3K63A

X-ray structure of the pf04200 domain from q9pra0_urepa protein of ureaplasma parvum. nesg target uur17a.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
MEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKNGTLKLSLMLTDKKNNQVYYKLLEVSGFKSNPYGVDENGTIPGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid binding protein
molecule keywords Conserved hypothetical membrane lipoprotein
publication title X-ray structure of the PF04200 domain from Q9PRA0_UREPA protein of Ureaplasma parvum.
rcsb
source organism Ureaplasma parvum
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04200 Lipoprotein_17 Lipoprotein associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.270 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3k63A01
3K63A 3JVCA 2KRTA
chains in the Genus database with same CATH superfamily
1U8CB 1DYUA 2WOHA 3X3YA 4AKYA 1O7PB 1YGWA 1STDA 1C54A 2GBWB 3DGOA 2C4BA 1FZUA 1BNFA 4HBRA 4RNZA 4EW5A 1S723 3CPW2 5AIGA 3LH4A 2CFKA 3CCM3 1US1A 2JDIH 2L1SA 3BB9A 4FR9A 4XM4A 3FGYA 1BVIA 1BRJA 3Q1CA 1BSEA 5AIFA 3G4S3 3ROBA 2C11A 2P05A 5G2GA 1B3SA 1RMSA 2SBLA 3NQYA 4HM0B 4HM1B 3STDA 1ZO2A 2F56A 3NBJA 5G1LA 3X40A 3KFQC 1FGTA 1BNIA 1ZS7A 1DMNA 3JUMA 3A76A 5ELJA 1MNLA 2YFIB 3DH2A 5IF6A 7STDA 3KSED 1LQGC 1OCVA 1BNGA 3NM7A 1DVCA 1VQL3 1BNJA 1RCKA 2CW9A 1JB5A 4O2HA 1OUNA 1SIHA 2MF7A 3LTAA 1RNBA 4FCZA 1K9M4 5CF2A 3N9HA 3PGBA 5BU4A 2OTJ3 2IYJA 4BL2A 1LOWA 3KZTA 4AKZA 1KQS2 4NHFA 5RNTA 3DMCA 4GSPA 3G713 3NQZA 2BIRA 3FLJA 5KP4A 2F5WA 2XGNA 3PS8A 2BMRB 2Z6BA 1JBSA 1BSCA 3AGOA 1G96A 1RDSA 1QALA 2CWVA 7RNTA 5EEOA 1AVKA 2Q07A 1IDPA 3GSPA 3X41A 3HIGA 1GYBA 1TFKA 1ISKA 2F4YA 8CHOA 3B4OA 3LTCA 1I2GA 2M7OA 3JUOA 4CCVA 1OHPA 4J8TA 5D81A 3Q3FA 1EG9B 1S5AA 1YIT3 1SIIA 1W00A 5M18A 1V57A 1W6GA 4I4KA 4CDLA 3EHCA 1QVG2 2GXFA 1HU9A 1UGIA 1R4YA 2R41A 1BU4A 2KCDA 3AHSA 3F8XA 1TUHA 1ULJB 1VQ53 1E97A 1A2VA 1OHOA 2W56A 4O8SA 4WYKB 4WHAA 3CMA3 1A2KA 3ZG0A 3KCHA 4LSOA 3CCE3 1X1YA 3K0ZA 1EQKA 3LXUX 1YVSA 1SARA 3VF1A 2SARA 2XGLA 4HM6B 1FYSA 3CC23 2QA43 4OVMA 4EV5A 3CCQ3 2L4VA 1NO3A 3BNCA 1LNIA 3OXAA 5GSPA 7GSPA 3NX0A 3BIRA 1W6YA 3FG3A 1Q7HA 1RGFA 4L8OA 5D83A 2B24B 3OW22 1FGMA 3JUQA 4FMBA 1ASKA 1BRKA 4HM7B 5HOHA 1UW1A 5DREA 2FGTA 4I5QA 1SJWA 2RCDA 1FGQA 4U13A 1EKMA 1OGXA 2P09A 4AEQA 2OQEC 2OOVA 3FF0A 6RNTA 1OHSA 4L8PA 1Q40B 1GOUA 3EN8A 3CCU3 3RGRA 1K41A 1WMNA 1SPUA 4KFFA 2STDA 2P0XA 5KP3A 1RN7A 1C7HA 1BUQA 3OWSA 4FMDA 2XSOB 3OWYA 4Q53A 1OACA 4J9AA 2BMQB 3SX1A 1RCLA 1Q42A 1O7WB 4MMZB 3K7CA 4BL3A 4DKIA 1BIRA 3CU3A 4ZM8A 2KF5A 2XH9A 3V98A 3GZBA 4WP5A 4JF8A 6GSPA 1BRGA 3D79A 5M1AA 4L7KA 5AIIA 1GMRA 4BTYA 1RGCA 3GZXB 1MWTA 3K5TA 1LOYA 2OTL3 2Z77A 2RBIA 1JBRA 1B27A 1WMOA 3LTBA 1YHQ3 1AV4A 1OPYA 4HAAA 3TDGA 3HI7A 1YGEA 3V99A 4GHOA 1GOYA 2F99A 5AYRB 1UCJA 4RZMA 1KD14 2CWTA 3U1WA 5BVBA 5BXQA 1FUTA 3SXXA 2BO9B 3GRDA 3N54B 4EYCA 3MSOA 1JZOA 4N6LA 3WR2A 1VQ63 1VQ73 1F8NA 1Q7Y4 3RDEA 2P0MA 4R80A 3M8CA 2W04A 1TTOA 1JN5B 3WMDA 2OWPA 3Q2PA 3X42A 2KXGA 1BANA 3EE1A 2WGOA 1K734 4IIAA 1PY3A 2YFLB 4LMIA 1W7CA 3CC43 3B8LA 2CC3A 4X2HA 2AAEA 1NWWA 2P38A 2A15A 3EBTA 1KC84 3LYGA 1ROAA 1B21A 3X3ZA 2CK3H 1IQ8A 1BRNL 1MGRA 1IYYA 3ECFA 2UX0A 1DMQA 3I563 3WOEB 1W2B2 3F7SA 1LOXA 2XFTA 1D6UA 5CLKA 3AMOB 3X3XA 4FMAA 3UL5A 1ZX2A 3MHEA 1M1K4 1BRIA 3LTDA 3GZYB 3IJEB 4H61A 2IUKA 1Q814 4XBTA 2PZVA 1LXEA 4HJLB 1IK3A 1B2MA 4HM4B 4LEHA 4OUQA 4FCMA 5JBSA 2CKFB 2MC8A 5IENA 1JB2A 1B2UA 3T8UA 1A67A 5STDA 2KRTA 4HM2B 3G0KA 1MGWA 3KIIA 4G1MB 3UB1A 2CX0A 3VSYA 2ZDJA 3UNLA 5IERA 3K9MC 3MKIA 5BIRA 1M1XB 1WTHA 1B20A 3LT8A 4EXRA 3V92A 4GB5A 3WDGB 1TRPA 1HZ1A 1O7GB 1YVBI 1SQWA 4XBYA 3HIIA 1W2ZA 5A0OB 1FGOA 1QVF2 1DETA 1IVWA 1Q824 3MPHA 4ORLA 1RGLA 3G6E3 2YX9A 5I97A 2LYXA 2BMOB 1Z1SA 2IMJA 2RNTA 3PZWA 5FW5A 3ZFZA 1BUJA 1IVUA 4WWUC 1RN4A 3CNMA 4KFDA 1TRQA 1VZZA 2F86B 2Y74A 1JBTA 4R1KA 2CX1A 1IV7A 2QGUA 2RSXA 3JVCA 4HKVB 5AEUB 2ZA4A 4EV2A 3AHWA 1I3IA 1ROVA 3OV4A 1I70A 1IVXA 2AADA 2HMMB 1R4CA 2V1LA 1YJN3 2W0QA 1NB3I 4FMCA 1BSDA 1O7MB 5G1KA 3NV0A 4K61A 1V58A 2HMLB 2OOVC 3ALAA 3DM8A 1RHLA 3FG1A 4MJDA 4XBXA 3Q90A 3SOAA 1AY7A 4EBGA 3EQQB 1T3BA 1RKYA 4HYZA 1W6CA 1TIJA 1CH0A 1TJDA 1RNTA 2FXTA 2H0GA 2IY2A 2IUJA 4HZ9B 4N6NB 5D82A 1ZGXA 1T2HA 1UCIA 2IA7A 3FCSB 3J7Yd 3U97A 3CCV3 1UCKA 2R4IA 4TX4A 1N5HA 1FGRA 3UL6A 3GZRA 6STDA 5CF1A 3JUNA 1GD3A 1X1XA 5IG3A 2F98A 1UUGB 3BNBA 5AI1A 3SVAA 4WFOA 5DRVA 4XDWA 1PYLA 1GOVA 3DGMA 4MMYB 1W02A 1I2FA 1EA2A 1UUWB 1B2SA 3F9SA 1VQO3 1UI7A 2GEYA 1E3RA 3QK9A 2D42A 1RGKA 5IG0A 1X1WA 1DE3A 2W9PA 1RGAA 3LMLA 1PFPA 4RNYA 1IU7A 5KP1A 3IMAB 4K1VA 3BNDA 4BTXA 1UI8A 1HKXA 4CJNA 3CNXA 5AIHA 5CK6A 1RGGA 5HGRA 3SLUA 5TGNA 3H51A 1I3FA 3DUKA 3NHXA 3RGAA 2BT3A 1N8QA 5CXOA 4CPKA 3RNTA 2W56B 2XFSA 1VQ93 2O9UX 2CWUA 3K63A 1AQZA 2QEX3 4JRFA 3SEDA 1YJW3 2CFGA 4HOHA 1JRQA 1B2ZA 1GY7A 2F5MA 3FH1A 5LC7A 3CCJ3 1DMMA 4HZBB 5IEPA 1D6YA 1A90A 1BRHA 1DVDA 1O7HB 1YI23 3D9RA 1I0XA 3MG2A 3KN4A 1D6ZA 1QJGA 3B4PA 2CFDA 1N9EA 3F14A 3IPTA 4H3UA 1RGHA 4OK0A 3GAXA 1GMQA 1RTUA 4BTWA 9RNTA 2KAAA 4O02B 1NDOB 2XSHB 4QWTA 3WOFB 4N6TA 1BNEA 2HMKB 4GL6A 3DGYA 2E2UA 1FUSA 3EB8A 3CD63 5EVHA 3SOYA 3DGNA 4N3VA 2E2TA 3BU4A 1BRSA 3OWUA 3FKAA 1GY6A 1VQK3 1O7NB 1JKGA 5EQLA 3WA3A 4PEJA 1T5YA 5JPUA 1OF5A 1ULIB 2K3DA 4N6MA 1T2IA 2GU3A 3MG1A 1WQLB 1M9GA 4XDVA 3EX9A 3KSPA 3L0RA 2K0MA 4FCJA 4IPBA 1N9JA 1YIJ3 3T0UA 4LZIA 3ZG5A 3CPOA 3I553 3WA2X 2C10A 3I0YA 4N6OB 3H3HA 1FA3A 3S27A 2GBXB 2K54A 4MMXB 5ELUA 4R9KA 1NB5I 1KWIA 5IG5A 4KVHA 4NREA 3A5EA 3D5GA 2FNQA 3S5CA 2XRXB 2YFJB 3FZWA 4X2OA 3EJVA 2KF6A 3S29A 4WYKA 1W01A 1VQ43 4J5KA 4BU4A 2ML5A 4RNTA 3PCSA 2H0HA 2W9QA 2BU4A 3AGNA 1LVNA 3D4AA 3NBBA 5IW9A 3CCS3 1RLSA 1UUVB 3VGNA 3EBYA 3EF8A 1RJOA 1N5PA 1JB4A 1KSIA 2WGQA 4LGQA 1TU5A 4HVNA 3FG4A 1IQYA 3NBRA 2HOHA 4HM3B 2ML6A 4HM8B 3O8YA 5IEOA 2OCTA 3HOHA 3LZAA 1W4NA 3QRDA 4EC6A 5JPPA 1BAOA 1UCLA 1K28A 1X1UA 3E99A 1Q40A 3LT9A 1AVLA 2BNGA 1OH0A 2CG1A 1Y4KA 4R9LA 3T8NA 1BOXA 3MYTA 1I0VA 3NM2A 3NXJA 1I8VA 3UJMA 2LQVA 1Q864 1JKGB 2J8XB 2O3OA 4K1UA 1JJ22 3EN1B 1OF5B 1GS3A 1NNVA 1OGZA 1IVVA 1HYFA 2UGIA 3JUPA 1E3VA 3NUVA 5IG4A 1RGEA 1V74A 4STDA 2WO0A 2XEPA 1RSNA 1K8A4 3DY5A 1RRLA 2KF3A 4NPBA 3URPA 8RNTA 1CYUA 2D1WA 2HMOB 1A2PA 3N8BA 3S67A 2W2CA 4K90B 3CCR3 3EC9A 1YNVX 4LYLB 1GY5A 2XR8B 3SYUA 2UUGC 2XF3A 4ILFA 5LC6A 1J2BA 1MWUA 2Y73A 3LOYA 1MWSA 4KFEA 4N6UA 2CHCA 2Z76A 1CEWI 3G8ZA 3CME3 1M904 1TFOA 4O3VA 1WNHA 1VQN3 2RGQA 2PNCA 3BNEA 4XB5A 1EUIC 1LRAA 2BHMA 1N8R4 3S28A 1LQMB 1IQXA 1YJ93 1CYVA 2W03A 1JV2B 3FF2A 1G0TA 1JZDA 1GMPA 3CCL3 1VQM3 5FGOA 3MG3A 1STFI 1VQ83 4KZ1A 2ZL8A 1UDII 2QIYA 1JN5A 1IV9A 2Z7AA 1PU4A 1Q9EA 3F7XA 2JQ5A 2INXA 1QAFA 3OX9A 4HM5B 1I2EA 3PCRA 1B2XA 1GD4A 4IT7A 1U5OA 1W5ZA 1RN1A 1RRHA 1BNRA 1WMPA 2RFRA 1NU3A 3ER7A 2CG0A 2W6JH 3HX8A 4N6V0 2E2VA 3DZLA 2OQEA 2ZHXB 3CC73 3NV0B 1LNHA 3WODG 1BSBA 1MOLA 1MWRA 3CXC2 1JNQA 2WOFA 1FW7A 3WHOA 2I9WA 3KE7A 1L5GB 1QAKA 2GU1A 3AMOA 1VQP3 2H0IA 1QMAA 3B7CA 1BNSA 3DGLA 5AEWB 2B1XB 3FSDA 3KKGA 4KT3B 4BIRA 1UGHI 3D3LA 3G16A 2HMNB 3HZPA 4MEIA 5M19A 1CQSA 4R4KA 1TP6A 3D5IA 3F8HA 5AYSC 1AR0A 3HK4A 2CFWA 3PYJA 3F40A 2GSPA 1BGSA 1EEJA 3DXOA 3MWZA 1NJI4 1IT7A 1LOVA 2HMJB 1BSAA 2KF4A 4RBNA 1VQQA 1G02A 2GEXA 3PXMA 3BLZA 1FUWA 3GWRA 4J5GA 1IT8A 2CIUA 2CH9A 1GSPA 2CFLA
chains in the Genus database with same CATH topology
1U8CB 1DYUA 2WOHA 3X3YA 4AKYA 1O7PB 1STDA 2GBWB 3DGOA 4HBRA 4RNZA 1S723 3CPW2 5AIGA 3LH4A 2CFKA 3CCM3 1US1A 2JDIH 4FR9A 3BB9A 4XM4A 3FGYA 3Q1CA 5AIFA 3G4S3 3ROBA 2C11A 2P05A 5G2GA 2SBLA 3NQYA 4HM0B 3STDA 4HM1B 1ZO2A 3NBJA 3X40A 3KFQC 1FGTA 5ELJA 1DMNA 3JUMA 3A76A 1MNLA 2YFIB 5IF6A 7STDA 3KSED 1OCVA 3NM7A 1DVCA 1VQL3 2CW9A 1JB5A 4O2HA 1OUNA 1SIHA 2MF7A 3LTAA 4FCZA 1K9M4 5CF2A 3N9HA 3PGBA 2OTJ3 4AKZA 3KZTA 1KQS2 4NHFA 3DMCA 3G713 3NQZA 3FLJA 5KP4A 2XGNA 3PS8A 2BMRB 2Z6BA 1G96A 1QALA 2CWVA 5EEOA 1AVKA 2Q07A 1IDPA 3X41A 3HIGA 1GYBA 1TFKA 1ISKA 8CHOA 3B4OA 3LTCA 2M7OA 3JUOA 4CCVA 1OHPA 4J8TA 5D81A 1EG9B 1S5AA 1YIT3 1SIIA 1W00A 1W6GA 4I4KA 4CDLA 3EHCA 1QVG2 2GXFA 1HU9A 3F8XA 2KCDA 1TUHA 1ULJB 1VQ53 1E97A 1A2VA 1OHOA 2W56A 4O8SA 4WYKB 4WHAA 3CMA3 1A2KA 4LSOA 3CCE3 3K0ZA 1EQKA 3LXUX 3VF1A 2XGLA 4HM6B 3CC23 2QA43 4OVMA 4EV5A 3CCQ3 2L4VA 1NO3A 3BNCA 3OXAA 3NX0A 1W6YA 3FG3A 4L8OA 5D83A 2B24B 3OW22 1FGMA 3JUQA 4FMBA 1ASKA 4HM7B 1UW1A 5DREA 2FGTA 1SJWA 2RCDA 1FGQA 4U13A 1EKMA 1OGXA 2P09A 4AEQA 2OQEC 2OOVA 3FF0A 1OHSA 4L8PA 1Q40B 3EN8A 3CCU3 3RGRA 1K41A 1WMNA 1SPUA 4KFFA 2STDA 2P0XA 5KP3A 1RN7A 1C7HA 1BUQA 3OWSA 4FMDA 2XSOB 3OWYA 4Q53A 1OACA 4J9AA 2BMQB 1Q42A 1O7WB 4MMZB 3K7CA 3CU3A 4ZM8A 2XH9A 3V98A 3GZBA 4WP5A 4JF8A 4L7KA 5AIIA 4BTYA 3GZXB 3K5TA 2OTL3 2Z77A 1WMOA 3LTBA 1YHQ3 1AV4A 1OPYA 3TDGA 3HI7A 1YGEA 3V99A 2F99A 5AYRB 1KD14 4RZMA 2CWTA 3U1WA 5BVBA 5BXQA 3SXXA 2BO9B 3GRDA 3N54B 4EYCA 3MSOA 4N6LA 1VQ63 1VQ73 1F8NA 1Q7Y4 3RDEA 2P0MA 4R80A 3M8CA 2W04A 1JN5B 3WMDA 2OWPA 3Q2PA 3X42A 2KXGA 3EE1A 2WGOA 1K734 4IIAA 2YFLB 4LMIA 1W7CA 3CC43 3B8LA 2CC3A 4X2HA 1NWWA 2P38A 2A15A 3EBTA 1KC84 3LYGA 1ROAA 3X3ZA 2CK3H 1IQ8A 3ECFA 2UX0A 1DMQA 3I563 3WOEB 1W2B2 3F7SA 1LOXA 2XFTA 1D6UA 5CLKA 3AMOB 3X3XA 4FMAA 3UL5A 1ZX2A 3MHEA 1M1K4 3LTDA 3GZYB 3IJEB 4H61A 2IUKA 1Q814 4XBTA 2PZVA 1LXEA 4HJLB 1IK3A 4HM4B 4LEHA 4OUQA 4FCMA 5JBSA 2CKFB 2MC8A 5IENA 1JB2A 3T8UA 1A67A 5STDA 2KRTA 4HM2B 3G0KA 3KIIA 3UB1A 4G1MB 3VSYA 2ZDJA 3UNLA 5IERA 3K9MC 3MKIA 1M1XB 1WTHA 3LT8A 4EXRA 3V92A 4GB5A 3WDGB 1O7GB 1YVBI 1SQWA 4XBYA 3HIIA 1W2ZA 5A0OB 1FGOA 1QVF2 1IVWA 1Q824 3MPHA 4ORLA 3G6E3 2YX9A 5I97A 2LYXA 2BMOB 1Z1SA 2IMJA 3PZWA 5FW5A 1IVUA 4WWUC 3CNMA 4KFDA 1VZZA 2F86B 2Y74A 4R1KA 2QGUA 1IV7A 2RSXA 3JVCA 4HKVB 5AEUB 4EV2A 1ROVA 3OV4A 1IVXA 2HMMB 2V1LA 1R4CA 1YJN3 2W0QA 1NB3I 4FMCA 1O7MB 3NV0A 4K61A 2HMLB 2OOVC 3DM8A 3ALAA 3FG1A 4XBXA 4MJDA 3SOAA 3SX1A 3Q90A 4EBGA 3EQQB 1RKYA 4HYZA 1W6CA 1TIJA 2FXTA 2IUJA 4HZ9B 4N6NB 5D82A 2IA7A 3FCSB 3J7Yd 3U97A 3CCV3 2R4IA 4TX4A 3UL6A 1N5HA 1FGRA 6STDA 3GZRA 5CF1A 3JUNA 1GD3A 5IG3A 2F98A 3BNBA 5AI1A 3SVAA 4WFOA 5DRVA 4XDWA 3DGMA 4MMYB 1W02A 1EA2A 1UUWB 3F9SA 1VQO3 1UI7A 2GEYA 1E3RA 3QK9A 2D42A 5IG0A 2W9PA 3LMLA 1PFPA 4RNYA 1IU7A 5KP1A 3IMAB 4K1VA 3BNDA 4BTXA 1UI8A 1HKXA 3CNXA 5AIHA 5CK6A 5HGRA 3SLUA 5TGNA 3H51A 3DUKA 3NHXA 3RGAA 2BT3A 1N8QA 5CXOA 2W56B 2XFSA 1VQ93 2O9UX 2CWUA 3K63A 2QEX3 4JRFA 3SEDA 1YJW3 2CFGA 1FA3A 1JRQA 3CCJ3 1GY7A 3FH1A 5LC7A 1A90A 1DMMA 4HZBB 5IEPA 1D6YA 1DVDA 1O7HB 1YI23 3D9RA 3MG2A 3KN4A 3B4PA 1D6ZA 1QJGA 2CFDA 1N9EA 3F14A 3IPTA 4H3UA 4OK0A 3GAXA 4BTWA 4O02B 4QWTA 1NDOB 2XSHB 3WOFB 4N6TA 2HMKB 4GL6A 2E2UA 3EB8A 3CD63 5EVHA 3SOYA 3DGNA 4N3VA 2E2TA 3OWUA 3FKAA 1GY6A 1VQK3 1O7NB 1JKGA 5EQLA 3WA3A 4PEJA 1T5YA 5JPUA 1OF5A 1ULIB 4N6MA 2GU3A 3MG1A 1WQLB 1M9GA 4XDVA 3EX9A 3KSPA 3L0RA 2K0MA 4FCJA 4IPBA 1N9JA 1YIJ3 3T0UA 4LZIA 3CPOA 3I553 3WA2X 2C10A 3I0YA 4N6OB 3H3HA 3S27A 2GBXB 2K54A 4MMXB 5ELUA 4R9KA 1NB5I 1KWIA 4KVHA 4NREA 2FNQA 3S5CA 2XRXB 2YFJB 3FZWA 4X2OA 3EJVA 3S29A 4WYKA 1W01A 1VQ43 2ML5A 3PCSA 2W9QA 5IW9A 1LVNA 3NBBA 3CCS3 1UUVB 3VGNA 3EBYA 3EF8A 1RJOA 1N5PA 1JB4A 1KSIA 2WGQA 4LGQA 1TU5A 4HVNA 3FG4A 1IQYA 3NBRA 4HM3B 2ML6A 4HM8B 3O8YA 5IEOA 2OCTA 3LZAA 1W4NA 3QRDA 4EC6A 5JPPA 1K28A 3E99A 1Q40A 3LT9A 1AVLA 2BNGA 1OH0A 2CG1A 1Y4KA 4R9LA 3T8NA 3MYTA 3NXJA 3NM2A 3UJMA 2LQVA 1Q864 1JKGB 2O3OA 4K1UA 1JJ22 3EN1B 1OF5B 1GS3A 1OGZA 1IVVA 3JUPA 1E3VA 3NUVA 5IG4A 1V74A 4STDA 2WO0A 2XEPA 1K8A4 3DY5A 1RRLA 1CYUA 2D1WA 2HMOB 3N8BA 3S67A 2W2CA 4K90B 3CCR3 3EC9A 1GY5A 2XR8B 2XF3A 5LC6A 1J2BA 2Y73A 3LOYA 4N6UA 4KFEA 3CME3 2CHCA 2Z76A 1CEWI 3G8ZA 1M904 1VQN3 1TFOA 4O3VA 1WNHA 2RGQA 2PNCA 3BNEA 4XB5A 2BHMA 1N8R4 3S28A 1IQXA 1YJ93 1CYVA 2W03A 1JV2B 3FF2A 3CCL3 1VQM3 5FGOA 3MG3A 1STFI 1VQ83 4KZ1A 2ZL8A 2QIYA 1JN5A 1IV9A 2Z7AA 1PU4A 3F7XA 2JQ5A 2INXA 1QAFA 3OX9A 4HM5B 3PCRA 1GD4A 4IT7A 1U5OA 1W5ZA 1RRHA 1WMPA 2RFRA 1NU3A 3ER7A 2CG0A 2W6JH 3HX8A 4N6V0 2E2VA 3DZLA 2OQEA 3CC73 3NV0B 1LNHA 3WODG 1MOLA 3CXC2 1JNQA 2WOFA 2I9WA 3KE7A 1L5GB 1QAKA 2GU1A 3AMOA 1VQP3 1QMAA 3B7CA 3DGLA 5AEWB 2B1XB 3FSDA 3KKGA 3D3LA 3G16A 2HMNB 3HZPA 4MEIA 1CQSA 4R4KA 1TP6A 3F8HA 5AYSC 1AR0A 3HK4A 2CFWA 3PYJA 3F40A 3DXOA 3MWZA 1NJI4 1IT7A 2HMJB 4RBNA 2GEXA 3PXMA 3BLZA 1FUWA 3GWRA 1IT8A 2CIUA 2CH9A 5IG5A 2CFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K63 A;  3JVC A;  2KRT A; 
#chains in the Genus database with same CATH topology
 1U8C B;  1DYU A;  2WOH A;  3X3Y A;  4AKY A;  1O7P B;  1YGW A;  1STD A;  1C54 A;  2GBW B;  3DGO A;  2C4B A;  1FZU A;  1BNF A;  4HBR A;  4RNZ A;  4EW5 A;  1S72 3;  3CPW 2;  5AIG A;  3LH4 A;  2CFK A;  3CCM 3;  1US1 A;  2JDI H;  2L1S A;  3BB9 A;  4FR9 A;  4XM4 A;  3FGY A;  1BVI A;  1BRJ A;  3Q1C A;  1BSE A;  5AIF A;  3G4S 3;  3ROB A;  2C11 A;  2P05 A;  5G2G A;  1B3S A;  1RMS A;  2SBL A;  3NQY A;  4HM0 B;  4HM1 B;  3STD A;  1ZO2 A;  2F56 A;  3NBJ A;  5G1L A;  3X40 A;  3KFQ C;  1FGT A;  1BNI A;  1ZS7 A;  1DMN A;  3JUM A;  3A76 A;  5ELJ A;  1MNL A;  2YFI B;  3DH2 A;  5IF6 A;  7STD A;  3KSE D;  1LQG C;  1OCV A;  1BNG A;  3NM7 A;  1DVC A;  1VQL 3;  1BNJ A;  1RCK A;  2CW9 A;  1JB5 A;  4O2H A;  1OUN A;  1SIH A;  2MF7 A;  3LTA A;  1RNB A;  4FCZ A;  1K9M 4;  5CF2 A;  3N9H A;  3PGB A;  5BU4 A;  2OTJ 3;  2IYJ A;  4BL2 A;  1LOW A;  3KZT A;  4AKZ A;  1KQS 2;  4NHF A;  5RNT A;  3DMC A;  4GSP A;  3G71 3;  3NQZ A;  2BIR A;  3FLJ A;  5KP4 A;  2F5W A;  2XGN A;  3PS8 A;  2BMR B;  2Z6B A;  1JBS A;  1BSC A;  3AGO A;  1G96 A;  1RDS A;  1QAL A;  2CWV A;  7RNT A;  5EEO A;  1AVK A;  2Q07 A;  1IDP A;  3GSP A;  3X41 A;  3HIG A;  1GYB A;  1TFK A;  1ISK A;  2F4Y A;  8CHO A;  3B4O A;  3LTC A;  1I2G A;  2M7O A;  3JUO A;  4CCV A;  1OHP A;  4J8T A;  5D81 A;  3Q3F A;  1EG9 B;  1S5A A;  1YIT 3;  1SII A;  1W00 A;  5M18 A;  1V57 A;  1W6G A;  4I4K A;  4CDL A;  3EHC A;  1QVG 2;  2GXF A;  1HU9 A;  1UGI A;  1R4Y A;  2R41 A;  1BU4 A;  2KCD A;  3AHS A;  3F8X A;  1TUH A;  1ULJ B;  1VQ5 3;  1E97 A;  1A2V A;  1OHO A;  2W56 A;  4O8S A;  4WYK B;  4WHA A;  3CMA 3;  1A2K A;  3ZG0 A;  3KCH A;  4LSO A;  3CCE 3;  1X1Y A;  3K0Z A;  1EQK A;  3LXU X;  1YVS A;  1SAR A;  3VF1 A;  2SAR A;  2XGL A;  4HM6 B;  1FYS A;  3CC2 3;  2QA4 3;  4OVM A;  4EV5 A;  3CCQ 3;  2L4V A;  1NO3 A;  3BNC A;  1LNI A;  3OXA A;  5GSP A;  7GSP A;  3NX0 A;  3BIR A;  1W6Y A;  3FG3 A;  1Q7H A;  1RGF A;  4L8O A;  5D83 A;  2B24 B;  3OW2 2;  1FGM A;  3JUQ A;  4FMB A;  1ASK A;  1BRK A;  4HM7 B;  5HOH A;  1UW1 A;  5DRE A;  2FGT A;  4I5Q A;  1SJW A;  2RCD A;  1FGQ A;  4U13 A;  1EKM A;  1OGX A;  2P09 A;  4AEQ A;  2OQE C;  2OOV A;  3FF0 A;  6RNT A;  1OHS A;  4L8P A;  1Q40 B;  1GOU A;  3EN8 A;  3CCU 3;  3RGR A;  1K41 A;  1WMN A;  1SPU A;  4KFF A;  2STD A;  2P0X A;  5KP3 A;  1RN7 A;  1C7H A;  1BUQ A;  3OWS A;  4FMD A;  2XSO B;  3OWY A;  4Q53 A;  1OAC A;  4J9A A;  2BMQ B;  3SX1 A;  1RCL A;  1Q42 A;  1O7W B;  4MMZ B;  3K7C A;  4BL3 A;  4DKI A;  1BIR A;  3CU3 A;  4ZM8 A;  2KF5 A;  2XH9 A;  3V98 A;  3GZB A;  4WP5 A;  4JF8 A;  6GSP A;  1BRG A;  3D79 A;  5M1A A;  4L7K A;  5AII A;  1GMR A;  4BTY A;  1RGC A;  3GZX B;  1MWT A;  3K5T A;  1LOY A;  2OTL 3;  2Z77 A;  2RBI A;  1JBR A;  1B27 A;  1WMO A;  3LTB A;  1YHQ 3;  1AV4 A;  1OPY A;  4HAA A;  3TDG A;  3HI7 A;  1YGE A;  3V99 A;  4GHO A;  1GOY A;  2F99 A;  5AYR B;  1UCJ A;  4RZM A;  1KD1 4;  2CWT A;  3U1W A;  5BVB A;  5BXQ A;  1FUT A;  3SXX A;  2BO9 B;  3GRD A;  3N54 B;  4EYC A;  3MSO A;  1JZO A;  4N6L A;  3WR2 A;  1VQ6 3;  1VQ7 3;  1F8N A;  1Q7Y 4;  3RDE A;  2P0M A;  4R80 A;  3M8C A;  2W04 A;  1TTO A;  1JN5 B;  3WMD A;  2OWP A;  3Q2P A;  3X42 A;  2KXG A;  1BAN A;  3EE1 A;  2WGO A;  1K73 4;  4IIA A;  1PY3 A;  2YFL B;  4LMI A;  1W7C A;  3CC4 3;  3B8L A;  2CC3 A;  4X2H A;  2AAE A;  1NWW A;  2P38 A;  2A15 A;  3EBT A;  1KC8 4;  3LYG A;  1ROA A;  1B21 A;  3X3Z A;  2CK3 H;  1IQ8 A;  1BRN L;  1MGR A;  1IYY A;  3ECF A;  2UX0 A;  1DMQ A;  3I56 3;  3WOE B;  1W2B 2;  3F7S A;  1LOX A;  2XFT A;  1D6U A;  5CLK A;  3AMO B;  3X3X A;  4FMA A;  3UL5 A;  1ZX2 A;  3MHE A;  1M1K 4;  1BRI A;  3LTD A;  3GZY B;  3IJE B;  4H61 A;  2IUK A;  1Q81 4;  4XBT A;  2PZV A;  1LXE A;  4HJL B;  1IK3 A;  1B2M A;  4HM4 B;  4LEH A;  4OUQ A;  4FCM A;  5JBS A;  2CKF B;  2MC8 A;  5IEN A;  1JB2 A;  1B2U A;  3T8U A;  1A67 A;  5STD A;  2KRT A;  4HM2 B;  3G0K A;  1MGW A;  3KII A;  4G1M B;  3UB1 A;  2CX0 A;  3VSY A;  2ZDJ A;  3UNL A;  5IER A;  3K9M C;  3MKI A;  5BIR A;  1M1X B;  1WTH A;  1B20 A;  3LT8 A;  4EXR A;  3V92 A;  4GB5 A;  3WDG B;  1TRP A;  1HZ1 A;  1O7G B;  1YVB I;  1SQW A;  4XBY A;  3HII A;  1W2Z A;  5A0O B;  1FGO A;  1QVF 2;  1DET A;  1IVW A;  1Q82 4;  3MPH A;  4ORL A;  1RGL A;  3G6E 3;  2YX9 A;  5I97 A;  2LYX A;  2BMO B;  1Z1S A;  2IMJ A;  2RNT A;  3PZW A;  5FW5 A;  3ZFZ A;  1BUJ A;  1IVU A;  4WWU C;  1RN4 A;  3CNM A;  4KFD A;  1TRQ A;  1VZZ A;  2F86 B;  2Y74 A;  1JBT A;  4R1K A;  2CX1 A;  1IV7 A;  2QGU A;  2RSX A;  3JVC A;  4HKV B;  5AEU B;  2ZA4 A;  4EV2 A;  3AHW A;  1I3I A;  1ROV A;  3OV4 A;  1I70 A;  1IVX A;  2AAD A;  2HMM B;  1R4C A;  2V1L A;  1YJN 3;  2W0Q A;  1NB3 I;  4FMC A;  1BSD A;  1O7M B;  5G1K A;  3NV0 A;  4K61 A;  1V58 A;  2HML B;  2OOV C;  3ALA A;  3DM8 A;  1RHL A;  3FG1 A;  4MJD A;  4XBX A;  3Q90 A;  3SOA A;  1AY7 A;  4EBG A;  3EQQ B;  1T3B A;  1RKY A;  4HYZ A;  1W6C A;  1TIJ A;  1CH0 A;  1TJD A;  1RNT A;  2FXT A;  2H0G A;  2IY2 A;  2IUJ A;  4HZ9 B;  4N6N B;  5D82 A;  1ZGX A;  1T2H A;  1UCI A;  2IA7 A;  3FCS B;  3J7Y d;  3U97 A;  3CCV 3;  1UCK A;  2R4I A;  4TX4 A;  1N5H A;  1FGR A;  3UL6 A;  3GZR A;  6STD A;  5CF1 A;  3JUN A;  1GD3 A;  1X1X A;  5IG3 A;  2F98 A;  1UUG B;  3BNB A;  5AI1 A;  3SVA A;  4WFO A;  5DRV A;  4XDW A;  1PYL A;  1GOV A;  3DGM A;  4MMY B;  1W02 A;  1I2F A;  1EA2 A;  1UUW B;  1B2S A;  3F9S A;  1VQO 3;  1UI7 A;  2GEY A;  1E3R A;  3QK9 A;  2D42 A;  1RGK A;  5IG0 A;  1X1W A;  1DE3 A;  2W9P A;  1RGA A;  3LML A;  1PFP A;  4RNY A;  1IU7 A;  5KP1 A;  3IMA B;  4K1V A;  3BND A;  4BTX A;  1UI8 A;  1HKX A;  4CJN A;  3CNX A;  5AIH A;  5CK6 A;  1RGG A;  5HGR A;  3SLU A;  5TGN A;  3H51 A;  1I3F A;  3DUK A;  3NHX A;  3RGA A;  2BT3 A;  1N8Q A;  5CXO A;  4CPK A;  3RNT A;  2W56 B;  2XFS A;  1VQ9 3;  2O9U X;  2CWU A;  3K63 A;  1AQZ A;  2QEX 3;  4JRF A;  3SED A;  1YJW 3;  2CFG A;  4HOH A;  1JRQ A;  1B2Z A;  1GY7 A;  2F5M A;  3FH1 A;  5LC7 A;  3CCJ 3;  1DMM A;  4HZB B;  5IEP A;  1D6Y A;  1A90 A;  1BRH A;  1DVD A;  1O7H B;  1YI2 3;  3D9R A;  1I0X A;  3MG2 A;  3KN4 A;  1D6Z A;  1QJG A;  3B4P A;  2CFD A;  1N9E A;  3F14 A;  3IPT A;  4H3U A;  1RGH A;  4OK0 A;  3GAX A;  1GMQ A;  1RTU A;  4BTW A;  9RNT A;  2KAA A;  4O02 B;  1NDO B;  2XSH B;  4QWT A;  3WOF B;  4N6T A;  1BNE A;  2HMK B;  4GL6 A;  3DGY A;  2E2U A;  1FUS A;  3EB8 A;  3CD6 3;  5EVH A;  3SOY A;  3DGN A;  4N3V A;  2E2T A;  3BU4 A;  1BRS A;  3OWU A;  3FKA A;  1GY6 A;  1VQK 3;  1O7N B;  1JKG A;  5EQL A;  3WA3 A;  4PEJ A;  1T5Y A;  5JPU A;  1OF5 A;  1ULI B;  2K3D A;  4N6M A;  1T2I A;  2GU3 A;  3MG1 A;  1WQL B;  1M9G A;  4XDV A;  3EX9 A;  3KSP A;  3L0R A;  2K0M A;  4FCJ A;  4IPB A;  1N9J A;  1YIJ 3;  3T0U A;  4LZI A;  3ZG5 A;  3CPO A;  3I55 3;  3WA2 X;  2C10 A;  3I0Y A;  4N6O B;  3H3H A;  1FA3 A;  3S27 A;  2GBX B;  2K54 A;  4MMX B;  5ELU A;  4R9K A;  1NB5 I;  1KWI A;  5IG5 A;  4KVH A;  4NRE A;  3A5E A;  3D5G A;  2FNQ A;  3S5C A;  2XRX B;  2YFJ B;  3FZW A;  4X2O A;  3EJV A;  2KF6 A;  3S29 A;  4WYK A;  1W01 A;  1VQ4 3;  4J5K A;  4BU4 A;  2ML5 A;  4RNT A;  3PCS A;  2H0H A;  2W9Q A;  2BU4 A;  3AGN A;  1LVN A;  3D4A A;  3NBB A;  5IW9 A;  3CCS 3;  1RLS A;  1UUV B;  3VGN A;  3EBY A;  3EF8 A;  1RJO A;  1N5P A;  1JB4 A;  1KSI A;  2WGQ A;  4LGQ A;  1TU5 A;  4HVN A;  3FG4 A;  1IQY A;  3NBR A;  2HOH A;  4HM3 B;  2ML6 A;  4HM8 B;  3O8Y A;  5IEO A;  2OCT A;  3HOH A;  3LZA A;  1W4N A;  3QRD A;  4EC6 A;  5JPP A;  1BAO A;  1UCL A;  1K28 A;  1X1U A;  3E99 A;  1Q40 A;  3LT9 A;  1AVL A;  2BNG A;  1OH0 A;  2CG1 A;  1Y4K A;  4R9L A;  3T8N A;  1BOX A;  3MYT A;  1I0V A;  3NM2 A;  3NXJ A;  1I8V A;  3UJM A;  2LQV A;  1Q86 4;  1JKG B;  2J8X B;  2O3O A;  4K1U A;  1JJ2 2;  3EN1 B;  1OF5 B;  1GS3 A;  1NNV A;  1OGZ A;  1IVV A;  1HYF A;  2UGI A;  3JUP A;  1E3V A;  3NUV A;  5IG4 A;  1RGE A;  1V74 A;  4STD A;  2WO0 A;  2XEP A;  1RSN A;  1K8A 4;  3DY5 A;  1RRL A;  2KF3 A;  4NPB A;  3URP A;  8RNT A;  1CYU A;  2D1W A;  2HMO B;  1A2P A;  3N8B A;  3S67 A;  2W2C A;  4K90 B;  3CCR 3;  3EC9 A;  1YNV X;  4LYL B;  1GY5 A;  2XR8 B;  3SYU A;  2UUG C;  2XF3 A;  4ILF A;  5LC6 A;  1J2B A;  1MWU A;  2Y73 A;  3LOY A;  1MWS A;  4KFE A;  4N6U A;  2CHC A;  2Z76 A;  1CEW I;  3G8Z A;  3CME 3;  1M90 4;  1TFO A;  4O3V A;  1WNH A;  1VQN 3;  2RGQ A;  2PNC A;  3BNE A;  4XB5 A;  1EUI C;  1LRA A;  2BHM A;  1N8R 4;  3S28 A;  1LQM B;  1IQX A;  1YJ9 3;  1CYV A;  2W03 A;  1JV2 B;  3FF2 A;  1G0T A;  1JZD A;  1GMP A;  3CCL 3;  1VQM 3;  5FGO A;  3MG3 A;  1STF I;  1VQ8 3;  4KZ1 A;  2ZL8 A;  1UDI I;  2QIY A;  1JN5 A;  1IV9 A;  2Z7A A;  1PU4 A;  1Q9E A;  3F7X A;  2JQ5 A;  2INX A;  1QAF A;  3OX9 A;  4HM5 B;  1I2E A;  3PCR A;  1B2X A;  1GD4 A;  4IT7 A;  1U5O A;  1W5Z A;  1RN1 A;  1RRH A;  1BNR A;  1WMP A;  2RFR A;  1NU3 A;  3ER7 A;  2CG0 A;  2W6J H;  3HX8 A;  4N6V 0;  2E2V A;  3DZL A;  2OQE A;  2ZHX B;  3CC7 3;  3NV0 B;  1LNH A;  3WOD G;  1BSB A;  1MOL A;  1MWR A;  3CXC 2;  1JNQ A;  2WOF A;  1FW7 A;  3WHO A;  2I9W A;  3KE7 A;  1L5G B;  1QAK A;  2GU1 A;  3AMO A;  1VQP 3;  2H0I A;  1QMA A;  3B7C A;  1BNS A;  3DGL A;  5AEW B;  2B1X B;  3FSD A;  3KKG A;  4KT3 B;  4BIR A;  1UGH I;  3D3L A;  3G16 A;  2HMN B;  3HZP A;  4MEI A;  5M19 A;  1CQS A;  4R4K A;  1TP6 A;  3D5I A;  3F8H A;  5AYS C;  1AR0 A;  3HK4 A;  2CFW A;  3PYJ A;  3F40 A;  2GSP A;  1BGS A;  1EEJ A;  3DXO A;  3MWZ A;  1NJI 4;  1IT7 A;  1LOV A;  2HMJ B;  1BSA A;  2KF4 A;  4RBN A;  1VQQ A;  1G02 A;  2GEX A;  3PXM A;  3BLZ A;  1FUW A;  3GWR A;  4J5G A;  1IT8 A;  2CIU A;  2CH9 A;  1GSP A;  2CFL A; 
#chains in the Genus database with same CATH homology
 1U8C B;  1DYU A;  2WOH A;  3X3Y A;  4AKY A;  1O7P B;  1STD A;  2GBW B;  3DGO A;  4HBR A;  4RNZ A;  1S72 3;  3CPW 2;  5AIG A;  3LH4 A;  2CFK A;  3CCM 3;  1US1 A;  2JDI H;  4FR9 A;  3BB9 A;  4XM4 A;  3FGY A;  3Q1C A;  5AIF A;  3G4S 3;  3ROB A;  2C11 A;  2P05 A;  5G2G A;  2SBL A;  3NQY A;  4HM0 B;  3STD A;  4HM1 B;  1ZO2 A;  3NBJ A;  3X40 A;  3KFQ C;  1FGT A;  5ELJ A;  1DMN A;  3JUM A;  3A76 A;  1MNL A;  2YFI B;  5IF6 A;  7STD A;  3KSE D;  1OCV A;  3NM7 A;  1DVC A;  1VQL 3;  2CW9 A;  1JB5 A;  4O2H A;  1OUN A;  1SIH A;  2MF7 A;  3LTA A;  4FCZ A;  1K9M 4;  5CF2 A;  3N9H A;  3PGB A;  2OTJ 3;  4AKZ A;  3KZT A;  1KQS 2;  4NHF A;  3DMC A;  3G71 3;  3NQZ A;  3FLJ A;  5KP4 A;  2XGN A;  3PS8 A;  2BMR B;  2Z6B A;  1G96 A;  1QAL A;  2CWV A;  5EEO A;  1AVK A;  2Q07 A;  1IDP A;  3X41 A;  3HIG A;  1GYB A;  1TFK A;  1ISK A;  8CHO A;  3B4O A;  3LTC A;  2M7O A;  3JUO A;  4CCV A;  1OHP A;  4J8T A;  5D81 A;  1EG9 B;  1S5A A;  1YIT 3;  1SII A;  1W00 A;  1W6G A;  4I4K A;  4CDL A;  3EHC A;  1QVG 2;  2GXF A;  1HU9 A;  3F8X A;  2KCD A;  1TUH A;  1ULJ B;  1VQ5 3;  1E97 A;  1A2V A;  1OHO A;  2W56 A;  4O8S A;  4WYK B;  4WHA A;  3CMA 3;  1A2K A;  4LSO A;  3CCE 3;  3K0Z A;  1EQK A;  3LXU X;  3VF1 A;  2XGL A;  4HM6 B;  3CC2 3;  2QA4 3;  4OVM A;  4EV5 A;  3CCQ 3;  2L4V A;  1NO3 A;  3BNC A;  3OXA A;  3NX0 A;  1W6Y A;  3FG3 A;  4L8O A;  5D83 A;  2B24 B;  3OW2 2;  1FGM A;  3JUQ A;  4FMB A;  1ASK A;  4HM7 B;  1UW1 A;  5DRE A;  2FGT A;  1SJW A;  2RCD A;  1FGQ A;  4U13 A;  1EKM A;  1OGX A;  2P09 A;  4AEQ A;  2OQE C;  2OOV A;  3FF0 A;  1OHS A;  4L8P A;  1Q40 B;  3EN8 A;  3CCU 3;  3RGR A;  1K41 A;  1WMN A;  1SPU A;  4KFF A;  2STD A;  2P0X A;  5KP3 A;  1RN7 A;  1C7H A;  1BUQ A;  3OWS A;  4FMD A;  2XSO B;  3OWY A;  4Q53 A;  1OAC A;  4J9A A;  2BMQ B;  1Q42 A;  1O7W B;  4MMZ B;  3K7C A;  3CU3 A;  4ZM8 A;  2XH9 A;  3V98 A;  3GZB A;  4WP5 A;  4JF8 A;  4L7K A;  5AII A;  4BTY A;  3GZX B;  3K5T A;  2OTL 3;  2Z77 A;  1WMO A;  3LTB A;  1YHQ 3;  1AV4 A;  1OPY A;  3TDG A;  3HI7 A;  1YGE A;  3V99 A;  2F99 A;  5AYR B;  1KD1 4;  4RZM A;  2CWT A;  3U1W A;  5BVB A;  5BXQ A;  3SXX A;  2BO9 B;  3GRD A;  3N54 B;  4EYC A;  3MSO A;  4N6L A;  1VQ6 3;  1VQ7 3;  1F8N A;  1Q7Y 4;  3RDE A;  2P0M A;  4R80 A;  3M8C A;  2W04 A;  1JN5 B;  3WMD A;  2OWP A;  3Q2P A;  3X42 A;  2KXG A;  3EE1 A;  2WGO A;  1K73 4;  4IIA A;  2YFL B;  4LMI A;  1W7C A;  3CC4 3;  3B8L A;  2CC3 A;  4X2H A;  1NWW A;  2P38 A;  2A15 A;  3EBT A;  1KC8 4;  3LYG A;  1ROA A;  3X3Z A;  2CK3 H;  1IQ8 A;  3ECF A;  2UX0 A;  1DMQ A;  3I56 3;  3WOE B;  1W2B 2;  3F7S A;  1LOX A;  2XFT A;  1D6U A;  5CLK A;  3AMO B;  3X3X A;  4FMA A;  3UL5 A;  1ZX2 A;  3MHE A;  1M1K 4;  3LTD A;  3GZY B;  3IJE B;  4H61 A;  2IUK A;  1Q81 4;  4XBT A;  2PZV A;  1LXE A;  4HJL B;  1IK3 A;  4HM4 B;  4LEH A;  4OUQ A;  4FCM A;  5JBS A;  2CKF B;  2MC8 A;  5IEN A;  1JB2 A;  3T8U A;  1A67 A;  5STD A;  2KRT A;  4HM2 B;  3G0K A;  3KII A;  3UB1 A;  4G1M B;  3VSY A;  2ZDJ A;  3UNL A;  5IER A;  3K9M C;  3MKI A;  1M1X B;  1WTH A;  3LT8 A;  4EXR A;  3V92 A;  4GB5 A;  3WDG B;  1O7G B;  1YVB I;  1SQW A;  4XBY A;  3HII A;  1W2Z A;  5A0O B;  1FGO A;  1QVF 2;  1IVW A;  1Q82 4;  3MPH A;  4ORL A;  3G6E 3;  2YX9 A;  5I97 A;  2LYX A;  2BMO B;  1Z1S A;  2IMJ A;  3PZW A;  5FW5 A;  1IVU A;  4WWU C;  3CNM A;  4KFD A;  1VZZ A;  2F86 B;  2Y74 A;  4R1K A;  2QGU A;  1IV7 A;  2RSX A;  3JVC A;  4HKV B;  5AEU B;  4EV2 A;  1ROV A;  3OV4 A;  1IVX A;  2HMM B;  2V1L A;  1R4C A;  1YJN 3;  2W0Q A;  1NB3 I;  4FMC A;  1O7M B;  3NV0 A;  4K61 A;  2HML B;  2OOV C;  3DM8 A;  3ALA A;  3FG1 A;  4XBX A;  4MJD A;  3SOA A;  3SX1 A;  3Q90 A;  4EBG A;  3EQQ B;  1RKY A;  4HYZ A;  1W6C A;  1TIJ A;  2FXT A;  2IUJ A;  4HZ9 B;  4N6N B;  5D82 A;  2IA7 A;  3FCS B;  3J7Y d;  3U97 A;  3CCV 3;  2R4I A;  4TX4 A;  3UL6 A;  1N5H A;  1FGR A;  6STD A;  3GZR A;  5CF1 A;  3JUN A;  1GD3 A;  5IG3 A;  2F98 A;  3BNB A;  5AI1 A;  3SVA A;  4WFO A;  5DRV A;  4XDW A;  3DGM A;  4MMY B;  1W02 A;  1EA2 A;  1UUW B;  3F9S A;  1VQO 3;  1UI7 A;  2GEY A;  1E3R A;  3QK9 A;  2D42 A;  5IG0 A;  2W9P A;  3LML A;  1PFP A;  4RNY A;  1IU7 A;  5KP1 A;  3IMA B;  4K1V A;  3BND A;  4BTX A;  1UI8 A;  1HKX A;  3CNX A;  5AIH A;  5CK6 A;  5HGR A;  3SLU A;  5TGN A;  3H51 A;  3DUK A;  3NHX A;  3RGA A;  2BT3 A;  1N8Q A;  5CXO A;  2W56 B;  2XFS A;  1VQ9 3;  2O9U X;  2CWU A;  3K63 A;  2QEX 3;  4JRF A;  3SED A;  1YJW 3;  2CFG A;  1FA3 A;  1JRQ A;  3CCJ 3;  1GY7 A;  3FH1 A;  5LC7 A;  1A90 A;  1DMM A;  4HZB B;  5IEP A;  1D6Y A;  1DVD A;  1O7H B;  1YI2 3;  3D9R A;  3MG2 A;  3KN4 A;  3B4P A;  1D6Z A;  1QJG A;  2CFD A;  1N9E A;  3F14 A;  3IPT A;  4H3U A;  4OK0 A;  3GAX A;  4BTW A;  4O02 B;  4QWT A;  1NDO B;  2XSH B;  3WOF B;  4N6T A;  2HMK B;  4GL6 A;  2E2U A;  3EB8 A;  3CD6 3;  5EVH A;  3SOY A;  3DGN A;  4N3V A;  2E2T A;  3OWU A;  3FKA A;  1GY6 A;  1VQK 3;  1O7N B;  1JKG A;  5EQL A;  3WA3 A;  4PEJ A;  1T5Y A;  5JPU A;  1OF5 A;  1ULI B;  4N6M A;  2GU3 A;  3MG1 A;  1WQL B;  1M9G A;  4XDV A;  3EX9 A;  3KSP A;  3L0R A;  2K0M A;  4FCJ A;  4IPB A;  1N9J A;  1YIJ 3;  3T0U A;  4LZI A;  3CPO A;  3I55 3;  3WA2 X;  2C10 A;  3I0Y A;  4N6O B;  3H3H A;  3S27 A;  2GBX B;  2K54 A;  4MMX B;  5ELU A;  4R9K A;  1NB5 I;  1KWI A;  4KVH A;  4NRE A;  2FNQ A;  3S5C A;  2XRX B;  2YFJ B;  3FZW A;  4X2O A;  3EJV A;  3S29 A;  4WYK A;  1W01 A;  1VQ4 3;  2ML5 A;  3PCS A;  2W9Q A;  5IW9 A;  1LVN A;  3NBB A;  3CCS 3;  1UUV B;  3VGN A;  3EBY A;  3EF8 A;  1RJO A;  1N5P A;  1JB4 A;  1KSI A;  2WGQ A;  4LGQ A;  1TU5 A;  4HVN A;  3FG4 A;  1IQY A;  3NBR A;  4HM3 B;  2ML6 A;  4HM8 B;  3O8Y A;  5IEO A;  2OCT A;  3LZA A;  1W4N A;  3QRD A;  4EC6 A;  5JPP A;  1K28 A;  3E99 A;  1Q40 A;  3LT9 A;  1AVL A;  2BNG A;  1OH0 A;  2CG1 A;  1Y4K A;  4R9L A;  3T8N A;  3MYT A;  3NXJ A;  3NM2 A;  3UJM A;  2LQV A;  1Q86 4;  1JKG B;  2O3O A;  4K1U A;  1JJ2 2;  3EN1 B;  1OF5 B;  1GS3 A;  1OGZ A;  1IVV A;  3JUP A;  1E3V A;  3NUV A;  5IG4 A;  1V74 A;  4STD A;  2WO0 A;  2XEP A;  1K8A 4;  3DY5 A;  1RRL A;  1CYU A;  2D1W A;  2HMO B;  3N8B A;  3S67 A;  2W2C A;  4K90 B;  3CCR 3;  3EC9 A;  1GY5 A;  2XR8 B;  2XF3 A;  5LC6 A;  1J2B A;  2Y73 A;  3LOY A;  4N6U A;  4KFE A;  3CME 3;  2CHC A;  2Z76 A;  1CEW I;  3G8Z A;  1M90 4;  1VQN 3;  1TFO A;  4O3V A;  1WNH A;  2RGQ A;  2PNC A;  3BNE A;  4XB5 A;  2BHM A;  1N8R 4;  3S28 A;  1IQX A;  1YJ9 3;  1CYV A;  2W03 A;  1JV2 B;  3FF2 A;  3CCL 3;  1VQM 3;  5FGO A;  3MG3 A;  1STF I;  1VQ8 3;  4KZ1 A;  2ZL8 A;  2QIY A;  1JN5 A;  1IV9 A;  2Z7A A;  1PU4 A;  3F7X A;  2JQ5 A;  2INX A;  1QAF A;  3OX9 A;  4HM5 B;  3PCR A;  1GD4 A;  4IT7 A;  1U5O A;  1W5Z A;  1RRH A;  1WMP A;  2RFR A;  1NU3 A;  3ER7 A;  2CG0 A;  2W6J H;  3HX8 A;  4N6V 0;  2E2V A;  3DZL A;  2OQE A;  3CC7 3;  3NV0 B;  1LNH A;  3WOD G;  1MOL A;  3CXC 2;  1JNQ A;  2WOF A;  2I9W A;  3KE7 A;  1L5G B;  1QAK A;  2GU1 A;  3AMO A;  1VQP 3;  1QMA A;  3B7C A;  3DGL A;  5AEW B;  2B1X B;  3FSD A;  3KKG A;  3D3L A;  3G16 A;  2HMN B;  3HZP A;  4MEI A;  1CQS A;  4R4K A;  1TP6 A;  3F8H A;  5AYS C;  1AR0 A;  3HK4 A;  2CFW A;  3PYJ A;  3F40 A;  3DXO A;  3MWZ A;  1NJI 4;  1IT7 A;  2HMJ B;  4RBN A;  2GEX A;  3PXM A;  3BLZ A;  1FUW A;  3GWR A;  1IT8 A;  2CIU A;  2CH9 A;  5IG5 A;  2CFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...