1RNBA

Crystal structure of a barnase-d(*gp*c) complex at 1.9 angstroms resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
QVINTFDGVADYLQTYHKLPNDYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a barnase-d(GpC) complex at 1.9 A resolution.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords DNA (5'-D(*GP*C)-3')
total genus 28
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 1991-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rnbA00
1TTOA 1CH0A 1GOVA 1I3FA 2C4BA 1BSDA 1BSBA 1BRHA 1I8VA 1LOVA 1SARA 1BSEA 1YNVX 1T2IA 1UCIA 2ZA4A 1RGHA 1PYLA 1B3SA 3DH2A 3HOHA 3DGYA 1Q9EA 1X1UA 5HOHA 1UCLA 1T2HA 2KF4A 1RTUA 5RNTA 2F4YA 1GOUA 1GMQA 1RGAA 1RDSA 2AADA 1BVIA 1BGSA 2KF6A 4J5GA 2RBIA 1BNEA 2F5MA 1AQZA 1FW7A 1B2XA 3D5GA 7RNTA 1JBTA 2F56A 8RNTA 1BNGA 1X1WA 1RGFA 2BU4A 1DETA 1X1XA 5BIRA 1RGGA 1HYFA 1RLSA 4J5KA 4GSPA 1A2PA 1GMRA 2F5WA 1JBSA 1BOXA 6GSPA 1FUTA 3RNTA 1BRNL 1LOWA 1ZGXA 1LNIA 1FZUA 1FUSA 1RN4A 2KAAA 5GSPA 3KCHA 1G02A 1BANA 1TRQA 1BIRA 3D5IA 3Q3FA 1IYYA 1BNSA 1B20A 4GHOA 3URPA 2HOHA 3AGNA 7GSPA 1I2FA 2KF5A 1PY3A 1BAOA 1BSAA 9RNTA 1RHLA 1RGKA 1BNJA 1BNRA 1FYSA 1RMSA 1BRIA 2GSPA 1BRGA 1LRAA 3BU4A 1I3IA 1I0VA 2AAEA 3D4AA 1C54A 1BSCA 1MGWA 1RCKA 4BIRA 1I2GA 1B21A 1BRJA 1YVSA 1BU4A 4HOHA 3AHSA 1RNBA 1I0XA 1LOYA 1B2UA 6RNTA 1DE3A 1GMPA 1BRSA 1RNTA 4BU4A 1RCLA 1R4YA 1RGCA 1GOYA 1I2EA 1B2ZA 1TRPA 1MGRA 2SARA 4HAAA 1I70A 1AY7A 3AGOA 5BU4A 1RN1A 4RNTA 3A5EA 1HZ1A 2KF3A 3GSPA 3WHOA 1RGEA 1BNIA 2RNTA 1B2MA 1B2SA 1JBRA 1YGWA 2BIRA 1BNFA 1RSNA 1B27A 1UCJA 1BUJA 1RGLA 3BIRA 1GSPA 1BRKA 1UCKA 1X1YA 3SYUA 3WR2A 3AHWA
chains in the Genus database with same CATH superfamily
2ZDJA 1GOVA 3NM2A 3G0KA 1W00A 2K3DA 5KP3A 2BMQB 2QEX3 2RFRA 4KFEA 4AKZA 1LOVA 4JF8A 1AR0A 1UCIA 1YGEA 3LTDA 1OGZA 1N5HA 3LT9A 1WMPA 1T5YA 3PCSA 3HOHA 3F7XA 1Q9EA 1DMNA 2H0IA 4FMCA 4PEJA 2OCTA 5HOHA 3G4S3 1T2HA 1UW1A 2XH9A 2WGQA 4LEHA 1LOXA 4RBNA 2F4YA 1GMQA 3G6E3 1RGAA 3EN8A 1RDSA 2CFWA 1W5ZA 4N6MA 1Q864 3FGYA 1BVIA 3NX0A 1BGSA 4FR9A 2OTJ3 4KZ1A 2P38A 4WYKA 2GU3A 1JB4A 3NV0B 3OXAA 5EEOA 4RNYA 2ZHXB 1B2XA 3EB8A 5IENA 1KC84 1JBTA 4BTWA 2BMOB 3MPHA 4IPBA 1NB3I 2CW9A 1HKXA 1Q7HA 3N9HA 3UL5A 1X1WA 1RGFA 3U1WA 3I553 3PZWA 1DYUA 4CJNA 3LH4A 5BIRA 1YI23 2HMLB 1SPUA 1W2ZA 3OWUA 1CQSA 1RKYA 1JKGB 1WQLB 3CXC2 3SVAA 4XBXA 3EBYA 1BOXA 3S5CA 4R80A 3RNTA 4RNZA 1LOWA 1ZGXA 3OV4A 3MHEA 3G16A 1FGOA 4X2OA 3CCU3 1UGHI 4FMDA 2ML5A 3KCHA 4I4KA 3N54B 3SOYA 1VQQA 4CPKA 2GEXA 3EQQB 1BNSA 1ULJB 1Z1SA 1YJ93 1FGRA 2O3OA 3F8XA 3MG3A 4FCZA 3F8HA 1LNHA 2XSOB 2KF5A 3KZTA 2BNGA 1V74A 1BAOA 2XR8B 4MJDA 2BMRB 1Y4KA 4L8OA 9RNTA 1AV4A 2RGQA 1BNJA 5BXQA 2CHCA 1O7PB 1TJDA 4HZ9B 3BB9A 3CPW2 1N8R4 1STDA 2W56B 2CWVA 1I3IA 1ROAA 2AAEA 3BU4A 3DGOA 3KE7A 3LTBA 4RZMA 2CKFB 1KWIA 1D6YA 1MWUA 3F7SA 2GBXB 1Q814 4BIRA 1IDPA 1B21A 5IG0A 3DGMA 1GD3A 1BRJA 1SQWA 3FSDA 3GZRA 3VF1A 4N6LA 3S29A 3AHSA 2HMMB 3FF0A 2O9UX 3CPOA 3LMLA 3WMDA 1IQ8A 1Q824 1GMPA 3DY5A 1TP6A 4CDLA 1RNTA 1QALA 1JN5B 2V1LA 4LZIA 4JRFA 4R9LA 2MC8A 3X42A 2YFIB 3H51A 4XDVA 4J9AA 3BNDA 3EJVA 4ILFA 5G1KA 2W03A 4HAAA 1E3VA 4HBRA 4LMIA 3NQZA 3FF2A 5BU4A 1O7GB 4HVNA 3F40A 3KN4A 3LXUX 1FGQA 2HMJB 1MOLA 1VQN3 1QMAA 1RRLA 1HZ1A 1WNHA 3NBBA 5FW5A 2BO9B 2LQVA 1JBRA 1JJ22 1N9JA 4HM4B 3NHXA 1KQS2 4AEQA 4CCVA 1VQ73 1UCJA 3FCSB 3ZG5A 4MMXB 3JUMA 3S28A 4EXRA 3BIRA 1GSPA 2HMKB 1IT8A 1BRKA 1X1YA 3WR2A 1OACA 1VQ93 2PZVA 1IVUA 3LYGA 1BSDA 1ULIB 2GBWB 2QIYA 2YFLB 3IJEB 3NQYA 2PNCA 1K28A 1BSEA 1GY7A 1YNVX 4HM2B 2ZA4A 1RGHA 1EG9B 2CFKA 3MWZA 2IUJA 1K734 5IW9A 3X40A 1NO3A 3CCV3 1IVVA 3LTCA 1UCLA 4HKVB 1PU4A 1NU3A 2KF4A 1RTUA 3HIIA 4K1VA 1GOUA 2UX0A 1UUVB 1YHQ3 5AEUB 1UDII 1LQGC 4J5GA 4XB5A 1RRHA 2RBIA 1S723 3LT8A 3UB1A 2E2UA 1AQZA 4X2HA 1A67A 4HM5B 2IYJA 3D5GA 3VSYA 5CF1A 1IVWA 2F56A 2OQEA 2HMOB 3CMA3 2W9QA 4R1KA 1FA3A 3OW22 1IVXA 1BNGA 5AI1A 1UUWB 4NREA 4WHAA 4BL3A 1RLSA 4J5KA 3B4PA 3JUOA 4GSPA 1EUIC 1A2PA 1OHSA 1EEJA 3UJMA 1GMRA 1FUTA 3LTAA 4LGQA 1VQ53 1BRNL 4XBYA 3FKAA 4L8PA 3BNBA 4XDWA 2CX0A 1FUSA 2B1XB 3EHCA 4I5QA 1MWRA 3S67A 4STDA 5GSPA 1G02A 1IYYA 2QGUA 1LXEA 1O7WB 2JDIH 5KP4A 2HOHA 3UL6A 1QVG2 5JPPA 3KSED 2BT3A 4FCJA 4N3VA 3IMAB 4Q53A 3K7CA 3TDGA 1Q7Y4 2CH9A 2STDA 3DMCA 1OCVA 1W6GA 5DRVA 2GSPA 3RGAA 1BRGA 1FGTA 1LRAA 3CNMA 3D9RA 3D4AA 1MNLA 3CCR3 3LOYA 2UGIA 4HM3B 1BSCA 4WYKB 4N6V0 2C10A 2SBLA 4MMZB 3VGNA 1OHOA 1G0TA 1IV9A 1I2GA 2CIUA 4HM1B 4EC6A 1SIHA 1F8NA 5BVBA 1BU4A 3NM7A 1JRQA 4HOHA 2UUGC 3NBJA 1TU5A 3CCS3 5JBSA 3PCRA 3EN1B 1CYUA 1N9EA 1IV7A 1LOYA 2JQ5A 1GY5A 3DM8A 3PYJA 4HM7B 5ELJA 4EW5A 4BU4A 5CXOA 5IG4A 3STDA 4WWUC 1NDOB 1RCLA 1R4YA 2M7OA 1D6UA 1I2EA 1O7HB 5IEOA 1E97A 1TFOA 2L1SA 1M1XB 2SARA 4EBGA 1W2B2 3CC43 1A90A 4XBTA 4EV5A 3T8NA 1I70A 3GWRA 3B7CA 3AGOA 3MG1A 5KP1A 2W04A 3GZXB 4N6TA 3WOFB 3CU3A 4J8TA 5STDA 1VZZA 1B2MA 1B2SA 4ZM8A 3ROBA 4AKYA 2KXGA 1J2BA 1BNFA 3JUNA 1BUJA 5D82A 3T0UA 4H61A 1M9GA 3HZPA 4GB5A 2K54A 2CG0A 2KRTA 2CC3A 1VQ63 4KFDA 3AHWA 3JUPA 1CH0A 3KKGA 5D81A 1BSBA 1I8VA 1SARA 1ASKA 3H3HA 3WOEB 3F14A 2OQEC 1CYVA 1T2IA 4O8SA 1JNQA 2XF3A 3E99A 2XGLA 2OTL3 2H0GA 5AIHA 4U13A 2OOVC 4EV2A 2XFTA 5LC7A 5AYRB 5IEPA 2KCDA 3B8LA 2IY2A 1YIT3 3K0ZA 4XM4A 3V92A 1LQMB 5RNTA 5AIGA 1EKMA 2AADA 3UNLA 2KF6A 3DZLA 5ELUA 3BNEA 1BNEA 1UI7A 2F5MA 2CG1A 5EQLA 2XEPA 5IG5A 4TX4A 2Y74A 7RNTA 1N5PA 1OH0A 1V57A 5CLKA 1DVDA 2P05A 2E2TA 4LSOA 1N8QA 8RNTA 2GEYA 1DMMA 1DETA 3F9SA 1Q42A 1TUHA 1X1XA 1QAKA 2C11A 3CCM3 5IERA 1V58A 4OVMA 3EX9A 3Q90A 2Z6BA 2F5WA 1JBSA 2FGTA 6GSPA 1K8A4 2K0MA 3X3XA 4BTYA 1GYBA 3WDGB 5D83A 1YVBI 2ZL8A 1IQXA 1LNIA 4K1UA 3QK9A 3JUQA 1C7HA 1DMQA 3MSOA 5M1AA 1RN4A 3HIGA 1O7NB 1OF5B 3D5IA 1BANA 3ER7A 1BIRA 5IF6A 1VQP3 1VQ43 5FGOA 3KFQC 1QAFA 1QJGA 2GXFA 1K9M4 3HX8A 7GSPA 1ZS7A 2W56A 3K63A 2IUKA 1FUWA 4HM0B 1PY3A 5TGNA 5AIFA 1RHLA 3WA2X 2RCDA 1RGKA 2F98A 3KIIA 1O7MB 4NHFA 3CCE3 1ISKA 4IT7A 1FYSA 4HM8B 4MEIA 1Q40A 1RMSA 1BNRA 3LZAA 1BRIA 1I0VA 3FG4A 1C54A 1JV2B 2A15A 1DE3A 1G96A 3CC73 1MGWA 1OHPA 1RCKA 1YJN3 3OX9A 1W7CA 3B4OA 2D1WA 3L0RA 3T8UA 1W6YA 2WO0A 4N6NB 1AVLA 3D3LA 3OWSA 1I0XA 1B2UA 2WOHA 3PGBA 1T3BA 1FGMA 2CWUA 4LYLB 4KT3B 4FMAA 3V98A 4K90B 1QVF2 3Q2PA 1D6ZA 1MGRA 2XRXB 3ECFA 2ML6A 1NJI4 1GD4A 4G1MB 4WP5A 2OOVA 1AY7A 1JN5A 4RNTA 4QWTA 4HJLB 3SXXA 4GL6A 5HGRA 2CWTA 1RJOA 3A5EA 2KF3A 3GSPA 3AMOA 3CCQ3 3U97A 4R9KA 2P09A 1BNIA 1LVNA 3GZYB 1GS3A 3N8BA 4ORLA 1YGWA 4WFOA 3CCL3 1MWTA 4FMBA 2IA7A 1RSNA 1B27A 1ZX2A 1AVKA 3MKIA 3M8CA 3CD63 7STDA 3DGLA 1UGIA 1U5OA 2Q07A 1ROVA 3AMOB 1TTOA 1I3FA 4KFFA 1SIIA 1OF5A 3IPTA 3G8ZA 4HM6B 5G2GA 3RDEA 2C4BA 1CEWI 3ZFZA 1JZOA 2R4IA 3V99A 1BRHA 1ZO2A 5CK6A 4OUQA 3EE1A 4K61A 1TFKA 2L4VA 2XSHB 1L5GB 1PYLA 1NNVA 1B3SA 3DGNA 1JB2A 3DH2A 4R4KA 3DGYA 1X1UA 1MWSA 3KSPA 3NXJA 4NPBA 1Q40B 4O2HA 1E3RA 5JPUA 3SLUA 1YIJ3 3K5TA 3CNXA 2FXTA 4IIAA 2RSXA 1PFPA 2D42A 2CFLA 2GU1A 1FW7A 2F86B 3PXMA 2R41A 5CF2A 2F99A 1US1A 3EC9A 1KSIA 2CFDA 3RGRA 3A76A 4MMYB 2BU4A 2Y73A 3GAXA 3Q1CA 3FG3A 1RGGA 3MYTA 5IG3A 1HYFA 1OGXA 5LC6A 2YFJB 2E2VA 4O02B 1WMNA 4BL2A 1R4CA 3DXOA 1NWWA 2W6JH 2YX9A 1W4NA 4KVHA 4O3VA 3GZBA 3X41A 2Z77A 2Z7AA 1FZUA 1UUGB 2KAAA 3OWYA 1YJW3 5DREA 1TRQA 3Q3FA 4DKIA 2BHMA 5AEWB 1B20A 4GHOA 3URPA 1IK3A 1IQYA 3AGNA 3EF8A 3PS8A 5AIIA 1I2FA 5A0OB 4L7KA 3FG1A 3DUKA 5AYSC 1BSAA 4HYZA 2HMNB 8CHOA 1M1K4 3EBTA 3CME3 2OWPA 3MG2A 1IT7A 2CK3H 2Z76A 2WOFA 3X3YA 3HK4A 2CFGA 4HZBB 1BUQA 1EA2A 4EYCA 5EVHA 1U8CB 3SOAA 1SJWA 1UI8A 4H3UA 4BTXA 1OUNA 2P0XA 3WODG 3CC23 2QA43 2W9PA 2H0HA 1NB5I 2XGNA 5I97A 3S27A 2B24B 3FH1A 1OPYA 1K41A 1TIJA 4FCMA 1IU7A 3SEDA 2CX1A 1YVSA 2P0MA 2W0QA 3K9MC 1VQM3 3NUVA 3I563 1EQKA 3FZWA 1JZDA 2WGOA 1RNBA 1M904 4OK0A 3I0YA 1S5AA 1W01A 2FNQA 3X3ZA 3SX1A 6RNTA 1VQO3 1WTHA 1KD14 1BRSA 4N6UA 1VQ83 1HU9A 3D79A 3ALAA 2IMJA 1W6CA 1RGCA 1JKGA 1GOYA 1B2ZA 1TRPA 3ZG0A 1WMOA 3BNCA 5G1LA 2INXA 2LYXA 1JB5A 2XFSA 4N6OB 5M18A 3J7Yd 1RN1A 3NV0A 3HI7A 2J8XB 1A2VA 2I9WA 3BLZA 3NBRA 3CCJ3 3WHOA 3GRDA 1DVCA 1RGEA 1STFI 3QRDA 6STDA 1GY6A 2RNTA 1VQL3 2MF7A 1A2KA 3O8YA 5M19A 2BIRA 3WA3A 1W02A 1RN7A 2W2CA 1RGLA 3FLJA 3JVCA 1VQK3 3G713 1UCKA 3SYUA
chains in the Genus database with same CATH topology
1TTOA 1CH0A 1GOVA 1I3FA 2C4BA 1BSDA 1BSBA 1BRHA 1I8VA 1LOVA 1SARA 1BSEA 1YNVX 1T2IA 1UCIA 2ZA4A 1RGHA 1PYLA 1B3SA 3DH2A 3HOHA 3DGYA 1Q9EA 1X1UA 5HOHA 1UCLA 1T2HA 2KF4A 1RTUA 5RNTA 2F4YA 1GOUA 1GMQA 1RGAA 1RDSA 2AADA 1BVIA 1BGSA 2KF6A 4J5GA 2RBIA 1BNEA 2F5MA 1AQZA 1FW7A 1B2XA 3D5GA 7RNTA 1JBTA 2F56A 8RNTA 1BNGA 1X1WA 1RGFA 2BU4A 1DETA 1X1XA 5BIRA 1RGGA 1HYFA 1RLSA 4J5KA 4GSPA 1A2PA 1GMRA 2F5WA 1JBSA 1BOXA 6GSPA 1FUTA 3RNTA 1BRNL 1LOWA 1ZGXA 1LNIA 1FZUA 1FUSA 1RN4A 2KAAA 5GSPA 3KCHA 1G02A 1BANA 1TRQA 1BIRA 3D5IA 3Q3FA 1IYYA 1BNSA 1B20A 4GHOA 3URPA 2HOHA 3AGNA 7GSPA 1I2FA 2KF5A 1PY3A 1BAOA 1BSAA 9RNTA 1RHLA 1RGKA 1BNJA 1BNRA 1FYSA 1RMSA 1BRIA 2GSPA 1BRGA 1LRAA 3BU4A 1I3IA 1I0VA 2AAEA 3D4AA 1C54A 1BSCA 1MGWA 1RCKA 4BIRA 1I2GA 1B21A 1BRJA 1YVSA 1BU4A 4HOHA 3AHSA 1RNBA 1I0XA 1LOYA 1B2UA 6RNTA 1DE3A 1GMPA 1BRSA 1RNTA 4BU4A 1RCLA 1R4YA 1RGCA 1GOYA 1I2EA 1B2ZA 1TRPA 1MGRA 2SARA 4HAAA 1I70A 1AY7A 3AGOA 5BU4A 1RN1A 4RNTA 3A5EA 1HZ1A 2KF3A 3GSPA 3WHOA 1RGEA 1BNIA 2RNTA 1B2MA 1B2SA 1JBRA 1YGWA 2BIRA 1BNFA 1RSNA 1B27A 1UCJA 1BUJA 1RGLA 3BIRA 1GSPA 1BRKA 1UCKA 1X1YA 3SYUA 3WR2A 3AHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TTO A;  1CH0 A;  1GOV A;  1I3F A;  2C4B A;  1BSD A;  1BSB A;  1BRH A;  1I8V A;  1LOV A;  1SAR A;  1BSE A;  1YNV X;  1T2I A;  1UCI A;  2ZA4 A;  1RGH A;  1PYL A;  1B3S A;  3DH2 A;  3HOH A;  3DGY A;  1Q9E A;  1X1U A;  5HOH A;  1UCL A;  1T2H A;  2KF4 A;  1RTU A;  5RNT A;  2F4Y A;  1GOU A;  1GMQ A;  1RGA A;  1RDS A;  2AAD A;  1BVI A;  1BGS A;  2KF6 A;  4J5G A;  2RBI A;  1BNE A;  2F5M A;  1AQZ A;  1FW7 A;  1B2X A;  3D5G A;  7RNT A;  1JBT A;  2F56 A;  8RNT A;  1BNG A;  1X1W A;  1RGF A;  2BU4 A;  1DET A;  1X1X A;  5BIR A;  1RGG A;  1HYF A;  1RLS A;  4J5K A;  4GSP A;  1A2P A;  1GMR A;  2F5W A;  1JBS A;  1BOX A;  6GSP A;  1FUT A;  3RNT A;  1BRN L;  1LOW A;  1ZGX A;  1LNI A;  1FZU A;  1FUS A;  1RN4 A;  2KAA A;  5GSP A;  3KCH A;  1G02 A;  1BAN A;  1TRQ A;  1BIR A;  3D5I A;  3Q3F A;  1IYY A;  1BNS A;  1B20 A;  4GHO A;  3URP A;  2HOH A;  3AGN A;  7GSP A;  1I2F A;  2KF5 A;  1PY3 A;  1BAO A;  1BSA A;  9RNT A;  1RHL A;  1RGK A;  1BNJ A;  1BNR A;  1FYS A;  1RMS A;  1BRI A;  2GSP A;  1BRG A;  1LRA A;  3BU4 A;  1I3I A;  1I0V A;  2AAE A;  3D4A A;  1C54 A;  1BSC A;  1MGW A;  1RCK A;  4BIR A;  1I2G A;  1B21 A;  1BRJ A;  1YVS A;  1BU4 A;  4HOH A;  3AHS A;  1RNB A;  1I0X A;  1LOY A;  1B2U A;  6RNT A;  1DE3 A;  1GMP A;  1BRS A;  1RNT A;  4BU4 A;  1RCL A;  1R4Y A;  1RGC A;  1GOY A;  1I2E A;  1B2Z A;  1TRP A;  1MGR A;  2SAR A;  4HAA A;  1I70 A;  1AY7 A;  3AGO A;  5BU4 A;  1RN1 A;  4RNT A;  3A5E A;  1HZ1 A;  2KF3 A;  3GSP A;  3WHO A;  1RGE A;  1BNI A;  2RNT A;  1B2M A;  1B2S A;  1JBR A;  1YGW A;  2BIR A;  1BNF A;  1RSN A;  1B27 A;  1UCJ A;  1BUJ A;  1RGL A;  3BIR A;  1GSP A;  1BRK A;  1UCK A;  1X1Y A;  3SYU A;  3WR2 A;  3AHW A; 
#chains in the Genus database with same CATH topology
 2ZDJ A;  1GOV A;  3NM2 A;  3G0K A;  1W00 A;  2K3D A;  5KP3 A;  2BMQ B;  2QEX 3;  2RFR A;  4KFE A;  4AKZ A;  1LOV A;  4JF8 A;  1AR0 A;  1UCI A;  1YGE A;  3LTD A;  1OGZ A;  1N5H A;  3LT9 A;  1WMP A;  1T5Y A;  3PCS A;  3HOH A;  3F7X A;  1Q9E A;  1DMN A;  2H0I A;  4FMC A;  4PEJ A;  2OCT A;  5HOH A;  3G4S 3;  1T2H A;  1UW1 A;  2XH9 A;  2WGQ A;  4LEH A;  1LOX A;  4RBN A;  2F4Y A;  1GMQ A;  3G6E 3;  1RGA A;  3EN8 A;  1RDS A;  2CFW A;  1W5Z A;  4N6M A;  1Q86 4;  3FGY A;  1BVI A;  3NX0 A;  1BGS A;  4FR9 A;  2OTJ 3;  4KZ1 A;  2P38 A;  4WYK A;  2GU3 A;  1JB4 A;  3NV0 B;  3OXA A;  5EEO A;  4RNY A;  2ZHX B;  1B2X A;  3EB8 A;  5IEN A;  1KC8 4;  1JBT A;  4BTW A;  2BMO B;  3MPH A;  4IPB A;  1NB3 I;  2CW9 A;  1HKX A;  1Q7H A;  3N9H A;  3UL5 A;  1X1W A;  1RGF A;  3U1W A;  3I55 3;  3PZW A;  1DYU A;  4CJN A;  3LH4 A;  5BIR A;  1YI2 3;  2HML B;  1SPU A;  1W2Z A;  3OWU A;  1CQS A;  1RKY A;  1JKG B;  1WQL B;  3CXC 2;  3SVA A;  4XBX A;  3EBY A;  1BOX A;  3S5C A;  4R80 A;  3RNT A;  4RNZ A;  1LOW A;  1ZGX A;  3OV4 A;  3MHE A;  3G16 A;  1FGO A;  4X2O A;  3CCU 3;  1UGH I;  4FMD A;  2ML5 A;  3KCH A;  4I4K A;  3N54 B;  3SOY A;  1VQQ A;  4CPK A;  2GEX A;  3EQQ B;  1BNS A;  1ULJ B;  1Z1S A;  1YJ9 3;  1FGR A;  2O3O A;  3F8X A;  3MG3 A;  4FCZ A;  3F8H A;  1LNH A;  2XSO B;  2KF5 A;  3KZT A;  2BNG A;  1V74 A;  1BAO A;  2XR8 B;  4MJD A;  2BMR B;  1Y4K A;  4L8O A;  9RNT A;  1AV4 A;  2RGQ A;  1BNJ A;  5BXQ A;  2CHC A;  1O7P B;  1TJD A;  4HZ9 B;  3BB9 A;  3CPW 2;  1N8R 4;  1STD A;  2W56 B;  2CWV A;  1I3I A;  1ROA A;  2AAE A;  3BU4 A;  3DGO A;  3KE7 A;  3LTB A;  4RZM A;  2CKF B;  1KWI A;  1D6Y A;  1MWU A;  3F7S A;  2GBX B;  1Q81 4;  4BIR A;  1IDP A;  1B21 A;  5IG0 A;  3DGM A;  1GD3 A;  1BRJ A;  1SQW A;  3FSD A;  3GZR A;  3VF1 A;  4N6L A;  3S29 A;  3AHS A;  2HMM B;  3FF0 A;  2O9U X;  3CPO A;  3LML A;  3WMD A;  1IQ8 A;  1Q82 4;  1GMP A;  3DY5 A;  1TP6 A;  4CDL A;  1RNT A;  1QAL A;  1JN5 B;  2V1L A;  4LZI A;  4JRF A;  4R9L A;  2MC8 A;  3X42 A;  2YFI B;  3H51 A;  4XDV A;  4J9A A;  3BND A;  3EJV A;  4ILF A;  5G1K A;  2W03 A;  4HAA A;  1E3V A;  4HBR A;  4LMI A;  3NQZ A;  3FF2 A;  5BU4 A;  1O7G B;  4HVN A;  3F40 A;  3KN4 A;  3LXU X;  1FGQ A;  2HMJ B;  1MOL A;  1VQN 3;  1QMA A;  1RRL A;  1HZ1 A;  1WNH A;  3NBB A;  5FW5 A;  2BO9 B;  2LQV A;  1JBR A;  1JJ2 2;  1N9J A;  4HM4 B;  3NHX A;  1KQS 2;  4AEQ A;  4CCV A;  1VQ7 3;  1UCJ A;  3FCS B;  3ZG5 A;  4MMX B;  3JUM A;  3S28 A;  4EXR A;  3BIR A;  1GSP A;  2HMK B;  1IT8 A;  1BRK A;  1X1Y A;  3WR2 A;  1OAC A;  1VQ9 3;  2PZV A;  1IVU A;  3LYG A;  1BSD A;  1ULI B;  2GBW B;  2QIY A;  2YFL B;  3IJE B;  3NQY A;  2PNC A;  1K28 A;  1BSE A;  1GY7 A;  1YNV X;  4HM2 B;  2ZA4 A;  1RGH A;  1EG9 B;  2CFK A;  3MWZ A;  2IUJ A;  1K73 4;  5IW9 A;  3X40 A;  1NO3 A;  3CCV 3;  1IVV A;  3LTC A;  1UCL A;  4HKV B;  1PU4 A;  1NU3 A;  2KF4 A;  1RTU A;  3HII A;  4K1V A;  1GOU A;  2UX0 A;  1UUV B;  1YHQ 3;  5AEU B;  1UDI I;  1LQG C;  4J5G A;  4XB5 A;  1RRH A;  2RBI A;  1S72 3;  3LT8 A;  3UB1 A;  2E2U A;  1AQZ A;  4X2H A;  1A67 A;  4HM5 B;  2IYJ A;  3D5G A;  3VSY A;  5CF1 A;  1IVW A;  2F56 A;  2OQE A;  2HMO B;  3CMA 3;  2W9Q A;  4R1K A;  1FA3 A;  3OW2 2;  1IVX A;  1BNG A;  5AI1 A;  1UUW B;  4NRE A;  4WHA A;  4BL3 A;  1RLS A;  4J5K A;  3B4P A;  3JUO A;  4GSP A;  1EUI C;  1A2P A;  1OHS A;  1EEJ A;  3UJM A;  1GMR A;  1FUT A;  3LTA A;  4LGQ A;  1VQ5 3;  1BRN L;  4XBY A;  3FKA A;  4L8P A;  3BNB A;  4XDW A;  2CX0 A;  1FUS A;  2B1X B;  3EHC A;  4I5Q A;  1MWR A;  3S67 A;  4STD A;  5GSP A;  1G02 A;  1IYY A;  2QGU A;  1LXE A;  1O7W B;  2JDI H;  5KP4 A;  2HOH A;  3UL6 A;  1QVG 2;  5JPP A;  3KSE D;  2BT3 A;  4FCJ A;  4N3V A;  3IMA B;  4Q53 A;  3K7C A;  3TDG A;  1Q7Y 4;  2CH9 A;  2STD A;  3DMC A;  1OCV A;  1W6G A;  5DRV A;  2GSP A;  3RGA A;  1BRG A;  1FGT A;  1LRA A;  3CNM A;  3D9R A;  3D4A A;  1MNL A;  3CCR 3;  3LOY A;  2UGI A;  4HM3 B;  1BSC A;  4WYK B;  4N6V 0;  2C10 A;  2SBL A;  4MMZ B;  3VGN A;  1OHO A;  1G0T A;  1IV9 A;  1I2G A;  2CIU A;  4HM1 B;  4EC6 A;  1SIH A;  1F8N A;  5BVB A;  1BU4 A;  3NM7 A;  1JRQ A;  4HOH A;  2UUG C;  3NBJ A;  1TU5 A;  3CCS 3;  5JBS A;  3PCR A;  3EN1 B;  1CYU A;  1N9E A;  1IV7 A;  1LOY A;  2JQ5 A;  1GY5 A;  3DM8 A;  3PYJ A;  4HM7 B;  5ELJ A;  4EW5 A;  4BU4 A;  5CXO A;  5IG4 A;  3STD A;  4WWU C;  1NDO B;  1RCL A;  1R4Y A;  2M7O A;  1D6U A;  1I2E A;  1O7H B;  5IEO A;  1E97 A;  1TFO A;  2L1S A;  1M1X B;  2SAR A;  4EBG A;  1W2B 2;  3CC4 3;  1A90 A;  4XBT A;  4EV5 A;  3T8N A;  1I70 A;  3GWR A;  3B7C A;  3AGO A;  3MG1 A;  5KP1 A;  2W04 A;  3GZX B;  4N6T A;  3WOF B;  3CU3 A;  4J8T A;  5STD A;  1VZZ A;  1B2M A;  1B2S A;  4ZM8 A;  3ROB A;  4AKY A;  2KXG A;  1J2B A;  1BNF A;  3JUN A;  1BUJ A;  5D82 A;  3T0U A;  4H61 A;  1M9G A;  3HZP A;  4GB5 A;  2K54 A;  2CG0 A;  2KRT A;  2CC3 A;  1VQ6 3;  4KFD A;  3AHW A;  3JUP A;  1CH0 A;  3KKG A;  5D81 A;  1BSB A;  1I8V A;  1SAR A;  1ASK A;  3H3H A;  3WOE B;  3F14 A;  2OQE C;  1CYV A;  1T2I A;  4O8S A;  1JNQ A;  2XF3 A;  3E99 A;  2XGL A;  2OTL 3;  2H0G A;  5AIH A;  4U13 A;  2OOV C;  4EV2 A;  2XFT A;  5LC7 A;  5AYR B;  5IEP A;  2KCD A;  3B8L A;  2IY2 A;  1YIT 3;  3K0Z A;  4XM4 A;  3V92 A;  1LQM B;  5RNT A;  5AIG A;  1EKM A;  2AAD A;  3UNL A;  2KF6 A;  3DZL A;  5ELU A;  3BNE A;  1BNE A;  1UI7 A;  2F5M A;  2CG1 A;  5EQL A;  2XEP A;  5IG5 A;  4TX4 A;  2Y74 A;  7RNT A;  1N5P A;  1OH0 A;  1V57 A;  5CLK A;  1DVD A;  2P05 A;  2E2T A;  4LSO A;  1N8Q A;  8RNT A;  2GEY A;  1DMM A;  1DET A;  3F9S A;  1Q42 A;  1TUH A;  1X1X A;  1QAK A;  2C11 A;  3CCM 3;  5IER A;  1V58 A;  4OVM A;  3EX9 A;  3Q90 A;  2Z6B A;  2F5W A;  1JBS A;  2FGT A;  6GSP A;  1K8A 4;  2K0M A;  3X3X A;  4BTY A;  1GYB A;  3WDG B;  5D83 A;  1YVB I;  2ZL8 A;  1IQX A;  1LNI A;  4K1U A;  3QK9 A;  3JUQ A;  1C7H A;  1DMQ A;  3MSO A;  5M1A A;  1RN4 A;  3HIG A;  1O7N B;  1OF5 B;  3D5I A;  1BAN A;  3ER7 A;  1BIR A;  5IF6 A;  1VQP 3;  1VQ4 3;  5FGO A;  3KFQ C;  1QAF A;  1QJG A;  2GXF A;  1K9M 4;  3HX8 A;  7GSP A;  1ZS7 A;  2W56 A;  3K63 A;  2IUK A;  1FUW A;  4HM0 B;  1PY3 A;  5TGN A;  5AIF A;  1RHL A;  3WA2 X;  2RCD A;  1RGK A;  2F98 A;  3KII A;  1O7M B;  4NHF A;  3CCE 3;  1ISK A;  4IT7 A;  1FYS A;  4HM8 B;  4MEI A;  1Q40 A;  1RMS A;  1BNR A;  3LZA A;  1BRI A;  1I0V A;  3FG4 A;  1C54 A;  1JV2 B;  2A15 A;  1DE3 A;  1G96 A;  3CC7 3;  1MGW A;  1OHP A;  1RCK A;  1YJN 3;  3OX9 A;  1W7C A;  3B4O A;  2D1W A;  3L0R A;  3T8U A;  1W6Y A;  2WO0 A;  4N6N B;  1AVL A;  3D3L A;  3OWS A;  1I0X A;  1B2U A;  2WOH A;  3PGB A;  1T3B A;  1FGM A;  2CWU A;  4LYL B;  4KT3 B;  4FMA A;  3V98 A;  4K90 B;  1QVF 2;  3Q2P A;  1D6Z A;  1MGR A;  2XRX B;  3ECF A;  2ML6 A;  1NJI 4;  1GD4 A;  4G1M B;  4WP5 A;  2OOV A;  1AY7 A;  1JN5 A;  4RNT A;  4QWT A;  4HJL B;  3SXX A;  4GL6 A;  5HGR A;  2CWT A;  1RJO A;  3A5E A;  2KF3 A;  3GSP A;  3AMO A;  3CCQ 3;  3U97 A;  4R9K A;  2P09 A;  1BNI A;  1LVN A;  3GZY B;  1GS3 A;  3N8B A;  4ORL A;  1YGW A;  4WFO A;  3CCL 3;  1MWT A;  4FMB A;  2IA7 A;  1RSN A;  1B27 A;  1ZX2 A;  1AVK A;  3MKI A;  3M8C A;  3CD6 3;  7STD A;  3DGL A;  1UGI A;  1U5O A;  2Q07 A;  1ROV A;  3AMO B;  1TTO A;  1I3F A;  4KFF A;  1SII A;  1OF5 A;  3IPT A;  3G8Z A;  4HM6 B;  5G2G A;  3RDE A;  2C4B A;  1CEW I;  3ZFZ A;  1JZO A;  2R4I A;  3V99 A;  1BRH A;  1ZO2 A;  5CK6 A;  4OUQ A;  3EE1 A;  4K61 A;  1TFK A;  2L4V A;  2XSH B;  1L5G B;  1PYL A;  1NNV A;  1B3S A;  3DGN A;  1JB2 A;  3DH2 A;  4R4K A;  3DGY A;  1X1U A;  1MWS A;  3KSP A;  3NXJ A;  4NPB A;  1Q40 B;  4O2H A;  1E3R A;  5JPU A;  3SLU A;  1YIJ 3;  3K5T A;  3CNX A;  2FXT A;  4IIA A;  2RSX A;  1PFP A;  2D42 A;  2CFL A;  2GU1 A;  1FW7 A;  2F86 B;  3PXM A;  2R41 A;  5CF2 A;  2F99 A;  1US1 A;  3EC9 A;  1KSI A;  2CFD A;  3RGR A;  3A76 A;  4MMY B;  2BU4 A;  2Y73 A;  3GAX A;  3Q1C A;  3FG3 A;  1RGG A;  3MYT A;  5IG3 A;  1HYF A;  1OGX A;  5LC6 A;  2YFJ B;  2E2V A;  4O02 B;  1WMN A;  4BL2 A;  1R4C A;  3DXO A;  1NWW A;  2W6J H;  2YX9 A;  1W4N A;  4KVH A;  4O3V A;  3GZB A;  3X41 A;  2Z77 A;  2Z7A A;  1FZU A;  1UUG B;  2KAA A;  3OWY A;  1YJW 3;  5DRE A;  1TRQ A;  3Q3F A;  4DKI A;  2BHM A;  5AEW B;  1B20 A;  4GHO A;  3URP A;  1IK3 A;  1IQY A;  3AGN A;  3EF8 A;  3PS8 A;  5AII A;  1I2F A;  5A0O B;  4L7K A;  3FG1 A;  3DUK A;  5AYS C;  1BSA A;  4HYZ A;  2HMN B;  8CHO A;  1M1K 4;  3EBT A;  3CME 3;  2OWP A;  3MG2 A;  1IT7 A;  2CK3 H;  2Z76 A;  2WOF A;  3X3Y A;  3HK4 A;  2CFG A;  4HZB B;  1BUQ A;  1EA2 A;  4EYC A;  5EVH A;  1U8C B;  3SOA A;  1SJW A;  1UI8 A;  4H3U A;  4BTX A;  1OUN A;  2P0X A;  3WOD G;  3CC2 3;  2QA4 3;  2W9P A;  2H0H A;  1NB5 I;  2XGN A;  5I97 A;  3S27 A;  2B24 B;  3FH1 A;  1OPY A;  1K41 A;  1TIJ A;  4FCM A;  1IU7 A;  3SED A;  2CX1 A;  1YVS A;  2P0M A;  2W0Q A;  3K9M C;  1VQM 3;  3NUV A;  3I56 3;  1EQK A;  3FZW A;  1JZD A;  2WGO A;  1RNB A;  1M90 4;  4OK0 A;  3I0Y A;  1S5A A;  1W01 A;  2FNQ A;  3X3Z A;  3SX1 A;  6RNT A;  1VQO 3;  1WTH A;  1KD1 4;  1BRS A;  4N6U A;  1VQ8 3;  1HU9 A;  3D79 A;  3ALA A;  2IMJ A;  1W6C A;  1RGC A;  1JKG A;  1GOY A;  1B2Z A;  1TRP A;  3ZG0 A;  1WMO A;  3BNC A;  5G1L A;  2INX A;  2LYX A;  1JB5 A;  2XFS A;  4N6O B;  5M18 A;  3J7Y d;  1RN1 A;  3NV0 A;  3HI7 A;  2J8X B;  1A2V A;  2I9W A;  3BLZ A;  3NBR A;  3CCJ 3;  3WHO A;  3GRD A;  1DVC A;  1RGE A;  1STF I;  3QRD A;  6STD A;  1GY6 A;  2RNT A;  1VQL 3;  2MF7 A;  1A2K A;  3O8Y A;  5M19 A;  2BIR A;  3WA3 A;  1W02 A;  1RN7 A;  2W2C A;  1RGL A;  3FLJ A;  3JVC A;  1VQK 3;  3G71 3;  1UCK A;  3SYU A; 
#chains in the Genus database with same CATH homology
 1TTO A;  1CH0 A;  1GOV A;  1I3F A;  2C4B A;  1BSD A;  1BSB A;  1BRH A;  1I8V A;  1LOV A;  1SAR A;  1BSE A;  1YNV X;  1T2I A;  1UCI A;  2ZA4 A;  1RGH A;  1PYL A;  1B3S A;  3DH2 A;  3HOH A;  3DGY A;  1Q9E A;  1X1U A;  5HOH A;  1UCL A;  1T2H A;  2KF4 A;  1RTU A;  5RNT A;  2F4Y A;  1GOU A;  1GMQ A;  1RGA A;  1RDS A;  2AAD A;  1BVI A;  1BGS A;  2KF6 A;  4J5G A;  2RBI A;  1BNE A;  2F5M A;  1AQZ A;  1FW7 A;  1B2X A;  3D5G A;  7RNT A;  1JBT A;  2F56 A;  8RNT A;  1BNG A;  1X1W A;  1RGF A;  2BU4 A;  1DET A;  1X1X A;  5BIR A;  1RGG A;  1HYF A;  1RLS A;  4J5K A;  4GSP A;  1A2P A;  1GMR A;  2F5W A;  1JBS A;  1BOX A;  6GSP A;  1FUT A;  3RNT A;  1BRN L;  1LOW A;  1ZGX A;  1LNI A;  1FZU A;  1FUS A;  1RN4 A;  2KAA A;  5GSP A;  3KCH A;  1G02 A;  1BAN A;  1TRQ A;  1BIR A;  3D5I A;  3Q3F A;  1IYY A;  1BNS A;  1B20 A;  4GHO A;  3URP A;  2HOH A;  3AGN A;  7GSP A;  1I2F A;  2KF5 A;  1PY3 A;  1BAO A;  1BSA A;  9RNT A;  1RHL A;  1RGK A;  1BNJ A;  1BNR A;  1FYS A;  1RMS A;  1BRI A;  2GSP A;  1BRG A;  1LRA A;  3BU4 A;  1I3I A;  1I0V A;  2AAE A;  3D4A A;  1C54 A;  1BSC A;  1MGW A;  1RCK A;  4BIR A;  1I2G A;  1B21 A;  1BRJ A;  1YVS A;  1BU4 A;  4HOH A;  3AHS A;  1RNB A;  1I0X A;  1LOY A;  1B2U A;  6RNT A;  1DE3 A;  1GMP A;  1BRS A;  1RNT A;  4BU4 A;  1RCL A;  1R4Y A;  1RGC A;  1GOY A;  1I2E A;  1B2Z A;  1TRP A;  1MGR A;  2SAR A;  4HAA A;  1I70 A;  1AY7 A;  3AGO A;  5BU4 A;  1RN1 A;  4RNT A;  3A5E A;  1HZ1 A;  2KF3 A;  3GSP A;  3WHO A;  1RGE A;  1BNI A;  2RNT A;  1B2M A;  1B2S A;  1JBR A;  1YGW A;  2BIR A;  1BNF A;  1RSN A;  1B27 A;  1UCJ A;  1BUJ A;  1RGL A;  3BIR A;  1GSP A;  1BRK A;  1UCK A;  1X1Y A;  3SYU A;  3WR2 A;  3AHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...