1RNBA

Crystal structure of a barnase-d(*gp*c) complex at 1.9 angstroms resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
QVINTFDGVADYLQTYHKLPNDYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords DNA (5'-D(*GP*C)-3')
publication title Crystal structure of a barnase-d(GpC) complex at 1.9 A resolution.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 28
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 1991-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rnbA00
3URPA 1BNEA 1BANA 1B2UA 1LNIA 1B21A 2KAAA 1BGSA 1BRKA 1FYSA 1X1UA 3HOHA 1Q9EA 1MGRA 2KF3A 1RMSA 1BRHA 1GOVA 1A2PA 1X1WA 1FW7A 1TTOA 1I8VA 1BRJA 1I3FA 3WHOA 1RNTA 1GOYA 1X1XA 1FUTA 3D5IA 1B3SA 2KF4A 1RDSA 1UCKA 2F56A 4J5GA 1I2EA 1BU4A 1PYLA 1B2ZA 2SARA 1RGHA 1BNSA 5BU4A 5BIRA 6RNTA 3A5EA 1BAOA 1RGEA 4HOHA 1RTUA 1I2FA 2AADA 4HAAA 1I2GA 1MGWA 2F5WA 5GSPA 1RGFA 9RNTA 1PY3A 1RGLA 1BNJA 3AHWA 2F5MA 1GSPA 1TRQA 3GSPA 1BSBA 1I0XA 1I3IA 1BSEA 1RGAA 1B20A 3D5GA 1C54A 1RN1A 1T2IA 2RNTA 2KF6A 4GSPA 3DGYA 1BUJA 1RNBA 2BIRA 3WR2A 1I70A 1AY7A 1SARA 1TRPA 2GSPA 1BSAA 1T2HA 4BIRA 1BOXA 1R4YA 1HYFA 1DETA 1RLSA 1RGCA 1UCLA 1FZUA 1DE3A 1I0VA 4J5KA 3AGNA 3DH2A 6GSPA 1ZGXA 8RNTA 1LOYA 1BNRA 1YNVX 7GSPA 4BU4A 1B2XA 1RCKA 1BRNL 1IYYA 3Q3FA 3BU4A 3KCHA 1X1YA 1BRGA 1B27A 1JBSA 1FUSA 1JBTA 1RGGA 1BRIA 1JBRA 1AQZA 3BIRA 2KF5A 1CH0A 1LOVA 1RGKA 1RN4A 1YVSA 1B2MA 1BNIA 4GHOA 1GMQA 1UCJA 2F4YA 1BSCA 1RSNA 2RBIA 1GMPA 1BVIA 3SYUA 7RNTA 2BU4A 1BSDA 3AHSA 2C4BA 2AAEA 1RHLA 5HOHA 1LOWA 1BRSA 5RNTA 1HZ1A 1G02A 1RCLA 1YGWA 1BIRA 2HOHA 1UCIA 1BNFA 3AGOA 1GOUA 4RNTA 1BNGA 3RNTA 1B2SA 3D4AA 1GMRA 2ZA4A 1LRAA
chains in the Genus database with same CATH superfamily
3S5CA 1BANA 4L8PA 1LNIA 4R4KA 1WMPA 3NX0A 5ELJA 4EYCA 1BGSA 1SIHA 2GEXA 3HOHA 2XGLA 3WOEB 1MGRA 1UDII 1LXEA 1LOXA 2KF3A 2O9UX 3CU3A 1JJ22 1OPYA 2RGQA 1Z1SA 1U8CB 3DGLA 3FZWA 4HM1B 2M7OA 2CC3A 3UL6A 3X42A 4EV5A 3I563 1V57A 3FGYA 2W6JH 1GOYA 4OVMA 3X40A 1RRLA 4MMXB 1N8QA 3D5IA 1TUHA 4N6MA 4AKZA 4HM4B 1GD3A 1UCKA 4J9AA 2CX1A 2KXGA 1FGRA 1PYLA 3DUKA 1SJWA 3AMOA 3EB8A 5AIHA 4IT7A 1JN5B 2SARA 3VSYA 5D83A 1FGTA 3WA3A 5BIRA 2FGTA 3A5EA 2E2UA 3JVCA 1LQMB 1W2B2 2AADA 5IEOA 1I2GA 3F8XA 4LSOA 1YI23 1Q864 1RGFA 3BNEA 3CCR3 3E99A 2LQVA 2BMRB 4LMIA 2IUJA 1BNJA 3DY5A 4XDWA 3I0YA 3VF1A 1DMNA 1L5GB 3AHWA 2F5MA 2P09A 2WOHA 3DGOA 1VZZA 1G96A 2CX0A 3V92A 2CFDA 2BMOB 4XM4A 4ORLA 1VQN3 3S67A 1FW7A 1Q7HA 3EBTA 3ZG0A 2W9PA 4XBTA 1YVBI 3ZG5A 1TJDA 5JBSA 1RN1A 5IG3A 2KF6A 1CQSA 2CHCA 3K63A 3PCSA 5AEWB 1Q824 1F8NA 1QVG2 2XSHB 2BO9B 3HK4A 1Q40B 3HI7A 1SARA 3SOAA 1IDPA 4HYZA 4N6V0 5LC6A 4BIRA 1BOXA 4AKYA 1W6YA 3X3ZA 2CWUA 1OUNA 2UX0A 1MWUA 2V1LA 1DETA 3F40A 1BUQA 2OTJ3 4H3UA 1FZUA 5G1KA 1VQ73 2STDA 3EN1B 4XBXA 1T3BA 3K5TA 1JB5A 1E97A 3M8CA 3KFQC 1WQLB 1OF5A 3BB9A 8RNTA 3G4S3 4HZBB 4K61A 3N54B 3PYJA 2SBLA 4GB5A 5EQLA 3DZLA 3ROBA 5IENA 3KE7A 4NPBA 4BU4A 3OX9A 1IQXA 1B2XA 2XFTA 7GSPA 1BRNL 1DVDA 3BU4A 2Z7AA 3SEDA 2HMKB 3CPW2 1JBSA 1O7WB 4NHFA 1QAFA 3PS8A 1V58A 2D42A 1NDOB 1ROAA 4I5QA 2Y74A 3NHXA 4KVHA 4BTXA 1CH0A 3FG4A 3F9SA 1RN4A 1IV9A 1ASKA 2HMMB 1Q42A 4N6TA 3JUPA 1JKGB 4FR9A 1UCJA 4GHOA 4WWUC 3UL5A 1G0TA 1IVWA 4JF8A 3CCS3 3DMCA 1JRQA 2ML5A 3K7CA 5AIIA 4EBGA 7RNTA 1JN5A 2BU4A 3A76A 5CLKA 1UGIA 1WMNA 2C4BA 1N5PA 2BNGA 3EC9A 3FCSB 4XDVA 2CWTA 2MF7A 1VQ63 4O2HA 1BRSA 3H51A 4RZMA 1V74A 1VQ83 1HZ1A 1IVUA 1GS3A 3KKGA 4U13A 1EUIC 1BNFA 3WDGB 2W04A 3BLZA 2B24B 2R4IA 5AI1A 1BNGA 3CCU3 3HZPA 1QMAA 1RN7A 5G2GA 4FMAA 2BIRA 1O7PB 1NB3I 2GSPA 2WO0A 1TIJA 2JQ5A 2Y73A 3F7XA 1BNEA 5ELUA 3T0UA 1B21A 2KAAA 3EX9A 2CG1A 1FYSA 1LNHA 1Q40A 1X1UA 5D82A 3WMDA 1N9EA 3GAXA 1A90A 1RMSA 2FXTA 1OGXA 5AYRB 1FGQA 1NB5I 1UI8A 1W4NA 2P0XA 2XH9A 3OXAA 1BRJA 3N8BA 3WHOA 3CD63 1X1XA 4O8SA 3OWSA 3S28A 1JB4A 3X3XA 1IT7A 1RDSA 3MG1A 5JPUA 1ZX2A 2L4VA 2K54A 3UJMA 3LT9A 3J7Yd 2HMOB 5BU4A 1U5OA 1YGEA 1VQ53 4NREA 1BAOA 3RDEA 4HOHA 5A0OB 1CEWI 1I2FA 1MGWA 2F5WA 1ZO2A 5GSPA 1K28A 4WYKB 9RNTA 3CXC2 1KWIA 1IT8A 1RJOA 2CWVA 3FLJA 1MWRA 1JKGA 3PCRA 1PU4A 5CF2A 5FGOA 1RRHA 1QAKA 1KC84 3NM2A 4FCZA 2IA7A 2ZDJA 3K9MC 3D5GA 1C54A 1EQKA 1IU7A 5IF6A 5AEUB 1BUJA 3LXUX 3JUQA 1OHPA 2OTL3 3IJEB 1I70A 4R9KA 4LGQA 1TRPA 1TFKA 3BNDA 2GBWB 3U1WA 2KCDA 3NBBA 1AR0A 4GL6A 1M904 2HMNB 1W01A 2A15A 4DKIA 4J5KA 1SQWA 3GZXB 2K0MA 5M19A 2H0HA 3CCE3 1YIJ3 1ISKA 3CCQ3 3IPTA 1EKMA 1BNRA 1US1A 1YNVX 3ECFA 5KP3A 3CC73 3I553 4HZ9B 3MWZA 3F8HA 1B27A 4OUQA 1EG9B 3BIRA 3X3YA 2KF5A 1AV4A 3D79A 3FF0A 3T8NA 2P0MA 1UUWB 1YVSA 1DMQA 4FMDA 3NQYA 3TDGA 4N6NB 1SIIA 1KQS2 3KZTA 2F4YA 3LTBA 1RSNA 2RBIA 4HM0B 3FG1A 3LH4A 1GMPA 1MWSA 1KD14 1BVIA 3LYGA 3KSPA 2W0QA 4N3VA 5AIGA 1BSDA 3OWYA 3DXOA 4KZ1A 3AHSA 3QK9A 4HKVB 4I4KA 1A2KA 2E2VA 3G8ZA 3OV4A 1RHLA 3SLUA 2CIUA 4EV2A 5IW9A 1LOWA 2H0GA 2P38A 5STDA 2KRTA 4WYKA 5IERA 1YJN3 3LTCA 3LTAA 1WNHA 1OHSA 1UCIA 5BXQA 1FGOA 3MG3A 2UGIA 3HIGA 3AGOA 1GOUA 3HX8A 1ZS7A 4J8TA 1M1XB 5IG4A 3IMAB 3O8YA 4X2OA 2RSXA 3RNTA 3LZAA 2YFJB 1IQ8A 3D4AA 4HVNA 3OWUA 4R80A 1N8R4 4K90B 3GZBA 1IVVA 3CC23 3GZRA 1B2UA 1YHQ3 1W02A 4IPBA 1BRKA 2CK3H 1W7CA 3B4OA 2R41A 3LMLA 2RFRA 2MC8A 1BRHA 1A2PA 4EW5A 3EHCA 1UGHI 3CC43 1RNTA 3KIIA 3NQZA 1FUTA 1NU3A 2CFGA 3L0RA 5CF1A 3G6E3 2KF4A 1W5ZA 1D6YA 3DGNA 2CH9A 3H3HA 1JNQA 4JRFA 2YFIB 1IVXA 2F98A 2QEX3 8CHOA 2GXFA 1B2ZA 1R4CA 1VQM3 3BNCA 1K734 4HM2B 1JZDA 1TP6A 5M1AA 1RGEA 2B1XB 3NM7A 3VGNA 1WTHA 2J8XB 1MOLA 4KT3B 3U97A 1M1K4 2OQEA 1NO3A 1D6ZA 5AYSC 1S5AA 3S27A 2WGOA 2PZVA 1RGLA 4O02B 3ER7A 3DM8A 3V98A 2QA43 3V99A 1GSPA 1LVNA 1TFOA 3GSPA 3PGBA 1BSBA 2C10A 1IK3A 3G713 1MNLA 2L1SA 3FSDA 3CCM3 1M9GA 1MWTA 4LYLB 3CME3 3GZYB 4FCMA 3T8UA 1T2IA 2RNTA 3DGYA 1QALA 2BHMA 1IQYA 1OHOA 5AIFA 1C7HA 3B7CA 3WR2A 1JZOA 1AY7A 1W00A 1N5HA 3LOYA 3QRDA 1BSAA 2W56B 5TGNA 3UNLA 3X41A 2PNCA 1K8A4 1RLSA 1RGCA 3EF8A 4O3VA 2OQEC 4RNZA 4LZIA 3MHEA 3JUOA 2LYXA 1DE3A 1KSIA 3AGNA 2E2TA 5IEPA 1ZGXA 2QIYA 4ZM8A 4K1UA 2W9QA 4XBYA 3CCJ3 2YFLB 5I97A 4Q53A 1RCKA 2WGQA 4IIAA 1UUVB 1VQQA 3Q3FA 3WA2X 1X1YA 2JDIH 4X2HA 3STDA 3MPHA 1VQL3 1DVCA 2YX9A 3EQQB 5HGRA 1A67A 1VQP3 3SOYA 2HMJB 1JBRA 1AQZA 3EE1A 5IG5A 1NNVA 1LOVA 2W03A 3WODG 3CNMA 2WOFA 1GMQA 3F7SA 4R9LA 3RGRA 1GYBA 1BSCA 1AVKA 1T5YA 4CCVA 5KP1A 1ULIB 3SXXA 5M18A 2Q07A 2CFWA 2Z76A 1Q7Y4 2IY2A 1OGZA 2CG0A 2H0IA 1W2ZA 2HMLB 2AAEA 2XEPA 2F99A 3CCV3 1YIT3 2CFKA 4L7KA 1YJW3 3HIIA 1JV2B 1RCLA 3KSED 2HOHA 4STDA 1K9M4 1A2VA 1O7MB 4CDLA 3D3LA 1LQGC 1GY6A 1B2SA 3BNBA 3EJVA 3G16A 4CPKA 2UUGC 1FGMA 1CYVA 1ROVA 1CYUA 1FA3A 1GMRA 2W2CA 1LRAA 1QVF2 2XSOB 3URPA 1DYUA 3ALAA 1Q9EA 2W56A 1X1WA 1GOVA 1OCVA 4MMZB 1JB2A 1TTOA 2OWPA 3Q2PA 5DREA 4EC6A 5BVBA 1IV7A 5KP4A 1I8VA 1I3FA 1OH0A 3GWRA 2GEYA 2IYJA 2I9WA 4H61A 1D6UA 4HM8B 4CJNA 3ZFZA 1HKXA 4BTWA 1B3SA 5JPPA 1Y4KA 4HM3B 5D81A 3D9RA 2F56A 2IMJA 1UUGB 2K3DA 2XR8B 3FG3A 1I2EA 2IUKA 3NV0B 4J5GA 1BU4A 2Z6BA 2XRXB 2XGNA 2C11A 4RBNA 1VQ43 1RGHA 1BNSA 3EBYA 1ULJB 3MSOA 6RNTA 7STDA 1S723 1VQK3 4OK0A 1RTUA 2GU3A 3Q90A 4HAAA 5G1LA 5IG0A 4HJLB 3CMA3 1J2BA 1AVLA 4BL2A 1PY3A 3EN8A 3RGAA 1K41A 4MEIA 1TU5A 3JUNA 1TRQA 2ML6A 1EEJA 4L8OA 5DRVA 3FF2A 1SPUA 3LTDA 1I0XA 1I3IA 5EEOA 1BSEA 1RGAA 1VQ93 3NBRA 1B20A 2GBXB 2Z77A 1EA2A 3MG2A 4K1VA 4MJDA 4PEJA 4QWTA 4GSPA 1QJGA 3G0KA 4HM7B 4XB5A 1Q814 1NJI4 4KFFA 1RNBA 3MYTA 3NUVA 2O3OA 3Q1CA 4G1MB 4WHAA 1T2HA 2F86B 5CK6A 2RCDA 4HBRA 3PZWA 1E3RA 1R4YA 1HU9A 3UB1A 3SX1A 1HYFA 1UCLA 4WFOA 1OACA 2QGUA 3NXJA 4KFEA 5FW5A 1I0VA 2ZHXB 4FMBA 3DH2A 6GSPA 4HM6B 4WP5A 4BTYA 1GD4A 1W6GA 1LOYA 1O7NB 1WMOA 4KFDA 2P05A 3FKAA 4LEHA 3K0ZA 3CCL3 3AMOB 6STDA 1IYYA 5LC7A 2CFLA 3KCHA 3DGMA 2FNQA 1BRGA 4R1KA 5CXOA 3SVAA 1NWWA 1UI7A 4HM5B 1YJ93 1FUSA 3FH1A 1JBTA 2ZL8A 4FCJA 3WOFB 3CNXA 1RGGA 3CPOA 3N9HA 3JUMA 1BRIA 3KN4A 4N6UA 1FUWA 1PFPA 3F14A 4BL3A 2CW9A 2GU1A 2XFSA 3PXMA 4FMCA 1RGKA 1STDA 2OOVA 4TX4A 1B2MA 1BNIA 4EXRA 3MKIA 3B8LA 3NV0A 2XF3A 4MMYB 2BT3A 1DMMA 1N9JA 1STFI 3SYUA 2D1WA 2OCTA 2CKFB 3LT8A 1O7HB 2BMQB 4RNYA 4AEQA 4N6LA 3OW22 1E3VA 3B4PA 4N6OB 5HOHA 4ILFA 1GY7A 5RNTA 1G02A 1YGWA 1GY5A 1BIRA 2INXA 5EVHA 1O7GB 3NBJA 1UW1A 3GRDA 4RNTA 1RKYA 1W6CA 2OOVC 3S29A 2ZA4A 1OF5B 1VQO3
chains in the Genus database with same CATH topology
3URPA 1BNEA 1BANA 1B2UA 1LNIA 1B21A 2KAAA 1BGSA 1BRKA 1FYSA 1X1UA 3HOHA 1Q9EA 1MGRA 2KF3A 1RMSA 1BRHA 1GOVA 1A2PA 1X1WA 1FW7A 1TTOA 1I8VA 1BRJA 1I3FA 3WHOA 1RNTA 1GOYA 1X1XA 1FUTA 3D5IA 1B3SA 2KF4A 1RDSA 1UCKA 2F56A 4J5GA 1I2EA 1BU4A 1PYLA 1B2ZA 2SARA 1RGHA 1BNSA 5BU4A 5BIRA 6RNTA 3A5EA 1BAOA 1RGEA 4HOHA 1RTUA 1I2FA 2AADA 4HAAA 1I2GA 1MGWA 2F5WA 5GSPA 1RGFA 9RNTA 1PY3A 1RGLA 1BNJA 3AHWA 2F5MA 1GSPA 1TRQA 3GSPA 1BSBA 1I0XA 1I3IA 1BSEA 1RGAA 1B20A 3D5GA 1C54A 1RN1A 1T2IA 2RNTA 2KF6A 4GSPA 3DGYA 1BUJA 1RNBA 2BIRA 3WR2A 1I70A 1AY7A 1SARA 1TRPA 2GSPA 1BSAA 1T2HA 4BIRA 1BOXA 1R4YA 1HYFA 1DETA 1RLSA 1RGCA 1UCLA 1FZUA 1DE3A 1I0VA 4J5KA 3AGNA 3DH2A 6GSPA 1ZGXA 8RNTA 1LOYA 1BNRA 1YNVX 7GSPA 4BU4A 1B2XA 1RCKA 1BRNL 1IYYA 3Q3FA 3BU4A 3KCHA 1X1YA 1BRGA 1B27A 1JBSA 1FUSA 1JBTA 1RGGA 1BRIA 1JBRA 1AQZA 3BIRA 2KF5A 1CH0A 1LOVA 1RGKA 1RN4A 1YVSA 1B2MA 1BNIA 4GHOA 1GMQA 1UCJA 2F4YA 1BSCA 1RSNA 2RBIA 1GMPA 1BVIA 3SYUA 7RNTA 2BU4A 1BSDA 3AHSA 2C4BA 2AAEA 1RHLA 5HOHA 1LOWA 1BRSA 5RNTA 1HZ1A 1G02A 1RCLA 1YGWA 1BIRA 2HOHA 1UCIA 1BNFA 3AGOA 1GOUA 4RNTA 1BNGA 3RNTA 1B2SA 3D4AA 1GMRA 2ZA4A 1LRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3URP A;  1BNE A;  1BAN A;  1B2U A;  1LNI A;  1B21 A;  2KAA A;  1BGS A;  1BRK A;  1FYS A;  1X1U A;  3HOH A;  1Q9E A;  1MGR A;  2KF3 A;  1RMS A;  1BRH A;  1GOV A;  1A2P A;  1X1W A;  1FW7 A;  1TTO A;  1I8V A;  1BRJ A;  1I3F A;  3WHO A;  1RNT A;  1GOY A;  1X1X A;  1FUT A;  3D5I A;  1B3S A;  2KF4 A;  1RDS A;  1UCK A;  2F56 A;  4J5G A;  1I2E A;  1BU4 A;  1PYL A;  1B2Z A;  2SAR A;  1RGH A;  1BNS A;  5BU4 A;  5BIR A;  6RNT A;  3A5E A;  1BAO A;  1RGE A;  4HOH A;  1RTU A;  1I2F A;  2AAD A;  4HAA A;  1I2G A;  1MGW A;  2F5W A;  5GSP A;  1RGF A;  9RNT A;  1PY3 A;  1RGL A;  1BNJ A;  3AHW A;  2F5M A;  1GSP A;  1TRQ A;  3GSP A;  1BSB A;  1I0X A;  1I3I A;  1BSE A;  1RGA A;  1B20 A;  3D5G A;  1C54 A;  1RN1 A;  1T2I A;  2RNT A;  2KF6 A;  4GSP A;  3DGY A;  1BUJ A;  1RNB A;  2BIR A;  3WR2 A;  1I70 A;  1AY7 A;  1SAR A;  1TRP A;  2GSP A;  1BSA A;  1T2H A;  4BIR A;  1BOX A;  1R4Y A;  1HYF A;  1DET A;  1RLS A;  1RGC A;  1UCL A;  1FZU A;  1DE3 A;  1I0V A;  4J5K A;  3AGN A;  3DH2 A;  6GSP A;  1ZGX A;  8RNT A;  1LOY A;  1BNR A;  1YNV X;  7GSP A;  4BU4 A;  1B2X A;  1RCK A;  1BRN L;  1IYY A;  3Q3F A;  3BU4 A;  3KCH A;  1X1Y A;  1BRG A;  1B27 A;  1JBS A;  1FUS A;  1JBT A;  1RGG A;  1BRI A;  1JBR A;  1AQZ A;  3BIR A;  2KF5 A;  1CH0 A;  1LOV A;  1RGK A;  1RN4 A;  1YVS A;  1B2M A;  1BNI A;  4GHO A;  1GMQ A;  1UCJ A;  2F4Y A;  1BSC A;  1RSN A;  2RBI A;  1GMP A;  1BVI A;  3SYU A;  7RNT A;  2BU4 A;  1BSD A;  3AHS A;  2C4B A;  2AAE A;  1RHL A;  5HOH A;  1LOW A;  1BRS A;  5RNT A;  1HZ1 A;  1G02 A;  1RCL A;  1YGW A;  1BIR A;  2HOH A;  1UCI A;  1BNF A;  3AGO A;  1GOU A;  4RNT A;  1BNG A;  3RNT A;  1B2S A;  3D4A A;  1GMR A;  2ZA4 A;  1LRA A; 
#chains in the Genus database with same CATH topology
 3S5C A;  1BAN A;  4L8P A;  1LNI A;  4R4K A;  1WMP A;  3NX0 A;  5ELJ A;  4EYC A;  1BGS A;  1SIH A;  2GEX A;  3HOH A;  2XGL A;  3WOE B;  1MGR A;  1UDI I;  1LXE A;  1LOX A;  2KF3 A;  2O9U X;  3CU3 A;  1JJ2 2;  1OPY A;  2RGQ A;  1Z1S A;  1U8C B;  3DGL A;  3FZW A;  4HM1 B;  2M7O A;  2CC3 A;  3UL6 A;  3X42 A;  4EV5 A;  3I56 3;  1V57 A;  3FGY A;  2W6J H;  1GOY A;  4OVM A;  3X40 A;  1RRL A;  4MMX B;  1N8Q A;  3D5I A;  1TUH A;  4N6M A;  4AKZ A;  4HM4 B;  1GD3 A;  1UCK A;  4J9A A;  2CX1 A;  2KXG A;  1FGR A;  1PYL A;  3DUK A;  1SJW A;  3AMO A;  3EB8 A;  5AIH A;  4IT7 A;  1JN5 B;  2SAR A;  3VSY A;  5D83 A;  1FGT A;  3WA3 A;  5BIR A;  2FGT A;  3A5E A;  2E2U A;  3JVC A;  1LQM B;  1W2B 2;  2AAD A;  5IEO A;  1I2G A;  3F8X A;  4LSO A;  1YI2 3;  1Q86 4;  1RGF A;  3BNE A;  3CCR 3;  3E99 A;  2LQV A;  2BMR B;  4LMI A;  2IUJ A;  1BNJ A;  3DY5 A;  4XDW A;  3I0Y A;  3VF1 A;  1DMN A;  1L5G B;  3AHW A;  2F5M A;  2P09 A;  2WOH A;  3DGO A;  1VZZ A;  1G96 A;  2CX0 A;  3V92 A;  2CFD A;  2BMO B;  4XM4 A;  4ORL A;  1VQN 3;  3S67 A;  1FW7 A;  1Q7H A;  3EBT A;  3ZG0 A;  2W9P A;  4XBT A;  1YVB I;  3ZG5 A;  1TJD A;  5JBS A;  1RN1 A;  5IG3 A;  2KF6 A;  1CQS A;  2CHC A;  3K63 A;  3PCS A;  5AEW B;  1Q82 4;  1F8N A;  1QVG 2;  2XSH B;  2BO9 B;  3HK4 A;  1Q40 B;  3HI7 A;  1SAR A;  3SOA A;  1IDP A;  4HYZ A;  4N6V 0;  5LC6 A;  4BIR A;  1BOX A;  4AKY A;  1W6Y A;  3X3Z A;  2CWU A;  1OUN A;  2UX0 A;  1MWU A;  2V1L A;  1DET A;  3F40 A;  1BUQ A;  2OTJ 3;  4H3U A;  1FZU A;  5G1K A;  1VQ7 3;  2STD A;  3EN1 B;  4XBX A;  1T3B A;  3K5T A;  1JB5 A;  1E97 A;  3M8C A;  3KFQ C;  1WQL B;  1OF5 A;  3BB9 A;  8RNT A;  3G4S 3;  4HZB B;  4K61 A;  3N54 B;  3PYJ A;  2SBL A;  4GB5 A;  5EQL A;  3DZL A;  3ROB A;  5IEN A;  3KE7 A;  4NPB A;  4BU4 A;  3OX9 A;  1IQX A;  1B2X A;  2XFT A;  7GSP A;  1BRN L;  1DVD A;  3BU4 A;  2Z7A A;  3SED A;  2HMK B;  3CPW 2;  1JBS A;  1O7W B;  4NHF A;  1QAF A;  3PS8 A;  1V58 A;  2D42 A;  1NDO B;  1ROA A;  4I5Q A;  2Y74 A;  3NHX A;  4KVH A;  4BTX A;  1CH0 A;  3FG4 A;  3F9S A;  1RN4 A;  1IV9 A;  1ASK A;  2HMM B;  1Q42 A;  4N6T A;  3JUP A;  1JKG B;  4FR9 A;  1UCJ A;  4GHO A;  4WWU C;  3UL5 A;  1G0T A;  1IVW A;  4JF8 A;  3CCS 3;  3DMC A;  1JRQ A;  2ML5 A;  3K7C A;  5AII A;  4EBG A;  7RNT A;  1JN5 A;  2BU4 A;  3A76 A;  5CLK A;  1UGI A;  1WMN A;  2C4B A;  1N5P A;  2BNG A;  3EC9 A;  3FCS B;  4XDV A;  2CWT A;  2MF7 A;  1VQ6 3;  4O2H A;  1BRS A;  3H51 A;  4RZM A;  1V74 A;  1VQ8 3;  1HZ1 A;  1IVU A;  1GS3 A;  3KKG A;  4U13 A;  1EUI C;  1BNF A;  3WDG B;  2W04 A;  3BLZ A;  2B24 B;  2R4I A;  5AI1 A;  1BNG A;  3CCU 3;  3HZP A;  1QMA A;  1RN7 A;  5G2G A;  4FMA A;  2BIR A;  1O7P B;  1NB3 I;  2GSP A;  2WO0 A;  1TIJ A;  2JQ5 A;  2Y73 A;  3F7X A;  1BNE A;  5ELU A;  3T0U A;  1B21 A;  2KAA A;  3EX9 A;  2CG1 A;  1FYS A;  1LNH A;  1Q40 A;  1X1U A;  5D82 A;  3WMD A;  1N9E A;  3GAX A;  1A90 A;  1RMS A;  2FXT A;  1OGX A;  5AYR B;  1FGQ A;  1NB5 I;  1UI8 A;  1W4N A;  2P0X A;  2XH9 A;  3OXA A;  1BRJ A;  3N8B A;  3WHO A;  3CD6 3;  1X1X A;  4O8S A;  3OWS A;  3S28 A;  1JB4 A;  3X3X A;  1IT7 A;  1RDS A;  3MG1 A;  5JPU A;  1ZX2 A;  2L4V A;  2K54 A;  3UJM A;  3LT9 A;  3J7Y d;  2HMO B;  5BU4 A;  1U5O A;  1YGE A;  1VQ5 3;  4NRE A;  1BAO A;  3RDE A;  4HOH A;  5A0O B;  1CEW I;  1I2F A;  1MGW A;  2F5W A;  1ZO2 A;  5GSP A;  1K28 A;  4WYK B;  9RNT A;  3CXC 2;  1KWI A;  1IT8 A;  1RJO A;  2CWV A;  3FLJ A;  1MWR A;  1JKG A;  3PCR A;  1PU4 A;  5CF2 A;  5FGO A;  1RRH A;  1QAK A;  1KC8 4;  3NM2 A;  4FCZ A;  2IA7 A;  2ZDJ A;  3K9M C;  3D5G A;  1C54 A;  1EQK A;  1IU7 A;  5IF6 A;  5AEU B;  1BUJ A;  3LXU X;  3JUQ A;  1OHP A;  2OTL 3;  3IJE B;  1I70 A;  4R9K A;  4LGQ A;  1TRP A;  1TFK A;  3BND A;  2GBW B;  3U1W A;  2KCD A;  3NBB A;  1AR0 A;  4GL6 A;  1M90 4;  2HMN B;  1W01 A;  2A15 A;  4DKI A;  4J5K A;  1SQW A;  3GZX B;  2K0M A;  5M19 A;  2H0H A;  3CCE 3;  1YIJ 3;  1ISK A;  3CCQ 3;  3IPT A;  1EKM A;  1BNR A;  1US1 A;  1YNV X;  3ECF A;  5KP3 A;  3CC7 3;  3I55 3;  4HZ9 B;  3MWZ A;  3F8H A;  1B27 A;  4OUQ A;  1EG9 B;  3BIR A;  3X3Y A;  2KF5 A;  1AV4 A;  3D79 A;  3FF0 A;  3T8N A;  2P0M A;  1UUW B;  1YVS A;  1DMQ A;  4FMD A;  3NQY A;  3TDG A;  4N6N B;  1SII A;  1KQS 2;  3KZT A;  2F4Y A;  3LTB A;  1RSN A;  2RBI A;  4HM0 B;  3FG1 A;  3LH4 A;  1GMP A;  1MWS A;  1KD1 4;  1BVI A;  3LYG A;  3KSP A;  2W0Q A;  4N3V A;  5AIG A;  1BSD A;  3OWY A;  3DXO A;  4KZ1 A;  3AHS A;  3QK9 A;  4HKV B;  4I4K A;  1A2K A;  2E2V A;  3G8Z A;  3OV4 A;  1RHL A;  3SLU A;  2CIU A;  4EV2 A;  5IW9 A;  1LOW A;  2H0G A;  2P38 A;  5STD A;  2KRT A;  4WYK A;  5IER A;  1YJN 3;  3LTC A;  3LTA A;  1WNH A;  1OHS A;  1UCI A;  5BXQ A;  1FGO A;  3MG3 A;  2UGI A;  3HIG A;  3AGO A;  1GOU A;  3HX8 A;  1ZS7 A;  4J8T A;  1M1X B;  5IG4 A;  3IMA B;  3O8Y A;  4X2O A;  2RSX A;  3RNT A;  3LZA A;  2YFJ B;  1IQ8 A;  3D4A A;  4HVN A;  3OWU A;  4R80 A;  1N8R 4;  4K90 B;  3GZB A;  1IVV A;  3CC2 3;  3GZR A;  1B2U A;  1YHQ 3;  1W02 A;  4IPB A;  1BRK A;  2CK3 H;  1W7C A;  3B4O A;  2R41 A;  3LML A;  2RFR A;  2MC8 A;  1BRH A;  1A2P A;  4EW5 A;  3EHC A;  1UGH I;  3CC4 3;  1RNT A;  3KII A;  3NQZ A;  1FUT A;  1NU3 A;  2CFG A;  3L0R A;  5CF1 A;  3G6E 3;  2KF4 A;  1W5Z A;  1D6Y A;  3DGN A;  2CH9 A;  3H3H A;  1JNQ A;  4JRF A;  2YFI B;  1IVX A;  2F98 A;  2QEX 3;  8CHO A;  2GXF A;  1B2Z A;  1R4C A;  1VQM 3;  3BNC A;  1K73 4;  4HM2 B;  1JZD A;  1TP6 A;  5M1A A;  1RGE A;  2B1X B;  3NM7 A;  3VGN A;  1WTH A;  2J8X B;  1MOL A;  4KT3 B;  3U97 A;  1M1K 4;  2OQE A;  1NO3 A;  1D6Z A;  5AYS C;  1S5A A;  3S27 A;  2WGO A;  2PZV A;  1RGL A;  4O02 B;  3ER7 A;  3DM8 A;  3V98 A;  2QA4 3;  3V99 A;  1GSP A;  1LVN A;  1TFO A;  3GSP A;  3PGB A;  1BSB A;  2C10 A;  1IK3 A;  3G71 3;  1MNL A;  2L1S A;  3FSD A;  3CCM 3;  1M9G A;  1MWT A;  4LYL B;  3CME 3;  3GZY B;  4FCM A;  3T8U A;  1T2I A;  2RNT A;  3DGY A;  1QAL A;  2BHM A;  1IQY A;  1OHO A;  5AIF A;  1C7H A;  3B7C A;  3WR2 A;  1JZO A;  1AY7 A;  1W00 A;  1N5H A;  3LOY A;  3QRD A;  1BSA A;  2W56 B;  5TGN A;  3UNL A;  3X41 A;  2PNC A;  1K8A 4;  1RLS A;  1RGC A;  3EF8 A;  4O3V A;  2OQE C;  4RNZ A;  4LZI A;  3MHE A;  3JUO A;  2LYX A;  1DE3 A;  1KSI A;  3AGN A;  2E2T A;  5IEP A;  1ZGX A;  2QIY A;  4ZM8 A;  4K1U A;  2W9Q A;  4XBY A;  3CCJ 3;  2YFL B;  5I97 A;  4Q53 A;  1RCK A;  2WGQ A;  4IIA A;  1UUV B;  1VQQ A;  3Q3F A;  3WA2 X;  1X1Y A;  2JDI H;  4X2H A;  3STD A;  3MPH A;  1VQL 3;  1DVC A;  2YX9 A;  3EQQ B;  5HGR A;  1A67 A;  1VQP 3;  3SOY A;  2HMJ B;  1JBR A;  1AQZ A;  3EE1 A;  5IG5 A;  1NNV A;  1LOV A;  2W03 A;  3WOD G;  3CNM A;  2WOF A;  1GMQ A;  3F7S A;  4R9L A;  3RGR A;  1GYB A;  1BSC A;  1AVK A;  1T5Y A;  4CCV A;  5KP1 A;  1ULI B;  3SXX A;  5M18 A;  2Q07 A;  2CFW A;  2Z76 A;  1Q7Y 4;  2IY2 A;  1OGZ A;  2CG0 A;  2H0I A;  1W2Z A;  2HML B;  2AAE A;  2XEP A;  2F99 A;  3CCV 3;  1YIT 3;  2CFK A;  4L7K A;  1YJW 3;  3HII A;  1JV2 B;  1RCL A;  3KSE D;  2HOH A;  4STD A;  1K9M 4;  1A2V A;  1O7M B;  4CDL A;  3D3L A;  1LQG C;  1GY6 A;  1B2S A;  3BNB A;  3EJV A;  3G16 A;  4CPK A;  2UUG C;  1FGM A;  1CYV A;  1ROV A;  1CYU A;  1FA3 A;  1GMR A;  2W2C A;  1LRA A;  1QVF 2;  2XSO B;  3URP A;  1DYU A;  3ALA A;  1Q9E A;  2W56 A;  1X1W A;  1GOV A;  1OCV A;  4MMZ B;  1JB2 A;  1TTO A;  2OWP A;  3Q2P A;  5DRE A;  4EC6 A;  5BVB A;  1IV7 A;  5KP4 A;  1I8V A;  1I3F A;  1OH0 A;  3GWR A;  2GEY A;  2IYJ A;  2I9W A;  4H61 A;  1D6U A;  4HM8 B;  4CJN A;  3ZFZ A;  1HKX A;  4BTW A;  1B3S A;  5JPP A;  1Y4K A;  4HM3 B;  5D81 A;  3D9R A;  2F56 A;  2IMJ A;  1UUG B;  2K3D A;  2XR8 B;  3FG3 A;  1I2E A;  2IUK A;  3NV0 B;  4J5G A;  1BU4 A;  2Z6B A;  2XRX B;  2XGN A;  2C11 A;  4RBN A;  1VQ4 3;  1RGH A;  1BNS A;  3EBY A;  1ULJ B;  3MSO A;  6RNT A;  7STD A;  1S72 3;  1VQK 3;  4OK0 A;  1RTU A;  2GU3 A;  3Q90 A;  4HAA A;  5G1L A;  5IG0 A;  4HJL B;  3CMA 3;  1J2B A;  1AVL A;  4BL2 A;  1PY3 A;  3EN8 A;  3RGA A;  1K41 A;  4MEI A;  1TU5 A;  3JUN A;  1TRQ A;  2ML6 A;  1EEJ A;  4L8O A;  5DRV A;  3FF2 A;  1SPU A;  3LTD A;  1I0X A;  1I3I A;  5EEO A;  1BSE A;  1RGA A;  1VQ9 3;  3NBR A;  1B20 A;  2GBX B;  2Z77 A;  1EA2 A;  3MG2 A;  4K1V A;  4MJD A;  4PEJ A;  4QWT A;  4GSP A;  1QJG A;  3G0K A;  4HM7 B;  4XB5 A;  1Q81 4;  1NJI 4;  4KFF A;  1RNB A;  3MYT A;  3NUV A;  2O3O A;  3Q1C A;  4G1M B;  4WHA A;  1T2H A;  2F86 B;  5CK6 A;  2RCD A;  4HBR A;  3PZW A;  1E3R A;  1R4Y A;  1HU9 A;  3UB1 A;  3SX1 A;  1HYF A;  1UCL A;  4WFO A;  1OAC A;  2QGU A;  3NXJ A;  4KFE A;  5FW5 A;  1I0V A;  2ZHX B;  4FMB A;  3DH2 A;  6GSP A;  4HM6 B;  4WP5 A;  4BTY A;  1GD4 A;  1W6G A;  1LOY A;  1O7N B;  1WMO A;  4KFD A;  2P05 A;  3FKA A;  4LEH A;  3K0Z A;  3CCL 3;  3AMO B;  6STD A;  1IYY A;  5LC7 A;  2CFL A;  3KCH A;  3DGM A;  2FNQ A;  1BRG A;  4R1K A;  5CXO A;  3SVA A;  1NWW A;  1UI7 A;  4HM5 B;  1YJ9 3;  1FUS A;  3FH1 A;  1JBT A;  2ZL8 A;  4FCJ A;  3WOF B;  3CNX A;  1RGG A;  3CPO A;  3N9H A;  3JUM A;  1BRI A;  3KN4 A;  4N6U A;  1FUW A;  1PFP A;  3F14 A;  4BL3 A;  2CW9 A;  2GU1 A;  2XFS A;  3PXM A;  4FMC A;  1RGK A;  1STD A;  2OOV A;  4TX4 A;  1B2M A;  1BNI A;  4EXR A;  3MKI A;  3B8L A;  3NV0 A;  2XF3 A;  4MMY B;  2BT3 A;  1DMM A;  1N9J A;  1STF I;  3SYU A;  2D1W A;  2OCT A;  2CKF B;  3LT8 A;  1O7H B;  2BMQ B;  4RNY A;  4AEQ A;  4N6L A;  3OW2 2;  1E3V A;  3B4P A;  4N6O B;  5HOH A;  4ILF A;  1GY7 A;  5RNT A;  1G02 A;  1YGW A;  1GY5 A;  1BIR A;  2INX A;  5EVH A;  1O7G B;  3NBJ A;  1UW1 A;  3GRD A;  4RNT A;  1RKY A;  1W6C A;  2OOV C;  3S29 A;  2ZA4 A;  1OF5 B;  1VQO 3; 
#chains in the Genus database with same CATH homology
 3URP A;  1BNE A;  1BAN A;  1B2U A;  1LNI A;  1B21 A;  2KAA A;  1BGS A;  1BRK A;  1FYS A;  1X1U A;  3HOH A;  1Q9E A;  1MGR A;  2KF3 A;  1RMS A;  1BRH A;  1GOV A;  1A2P A;  1X1W A;  1FW7 A;  1TTO A;  1I8V A;  1BRJ A;  1I3F A;  3WHO A;  1RNT A;  1GOY A;  1X1X A;  1FUT A;  3D5I A;  1B3S A;  2KF4 A;  1RDS A;  1UCK A;  2F56 A;  4J5G A;  1I2E A;  1BU4 A;  1PYL A;  1B2Z A;  2SAR A;  1RGH A;  1BNS A;  5BU4 A;  5BIR A;  6RNT A;  3A5E A;  1BAO A;  1RGE A;  4HOH A;  1RTU A;  1I2F A;  2AAD A;  4HAA A;  1I2G A;  1MGW A;  2F5W A;  5GSP A;  1RGF A;  9RNT A;  1PY3 A;  1RGL A;  1BNJ A;  3AHW A;  2F5M A;  1GSP A;  1TRQ A;  3GSP A;  1BSB A;  1I0X A;  1I3I A;  1BSE A;  1RGA A;  1B20 A;  3D5G A;  1C54 A;  1RN1 A;  1T2I A;  2RNT A;  2KF6 A;  4GSP A;  3DGY A;  1BUJ A;  1RNB A;  2BIR A;  3WR2 A;  1I70 A;  1AY7 A;  1SAR A;  1TRP A;  2GSP A;  1BSA A;  1T2H A;  4BIR A;  1BOX A;  1R4Y A;  1HYF A;  1DET A;  1RLS A;  1RGC A;  1UCL A;  1FZU A;  1DE3 A;  1I0V A;  4J5K A;  3AGN A;  3DH2 A;  6GSP A;  1ZGX A;  8RNT A;  1LOY A;  1BNR A;  1YNV X;  7GSP A;  4BU4 A;  1B2X A;  1RCK A;  1BRN L;  1IYY A;  3Q3F A;  3BU4 A;  3KCH A;  1X1Y A;  1BRG A;  1B27 A;  1JBS A;  1FUS A;  1JBT A;  1RGG A;  1BRI A;  1JBR A;  1AQZ A;  3BIR A;  2KF5 A;  1CH0 A;  1LOV A;  1RGK A;  1RN4 A;  1YVS A;  1B2M A;  1BNI A;  4GHO A;  1GMQ A;  1UCJ A;  2F4Y A;  1BSC A;  1RSN A;  2RBI A;  1GMP A;  1BVI A;  3SYU A;  7RNT A;  2BU4 A;  1BSD A;  3AHS A;  2C4B A;  2AAE A;  1RHL A;  5HOH A;  1LOW A;  1BRS A;  5RNT A;  1HZ1 A;  1G02 A;  1RCL A;  1YGW A;  1BIR A;  2HOH A;  1UCI A;  1BNF A;  3AGO A;  1GOU A;  4RNT A;  1BNG A;  3RNT A;  1B2S A;  3D4A A;  1GMR A;  2ZA4 A;  1LRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...