2MMN A;  5J41 A;  1YJ6 A;  3RAZ A;  3H79 A;  5IMD A;  2IMI A;  3UIW A;  3GTU A;  3CRU A;  4F9Z A;  5D9T A;  4PUA A;  1OC3 A;  1FW1 A;  1K0B A;  4WBR D;  2I4A A;  1J08 A;  4PNG A;  3HJP A;  2GST A;  1QK8 A;  3C1S A;  4IBP A;  4FQU A;  2OBK A;  2GZY A;  5G30 A;  4Q5N A;  2DJJ A;  2FUG 2;  2FNO A;  2LNT A;  2PER A;  2K8V A;  3BJ5 A;  3F8U A;  4RUV A;  2DSA A;  2B6M A;  3FEU A;  2WUL A;  1XFL A;  2M46 A;  5DAK B;  1JHB A;  3BCK A;  1VF4 A;  1Q98 A;  2LTK A;  4KUN A;  4TR1 A;  3CMI A;  2WJU A;  2CT6 A;  1G6W A;  5D93 A;  2DKI A;  4YQV A;  1PA3 A;  12GS A;  3P7X A;  2CAI A;  3TRX A;  4MAB A;  3G7Y A;  5CRG A;  1ZMA A;  2IN3 A;  5AGY A;  1O73 A;  3C7M A;  1TK8 B;  4ZB8 A;  2O8V B;  2QSI A;  4X0X A;  3ZIJ A;  3TKS A;  1WMJ A;  2CA8 A;  1EWX A;  2VLV A;  5IPG A;  14GS A;  2MMZ A;  2VLT A;  3LXT A;  1PX7 A;  4KSM A;  1JZW A;  2YP6 A;  3Q18 A;  3TCO A;  2VL2 C;  2IIY A;  1ERV A;  3BCI A;  5C04 A;  3ZTL A;  2BMX A;  2VM2 A;  4PUF C;  2LEG A;  2GSQ A;  3VPQ A;  2NBS A;  1PD2 1;  3GNJ A;  1PQN A;  1MD4 A;  1TXX A;  4IVF A;  4IW9 A;  3PR8 A;  1EOH A;  2H1B A;  5JCW A;  2L6D A;  2B5Y A;  1URM A;  3M9K A;  2C8U A;  3MIX A;  4K0G A;  3KIJ A;  1OC9 A;  4RQR A;  1PSQ A;  3G7J A;  2H19 A;  3I6A A;  3ZVJ A;  3ZMK A;  1K0A A;  1WIK A;  3W8J A;  2E2M A;  4LL1 B;  2VL9 A;  3C71 A;  4GLT A;  3DIE A;  4TN8 A;  1JFU A;  2VCZ A;  2XHF A;  3OR5 A;  1JZR A;  2JSY A;  1RW1 A;  3GL3 A;  4N0Z A;  1SKW B;  4MK3 A;  2H0G A;  4O92 A;  3QAG A;  1R5P A;  3GUS A;  1GLP A;  1GTB A;  4BWQ A;  2CAQ A;  3F0I A;  4MF7 A;  4DSS A;  3TGZ A;  2Z9S A;  3ZIV A;  2I1U A;  1GUH A;  2VCT A;  2J23 A;  5G2Z A;  1XCC A;  3UAR A;  1LBK A;  2P0G A;  1RQM A;  4TR4 A;  1PL1 A;  1VGL A;  2ZNM A;  4K8M A;  2VL2 A;  1W89 A;  7GSS A;  3V1W A;  4Z2T A;  3D22 A;  3M8N A;  4RQX A;  3ZL5 A;  2AHE A;  3HZ8 A;  4GSN A;  4IP6 A;  2X8G A;  3M0F A;  4XHM A;  4XTS A;  3GHA A;  4IEL A;  1HQO A;  4XIH A;  5IM9 A;  2C1Y A;  1A23 A;  1WOU A;  2FD3 A;  3F6D A;  4J57 E;  2OE0 A;  4WXT A;  4KDY A;  2BJX A;  4P3Y B;  1O85 A;  1TRV A;  1SD8 A;  4F0B A;  2WCI A;  1A8Y A;  2HXK A;  1F3B A;  3Q19 A;  1GSF A;  5EL8 A;  1YZX A;  2L5L A;  1GUL A;  4ZL7 A;  1ZYQ B;  5L71 A;  1V2A A;  1TDI A;  2HRN A;  3KZQ A;  1AQX A;  2UZ8 A;  4YH2 A;  2DLX A;  1FOV A;  5IOX A;  4FH8 A;  3G9B A;  4EXJ A;  1BG5 A;  1AQV A;  4ZXG A;  5G31 A;  1V58 A;  2VL3 A;  2IYJ A;  2C0E A;  4JRR A;  5DCG A;  1FHE A;  3H1N A;  4GXZ A;  5ECM B;  4PX1 A;  4YKG A;  4E8E A;  3CSI A;  2C3T A;  1QGV A;  3C8E A;  5E59 A;  4IJ3 A;  5HR3 A;  4ECJ A;  3QAW A;  3HJO A;  3ZLP A;  2MMA A;  1EP8 A;  2IY2 A;  1PX6 A;  2AYT A;  2PVQ A;  2X8H A;  3QDN A;  2IJY A;  1TK0 B;  3F9U A;  5D96 A;  1PKZ A;  2H72 A;  3GSS A;  4PGT A;  1ML6 A;  2VOC A;  2A4V A;  2B5E A;  2YOI A;  4ECB A;  1DE2 A;  4Q5R A;  1U87 A;  1ZOF A;  4ZB6 A;  2HSH A;  2JU5 A;  3CXG A;  2JZR A;  3A5W A;  4HOJ A;  4BWS A;  4RI7 A;  5IIZ A;  4NV2 A;  4NV5 A;  1FVK A;  4TKY A;  4TOP A;  4OO4 A;  4JR4 A;  4HUA A;  3EMX A;  5GST A;  1ERU A;  2ZUP A;  1M9B A;  5CRH A;  1QXH A;  6GSY A;  5LNK e;  1JLW A;  4K5R A;  3L0H A;  4ZB9 A;  1KEB A;  2VCX A;  3A2X A;  4J2F A;  5D73 A;  2E7P A;  8GSS A;  2QGV A;  5CRW A;  2LS5 A;  4O7H A;  4BL7 B;  3TKQ A;  4BVX B;  2R2J A;  3HY2 A;  2PWJ A;  2TRX A;  3PIN A;  3LW9 A;  2BTO T;  3Q6O A;  5CO3 A;  3HCZ A;  2F3M A;  3U5R E;  3TKP A;  2OBI A;  1K0N A;  4MPF A;  2H6Z A;  4EL1 A;  1EGO A;  4ISD A;  4TXV A;  3L9U A;  2H01 A;  3SWL A;  3TUE A;  3UMA A;  5B6M A;  2V32 A;  1QQ2 A;  4PTS A;  4L5L A;  1ILO A;  1SJZ A;  3KJY A;  2PVO C;  5DJM A;  2FWG A;  3A5I A;  4LMV A;  4PXO A;  2A2R A;  3KP9 A;  2N5F A;  2O87 A;  1GWC A;  4I6X A;  3KCM A;  3U6V A;  3BOA A;  1QMV A;  1GUK A;  2DJ3 A;  1GTA A;  3IBH A;  2KOK A;  5BRT A;  4G19 A;  4DEJ A;  2JL4 A;  3LSZ A;  4ML6 A;  3QMX A;  1U3I A;  1TI3 A;  3M3M A;  3UOM A;  2LJK A;  2EIO A;  3KXO A;  4ECC A;  1TTZ A;  2EIR A;  2NDO A;  4FYC A;  1XWK A;  4LMW A;  4TXO B;  1AXD A;  1F3A A;  1HNC A;  3J7Y k;  3FZ9 A;  1FB6 A;  3UEM A;  1A8L A;  4OFM A;  1S3A A;  4ID0 A;  1SK2 A;  2R0P A;  3EYT A;  1BQ7 A;  2WB9 A;  1NHY A;  4N10 A;  1BX9 A;  1Z3E A;  3ZIT A;  1I5G A;  2J9H A;  2PUK C;  3ISO A;  4WF4 A;  2YV7 A;  4X4J A;  1NSW A;  1NHO A;  1OVN A;  2PGT A;  5ECH B;  2IMD A;  4IKH A;  3UAP A;  3L9S A;  5HQP A;  1X9W B;  2FY6 A;  3F4T A;  1GSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...