3K63A

X-ray structure of the pf04200 domain from q9pra0_urepa protein of ureaplasma parvum. nesg target uur17a.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
MEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKNGTLKLSLMLTDKKNNQVYYKLLEVSGFKSNPYGVDENGTIPGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Conserved hypothetical membrane lipoprotein
publication title X-ray structure of the PF04200 domain from Q9PRA0_UREPA protein of Ureaplasma parvum.
rcsb
source organism Ureaplasma parvum
molecule tags Lipid binding protein
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04200 Lipoprotein_17 Lipoprotein associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.270 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3k63A01
3K63A 2KRTA 3JVCA
chains in the Genus database with same CATH superfamily
1GS3A 1MWSA 3LOYA 3DUKA 3MPHA 3URPA 6GSPA 3CMA3 3LTDA 4HM6B 5IG3A 3EE1A 3CCM3 1SPUA 4N6OB 2MF7A 1RGKA 4GL6A 4H3UA 2W0QA 1Q40A 3UJMA 1UW1A 3CD63 4MEIA 4GHOA 1RKYA 1JN5A 4R1KA 2CG0A 1AY7A 6STDA 1K734 1TU5A 1LNIA 3CCJ3 2CC3A 1JZDA 5IG4A 1IQ8A 4NREA 2XFTA 4N3VA 3JVCA 3S28A 3GWRA 1RTUA 4QWTA 1HKXA 1M9GA 2W04A 1BNGA 2CFGA 3ZFZA 1U8CB 3NQZA 1O7GB 1ISKA 1RN1A 3D4AA 2OQEA 5JBSA 2CX1A 4LZIA 3Q1CA 3AHSA 1SIIA 2QIYA 3JUOA 3OWYA 1W00A 2H0HA 2F98A 1AVLA 3U97A 3NBBA 2PZVA 1IV7A 2KCDA 5BVBA 2XF3A 1K8A4 2B24B 2XGNA 3EF8A 1B27A 5AIGA 3J7Yd 2A15A 3S5CA 3S29A 2KAAA 3FG1A 2YFLB 2F5WA 1GD3A 4WYKB 1FW7A 1QVF2 1JB4A 1NB3I 3NV0A 4FMBA 2Q07A 1WMOA 7GSPA 3DH2A 2AAEA 4R4KA 3SLUA 3V92A 3JUNA 3A76A 1IDPA 1FZUA 3AGNA 3GZYB 1V74A 4FCMA 3HIIA 5ELJA 3DY5A 2HMMB 1QVG2 1N5PA 1UUWB 1KQS2 4L8OA 1B2MA 2H0IA 2K3DA 4J9AA 1UCIA 2D42A 3I0YA 1A67A 1I2GA 3FKAA 2C4BA 4WP5A 2GXFA 4O02B 2HOHA 1EQKA 1A2PA 1N9EA 2RNTA 1X1XA 2FXTA 2BT3A 3BNDA 1VZZA 1NNVA 1YJW3 2LYXA 2UGIA 4L8PA 3KSPA 1VQN3 3FLJA 1ROAA 1DETA 1T2IA 1IVXA 4N6TA 5AYRB 4LYLB 2BO9B 3DXOA 1LOWA 4LEHA 1SQWA 2MC8A 1ZGXA 2H0GA 2KF4A 3AGOA 5JPPA 1B20A 1GSPA 1HYFA 1UI8A 3FGYA 3HOHA 3LTCA 1DE3A 4CJNA 3AMOA 1BNSA 2XR8B 1MGRA 3KKGA 4ILFA 3WA2X 1DVDA 1TIJA 5EEOA 1RGEA 1IQYA 2YX9A 3D9RA 5IF6A 3CXC2 3N9HA 5STDA 3GZBA 5FGOA 1YGWA 3NBJA 1UI7A 3HK4A 3PZWA 2BU4A 2LQVA 2Y74A 3FF2A 1OF5A 2GSPA 4R9LA 5CXOA 1JB5A 2CWTA 3CCR3 4KT3B 1BRJA 1BSDA 2CFKA 2F4YA 5CLKA 1UUGB 2GBXB 2OQEC 1N9JA 2YFJB 3FG4A 5GSPA 5KP1A 1T3BA 1CEWI 1LNHA 2K54A 5G2GA 1BNJA 5G1KA 1M904 3BNEA 2XSOB 1VQM3 1DVCA 2RBIA 1OHPA 1GMQA 1RGCA 3BB9A 4I4KA 3B4OA 2W56A 3EHCA 3CCU3 1HZ1A 1ULIB 1ZS7A 3D3LA 1Q7Y4 3KIIA 1FGRA 4HZ9B 3FF0A 2OWPA 1ZO2A 2P05A 1X1WA 1O7MB 1BNFA 5TGNA 2OOVA 1IK3A 1RNBA 3DZLA 1W2B2 5IEOA 1QAKA 4XBTA 3ROBA 4RZMA 1O7HB 1IVUA 3K63A 1JJ22 1RGHA 2UX0A 3SYUA 3UL5A 3RGRA 3SEDA 3MHEA 1YHQ3 3HZPA 1I8VA 2XEPA 1C54A 2E2VA 1BNIA 1RDSA 1WMPA 1UCJA 2WGOA 1X1YA 2ML5A 3OV4A 3FG3A 1TTOA 1EUIC 3HX8A 3RGAA 1IT7A 2CFWA 4LMIA 1K9M4 1O7WB 2AADA 4EYCA 3DMCA 3PCSA 1B21A 4HM3B 2WOFA 3CCV3 2ZDJA 3OXAA 4BTWA 1OPYA 2CIUA 1B2SA 1FGTA 1CQSA 2GEXA 4ZM8A 4TX4A 1C7HA 1FYSA 3GZRA 4K1VA 4WFOA 1DMQA 1RLSA 2F86B 5AI1A 2V1LA 1OCVA 2CK3H 2STDA 3X3XA 1G96A 2L1SA 5AEUB 3WHOA 4CPKA 3LT9A 1PYLA 1TUHA 3KN4A 1AR0A 1EEJA 1BRGA 1KD14 2Z77A 1FGMA 3EJVA 3N8BA 1JV2B 3F8XA 2UUGC 3F40A 2B1XB 3IMAB 3X3ZA 1YNVX 1BRHA 1ASKA 1WQLB 1QALA 1RRLA 2QEX3 2W9PA 3AHWA 4BU4A 2OCTA 2R41A 3NQYA 2JQ5A 4HJLB 1BUJA 4AKZA 1PY3A 1RSNA 2C10A 2HMNB 5AIIA 3WMDA 1JRQA 4Q53A 4XM4A 4BTYA 3I563 1IV9A 4NHFA 4ORLA 3LYGA 1BSAA 2INXA 4N6MA 2E2TA 1NO3A 5EVHA 1JB2A 3EX9A 1T5YA 2BMRB 5LC6A 3BIRA 4BL2A 1JZOA 2XFSA 3WA3A 3NV0B 7STDA 3G8ZA 3WDGB 1JBTA 1JBSA 1FA3A 1Z1SA 2K0MA 1RMSA 1WMNA 1KSIA 2W6JH 1STFI 2OOVC 4XDVA 1RN7A 3ZG0A 4OK0A 3G4S3 1RCLA 4I5QA 3NUVA 1NU3A 3QK9A 1PU4A 3LZAA 3TDGA 2F99A 1R4YA 3H3HA 1KC84 3O8YA 4KFDA 2PNCA 2W03A 1LOXA 3PGBA 2FNQA 4FCZA 3KZTA 2RGQA 3LH4A 4RBNA 4WYKA 4L7KA 5CK6A 2RSXA 3CC23 2XGLA 5AEWB 1GOVA 4GSPA 3T8UA 1GOUA 3V99A 2HMLB 3EB8A 3VGNA 3NM2A 1DMNA 1W2ZA 8CHOA 4R9KA 1YJN3 1YI23 1K41A 4WHAA 1B2XA 1US1A 4MMZB 1EKMA 3X3YA 1RRHA 1IVVA 2CW9A 3FH1A 1GY7A 5FW5A 3OWSA 4FMDA 1M1XB 3CCQ3 4HOHA 3BNBA 1ZX2A 2KXGA 3BU4A 3DGYA 1B2ZA 4J5GA 3BNCA 3IPTA 1I0XA 1HU9A 2CFLA 3GAXA 1YVBI 1VQP3 4RNZA 4X2HA 1UDII 5JPUA 3MG1A 4O8SA 2IY2A 4EC6A 3NHXA 4KFFA 1JNQA 1Q9EA 5CF1A 3LTAA 3G0KA 1ROVA 4HM7B 1UCLA 1BU4A 3V98A 3DGNA 2CWVA 4U13A 2P0MA 2P0XA 3HIGA 5D83A 1N8R4 1A90A 4LGQA 3H51A 1UCKA 4MMXB 1GYBA 3PXMA 5EQLA 1U5OA 4CCVA 4EV2A 2W56B 2IUKA 1TJDA 2BNGA 1GD4A 1BVIA 1LOVA 3EN8A 1BGSA 2Y73A 4KVHA 2CKFB 2IMJA 2R4IA 1BUQA 2HMOB 4HBRA 4XDWA 1ULJB 2GEYA 3SX1A 4R80A 4MJDA 2CX0A 4J5KA 2C11A 1BRIA 1FGQA 1MOLA 4WWUC 3F8HA 3WODG 1RGFA 3NBRA 3K9MC 2RFRA 4EXRA 1Q824 1VQ43 1FUWA 4IPBA 1JKGA 1GY6A 4H61A 4HVNA 4OUQA 3CCL3 1A2KA 5AIHA 1NDOB 1D6YA 1PFPA 1W5ZA 1I0VA 2CH9A 3G6E3 5RNTA 4IT7A 1WNHA 1OHSA 5A0OB 2BHMA 1KWIA 1RGAA 1IU7A 4HM1B 1SJWA 3Q90A 4FR9A 1VQ63 1FGOA 1DYUA 4EV5A 1B2UA 1I2EA 2BIRA 3D5IA 3Q3FA 3ZG5A 1VQ73 1Q40B 1W01A 3MSOA 1N8QA 1JN5B 5BU4A 5M19A 1BNEA 3I553 1Q7HA 1BRNL 2O3OA 3X40A 3NXJA 3D5GA 1AQZA 1RNTA 3GSPA 1LOYA 1BIRA 2ZL8A 5BIRA 1QJGA 7RNTA 5D81A 3LMLA 2I9WA 4HM5B 2KRTA 5DRVA 8RNTA 1MWTA 1BAOA 2GBWB 1YGEA 3B4PA 3SVAA 1YJ93 3CPOA 3MWZA 1OH0A 4JRFA 3RDEA 4IIAA 1RCKA 3NM7A 6RNTA 1O7NB 1Q42A 1W6YA 2KF3A 2KF5A 3ALAA 1CH0A 3UB1A 2IYJA 2Z6BA 2OTL3 1X1UA 2CG1A 1YIJ3 3GRDA 5M18A 1VQ53 4HZBB 1I2FA 1MWRA 4EBGA 3CCS3 3CNMA 2XSHB 3KSED 1LQMB 3CNXA 3SXXA 5M1AA 3EBTA 4LSOA 1SIHA 1S5AA 1VQK3 3T0UA 2ZHXB 3JUMA 4CDLA 4AEQA 2SBLA 3OWUA 4GB5A 2WGQA 3T8NA 1EA2A 4HKVB 5G1LA 1W4NA 1TRQA 5IEPA 2JDIH 1BNRA 1V57A 1YIT3 1MNLA 1S723 3BLZA 5AYSC 1VQQA 3EN1B 5DREA 1IT8A 3F7XA 9RNTA 1LRAA 1BSCA 1F8NA 1RJOA 2HMKB 3ER7A 1IVWA 3KE7A 3CPW2 4MMYB 2OTJ3 1K28A 1TP6A 1NB5I 1NWWA 3DGMA 1UUVB 2YFIB 4BTXA 1TFOA 4N6UA 3UL6A 3FSDA 3X42A 3CU3A 3EBYA 2J8XB 2QA43 1QMAA 3S67A 1DMMA 2Z7AA 1BRSA 3LXUX 1W7CA 4HM2B 4NPBA 4HYZA 5HGRA 3OW22 3VSYA 3AMOB 4HM4B 1R4CA 1W6CA 2QGUA 2KF6A 1EG9B 1OACA 3EQQB 3MG3A 2Z76A 2L4VA 3FZWA 4N6V0 3G16A 3MYTA 5IG0A 1BSEA 2CFDA 2ML6A 1VQO3 3K7CA 1IYYA 3DGOA 2P09A 1MGWA 1E3VA 2RCDA 3JUPA 4K1UA 4O2HA 1I70A 1D6UA 3STDA 5CF2A 1RGGA 2WO0A 3FCSB 1OF5B 1V58A 3ECFA 4DKIA 1WTHA 2O9UX 4HM0B 1CYUA 1IQXA 4O3VA 3VF1A 1O7PB 4KFEA 4XBYA 5IG5A 2W9QA 1GOYA 4K90B 4EW5A 1Q864 1JBRA 2BMQB 4BL3A 2BMOB 1G0TA 4RNYA 3WOEB 3PS8A 3F14A 1NJI4 1STDA 3G713 1CYVA 1M1K4 3A5EA 1SARA 3LT8A 2XRXB 2XH9A 4KZ1A 4AKYA 1TRPA 1MWUA 1BRKA 2E2UA 3IJEB 1OGZA 3OX9A 3B8LA 3N54B 1LXEA 3PYJA 1TFKA 1OGXA 1RGLA 3DGLA 2WOHA 3HI7A 5AIFA 1J2BA 4JF8A 1N5HA 1LVNA 1W6GA 5KP4A 3K5TA 1BANA 3MG2A 3U1WA 1LQGC 2D1WA 4XBXA 3WR2A 3K0ZA 5ELUA 1I3FA 1RHLA 5HOHA 5IW9A 3EC9A 2IUJA 3SOYA 3M8CA 1B3SA 1BSBA 1VQ83 3LTBA 4OVMA 3RNTA 3CME3 4STDA 1E97A 1JKGB 1FUTA 1GMRA 3DM8A 2P38A 3GZXB 4FCJA 1OHOA 2CHCA 1GMPA 1RN4A 1BOXA 4FMCA 3D79A 1AV4A 3KFQC 3QRDA 4G1MB 5IENA 1YVSA 3CCE3 3Q2PA 1UGHI 4N6NB 2F5MA 3KCHA 3CC43 1W02A 1G02A 3S27A 5IERA 4K61A 1AVKA 1T2HA 3MKIA 2ZA4A 4N6LA 1FUSA 3F9SA 5I97A 5BXQA 2IA7A 3L0RA 3NX0A 2HMJB 3E99A 4X2OA 1L5GB 1E3RA 4FMAA 4J8TA 1VQ93 3F7SA 4PEJA 2CWUA 2FGTA 3UNLA 2GU3A 2M7OA 1D6ZA 4RNTA 4BIRA 5LC7A 1QAFA 3WOFB 4XB5A 2SARA 2GU1A 4HAAA 3PCRA 4HM8B 5D82A 2W2CA 1A2VA 3SOAA 1VQL3 1OUNA 2F56A 3B7CA 1Q814 1I3IA 5KP3A 1UGIA 3X41A 1Y4KA 3CC73 1GY5A 3JUQA
chains in the Genus database with same CATH topology
1GS3A 3LOYA 3CMA3 3DUKA 3MPHA 3LTDA 4HM6B 5IG3A 3EE1A 3CCM3 1SPUA 4N6OB 2MF7A 4GL6A 4H3UA 3UJMA 2W0QA 1Q40A 1UW1A 3CD63 4MEIA 1RKYA 1JN5A 4R1KA 2CG0A 1K734 6STDA 1TU5A 3CCJ3 2CC3A 5IG4A 1IQ8A 4NREA 2XFTA 4N3VA 3JVCA 3S28A 3GWRA 4QWTA 1HKXA 1M9GA 2W04A 2CFGA 1U8CB 3NQZA 1O7GB 1ISKA 2OQEA 5JBSA 4LZIA 3Q1CA 1SIIA 2QIYA 3JUOA 3OWYA 1W00A 2F98A 1AVLA 3U97A 3NBBA 2PZVA 1IV7A 2KCDA 5BVBA 2XF3A 1K8A4 2XGNA 2B24B 3EF8A 5AIGA 3J7Yd 1YJ93 2A15A 3S5CA 3S29A 3FG1A 2YFLB 1GD3A 4WYKB 1QVF2 1JB4A 1NB3I 3NV0A 4FMBA 2Q07A 1WMOA 4R4KA 3SLUA 3V92A 3JUNA 3A76A 1IDPA 3GZYB 4FCMA 5ELJA 1V74A 3HIIA 3DY5A 2HMMB 1QVG2 1N5PA 1UUWB 1KQS2 4L8OA 4J9AA 2D42A 3I0YA 1A67A 3FKAA 4WP5A 2GXFA 4O02B 1EQKA 1N9EA 2FXTA 2BT3A 3BNDA 1VZZA 1YJW3 2LYXA 4L8PA 3KSPA 1VQN3 3FLJA 1ROAA 1IVXA 4N6TA 5AYRB 2BO9B 3DXOA 4LEHA 1SQWA 2MC8A 5JPPA 3FGYA 1UI8A 3LTCA 3AMOA 2XR8B 3KKGA 3WA2X 1DVDA 1TIJA 5EEOA 5IF6A 1IQYA 2YX9A 3D9RA 3CXC2 3N9HA 5STDA 3GZBA 5FGOA 3NBJA 1UI7A 3HK4A 3PZWA 2LQVA 2Y74A 3FF2A 1OF5A 4R9LA 5CXOA 1JB5A 2CWTA 3CCR3 2CFKA 5CLKA 2OQEC 2GBXB 2YFJB 1N9JA 3FG4A 5KP1A 1CEWI 1LNHA 2K54A 5G2GA 1M904 3BNEA 2XSOB 1VQM3 1DVCA 1OHPA 3BB9A 4I4KA 3B4OA 2W56A 3EHCA 3CCU3 1ULIB 3D3LA 1Q7Y4 3KIIA 1FGRA 4HZ9B 3FF0A 2OWPA 1ZO2A 2P05A 2OOVA 1O7MB 5TGNA 1IK3A 3DZLA 1W2B2 5IEOA 1QAKA 4XBTA 3ROBA 4RZMA 1O7HB 1IVUA 3K63A 1JJ22 2UX0A 3UL5A 3RGRA 3SEDA 3MHEA 1YHQ3 3HZPA 2XEPA 2E2VA 1WMPA 2WGOA 2ML5A 3OV4A 3FG3A 3HX8A 3RGAA 1IT7A 2CFWA 4LMIA 1K9M4 1O7WB 4EYCA 3DMCA 3PCSA 4HM3B 2WOFA 3CCV3 2ZDJA 3OXAA 4BTWA 1OPYA 2CIUA 4ZM8A 1FGTA 1CQSA 2GEXA 4TX4A 1C7HA 3GZRA 4K1VA 4WFOA 1DMQA 2F86B 5AI1A 2V1LA 1OCVA 2CK3H 2STDA 3X3XA 1G96A 5AEUB 3LT9A 1TUHA 3KN4A 1AR0A 1KD14 2Z77A 1FGMA 3EJVA 3N8BA 1JV2B 3F8XA 3IMAB 3F40A 2B1XB 3X3ZA 1ASKA 1WQLB 1QALA 1RRLA 2QEX3 2W9PA 2OCTA 3NQYA 2JQ5A 4HJLB 4AKZA 2C10A 2HMNB 5AIIA 3WMDA 1JRQA 4Q53A 4XM4A 4BTYA 3I563 1IV9A 4NHFA 4ORLA 3LYGA 4N6MA 2INXA 5EVHA 2E2TA 1NO3A 1JB2A 3EX9A 1T5YA 2BMRB 5LC6A 2XFSA 3WA3A 3NV0B 7STDA 3G8ZA 3WDGB 1FA3A 1GY5A 1Z1SA 2K0MA 1WMNA 1KSIA 2W6JH 1STFI 2OOVC 4XDVA 1RN7A 4OK0A 3G4S3 3NUVA 1NU3A 3QK9A 1PU4A 3LZAA 3TDGA 2F99A 3H3HA 1KC84 3O8YA 4KFDA 2PNCA 2W03A 1LOXA 3PGBA 2FNQA 4FCZA 3KZTA 3LH4A 4RBNA 4WYKA 4L7KA 5CK6A 2RSXA 2XGLA 5AEWB 3T8UA 3V99A 2HMLB 3EB8A 3VGNA 3NM2A 1DMNA 1W2ZA 8CHOA 4R9KA 1YJN3 1YI23 1K41A 4WHAA 1US1A 4MMZB 1EKMA 3X3YA 1RRHA 1IVVA 2CW9A 3FH1A 1GY7A 5FW5A 3OWSA 4FMDA 1M1XB 3CCQ3 3BNBA 1ZX2A 2KXGA 3BNCA 3IPTA 1HU9A 2CFLA 3GAXA 1YVBI 1VQP3 4RNZA 4X2HA 5JPUA 3MG1A 4O8SA 4EC6A 3NHXA 4KFFA 1JNQA 5CF1A 3LTAA 3G0KA 1ROVA 4HM7B 3V98A 3DGNA 2CWVA 4U13A 2P0MA 2P0XA 3HIGA 5D83A 1N8R4 1A90A 4LGQA 3H51A 4MMXB 1GYBA 3PXMA 5EQLA 1U5OA 4CCVA 4EV2A 2W56B 2IUKA 2BNGA 1GD4A 3EN8A 2Y73A 4KVHA 2CKFB 2IMJA 2R4IA 1BUQA 2HMOB 4HBRA 4XDWA 1ULJB 2GEYA 3SX1A 4R80A 4MJDA 4WWUC 2C11A 1FGQA 1MOLA 3F8HA 3WODG 3NBRA 1Q824 3K9MC 2RFRA 4EXRA 1VQ43 1FUWA 4IPBA 1JKGA 1GY6A 4H61A 4HVNA 4OUQA 3CCL3 1A2KA 5AIHA 1NDOB 1D6YA 1PFPA 1W5ZA 3G6E3 2CH9A 4IT7A 1WNHA 1OHSA 5A0OB 2BHMA 1KWIA 1IU7A 4HM1B 1SJWA 3Q90A 4FR9A 1VQ63 1FGOA 1DYUA 4EV5A 1VQ73 1Q40B 1W01A 3MSOA 1N8QA 1JN5B 3I553 2O3OA 3X40A 3NXJA 2ZL8A 1QJGA 5D81A 3LMLA 2I9WA 4HM5B 2KRTA 5DRVA 2GBWB 1YGEA 3B4PA 3SVAA 3CPOA 3MWZA 1OH0A 4JRFA 3RDEA 4IIAA 3NM7A 1O7NB 1Q42A 1W6YA 3ALAA 3UB1A 2Z6BA 2OTL3 2CG1A 1YIJ3 3GRDA 4HZBB 4EBGA 3CCS3 3CNMA 2XSHB 3KSED 3CNXA 3SXXA 3EBTA 4LSOA 1SIHA 1S5AA 1VQK3 3T0UA 3JUMA 4CDLA 4AEQA 2SBLA 3OWUA 4GB5A 2WGQA 3T8NA 1EA2A 4HKVB 1W4NA 5IEPA 2JDIH 1YIT3 1MNLA 1S723 3BLZA 5AYSC 3EN1B 5DREA 1IT8A 3F7XA 1F8NA 1RJOA 2HMKB 3ER7A 1IVWA 3KE7A 3CPW2 4MMYB 2OTJ3 1K28A 1TP6A 1NB5I 1NWWA 3DGMA 1UUVB 2YFIB 4BTXA 1TFOA 4N6UA 3UL6A 3FSDA 3X42A 3CU3A 3EBYA 2QA43 1QMAA 3S67A 1DMMA 2Z7AA 4HM2B 3LXUX 1W7CA 4HYZA 5HGRA 3OW22 3VSYA 3AMOB 4HM4B 1R4CA 1W6CA 2QGUA 1EG9B 1OACA 3EQQB 3MG3A 2Z76A 2L4VA 3FZWA 4N6V0 3G16A 3MYTA 5IG0A 2ML6A 2CFDA 1VQO3 3K7CA 3DGOA 2P09A 2RCDA 1E3VA 3JUPA 4K1UA 4O2HA 3STDA 5CF2A 1D6UA 2WO0A 3FCSB 1OF5B 3ECFA 1WTHA 2O9UX 4HM0B 1CYUA 1IQXA 4O3VA 3VF1A 1O7PB 4KFEA 4XBYA 5IG5A 2W9QA 4K90B 1Q864 2BMQB 2BMOB 3WOEB 4RNYA 3PS8A 3F14A 1NJI4 1STDA 3G713 1CYVA 1M1K4 3LT8A 2XRXB 2XH9A 4KZ1A 4AKYA 2E2UA 3IJEB 1OGZA 3OX9A 3B8LA 3N54B 1LXEA 3PYJA 1TFKA 1OGXA 3DGLA 2WOHA 3HI7A 5AIFA 1J2BA 4JF8A 1N5HA 1LVNA 1W6GA 5KP4A 3K5TA 3MG2A 3U1WA 2D1WA 4XBXA 3K0ZA 5ELUA 5IW9A 3EC9A 2IUJA 3SOYA 3M8CA 1VQ83 3LTBA 4OVMA 3CME3 4STDA 1E97A 1JKGB 3DM8A 2P38A 3GZXB 4FCJA 1OHOA 2CHCA 4FMCA 4G1MB 1AV4A 3KFQC 3QRDA 5IENA 3CCE3 3Q2PA 4N6NB 3CC43 1W02A 3S27A 5IERA 4K61A 1AVKA 3MKIA 4N6LA 5I97A 1VQ53 3F9SA 3CC23 5BXQA 2IA7A 3L0RA 3NX0A 2HMJB 3E99A 4X2OA 1L5GB 1E3RA 4FMAA 4J8TA 1VQ93 3F7SA 4PEJA 2CWUA 2FGTA 3UNLA 2GU3A 2M7OA 1D6ZA 5LC7A 1QAFA 3WOFB 4XB5A 2GU1A 3PCRA 4HM8B 5D82A 2W2CA 1A2VA 3SOAA 1VQL3 1OUNA 3B7CA 1Q814 5KP3A 3X41A 1Y4KA 3CC73 2RGQA 3JUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K63 A;  2KRT A;  3JVC A; 
#chains in the Genus database with same CATH topology
 1GS3 A;  1MWS A;  3LOY A;  3DUK A;  3MPH A;  3URP A;  6GSP A;  3CMA 3;  3LTD A;  4HM6 B;  5IG3 A;  3EE1 A;  3CCM 3;  1SPU A;  4N6O B;  2MF7 A;  1RGK A;  4GL6 A;  4H3U A;  2W0Q A;  1Q40 A;  3UJM A;  1UW1 A;  3CD6 3;  4MEI A;  4GHO A;  1RKY A;  1JN5 A;  4R1K A;  2CG0 A;  1AY7 A;  6STD A;  1K73 4;  1TU5 A;  1LNI A;  3CCJ 3;  2CC3 A;  1JZD A;  5IG4 A;  1IQ8 A;  4NRE A;  2XFT A;  4N3V A;  3JVC A;  3S28 A;  3GWR A;  1RTU A;  4QWT A;  1HKX A;  1M9G A;  2W04 A;  1BNG A;  2CFG A;  3ZFZ A;  1U8C B;  3NQZ A;  1O7G B;  1ISK A;  1RN1 A;  3D4A A;  2OQE A;  5JBS A;  2CX1 A;  4LZI A;  3Q1C A;  3AHS A;  1SII A;  2QIY A;  3JUO A;  3OWY A;  1W00 A;  2H0H A;  2F98 A;  1AVL A;  3U97 A;  3NBB A;  2PZV A;  1IV7 A;  2KCD A;  5BVB A;  2XF3 A;  1K8A 4;  2B24 B;  2XGN A;  3EF8 A;  1B27 A;  5AIG A;  3J7Y d;  2A15 A;  3S5C A;  3S29 A;  2KAA A;  3FG1 A;  2YFL B;  2F5W A;  1GD3 A;  4WYK B;  1FW7 A;  1QVF 2;  1JB4 A;  1NB3 I;  3NV0 A;  4FMB A;  2Q07 A;  1WMO A;  7GSP A;  3DH2 A;  2AAE A;  4R4K A;  3SLU A;  3V92 A;  3JUN A;  3A76 A;  1IDP A;  1FZU A;  3AGN A;  3GZY B;  1V74 A;  4FCM A;  3HII A;  5ELJ A;  3DY5 A;  2HMM B;  1QVG 2;  1N5P A;  1UUW B;  1KQS 2;  4L8O A;  1B2M A;  2H0I A;  2K3D A;  4J9A A;  1UCI A;  2D42 A;  3I0Y A;  1A67 A;  1I2G A;  3FKA A;  2C4B A;  4WP5 A;  2GXF A;  4O02 B;  2HOH A;  1EQK A;  1A2P A;  1N9E A;  2RNT A;  1X1X A;  2FXT A;  2BT3 A;  3BND A;  1VZZ A;  1NNV A;  1YJW 3;  2LYX A;  2UGI A;  4L8P A;  3KSP A;  1VQN 3;  3FLJ A;  1ROA A;  1DET A;  1T2I A;  1IVX A;  4N6T A;  5AYR B;  4LYL B;  2BO9 B;  3DXO A;  1LOW A;  4LEH A;  1SQW A;  2MC8 A;  1ZGX A;  2H0G A;  2KF4 A;  3AGO A;  5JPP A;  1B20 A;  1GSP A;  1HYF A;  1UI8 A;  3FGY A;  3HOH A;  3LTC A;  1DE3 A;  4CJN A;  3AMO A;  1BNS A;  2XR8 B;  1MGR A;  3KKG A;  4ILF A;  3WA2 X;  1DVD A;  1TIJ A;  5EEO A;  1RGE A;  1IQY A;  2YX9 A;  3D9R A;  5IF6 A;  3CXC 2;  3N9H A;  5STD A;  3GZB A;  5FGO A;  1YGW A;  3NBJ A;  1UI7 A;  3HK4 A;  3PZW A;  2BU4 A;  2LQV A;  2Y74 A;  3FF2 A;  1OF5 A;  2GSP A;  4R9L A;  5CXO A;  1JB5 A;  2CWT A;  3CCR 3;  4KT3 B;  1BRJ A;  1BSD A;  2CFK A;  2F4Y A;  5CLK A;  1UUG B;  2GBX B;  2OQE C;  1N9J A;  2YFJ B;  3FG4 A;  5GSP A;  5KP1 A;  1T3B A;  1CEW I;  1LNH A;  2K54 A;  5G2G A;  1BNJ A;  5G1K A;  1M90 4;  3BNE A;  2XSO B;  1VQM 3;  1DVC A;  2RBI A;  1OHP A;  1GMQ A;  1RGC A;  3BB9 A;  4I4K A;  3B4O A;  2W56 A;  3EHC A;  3CCU 3;  1HZ1 A;  1ULI B;  1ZS7 A;  3D3L A;  1Q7Y 4;  3KII A;  1FGR A;  4HZ9 B;  3FF0 A;  2OWP A;  1ZO2 A;  2P05 A;  1X1W A;  1O7M B;  1BNF A;  5TGN A;  2OOV A;  1IK3 A;  1RNB A;  3DZL A;  1W2B 2;  5IEO A;  1QAK A;  4XBT A;  3ROB A;  4RZM A;  1O7H B;  1IVU A;  3K63 A;  1JJ2 2;  1RGH A;  2UX0 A;  3SYU A;  3UL5 A;  3RGR A;  3SED A;  3MHE A;  1YHQ 3;  3HZP A;  1I8V A;  2XEP A;  1C54 A;  2E2V A;  1BNI A;  1RDS A;  1WMP A;  1UCJ A;  2WGO A;  1X1Y A;  2ML5 A;  3OV4 A;  3FG3 A;  1TTO A;  1EUI C;  3HX8 A;  3RGA A;  1IT7 A;  2CFW A;  4LMI A;  1K9M 4;  1O7W B;  2AAD A;  4EYC A;  3DMC A;  3PCS A;  1B21 A;  4HM3 B;  2WOF A;  3CCV 3;  2ZDJ A;  3OXA A;  4BTW A;  1OPY A;  2CIU A;  1B2S A;  1FGT A;  1CQS A;  2GEX A;  4ZM8 A;  4TX4 A;  1C7H A;  1FYS A;  3GZR A;  4K1V A;  4WFO A;  1DMQ A;  1RLS A;  2F86 B;  5AI1 A;  2V1L A;  1OCV A;  2CK3 H;  2STD A;  3X3X A;  1G96 A;  2L1S A;  5AEU B;  3WHO A;  4CPK A;  3LT9 A;  1PYL A;  1TUH A;  3KN4 A;  1AR0 A;  1EEJ A;  1BRG A;  1KD1 4;  2Z77 A;  1FGM A;  3EJV A;  3N8B A;  1JV2 B;  3F8X A;  2UUG C;  3F40 A;  2B1X B;  3IMA B;  3X3Z A;  1YNV X;  1BRH A;  1ASK A;  1WQL B;  1QAL A;  1RRL A;  2QEX 3;  2W9P A;  3AHW A;  4BU4 A;  2OCT A;  2R41 A;  3NQY A;  2JQ5 A;  4HJL B;  1BUJ A;  4AKZ A;  1PY3 A;  1RSN A;  2C10 A;  2HMN B;  5AII A;  3WMD A;  1JRQ A;  4Q53 A;  4XM4 A;  4BTY A;  3I56 3;  1IV9 A;  4NHF A;  4ORL A;  3LYG A;  1BSA A;  2INX A;  4N6M A;  2E2T A;  1NO3 A;  5EVH A;  1JB2 A;  3EX9 A;  1T5Y A;  2BMR B;  5LC6 A;  3BIR A;  4BL2 A;  1JZO A;  2XFS A;  3WA3 A;  3NV0 B;  7STD A;  3G8Z A;  3WDG B;  1JBT A;  1JBS A;  1FA3 A;  1Z1S A;  2K0M A;  1RMS A;  1WMN A;  1KSI A;  2W6J H;  1STF I;  2OOV C;  4XDV A;  1RN7 A;  3ZG0 A;  4OK0 A;  3G4S 3;  1RCL A;  4I5Q A;  3NUV A;  1NU3 A;  3QK9 A;  1PU4 A;  3LZA A;  3TDG A;  2F99 A;  1R4Y A;  3H3H A;  1KC8 4;  3O8Y A;  4KFD A;  2PNC A;  2W03 A;  1LOX A;  3PGB A;  2FNQ A;  4FCZ A;  3KZT A;  2RGQ A;  3LH4 A;  4RBN A;  4WYK A;  4L7K A;  5CK6 A;  2RSX A;  3CC2 3;  2XGL A;  5AEW B;  1GOV A;  4GSP A;  3T8U A;  1GOU A;  3V99 A;  2HML B;  3EB8 A;  3VGN A;  3NM2 A;  1DMN A;  1W2Z A;  8CHO A;  4R9K A;  1YJN 3;  1YI2 3;  1K41 A;  4WHA A;  1B2X A;  1US1 A;  4MMZ B;  1EKM A;  3X3Y A;  1RRH A;  1IVV A;  2CW9 A;  3FH1 A;  1GY7 A;  5FW5 A;  3OWS A;  4FMD A;  1M1X B;  3CCQ 3;  4HOH A;  3BNB A;  1ZX2 A;  2KXG A;  3BU4 A;  3DGY A;  1B2Z A;  4J5G A;  3BNC A;  3IPT A;  1I0X A;  1HU9 A;  2CFL A;  3GAX A;  1YVB I;  1VQP 3;  4RNZ A;  4X2H A;  1UDI I;  5JPU A;  3MG1 A;  4O8S A;  2IY2 A;  4EC6 A;  3NHX A;  4KFF A;  1JNQ A;  1Q9E A;  5CF1 A;  3LTA A;  3G0K A;  1ROV A;  4HM7 B;  1UCL A;  1BU4 A;  3V98 A;  3DGN A;  2CWV A;  4U13 A;  2P0M A;  2P0X A;  3HIG A;  5D83 A;  1N8R 4;  1A90 A;  4LGQ A;  3H51 A;  1UCK A;  4MMX B;  1GYB A;  3PXM A;  5EQL A;  1U5O A;  4CCV A;  4EV2 A;  2W56 B;  2IUK A;  1TJD A;  2BNG A;  1GD4 A;  1BVI A;  1LOV A;  3EN8 A;  1BGS A;  2Y73 A;  4KVH A;  2CKF B;  2IMJ A;  2R4I A;  1BUQ A;  2HMO B;  4HBR A;  4XDW A;  1ULJ B;  2GEY A;  3SX1 A;  4R80 A;  4MJD A;  2CX0 A;  4J5K A;  2C11 A;  1BRI A;  1FGQ A;  1MOL A;  4WWU C;  3F8H A;  3WOD G;  1RGF A;  3NBR A;  3K9M C;  2RFR A;  4EXR A;  1Q82 4;  1VQ4 3;  1FUW A;  4IPB A;  1JKG A;  1GY6 A;  4H61 A;  4HVN A;  4OUQ A;  3CCL 3;  1A2K A;  5AIH A;  1NDO B;  1D6Y A;  1PFP A;  1W5Z A;  1I0V A;  2CH9 A;  3G6E 3;  5RNT A;  4IT7 A;  1WNH A;  1OHS A;  5A0O B;  2BHM A;  1KWI A;  1RGA A;  1IU7 A;  4HM1 B;  1SJW A;  3Q90 A;  4FR9 A;  1VQ6 3;  1FGO A;  1DYU A;  4EV5 A;  1B2U A;  1I2E A;  2BIR A;  3D5I A;  3Q3F A;  3ZG5 A;  1VQ7 3;  1Q40 B;  1W01 A;  3MSO A;  1N8Q A;  1JN5 B;  5BU4 A;  5M19 A;  1BNE A;  3I55 3;  1Q7H A;  1BRN L;  2O3O A;  3X40 A;  3NXJ A;  3D5G A;  1AQZ A;  1RNT A;  3GSP A;  1LOY A;  1BIR A;  2ZL8 A;  5BIR A;  1QJG A;  7RNT A;  5D81 A;  3LML A;  2I9W A;  4HM5 B;  2KRT A;  5DRV A;  8RNT A;  1MWT A;  1BAO A;  2GBW B;  1YGE A;  3B4P A;  3SVA A;  1YJ9 3;  3CPO A;  3MWZ A;  1OH0 A;  4JRF A;  3RDE A;  4IIA A;  1RCK A;  3NM7 A;  6RNT A;  1O7N B;  1Q42 A;  1W6Y A;  2KF3 A;  2KF5 A;  3ALA A;  1CH0 A;  3UB1 A;  2IYJ A;  2Z6B A;  2OTL 3;  1X1U A;  2CG1 A;  1YIJ 3;  3GRD A;  5M18 A;  1VQ5 3;  4HZB B;  1I2F A;  1MWR A;  4EBG A;  3CCS 3;  3CNM A;  2XSH B;  3KSE D;  1LQM B;  3CNX A;  3SXX A;  5M1A A;  3EBT A;  4LSO A;  1SIH A;  1S5A A;  1VQK 3;  3T0U A;  2ZHX B;  3JUM A;  4CDL A;  4AEQ A;  2SBL A;  3OWU A;  4GB5 A;  2WGQ A;  3T8N A;  1EA2 A;  4HKV B;  5G1L A;  1W4N A;  1TRQ A;  5IEP A;  2JDI H;  1BNR A;  1V57 A;  1YIT 3;  1MNL A;  1S72 3;  3BLZ A;  5AYS C;  1VQQ A;  3EN1 B;  5DRE A;  1IT8 A;  3F7X A;  9RNT A;  1LRA A;  1BSC A;  1F8N A;  1RJO A;  2HMK B;  3ER7 A;  1IVW A;  3KE7 A;  3CPW 2;  4MMY B;  2OTJ 3;  1K28 A;  1TP6 A;  1NB5 I;  1NWW A;  3DGM A;  1UUV B;  2YFI B;  4BTX A;  1TFO A;  4N6U A;  3UL6 A;  3FSD A;  3X42 A;  3CU3 A;  3EBY A;  2J8X B;  2QA4 3;  1QMA A;  3S67 A;  1DMM A;  2Z7A A;  1BRS A;  3LXU X;  1W7C A;  4HM2 B;  4NPB A;  4HYZ A;  5HGR A;  3OW2 2;  3VSY A;  3AMO B;  4HM4 B;  1R4C A;  1W6C A;  2QGU A;  2KF6 A;  1EG9 B;  1OAC A;  3EQQ B;  3MG3 A;  2Z76 A;  2L4V A;  3FZW A;  4N6V 0;  3G16 A;  3MYT A;  5IG0 A;  1BSE A;  2CFD A;  2ML6 A;  1VQO 3;  3K7C A;  1IYY A;  3DGO A;  2P09 A;  1MGW A;  1E3V A;  2RCD A;  3JUP A;  4K1U A;  4O2H A;  1I70 A;  1D6U A;  3STD A;  5CF2 A;  1RGG A;  2WO0 A;  3FCS B;  1OF5 B;  1V58 A;  3ECF A;  4DKI A;  1WTH A;  2O9U X;  4HM0 B;  1CYU A;  1IQX A;  4O3V A;  3VF1 A;  1O7P B;  4KFE A;  4XBY A;  5IG5 A;  2W9Q A;  1GOY A;  4K90 B;  4EW5 A;  1Q86 4;  1JBR A;  2BMQ B;  4BL3 A;  2BMO B;  1G0T A;  4RNY A;  3WOE B;  3PS8 A;  3F14 A;  1NJI 4;  1STD A;  3G71 3;  1CYV A;  1M1K 4;  3A5E A;  1SAR A;  3LT8 A;  2XRX B;  2XH9 A;  4KZ1 A;  4AKY A;  1TRP A;  1MWU A;  1BRK A;  2E2U A;  3IJE B;  1OGZ A;  3OX9 A;  3B8L A;  3N54 B;  1LXE A;  3PYJ A;  1TFK A;  1OGX A;  1RGL A;  3DGL A;  2WOH A;  3HI7 A;  5AIF A;  1J2B A;  4JF8 A;  1N5H A;  1LVN A;  1W6G A;  5KP4 A;  3K5T A;  1BAN A;  3MG2 A;  3U1W A;  1LQG C;  2D1W A;  4XBX A;  3WR2 A;  3K0Z A;  5ELU A;  1I3F A;  1RHL A;  5HOH A;  5IW9 A;  3EC9 A;  2IUJ A;  3SOY A;  3M8C A;  1B3S A;  1BSB A;  1VQ8 3;  3LTB A;  4OVM A;  3RNT A;  3CME 3;  4STD A;  1E97 A;  1JKG B;  1FUT A;  1GMR A;  3DM8 A;  2P38 A;  3GZX B;  4FCJ A;  1OHO A;  2CHC A;  1GMP A;  1RN4 A;  1BOX A;  4FMC A;  3D79 A;  1AV4 A;  3KFQ C;  3QRD A;  4G1M B;  5IEN A;  1YVS A;  3CCE 3;  3Q2P A;  1UGH I;  4N6N B;  2F5M A;  3KCH A;  3CC4 3;  1W02 A;  1G02 A;  3S27 A;  5IER A;  4K61 A;  1AVK A;  1T2H A;  3MKI A;  2ZA4 A;  4N6L A;  1FUS A;  3F9S A;  5I97 A;  5BXQ A;  2IA7 A;  3L0R A;  3NX0 A;  2HMJ B;  3E99 A;  4X2O A;  1L5G B;  1E3R A;  4FMA A;  4J8T A;  1VQ9 3;  3F7S A;  4PEJ A;  2CWU A;  2FGT A;  3UNL A;  2GU3 A;  2M7O A;  1D6Z A;  4RNT A;  4BIR A;  5LC7 A;  1QAF A;  3WOF B;  4XB5 A;  2SAR A;  2GU1 A;  4HAA A;  3PCR A;  4HM8 B;  5D82 A;  2W2C A;  1A2V A;  3SOA A;  1VQL 3;  1OUN A;  2F56 A;  3B7C A;  1Q81 4;  1I3I A;  5KP3 A;  1UGI A;  3X41 A;  1Y4K A;  3CC7 3;  1GY5 A;  3JUQ A; 
#chains in the Genus database with same CATH homology
 1GS3 A;  3LOY A;  3CMA 3;  3DUK A;  3MPH A;  3LTD A;  4HM6 B;  5IG3 A;  3EE1 A;  3CCM 3;  1SPU A;  4N6O B;  2MF7 A;  4GL6 A;  4H3U A;  3UJM A;  2W0Q A;  1Q40 A;  1UW1 A;  3CD6 3;  4MEI A;  1RKY A;  1JN5 A;  4R1K A;  2CG0 A;  1K73 4;  6STD A;  1TU5 A;  3CCJ 3;  2CC3 A;  5IG4 A;  1IQ8 A;  4NRE A;  2XFT A;  4N3V A;  3JVC A;  3S28 A;  3GWR A;  4QWT A;  1HKX A;  1M9G A;  2W04 A;  2CFG A;  1U8C B;  3NQZ A;  1O7G B;  1ISK A;  2OQE A;  5JBS A;  4LZI A;  3Q1C A;  1SII A;  2QIY A;  3JUO A;  3OWY A;  1W00 A;  2F98 A;  1AVL A;  3U97 A;  3NBB A;  2PZV A;  1IV7 A;  2KCD A;  5BVB A;  2XF3 A;  1K8A 4;  2XGN A;  2B24 B;  3EF8 A;  5AIG A;  3J7Y d;  1YJ9 3;  2A15 A;  3S5C A;  3S29 A;  3FG1 A;  2YFL B;  1GD3 A;  4WYK B;  1QVF 2;  1JB4 A;  1NB3 I;  3NV0 A;  4FMB A;  2Q07 A;  1WMO A;  4R4K A;  3SLU A;  3V92 A;  3JUN A;  3A76 A;  1IDP A;  3GZY B;  4FCM A;  5ELJ A;  1V74 A;  3HII A;  3DY5 A;  2HMM B;  1QVG 2;  1N5P A;  1UUW B;  1KQS 2;  4L8O A;  4J9A A;  2D42 A;  3I0Y A;  1A67 A;  3FKA A;  4WP5 A;  2GXF A;  4O02 B;  1EQK A;  1N9E A;  2FXT A;  2BT3 A;  3BND A;  1VZZ A;  1YJW 3;  2LYX A;  4L8P A;  3KSP A;  1VQN 3;  3FLJ A;  1ROA A;  1IVX A;  4N6T A;  5AYR B;  2BO9 B;  3DXO A;  4LEH A;  1SQW A;  2MC8 A;  5JPP A;  3FGY A;  1UI8 A;  3LTC A;  3AMO A;  2XR8 B;  3KKG A;  3WA2 X;  1DVD A;  1TIJ A;  5EEO A;  5IF6 A;  1IQY A;  2YX9 A;  3D9R A;  3CXC 2;  3N9H A;  5STD A;  3GZB A;  5FGO A;  3NBJ A;  1UI7 A;  3HK4 A;  3PZW A;  2LQV A;  2Y74 A;  3FF2 A;  1OF5 A;  4R9L A;  5CXO A;  1JB5 A;  2CWT A;  3CCR 3;  2CFK A;  5CLK A;  2OQE C;  2GBX B;  2YFJ B;  1N9J A;  3FG4 A;  5KP1 A;  1CEW I;  1LNH A;  2K54 A;  5G2G A;  1M90 4;  3BNE A;  2XSO B;  1VQM 3;  1DVC A;  1OHP A;  3BB9 A;  4I4K A;  3B4O A;  2W56 A;  3EHC A;  3CCU 3;  1ULI B;  3D3L A;  1Q7Y 4;  3KII A;  1FGR A;  4HZ9 B;  3FF0 A;  2OWP A;  1ZO2 A;  2P05 A;  2OOV A;  1O7M B;  5TGN A;  1IK3 A;  3DZL A;  1W2B 2;  5IEO A;  1QAK A;  4XBT A;  3ROB A;  4RZM A;  1O7H B;  1IVU A;  3K63 A;  1JJ2 2;  2UX0 A;  3UL5 A;  3RGR A;  3SED A;  3MHE A;  1YHQ 3;  3HZP A;  2XEP A;  2E2V A;  1WMP A;  2WGO A;  2ML5 A;  3OV4 A;  3FG3 A;  3HX8 A;  3RGA A;  1IT7 A;  2CFW A;  4LMI A;  1K9M 4;  1O7W B;  4EYC A;  3DMC A;  3PCS A;  4HM3 B;  2WOF A;  3CCV 3;  2ZDJ A;  3OXA A;  4BTW A;  1OPY A;  2CIU A;  4ZM8 A;  1FGT A;  1CQS A;  2GEX A;  4TX4 A;  1C7H A;  3GZR A;  4K1V A;  4WFO A;  1DMQ A;  2F86 B;  5AI1 A;  2V1L A;  1OCV A;  2CK3 H;  2STD A;  3X3X A;  1G96 A;  5AEU B;  3LT9 A;  1TUH A;  3KN4 A;  1AR0 A;  1KD1 4;  2Z77 A;  1FGM A;  3EJV A;  3N8B A;  1JV2 B;  3F8X A;  3IMA B;  3F40 A;  2B1X B;  3X3Z A;  1ASK A;  1WQL B;  1QAL A;  1RRL A;  2QEX 3;  2W9P A;  2OCT A;  3NQY A;  2JQ5 A;  4HJL B;  4AKZ A;  2C10 A;  2HMN B;  5AII A;  3WMD A;  1JRQ A;  4Q53 A;  4XM4 A;  4BTY A;  3I56 3;  1IV9 A;  4NHF A;  4ORL A;  3LYG A;  4N6M A;  2INX A;  5EVH A;  2E2T A;  1NO3 A;  1JB2 A;  3EX9 A;  1T5Y A;  2BMR B;  5LC6 A;  2XFS A;  3WA3 A;  3NV0 B;  7STD A;  3G8Z A;  3WDG B;  1FA3 A;  1GY5 A;  1Z1S A;  2K0M A;  1WMN A;  1KSI A;  2W6J H;  1STF I;  2OOV C;  4XDV A;  1RN7 A;  4OK0 A;  3G4S 3;  3NUV A;  1NU3 A;  3QK9 A;  1PU4 A;  3LZA A;  3TDG A;  2F99 A;  3H3H A;  1KC8 4;  3O8Y A;  4KFD A;  2PNC A;  2W03 A;  1LOX A;  3PGB A;  2FNQ A;  4FCZ A;  3KZT A;  3LH4 A;  4RBN A;  4WYK A;  4L7K A;  5CK6 A;  2RSX A;  2XGL A;  5AEW B;  3T8U A;  3V99 A;  2HML B;  3EB8 A;  3VGN A;  3NM2 A;  1DMN A;  1W2Z A;  8CHO A;  4R9K A;  1YJN 3;  1YI2 3;  1K41 A;  4WHA A;  1US1 A;  4MMZ B;  1EKM A;  3X3Y A;  1RRH A;  1IVV A;  2CW9 A;  3FH1 A;  1GY7 A;  5FW5 A;  3OWS A;  4FMD A;  1M1X B;  3CCQ 3;  3BNB A;  1ZX2 A;  2KXG A;  3BNC A;  3IPT A;  1HU9 A;  2CFL A;  3GAX A;  1YVB I;  1VQP 3;  4RNZ A;  4X2H A;  5JPU A;  3MG1 A;  4O8S A;  4EC6 A;  3NHX A;  4KFF A;  1JNQ A;  5CF1 A;  3LTA A;  3G0K A;  1ROV A;  4HM7 B;  3V98 A;  3DGN A;  2CWV A;  4U13 A;  2P0M A;  2P0X A;  3HIG A;  5D83 A;  1N8R 4;  1A90 A;  4LGQ A;  3H51 A;  4MMX B;  1GYB A;  3PXM A;  5EQL A;  1U5O A;  4CCV A;  4EV2 A;  2W56 B;  2IUK A;  2BNG A;  1GD4 A;  3EN8 A;  2Y73 A;  4KVH A;  2CKF B;  2IMJ A;  2R4I A;  1BUQ A;  2HMO B;  4HBR A;  4XDW A;  1ULJ B;  2GEY A;  3SX1 A;  4R80 A;  4MJD A;  4WWU C;  2C11 A;  1FGQ A;  1MOL A;  3F8H A;  3WOD G;  3NBR A;  1Q82 4;  3K9M C;  2RFR A;  4EXR A;  1VQ4 3;  1FUW A;  4IPB A;  1JKG A;  1GY6 A;  4H61 A;  4HVN A;  4OUQ A;  3CCL 3;  1A2K A;  5AIH A;  1NDO B;  1D6Y A;  1PFP A;  1W5Z A;  3G6E 3;  2CH9 A;  4IT7 A;  1WNH A;  1OHS A;  5A0O B;  2BHM A;  1KWI A;  1IU7 A;  4HM1 B;  1SJW A;  3Q90 A;  4FR9 A;  1VQ6 3;  1FGO A;  1DYU A;  4EV5 A;  1VQ7 3;  1Q40 B;  1W01 A;  3MSO A;  1N8Q A;  1JN5 B;  3I55 3;  2O3O A;  3X40 A;  3NXJ A;  2ZL8 A;  1QJG A;  5D81 A;  3LML A;  2I9W A;  4HM5 B;  2KRT A;  5DRV A;  2GBW B;  1YGE A;  3B4P A;  3SVA A;  3CPO A;  3MWZ A;  1OH0 A;  4JRF A;  3RDE A;  4IIA A;  3NM7 A;  1O7N B;  1Q42 A;  1W6Y A;  3ALA A;  3UB1 A;  2Z6B A;  2OTL 3;  2CG1 A;  1YIJ 3;  3GRD A;  4HZB B;  4EBG A;  3CCS 3;  3CNM A;  2XSH B;  3KSE D;  3CNX A;  3SXX A;  3EBT A;  4LSO A;  1SIH A;  1S5A A;  1VQK 3;  3T0U A;  3JUM A;  4CDL A;  4AEQ A;  2SBL A;  3OWU A;  4GB5 A;  2WGQ A;  3T8N A;  1EA2 A;  4HKV B;  1W4N A;  5IEP A;  2JDI H;  1YIT 3;  1MNL A;  1S72 3;  3BLZ A;  5AYS C;  3EN1 B;  5DRE A;  1IT8 A;  3F7X A;  1F8N A;  1RJO A;  2HMK B;  3ER7 A;  1IVW A;  3KE7 A;  3CPW 2;  4MMY B;  2OTJ 3;  1K28 A;  1TP6 A;  1NB5 I;  1NWW A;  3DGM A;  1UUV B;  2YFI B;  4BTX A;  1TFO A;  4N6U A;  3UL6 A;  3FSD A;  3X42 A;  3CU3 A;  3EBY A;  2QA4 3;  1QMA A;  3S67 A;  1DMM A;  2Z7A A;  4HM2 B;  3LXU X;  1W7C A;  4HYZ A;  5HGR A;  3OW2 2;  3VSY A;  3AMO B;  4HM4 B;  1R4C A;  1W6C A;  2QGU A;  1EG9 B;  1OAC A;  3EQQ B;  3MG3 A;  2Z76 A;  2L4V A;  3FZW A;  4N6V 0;  3G16 A;  3MYT A;  5IG0 A;  2ML6 A;  2CFD A;  1VQO 3;  3K7C A;  3DGO A;  2P09 A;  2RCD A;  1E3V A;  3JUP A;  4K1U A;  4O2H A;  3STD A;  5CF2 A;  1D6U A;  2WO0 A;  3FCS B;  1OF5 B;  3ECF A;  1WTH A;  2O9U X;  4HM0 B;  1CYU A;  1IQX A;  4O3V A;  3VF1 A;  1O7P B;  4KFE A;  4XBY A;  5IG5 A;  2W9Q A;  4K90 B;  1Q86 4;  2BMQ B;  2BMO B;  3WOE B;  4RNY A;  3PS8 A;  3F14 A;  1NJI 4;  1STD A;  3G71 3;  1CYV A;  1M1K 4;  3LT8 A;  2XRX B;  2XH9 A;  4KZ1 A;  4AKY A;  2E2U A;  3IJE B;  1OGZ A;  3OX9 A;  3B8L A;  3N54 B;  1LXE A;  3PYJ A;  1TFK A;  1OGX A;  3DGL A;  2WOH A;  3HI7 A;  5AIF A;  1J2B A;  4JF8 A;  1N5H A;  1LVN A;  1W6G A;  5KP4 A;  3K5T A;  3MG2 A;  3U1W A;  2D1W A;  4XBX A;  3K0Z A;  5ELU A;  5IW9 A;  3EC9 A;  2IUJ A;  3SOY A;  3M8C A;  1VQ8 3;  3LTB A;  4OVM A;  3CME 3;  4STD A;  1E97 A;  1JKG B;  3DM8 A;  2P38 A;  3GZX B;  4FCJ A;  1OHO A;  2CHC A;  4FMC A;  4G1M B;  1AV4 A;  3KFQ C;  3QRD A;  5IEN A;  3CCE 3;  3Q2P A;  4N6N B;  3CC4 3;  1W02 A;  3S27 A;  5IER A;  4K61 A;  1AVK A;  3MKI A;  4N6L A;  5I97 A;  1VQ5 3;  3F9S A;  3CC2 3;  5BXQ A;  2IA7 A;  3L0R A;  3NX0 A;  2HMJ B;  3E99 A;  4X2O A;  1L5G B;  1E3R A;  4FMA A;  4J8T A;  1VQ9 3;  3F7S A;  4PEJ A;  2CWU A;  2FGT A;  3UNL A;  2GU3 A;  2M7O A;  1D6Z A;  5LC7 A;  1QAF A;  3WOF B;  4XB5 A;  2GU1 A;  3PCR A;  4HM8 B;  5D82 A;  2W2C A;  1A2V A;  3SOA A;  1VQL 3;  1OUN A;  3B7C A;  1Q81 4;  5KP3 A;  3X41 A;  1Y4K A;  3CC7 3;  2RGQ A;  3JUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...