4N6LA

Crystal structure of human cystatin e/m
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
120
structure length
114
Chain Sequence
QERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-M
publication title Structure and mechanism of an aspartimide-dependent Peptide ligase in human legumain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 21
structure length 114
sequence length 120
ec nomenclature
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6lA00
1GD3A 4TX4A 3UL5A 3SVAA 5LC7A 1LXEA 1CYVA 3PYJA 2BO9B 5LC6A 3IMAB 3PS8A 4CCVA 1N9JA 4IT7A 1IV7A 4LZIA 1DVDA 1TIJA 4N6V0 4N6UA 1DVCA 5EQLA 1YVBI 1MNLA 4N6TA 1R4CA 1G96A 3L0RA 5ELJA 1FUWA 3Q2PA 2W9PA 4N6NB 2O9UX 2W9QA 3GAXA 4N6MA 1PFPA 4ZM8A 1EQKA 3PXMA 1KWIA 3S67A 1WNHA 4EYCA 2KXGA 5ELUA 1IV9A 1NB3I 3MWZA 1M9GA 1A67A 4N6OB 2CH9A 3KSED 1MOLA 4N6LA 3QRDA 1FA3A 3NX0A 1A90A 3UL6A 1CEWI 1N5HA 3K9MC 2OCTA 1RN7A 3KFQC 1CYUA 5A0OB 1GD4A 1ROAA 1STFI 1NB5I 1N5PA 3LH4A
chains in the Genus database with same CATH superfamily
1OH0A 4KFFA 3VGNA 1DMNA 1BRIA 2OTL3 1GD3A 2O3OA 1Q9EA 4HZBB 1G0TA 1FGRA 1W7CA 5GSPA 4O2HA 2P0XA 4J5KA 1IVUA 2ML5A 1BUQA 1I0XA 2XFTA 1O7MB 1GSPA 2GBWB 1SIHA 1UCJA 1JKGB 1YGEA 5IERA 3CCE3 3H3HA 3TDGA 1LOVA 3LTDA 1VQ73 1UUVB 1Y4KA 3JUOA 1ULJB 2INXA 1ISKA 1C7HA 1D6ZA 1U8CB 3LTCA 1MWUA 3RDEA 2CC3A 3LMLA 1IV7A 2CWUA 3JUQA 3UNLA 1DVDA 1V58A 2CW9A 5JPPA 4H61A 1HU9A 1TIJA 2HMKB 1RDSA 3AHSA 4N6UA 1FZUA 2P09A 1UCLA 1O7NB 2KF5A 4FMCA 1T3BA 3I0YA 3WA3A 1DVCA 4WFOA 1DE3A 1V57A 1MGWA 3SLUA 4L8PA 2KCDA 3PGBA 4FCMA 2W6JH 2Z6BA 5CF2A 4HJLB 7STDA 2E2TA 3DH2A 1UGHI 1TFKA 3CXC2 3MG3A 2XH9A 3X40A 1Q40A 1YGWA 4XBTA 4AEQA 1OF5A 1FUWA 1Q824 1CH0A 5BXQA 3F14A 1Z1SA 5CXOA 2BT3A 3NM2A 3LT8A 2Z76A 2MC8A 2QA43 3AMOB 1ULIB 1PU4A 1TRPA 1RTUA 2FGTA 1OGXA 4HOHA 3PXMA 1HKXA 1UDII 2CWTA 1D6YA 2XR8B 1MWTA 4I5QA 2JDIH 3VSYA 3WA2X 1GOYA 4WWUC 1Q864 2K54A 5AEWB 1WMNA 1WNHA 2CFWA 1TTOA 4EYCA 1Q42A 1YI23 4GB5A 3FG4A 2HMOB 2YFJB 5IEOA 2H0GA 1JRQA 3H51A 2Y74A 1BNEA 3EN8A 1GMRA 2BMRB 1JBRA 2YFIB 1JNQA 3ROBA 3CCL3 3F40A 1W00A 1OPYA 3D3LA 1GY5A 4R4KA 4AKZA 1BRNL 3D79A 3NQYA 3NBJA 1UI8A 2B1XB 5IG0A 1ZX2A 4KZ1A 3WR2A 1LVNA 3GSPA 2HMLB 4N6LA 5HOHA 1U5OA 3QRDA 2XRXB 3F8HA 1OGZA 2BNGA 1W02A 1GMPA 1BIRA 1T5YA 2KF3A 1I2EA 3NXJA 4IIAA 3CNXA 3CCU3 3CC23 1HYFA 2A15A 4HM0B 1B27A 1JB2A 4JRFA 4RNTA 5CLKA 1KD14 1LOWA 1RJOA 5CK6A 3MPHA 1ASKA 1VQ43 1BSCA 1RGFA 1QMAA 3B4PA 1BGSA 3A76A 1JKGA 2WOHA 1I70A 1CYUA 2Y73A 5A0OB 3DGMA 1RN4A 3SVAA 1GD4A 2IMJA 1ROAA 9RNTA 3DGNA 4MMXB 3KKGA 3IJEB 1IQ8A 5TGNA 4O3VA 4MMYB 4BTWA 1FGQA 5EVHA 2E2UA 2CG0A 3V99A 2BMOB 4OVMA 3AGOA 4FR9A 4EV5A 1JN5B 3MHEA 2F99A 4EW5A 2E2VA 3X41A 4KFDA 1UUWB 5EEOA 3EE1A 3EQQB 5IG3A 3UL5A 4K1VA 3G8ZA 1F8NA 3FF0A 3OWSA 3E99A 2OQEA 1LXEA 5KP4A 3CME3 3LTBA 3MKIA 3EBTA 4HZ9B 1CYVA 3FZWA 2BO9B 3JUNA 5LC6A 1BSEA 1K41A 1A2VA 1GY7A 4ILFA 4STDA 1IVVA 1LNIA 2ZL8A 3CU3A 1B3SA 2YFLB 1I3FA 1E3VA 3AMOA 5JBSA 5KP1A 1N9JA 1SIIA 4NHFA 4EBGA 2UUGC 1T2IA 4LZIA 2F5MA 2F5WA 4KVHA 3OWYA 1BNJA 2CHCA 3B4OA 3NV0A 1W4NA 2BIRA 2KF6A 3SXXA 1BNSA 1YHQ3 3NQZA 1BSDA 4OUQA 5EQLA 4XDWA 4DKIA 1MGRA 1KC84 1B2XA 1RKYA 4NPBA 1KQS2 1VQL3 4HM5B 3B8LA 5I97A 1L5GB 2LYXA 3BB9A 1VQ63 1EEJA 3CCQ3 4RBNA 1B2SA 1S5AA 1V74A 3UB1A 5ELJA 3N9HA 2W04A 1OUNA 1AY7A 2GEXA 2K0MA 2RFRA 1BU4A 1UGIA 2MF7A 5STDA 1GOUA 3D9RA 4N6NB 1QAKA 1O7GB 4CDLA 1X1XA 1JB4A 4N6MA 4O8SA 2PNCA 2I9WA 2XSHB 1EQKA 4K90B 1KWIA 1NU3A 3PZWA 3K63A 4LMIA 1RHLA 1GS3A 2AADA 3G16A 1RGAA 5CF1A 1TRQA 3CPW2 1IV9A 3D4AA 1M1K4 1BVIA 2IUJA 4FMAA 3CCJ3 1NB3I 2M7OA 1O7HB 4HM7B 3O8YA 1FGMA 5IG4A 4X2HA 1BRGA 1M9GA 2CX0A 3NM7A 2P38A 2IUKA 1O7PB 2QGUA 2WOFA 2KF4A 2OQEC 1WMOA 1BRJA 2XF3A 5G1LA 1B2ZA 1MOLA 2Q07A 3ZG0A 1JN5A 3EJVA 3I563 3S27A 1OACA 1FA3A 2Z7AA 3NX0A 4CJNA 1YJ93 2W56B 1AVLA 1QVF2 3UL6A 5AYSC 1OHSA 1X1YA 2ML6A 4H3UA 4KT3B 1CEWI 1TP6A 1EUIC 3CCV3 1Q7HA 1BSBA 2C11A 1TJDA 2K3DA 3CMA3 4PEJA 2F98A 1QVG2 2C10A 1BNGA 3N8BA 3KZTA 1UCKA 6GSPA 4IPBA 2OCTA 4I4KA 3STDA 1VQO3 2CWVA 2BMQB 4BL3A 1GMQA 3DGYA 1DYUA 5M1AA 1X1UA 1W2B2 1K734 2XSOB 3K5TA 5KP3A 4FCJA 3ZG5A 1YJN3 1AR0A 3BNEA 1G02A 4RNZA 1RGLA 2R4IA 1NDOB 1PYLA 5BIRA 2GU3A 1DETA 2B24B 3U1WA 4BTXA 3DGLA 1ZGXA 3LOYA 3WODG 3LH4A 2CFKA 1S723 1QJGA 4WHAA 3MG2A 3T0UA 3CC73 2RGQA 3Q1CA 3B7CA 3CCR3 1N8R4 3VF1A 1BNFA 4QWTA 1US1A 4FMBA 4TX4A 3T8UA 1E97A 1CQSA 1RRLA 1GYBA 2WO0A 3F7XA 3HIIA 4X2OA 5FGOA 3JUMA 5LC7A 3V92A 1BRSA 1DMQA 3ER7A 3CCS3 1JB5A 1J2BA 3OW22 2CFGA 3WOEB 2W0QA 3KSPA 4U13A 4HM6B 1BAOA 5M18A 4XBXA 3HK4A 3GZBA 5DREA 4BU4A 3DUKA 3Q3FA 4L8OA 1ZO2A 4BL2A 1OHOA 3G6E3 2C4BA 4K1UA 4CCVA 1I2FA 3DXOA 1SPUA 2F56A 2FXTA 2L1SA 3FLJA 3DY5A 5BU4A 4IT7A 3LT9A 2JQ5A 2CIUA 4LYLB 4Q53A 2GSPA 1IT8A 1JZDA 2GEYA 2QEX3 4XM4A 1GY6A 5IF6A 3WMDA 1JJ22 1E3RA 3AHWA 2F86B 1YVBI 3J7Yd 3U97A 1N9EA 1STDA 4N3VA 3X3YA 4N6TA 1HZ1A 1RLSA 1B2MA 2XEPA 3X42A 3AGNA 3S29A 1NWWA 2WGQA 1GOVA 1VQP3 3FSDA 1W6CA 3F9SA 2WGOA 1BANA 1T2HA 2O9UX 2W9QA 3SEDA 2GBXB 4RNYA 2XFSA 1NO3A 2OWPA 3ZFZA 1WQLB 1PFPA 2W56A 1LQMB 2CG1A 1RRHA 4GSPA 1BUJA 3K0ZA 2IY2A 4J8TA 5AIHA 2KXGA 2PZVA 3LTAA 1FYSA 8CHOA 1IK3A 3RGAA 2F4YA 1MWSA 3EBYA 3SX1A 1JV2B 3ECFA 3SOYA 4XB5A 1A2KA 3BNCA 3MWZA 3OXAA 3X3ZA 8RNTA 3RGRA 3S28A 1RCKA 4WP5A 3EX9A 2L4VA 5IEPA 1B21A 2OOVA 3EF8A 3BLZA 3PCSA 1FGOA 2HMJB 4R9KA 4N6OB 1Q7Y4 1M904 2W2CA 2P05A 2HMMB 3F8XA 3MG1A 4CPKA 3SOAA 3IPTA 2CFLA 1UCIA 1B20A 3HI7A 4NREA 2D1WA 1W2ZA 1I3IA 3FKAA 1C54A 1N5HA 1N8QA 1EKMA 5HGRA 2R41A 5M19A 1SARA 2XGNA 6STDA 1MWRA 4KFEA 2CKFB 2W03A 4MJDA 1VQ93 1IYYA 1RNTA 1NJI4 2SARA 3HIGA 3KFQC 4XDVA 1LQGC 3EB8A 1KSIA 1OCVA 2HOHA 3KCHA 5D81A 4HM4B 3GZYB 3DZLA 1ROVA 2FNQA 2XGLA 3LZAA 4J5GA 3OV4A 1IDPA 1NB5I 3UJMA 5IG5A 4R9LA 1TFOA 1X1WA 3WDGB 7GSPA 1I8VA 3HOHA 3LXUX 5AYRB 2OTJ3 4HYZA 4GL6A 1B2UA 3URPA 1RGHA 3X3XA 3K7CA 4G1MB 1AQZA 1OHPA 1BRKA 2Z77A 1VQ53 1RGEA 3Q90A 1VQK3 1FGTA 2BU4A 3F7SA 4K61A 3MSOA 3NHXA 2P0MA 1AVKA 1BRHA 1LRAA 1RCLA 1W6YA 3T8NA 3CD63 2KRTA 2YX9A 1K28A 1FUSA 1DMMA 1QALA 3DMCA 3PYJA 4EXRA 1VQM3 3IMAB 1RGGA 7RNTA 3JVCA 3PS8A 2QIYA 1UUGB 1RNBA 1AV4A 1M1XB 4L7KA 4RZMA 1LNHA 5RNTA 1BNIA 4EV2A 3G713 3ALAA 1IQXA 4HKVB 3EC9A 5AIGA 2RBIA 1BSAA 3EHCA 4HM1B 3QK9A 2HMNB 1YNVX 3D5IA 3A5EA 3KIIA 2OOVC 3CPOA 3BIRA 1SQWA 4N6V0 4WYKB 5DRVA 3NV0B 4LGQA 3WHOA 1JBSA 4ORLA 3FGYA 3BU4A 4O02B 1IU7A 2IA7A 4JF8A 1W5ZA 1VQ83 3KE7A 5IW9A 3M8CA 1RGKA 1IVXA 2H0IA 2UX0A 1I2GA 1MNLA 1NNVA 3KN4A 4WYKA 5D82A 6RNTA 1R4CA 4HM8B 3GZRA 4HBRA 5BVBA 1G96A 1ZS7A 3NBBA 3L0RA 1YJW3 3FF2A 3FH1A 2GXFA 3NBRA 4HM3B 1K9M4 1R4YA 3Q2PA 4BTYA 5G1KA 5FW5A 2W9PA 1YIT3 1Q814 1SJWA 3GWRA 3HZPA 3GAXA 4EC6A 1EG9B 5AIIA 1IVWA 1PY3A 4ZM8A 1UW1A 1K8A4 3S67A 1BNRA 4OK0A 2J8XB 1TUHA 4XBYA 3I553 2CFDA 3DM8A 3EN1B 5ELUA 1LOYA 4FMDA 4BIRA 3G4S3 3SYUA 1O7WB 3DGOA 2KAAA 3CCM3 2LQVA 5D83A 4AKYA 4HVNA 4J9AA 2RNTA 5AI1A 3OX9A 3FG1A 2CX1A 3WOFB 3CNMA 1RMSA 1Q40B 1RGCA 2D42A 2UGIA 2V1LA 4LEHA 1BOXA 1A67A 1IT7A 1OF5B 5AEUB 2RCDA 2CH9A 2GU1A 3KSED 3LYGA 5AIFA 1YVSA 3GZXB 3MYTA 4GHOA 4HAAA 1WTHA 3JUPA 1VQQA 1A90A 1W01A 5G2GA 4LSOA 1I0VA 2RSXA 1W6GA 1TU5A 4R80A 2H0HA 3BNDA 3N54B 3NUVA 2ZA4A 3K9MC 1A2PA 4R1KA 2STDA 1RSNA 3D5GA 2SBLA 1WMPA 3GRDA 3PCRA 1FUTA 2IYJA 1RN7A 1JZOA 2BHMA 1UI7A 3G0KA 3CC43 1FW7A 1D6UA 4MEIA 1VZZA 3RNTA 4MMZB 1YIJ3 3OWUA 2AAEA 2CK3H 3V98A 2ZHXB 1JBTA 1RN1A 3BNBA 4HM2B 5JPUA 2ZDJA 1STFI 3HX8A 3FG3A 1IQYA 3S5CA 5IENA 1VQN3 1EA2A 1N5PA 3FCSB 1LOXA 1QAFA 4FCZA
chains in the Genus database with same CATH topology
1OH0A 4KFFA 3VGNA 1DMNA 2OTL3 1GD3A 2O3OA 4HZBB 1FGRA 1W7CA 4O2HA 2P0XA 1IVUA 2ML5A 1BUQA 2XFTA 1O7MB 2GBWB 1SIHA 1JKGB 1YGEA 5IERA 3CCE3 3H3HA 3TDGA 3LTDA 1VQ73 1UUVB 1Y4KA 3JUOA 1ULJB 2INXA 1ISKA 1C7HA 1D6ZA 1U8CB 3LTCA 3RDEA 2CC3A 3LMLA 1IV7A 2CWUA 3JUQA 3UNLA 1DVDA 2CW9A 5JPPA 4H61A 1HU9A 1TIJA 2HMKB 4N6UA 2P09A 1O7NB 4FMCA 3I0YA 3WA3A 1DVCA 4WFOA 3SLUA 4L8PA 2KCDA 3PGBA 4FCMA 2W6JH 2Z6BA 5CF2A 4HJLB 7STDA 2E2TA 1TFKA 3CXC2 3MG3A 2XH9A 3X40A 1Q40A 4XBTA 4AEQA 1OF5A 1FUWA 1Q824 5BXQA 3F14A 1Z1SA 5CXOA 2BT3A 3NM2A 3LT8A 2Z76A 2MC8A 2QA43 3AMOB 1ULIB 1PU4A 2FGTA 1OGXA 3PXMA 1HKXA 2CWTA 1D6YA 2XR8B 3VSYA 2JDIH 3WA2X 1Q864 4WWUC 2K54A 5AEWB 1WMNA 1WNHA 2CFWA 4EYCA 1YI23 1Q42A 4GB5A 3FG4A 2HMOB 2YFJB 5IEOA 1JRQA 3H51A 2Y74A 3EN8A 2BMRB 2YFIB 1JNQA 3ROBA 3CCL3 3F40A 1W00A 1OPYA 3D3LA 1GY5A 4R4KA 4AKZA 3NQYA 3NBJA 1UI8A 2B1XB 5IG0A 1ZX2A 4KZ1A 1LVNA 2HMLB 4N6LA 1U5OA 3QRDA 2XRXB 3F8HA 1OGZA 2BNGA 1W02A 1T5YA 3NXJA 4IIAA 3CNXA 3CCU3 3CC23 2A15A 4HM0B 4JRFA 1JB2A 5CLKA 1KD14 1RJOA 5CK6A 3MPHA 1ASKA 1VQ43 1QMAA 3B4PA 3A76A 1JKGA 2WOHA 1CYUA 2Y73A 5A0OB 3DGMA 3SVAA 1GD4A 2IMJA 1ROAA 3DGNA 4MMXB 3KKGA 3IJEB 1IQ8A 5TGNA 4O3VA 4MMYB 4BTWA 1FGQA 5EVHA 2E2UA 2CG0A 3V99A 2BMOB 4OVMA 4FR9A 4EV5A 1JN5B 3MHEA 2F99A 2E2VA 3X41A 4KFDA 1UUWB 5EEOA 3EE1A 3EQQB 5IG3A 3UL5A 4K1VA 3G8ZA 1F8NA 3FF0A 3OWSA 3E99A 2OQEA 1LXEA 5KP4A 3CME3 3LTBA 3MKIA 3EBTA 4HZ9B 1CYVA 3FZWA 2BO9B 3JUNA 5LC6A 1K41A 1A2VA 1GY7A 4STDA 1IVVA 2ZL8A 3CU3A 2YFLB 5JBSA 1E3VA 3AMOA 5KP1A 1N9JA 1SIIA 4NHFA 4EBGA 4LZIA 4KVHA 3OWYA 2CHCA 3B4OA 3NV0A 1W4NA 3SXXA 1YHQ3 3NQZA 4OUQA 5EQLA 4XDWA 1KC84 1RKYA 1KQS2 1VQL3 4HM5B 3B8LA 5I97A 1L5GB 2LYXA 3BB9A 1VQ63 3CCQ3 4RBNA 1S5AA 3UB1A 1V74A 5ELJA 3N9HA 2W04A 1OUNA 2RFRA 2GEXA 2K0MA 5STDA 2MF7A 3D9RA 4N6NB 1QAKA 1O7GB 4CDLA 4N6MA 1JB4A 4O8SA 2PNCA 2I9WA 2XSHB 1EQKA 4K90B 1KWIA 1NU3A 3PZWA 3K63A 4LMIA 1GS3A 3G16A 5CF1A 3CPW2 1IV9A 1M1K4 2IUJA 4FMAA 3CCJ3 1NB3I 2M7OA 1O7HB 4HM7B 3O8YA 1FGMA 5IG4A 4X2HA 1M9GA 3NM7A 2P38A 2IUKA 1O7PB 2QGUA 2WOFA 2OQEC 1WMOA 2XF3A 3I563 1MOLA 2Q07A 1JN5A 3EJVA 3S27A 1OACA 1FA3A 2Z7AA 3NX0A 1YJ93 2W56B 1AVLA 1QVF2 3UL6A 5AYSC 1OHSA 2ML6A 4H3UA 1CEWI 1TP6A 3CCV3 2C11A 3CMA3 4PEJA 2F98A 1QVG2 2C10A 3N8BA 3KZTA 4IPBA 2OCTA 4I4KA 3STDA 1VQO3 2CWVA 2BMQB 1DYUA 1W2B2 1K734 2XSOB 3K5TA 5KP3A 4FCJA 1YJN3 1AR0A 3BNEA 4RNZA 2R4IA 1NDOB 2GU3A 2B24B 3U1WA 4BTXA 3DGLA 3LOYA 3WODG 3LH4A 2CFKA 1S723 1QJGA 4WHAA 3MG2A 3T0UA 3CC73 2RGQA 3Q1CA 3B7CA 3CCR3 1N8R4 3VF1A 4QWTA 3T8UA 1US1A 4FMBA 4TX4A 1E97A 1CQSA 1RRLA 1GYBA 2WO0A 3F7XA 3HIIA 4X2OA 5FGOA 3JUMA 5LC7A 3V92A 3ER7A 1DMQA 3CCS3 1J2BA 1JB5A 3OW22 2CFGA 3WOEB 2W0QA 3KSPA 4U13A 4HM6B 4XBXA 3HK4A 3GZBA 5DREA 3DUKA 4L8OA 1ZO2A 1OHOA 3G6E3 4K1UA 4CCVA 3DXOA 1SPUA 2FXTA 3FLJA 3DY5A 4IT7A 3LT9A 2JQ5A 2CIUA 4Q53A 1IT8A 2GEYA 2QEX3 4XM4A 1GY6A 5IF6A 3WMDA 1JJ22 1E3RA 2F86B 1YVBI 3J7Yd 3U97A 1N9EA 1STDA 4N3VA 3X3YA 4N6TA 2XEPA 3X42A 3S29A 1NWWA 2WGQA 1VQP3 3FSDA 1W6CA 3F9SA 2WGOA 2O9UX 2W9QA 3SEDA 2GBXB 4RNYA 2XFSA 1NO3A 2OWPA 1WQLB 1PFPA 2W56A 2CG1A 1RRHA 3K0ZA 4J8TA 5AIHA 2KXGA 2PZVA 3LTAA 8CHOA 1IK3A 3RGAA 3EBYA 3SX1A 1JV2B 3ECFA 3SOYA 4XB5A 1A2KA 3BNCA 3MWZA 3OXAA 3X3ZA 3RGRA 3S28A 4WP5A 3EX9A 2L4VA 5IEPA 2OOVA 3EF8A 3BLZA 3PCSA 1FGOA 2HMJB 4R9KA 4N6OB 1Q7Y4 1M904 2W2CA 2P05A 2HMMB 3F8XA 3MG1A 3SOAA 3IPTA 2CFLA 3HI7A 4NREA 2D1WA 1W2ZA 3FKAA 1N5HA 1N8QA 1EKMA 5HGRA 2XGNA 6STDA 4KFEA 2CKFB 2W03A 4MJDA 1VQ93 1NJI4 3KFQC 3HIGA 4XDVA 3EB8A 1KSIA 1OCVA 5D81A 4HM4B 3GZYB 3DZLA 1ROVA 2FNQA 2XGLA 3LZAA 3OV4A 1IDPA 1NB5I 3UJMA 5IG5A 4R9LA 1TFOA 3WDGB 3LXUX 2OTJ3 5AYRB 4HYZA 4GL6A 3X3XA 3K7CA 4G1MB 1OHPA 2Z77A 1VQ53 3Q90A 1VQK3 1FGTA 3F7SA 4K61A 3MSOA 3NHXA 2P0MA 1AVKA 3T8NA 1W6YA 3CD63 2KRTA 2YX9A 1K28A 1DMMA 1QALA 3DMCA 3PYJA 4EXRA 1VQM3 3IMAB 3JVCA 3PS8A 2QIYA 1AV4A 1M1XB 4L7KA 4RZMA 1LNHA 4EV2A 3G713 3ALAA 1IQXA 4HKVB 3EC9A 5AIGA 3EHCA 4HM1B 3QK9A 2HMNB 3KIIA 2OOVC 3CPOA 4N6V0 1SQWA 4WYKB 5DRVA 3NV0B 4LGQA 4ORLA 3FGYA 4O02B 1IU7A 2IA7A 4JF8A 1W5ZA 1VQ83 3KE7A 5IW9A 3M8CA 1IVXA 2UX0A 4WYKA 1MNLA 3KN4A 5D82A 1R4CA 4HM8B 3GZRA 4HBRA 5BVBA 1G96A 3NBBA 3L0RA 1YJW3 3FF2A 3FH1A 2GXFA 3NBRA 4HM3B 1K9M4 3Q2PA 4BTYA 5FW5A 2W9PA 1YIT3 1Q814 1SJWA 3GWRA 3HZPA 3GAXA 4EC6A 1EG9B 5AIIA 1IVWA 4ZM8A 1UW1A 1K8A4 3S67A 4OK0A 1TUHA 4XBYA 3I553 2CFDA 3DM8A 3EN1B 5ELUA 4FMDA 3G4S3 1O7WB 3DGOA 3CCM3 2LQVA 5D83A 4AKYA 4HVNA 4J9AA 5AI1A 3OX9A 3FG1A 3WOFB 3CNMA 1Q40B 2D42A 2V1LA 4LEHA 1A67A 1IT7A 1OF5B 5AEUB 2RCDA 2CH9A 2GU1A 3KSED 3LYGA 5AIFA 3GZXB 3MYTA 1WTHA 3JUPA 1A90A 1W01A 5G2GA 4LSOA 2RSXA 1W6GA 1TU5A 4R80A 3BNDA 3N54B 3NUVA 3K9MC 4R1KA 2STDA 2SBLA 1WMPA 3GRDA 3PCRA 1RN7A 2BHMA 1UI7A 3G0KA 3CC43 1D6UA 4MEIA 1VZZA 4MMZB 1YIJ3 3OWUA 3V98A 2CK3H 4HM2B 3BNBA 5JPUA 2ZDJA 1STFI 3HX8A 3FG3A 1IQYA 3S5CA 5IENA 1VQN3 1EA2A 1N5PA 3FCSB 1LOXA 1QAFA 4FCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD3 A;  4TX4 A;  3UL5 A;  3SVA A;  5LC7 A;  1LXE A;  1CYV A;  3PYJ A;  2BO9 B;  5LC6 A;  3IMA B;  3PS8 A;  4CCV A;  1N9J A;  4IT7 A;  1IV7 A;  4LZI A;  1DVD A;  1TIJ A;  4N6V 0;  4N6U A;  1DVC A;  5EQL A;  1YVB I;  1MNL A;  4N6T A;  1R4C A;  1G96 A;  3L0R A;  5ELJ A;  1FUW A;  3Q2P A;  2W9P A;  4N6N B;  2O9U X;  2W9Q A;  3GAX A;  4N6M A;  1PFP A;  4ZM8 A;  1EQK A;  3PXM A;  1KWI A;  3S67 A;  1WNH A;  4EYC A;  2KXG A;  5ELU A;  1IV9 A;  1NB3 I;  3MWZ A;  1M9G A;  1A67 A;  4N6O B;  2CH9 A;  3KSE D;  1MOL A;  4N6L A;  3QRD A;  1FA3 A;  3NX0 A;  1A90 A;  3UL6 A;  1CEW I;  1N5H A;  3K9M C;  2OCT A;  1RN7 A;  3KFQ C;  1CYU A;  5A0O B;  1GD4 A;  1ROA A;  1STF I;  1NB5 I;  1N5P A;  3LH4 A; 
#chains in the Genus database with same CATH topology
 1OH0 A;  4KFF A;  3VGN A;  1DMN A;  1BRI A;  2OTL 3;  1GD3 A;  2O3O A;  1Q9E A;  4HZB B;  1G0T A;  1FGR A;  1W7C A;  5GSP A;  4O2H A;  2P0X A;  4J5K A;  1IVU A;  2ML5 A;  1BUQ A;  1I0X A;  2XFT A;  1O7M B;  1GSP A;  2GBW B;  1SIH A;  1UCJ A;  1JKG B;  1YGE A;  5IER A;  3CCE 3;  3H3H A;  3TDG A;  1LOV A;  3LTD A;  1VQ7 3;  1UUV B;  1Y4K A;  3JUO A;  1ULJ B;  2INX A;  1ISK A;  1C7H A;  1D6Z A;  1U8C B;  3LTC A;  1MWU A;  3RDE A;  2CC3 A;  3LML A;  1IV7 A;  2CWU A;  3JUQ A;  3UNL A;  1DVD A;  1V58 A;  2CW9 A;  5JPP A;  4H61 A;  1HU9 A;  1TIJ A;  2HMK B;  1RDS A;  3AHS A;  4N6U A;  1FZU A;  2P09 A;  1UCL A;  1O7N B;  2KF5 A;  4FMC A;  1T3B A;  3I0Y A;  3WA3 A;  1DVC A;  4WFO A;  1DE3 A;  1V57 A;  1MGW A;  3SLU A;  4L8P A;  2KCD A;  3PGB A;  4FCM A;  2W6J H;  2Z6B A;  5CF2 A;  4HJL B;  7STD A;  2E2T A;  3DH2 A;  1UGH I;  1TFK A;  3CXC 2;  3MG3 A;  2XH9 A;  3X40 A;  1Q40 A;  1YGW A;  4XBT A;  4AEQ A;  1OF5 A;  1FUW A;  1Q82 4;  1CH0 A;  5BXQ A;  3F14 A;  1Z1S A;  5CXO A;  2BT3 A;  3NM2 A;  3LT8 A;  2Z76 A;  2MC8 A;  2QA4 3;  3AMO B;  1ULI B;  1PU4 A;  1TRP A;  1RTU A;  2FGT A;  1OGX A;  4HOH A;  3PXM A;  1HKX A;  1UDI I;  2CWT A;  1D6Y A;  2XR8 B;  1MWT A;  4I5Q A;  2JDI H;  3VSY A;  3WA2 X;  1GOY A;  4WWU C;  1Q86 4;  2K54 A;  5AEW B;  1WMN A;  1WNH A;  2CFW A;  1TTO A;  4EYC A;  1Q42 A;  1YI2 3;  4GB5 A;  3FG4 A;  2HMO B;  2YFJ B;  5IEO A;  2H0G A;  1JRQ A;  3H51 A;  2Y74 A;  1BNE A;  3EN8 A;  1GMR A;  2BMR B;  1JBR A;  2YFI B;  1JNQ A;  3ROB A;  3CCL 3;  3F40 A;  1W00 A;  1OPY A;  3D3L A;  1GY5 A;  4R4K A;  4AKZ A;  1BRN L;  3D79 A;  3NQY A;  3NBJ A;  1UI8 A;  2B1X B;  5IG0 A;  1ZX2 A;  4KZ1 A;  3WR2 A;  1LVN A;  3GSP A;  2HML B;  4N6L A;  5HOH A;  1U5O A;  3QRD A;  2XRX B;  3F8H A;  1OGZ A;  2BNG A;  1W02 A;  1GMP A;  1BIR A;  1T5Y A;  2KF3 A;  1I2E A;  3NXJ A;  4IIA A;  3CNX A;  3CCU 3;  3CC2 3;  1HYF A;  2A15 A;  4HM0 B;  1B27 A;  1JB2 A;  4JRF A;  4RNT A;  5CLK A;  1KD1 4;  1LOW A;  1RJO A;  5CK6 A;  3MPH A;  1ASK A;  1VQ4 3;  1BSC A;  1RGF A;  1QMA A;  3B4P A;  1BGS A;  3A76 A;  1JKG A;  2WOH A;  1I70 A;  1CYU A;  2Y73 A;  5A0O B;  3DGM A;  1RN4 A;  3SVA A;  1GD4 A;  2IMJ A;  1ROA A;  9RNT A;  3DGN A;  4MMX B;  3KKG A;  3IJE B;  1IQ8 A;  5TGN A;  4O3V A;  4MMY B;  4BTW A;  1FGQ A;  5EVH A;  2E2U A;  2CG0 A;  3V99 A;  2BMO B;  4OVM A;  3AGO A;  4FR9 A;  4EV5 A;  1JN5 B;  3MHE A;  2F99 A;  4EW5 A;  2E2V A;  3X41 A;  4KFD A;  1UUW B;  5EEO A;  3EE1 A;  3EQQ B;  5IG3 A;  3UL5 A;  4K1V A;  3G8Z A;  1F8N A;  3FF0 A;  3OWS A;  3E99 A;  2OQE A;  1LXE A;  5KP4 A;  3CME 3;  3LTB A;  3MKI A;  3EBT A;  4HZ9 B;  1CYV A;  3FZW A;  2BO9 B;  3JUN A;  5LC6 A;  1BSE A;  1K41 A;  1A2V A;  1GY7 A;  4ILF A;  4STD A;  1IVV A;  1LNI A;  2ZL8 A;  3CU3 A;  1B3S A;  2YFL B;  1I3F A;  1E3V A;  3AMO A;  5JBS A;  5KP1 A;  1N9J A;  1SII A;  4NHF A;  4EBG A;  2UUG C;  1T2I A;  4LZI A;  2F5M A;  2F5W A;  4KVH A;  3OWY A;  1BNJ A;  2CHC A;  3B4O A;  3NV0 A;  1W4N A;  2BIR A;  2KF6 A;  3SXX A;  1BNS A;  1YHQ 3;  3NQZ A;  1BSD A;  4OUQ A;  5EQL A;  4XDW A;  4DKI A;  1MGR A;  1KC8 4;  1B2X A;  1RKY A;  4NPB A;  1KQS 2;  1VQL 3;  4HM5 B;  3B8L A;  5I97 A;  1L5G B;  2LYX A;  3BB9 A;  1VQ6 3;  1EEJ A;  3CCQ 3;  4RBN A;  1B2S A;  1S5A A;  1V74 A;  3UB1 A;  5ELJ A;  3N9H A;  2W04 A;  1OUN A;  1AY7 A;  2GEX A;  2K0M A;  2RFR A;  1BU4 A;  1UGI A;  2MF7 A;  5STD A;  1GOU A;  3D9R A;  4N6N B;  1QAK A;  1O7G B;  4CDL A;  1X1X A;  1JB4 A;  4N6M A;  4O8S A;  2PNC A;  2I9W A;  2XSH B;  1EQK A;  4K90 B;  1KWI A;  1NU3 A;  3PZW A;  3K63 A;  4LMI A;  1RHL A;  1GS3 A;  2AAD A;  3G16 A;  1RGA A;  5CF1 A;  1TRQ A;  3CPW 2;  1IV9 A;  3D4A A;  1M1K 4;  1BVI A;  2IUJ A;  4FMA A;  3CCJ 3;  1NB3 I;  2M7O A;  1O7H B;  4HM7 B;  3O8Y A;  1FGM A;  5IG4 A;  4X2H A;  1BRG A;  1M9G A;  2CX0 A;  3NM7 A;  2P38 A;  2IUK A;  1O7P B;  2QGU A;  2WOF A;  2KF4 A;  2OQE C;  1WMO A;  1BRJ A;  2XF3 A;  5G1L A;  1B2Z A;  1MOL A;  2Q07 A;  3ZG0 A;  1JN5 A;  3EJV A;  3I56 3;  3S27 A;  1OAC A;  1FA3 A;  2Z7A A;  3NX0 A;  4CJN A;  1YJ9 3;  2W56 B;  1AVL A;  1QVF 2;  3UL6 A;  5AYS C;  1OHS A;  1X1Y A;  2ML6 A;  4H3U A;  4KT3 B;  1CEW I;  1TP6 A;  1EUI C;  3CCV 3;  1Q7H A;  1BSB A;  2C11 A;  1TJD A;  2K3D A;  3CMA 3;  4PEJ A;  2F98 A;  1QVG 2;  2C10 A;  1BNG A;  3N8B A;  3KZT A;  1UCK A;  6GSP A;  4IPB A;  2OCT A;  4I4K A;  3STD A;  1VQO 3;  2CWV A;  2BMQ B;  4BL3 A;  1GMQ A;  3DGY A;  1DYU A;  5M1A A;  1X1U A;  1W2B 2;  1K73 4;  2XSO B;  3K5T A;  5KP3 A;  4FCJ A;  3ZG5 A;  1YJN 3;  1AR0 A;  3BNE A;  1G02 A;  4RNZ A;  1RGL A;  2R4I A;  1NDO B;  1PYL A;  5BIR A;  2GU3 A;  1DET A;  2B24 B;  3U1W A;  4BTX A;  3DGL A;  1ZGX A;  3LOY A;  3WOD G;  3LH4 A;  2CFK A;  1S72 3;  1QJG A;  4WHA A;  3MG2 A;  3T0U A;  3CC7 3;  2RGQ A;  3Q1C A;  3B7C A;  3CCR 3;  1N8R 4;  3VF1 A;  1BNF A;  4QWT A;  1US1 A;  4FMB A;  4TX4 A;  3T8U A;  1E97 A;  1CQS A;  1RRL A;  1GYB A;  2WO0 A;  3F7X A;  3HII A;  4X2O A;  5FGO A;  3JUM A;  5LC7 A;  3V92 A;  1BRS A;  1DMQ A;  3ER7 A;  3CCS 3;  1JB5 A;  1J2B A;  3OW2 2;  2CFG A;  3WOE B;  2W0Q A;  3KSP A;  4U13 A;  4HM6 B;  1BAO A;  5M18 A;  4XBX A;  3HK4 A;  3GZB A;  5DRE A;  4BU4 A;  3DUK A;  3Q3F A;  4L8O A;  1ZO2 A;  4BL2 A;  1OHO A;  3G6E 3;  2C4B A;  4K1U A;  4CCV A;  1I2F A;  3DXO A;  1SPU A;  2F56 A;  2FXT A;  2L1S A;  3FLJ A;  3DY5 A;  5BU4 A;  4IT7 A;  3LT9 A;  2JQ5 A;  2CIU A;  4LYL B;  4Q53 A;  2GSP A;  1IT8 A;  1JZD A;  2GEY A;  2QEX 3;  4XM4 A;  1GY6 A;  5IF6 A;  3WMD A;  1JJ2 2;  1E3R A;  3AHW A;  2F86 B;  1YVB I;  3J7Y d;  3U97 A;  1N9E A;  1STD A;  4N3V A;  3X3Y A;  4N6T A;  1HZ1 A;  1RLS A;  1B2M A;  2XEP A;  3X42 A;  3AGN A;  3S29 A;  1NWW A;  2WGQ A;  1GOV A;  1VQP 3;  3FSD A;  1W6C A;  3F9S A;  2WGO A;  1BAN A;  1T2H A;  2O9U X;  2W9Q A;  3SED A;  2GBX B;  4RNY A;  2XFS A;  1NO3 A;  2OWP A;  3ZFZ A;  1WQL B;  1PFP A;  2W56 A;  1LQM B;  2CG1 A;  1RRH A;  4GSP A;  1BUJ A;  3K0Z A;  2IY2 A;  4J8T A;  5AIH A;  2KXG A;  2PZV A;  3LTA A;  1FYS A;  8CHO A;  1IK3 A;  3RGA A;  2F4Y A;  1MWS A;  3EBY A;  3SX1 A;  1JV2 B;  3ECF A;  3SOY A;  4XB5 A;  1A2K A;  3BNC A;  3MWZ A;  3OXA A;  3X3Z A;  8RNT A;  3RGR A;  3S28 A;  1RCK A;  4WP5 A;  3EX9 A;  2L4V A;  5IEP A;  1B21 A;  2OOV A;  3EF8 A;  3BLZ A;  3PCS A;  1FGO A;  2HMJ B;  4R9K A;  4N6O B;  1Q7Y 4;  1M90 4;  2W2C A;  2P05 A;  2HMM B;  3F8X A;  3MG1 A;  4CPK A;  3SOA A;  3IPT A;  2CFL A;  1UCI A;  1B20 A;  3HI7 A;  4NRE A;  2D1W A;  1W2Z A;  1I3I A;  3FKA A;  1C54 A;  1N5H A;  1N8Q A;  1EKM A;  5HGR A;  2R41 A;  5M19 A;  1SAR A;  2XGN A;  6STD A;  1MWR A;  4KFE A;  2CKF B;  2W03 A;  4MJD A;  1VQ9 3;  1IYY A;  1RNT A;  1NJI 4;  2SAR A;  3HIG A;  3KFQ C;  4XDV A;  1LQG C;  3EB8 A;  1KSI A;  1OCV A;  2HOH A;  3KCH A;  5D81 A;  4HM4 B;  3GZY B;  3DZL A;  1ROV A;  2FNQ A;  2XGL A;  3LZA A;  4J5G A;  3OV4 A;  1IDP A;  1NB5 I;  3UJM A;  5IG5 A;  4R9L A;  1TFO A;  1X1W A;  3WDG B;  7GSP A;  1I8V A;  3HOH A;  3LXU X;  5AYR B;  2OTJ 3;  4HYZ A;  4GL6 A;  1B2U A;  3URP A;  1RGH A;  3X3X A;  3K7C A;  4G1M B;  1AQZ A;  1OHP A;  1BRK A;  2Z77 A;  1VQ5 3;  1RGE A;  3Q90 A;  1VQK 3;  1FGT A;  2BU4 A;  3F7S A;  4K61 A;  3MSO A;  3NHX A;  2P0M A;  1AVK A;  1BRH A;  1LRA A;  1RCL A;  1W6Y A;  3T8N A;  3CD6 3;  2KRT A;  2YX9 A;  1K28 A;  1FUS A;  1DMM A;  1QAL A;  3DMC A;  3PYJ A;  4EXR A;  1VQM 3;  3IMA B;  1RGG A;  7RNT A;  3JVC A;  3PS8 A;  2QIY A;  1UUG B;  1RNB A;  1AV4 A;  1M1X B;  4L7K A;  4RZM A;  1LNH A;  5RNT A;  1BNI A;  4EV2 A;  3G71 3;  3ALA A;  1IQX A;  4HKV B;  3EC9 A;  5AIG A;  2RBI A;  1BSA A;  3EHC A;  4HM1 B;  3QK9 A;  2HMN B;  1YNV X;  3D5I A;  3A5E A;  3KII A;  2OOV C;  3CPO A;  3BIR A;  1SQW A;  4N6V 0;  4WYK B;  5DRV A;  3NV0 B;  4LGQ A;  3WHO A;  1JBS A;  4ORL A;  3FGY A;  3BU4 A;  4O02 B;  1IU7 A;  2IA7 A;  4JF8 A;  1W5Z A;  1VQ8 3;  3KE7 A;  5IW9 A;  3M8C A;  1RGK A;  1IVX A;  2H0I A;  2UX0 A;  1I2G A;  1MNL A;  1NNV A;  3KN4 A;  4WYK A;  5D82 A;  6RNT A;  1R4C A;  4HM8 B;  3GZR A;  4HBR A;  5BVB A;  1G96 A;  1ZS7 A;  3NBB A;  3L0R A;  1YJW 3;  3FF2 A;  3FH1 A;  2GXF A;  3NBR A;  4HM3 B;  1K9M 4;  1R4Y A;  3Q2P A;  4BTY A;  5G1K A;  5FW5 A;  2W9P A;  1YIT 3;  1Q81 4;  1SJW A;  3GWR A;  3HZP A;  3GAX A;  4EC6 A;  1EG9 B;  5AII A;  1IVW A;  1PY3 A;  4ZM8 A;  1UW1 A;  1K8A 4;  3S67 A;  1BNR A;  4OK0 A;  2J8X B;  1TUH A;  4XBY A;  3I55 3;  2CFD A;  3DM8 A;  3EN1 B;  5ELU A;  1LOY A;  4FMD A;  4BIR A;  3G4S 3;  3SYU A;  1O7W B;  3DGO A;  2KAA A;  3CCM 3;  2LQV A;  5D83 A;  4AKY A;  4HVN A;  4J9A A;  2RNT A;  5AI1 A;  3OX9 A;  3FG1 A;  2CX1 A;  3WOF B;  3CNM A;  1RMS A;  1Q40 B;  1RGC A;  2D42 A;  2UGI A;  2V1L A;  4LEH A;  1BOX A;  1A67 A;  1IT7 A;  1OF5 B;  5AEU B;  2RCD A;  2CH9 A;  2GU1 A;  3KSE D;  3LYG A;  5AIF A;  1YVS A;  3GZX B;  3MYT A;  4GHO A;  4HAA A;  1WTH A;  3JUP A;  1VQQ A;  1A90 A;  1W01 A;  5G2G A;  4LSO A;  1I0V A;  2RSX A;  1W6G A;  1TU5 A;  4R80 A;  2H0H A;  3BND A;  3N54 B;  3NUV A;  2ZA4 A;  3K9M C;  1A2P A;  4R1K A;  2STD A;  1RSN A;  3D5G A;  2SBL A;  1WMP A;  3GRD A;  3PCR A;  1FUT A;  2IYJ A;  1RN7 A;  1JZO A;  2BHM A;  1UI7 A;  3G0K A;  3CC4 3;  1FW7 A;  1D6U A;  4MEI A;  1VZZ A;  3RNT A;  4MMZ B;  1YIJ 3;  3OWU A;  2AAE A;  2CK3 H;  3V98 A;  2ZHX B;  1JBT A;  1RN1 A;  3BNB A;  4HM2 B;  5JPU A;  2ZDJ A;  1STF I;  3HX8 A;  3FG3 A;  1IQY A;  3S5C A;  5IEN A;  1VQN 3;  1EA2 A;  1N5P A;  3FCS B;  1LOX A;  1QAF A;  4FCZ A; 
#chains in the Genus database with same CATH homology
 1OH0 A;  4KFF A;  3VGN A;  1DMN A;  2OTL 3;  1GD3 A;  2O3O A;  4HZB B;  1FGR A;  1W7C A;  4O2H A;  2P0X A;  1IVU A;  2ML5 A;  1BUQ A;  2XFT A;  1O7M B;  2GBW B;  1SIH A;  1JKG B;  1YGE A;  5IER A;  3CCE 3;  3H3H A;  3TDG A;  3LTD A;  1VQ7 3;  1UUV B;  1Y4K A;  3JUO A;  1ULJ B;  2INX A;  1ISK A;  1C7H A;  1D6Z A;  1U8C B;  3LTC A;  3RDE A;  2CC3 A;  3LML A;  1IV7 A;  2CWU A;  3JUQ A;  3UNL A;  1DVD A;  2CW9 A;  5JPP A;  4H61 A;  1HU9 A;  1TIJ A;  2HMK B;  4N6U A;  2P09 A;  1O7N B;  4FMC A;  3I0Y A;  3WA3 A;  1DVC A;  4WFO A;  3SLU A;  4L8P A;  2KCD A;  3PGB A;  4FCM A;  2W6J H;  2Z6B A;  5CF2 A;  4HJL B;  7STD A;  2E2T A;  1TFK A;  3CXC 2;  3MG3 A;  2XH9 A;  3X40 A;  1Q40 A;  4XBT A;  4AEQ A;  1OF5 A;  1FUW A;  1Q82 4;  5BXQ A;  3F14 A;  1Z1S A;  5CXO A;  2BT3 A;  3NM2 A;  3LT8 A;  2Z76 A;  2MC8 A;  2QA4 3;  3AMO B;  1ULI B;  1PU4 A;  2FGT A;  1OGX A;  3PXM A;  1HKX A;  2CWT A;  1D6Y A;  2XR8 B;  3VSY A;  2JDI H;  3WA2 X;  1Q86 4;  4WWU C;  2K54 A;  5AEW B;  1WMN A;  1WNH A;  2CFW A;  4EYC A;  1YI2 3;  1Q42 A;  4GB5 A;  3FG4 A;  2HMO B;  2YFJ B;  5IEO A;  1JRQ A;  3H51 A;  2Y74 A;  3EN8 A;  2BMR B;  2YFI B;  1JNQ A;  3ROB A;  3CCL 3;  3F40 A;  1W00 A;  1OPY A;  3D3L A;  1GY5 A;  4R4K A;  4AKZ A;  3NQY A;  3NBJ A;  1UI8 A;  2B1X B;  5IG0 A;  1ZX2 A;  4KZ1 A;  1LVN A;  2HML B;  4N6L A;  1U5O A;  3QRD A;  2XRX B;  3F8H A;  1OGZ A;  2BNG A;  1W02 A;  1T5Y A;  3NXJ A;  4IIA A;  3CNX A;  3CCU 3;  3CC2 3;  2A15 A;  4HM0 B;  4JRF A;  1JB2 A;  5CLK A;  1KD1 4;  1RJO A;  5CK6 A;  3MPH A;  1ASK A;  1VQ4 3;  1QMA A;  3B4P A;  3A76 A;  1JKG A;  2WOH A;  1CYU A;  2Y73 A;  5A0O B;  3DGM A;  3SVA A;  1GD4 A;  2IMJ A;  1ROA A;  3DGN A;  4MMX B;  3KKG A;  3IJE B;  1IQ8 A;  5TGN A;  4O3V A;  4MMY B;  4BTW A;  1FGQ A;  5EVH A;  2E2U A;  2CG0 A;  3V99 A;  2BMO B;  4OVM A;  4FR9 A;  4EV5 A;  1JN5 B;  3MHE A;  2F99 A;  2E2V A;  3X41 A;  4KFD A;  1UUW B;  5EEO A;  3EE1 A;  3EQQ B;  5IG3 A;  3UL5 A;  4K1V A;  3G8Z A;  1F8N A;  3FF0 A;  3OWS A;  3E99 A;  2OQE A;  1LXE A;  5KP4 A;  3CME 3;  3LTB A;  3MKI A;  3EBT A;  4HZ9 B;  1CYV A;  3FZW A;  2BO9 B;  3JUN A;  5LC6 A;  1K41 A;  1A2V A;  1GY7 A;  4STD A;  1IVV A;  2ZL8 A;  3CU3 A;  2YFL B;  5JBS A;  1E3V A;  3AMO A;  5KP1 A;  1N9J A;  1SII A;  4NHF A;  4EBG A;  4LZI A;  4KVH A;  3OWY A;  2CHC A;  3B4O A;  3NV0 A;  1W4N A;  3SXX A;  1YHQ 3;  3NQZ A;  4OUQ A;  5EQL A;  4XDW A;  1KC8 4;  1RKY A;  1KQS 2;  1VQL 3;  4HM5 B;  3B8L A;  5I97 A;  1L5G B;  2LYX A;  3BB9 A;  1VQ6 3;  3CCQ 3;  4RBN A;  1S5A A;  3UB1 A;  1V74 A;  5ELJ A;  3N9H A;  2W04 A;  1OUN A;  2RFR A;  2GEX A;  2K0M A;  5STD A;  2MF7 A;  3D9R A;  4N6N B;  1QAK A;  1O7G B;  4CDL A;  4N6M A;  1JB4 A;  4O8S A;  2PNC A;  2I9W A;  2XSH B;  1EQK A;  4K90 B;  1KWI A;  1NU3 A;  3PZW A;  3K63 A;  4LMI A;  1GS3 A;  3G16 A;  5CF1 A;  3CPW 2;  1IV9 A;  1M1K 4;  2IUJ A;  4FMA A;  3CCJ 3;  1NB3 I;  2M7O A;  1O7H B;  4HM7 B;  3O8Y A;  1FGM A;  5IG4 A;  4X2H A;  1M9G A;  3NM7 A;  2P38 A;  2IUK A;  1O7P B;  2QGU A;  2WOF A;  2OQE C;  1WMO A;  2XF3 A;  3I56 3;  1MOL A;  2Q07 A;  1JN5 A;  3EJV A;  3S27 A;  1OAC A;  1FA3 A;  2Z7A A;  3NX0 A;  1YJ9 3;  2W56 B;  1AVL A;  1QVF 2;  3UL6 A;  5AYS C;  1OHS A;  2ML6 A;  4H3U A;  1CEW I;  1TP6 A;  3CCV 3;  2C11 A;  3CMA 3;  4PEJ A;  2F98 A;  1QVG 2;  2C10 A;  3N8B A;  3KZT A;  4IPB A;  2OCT A;  4I4K A;  3STD A;  1VQO 3;  2CWV A;  2BMQ B;  1DYU A;  1W2B 2;  1K73 4;  2XSO B;  3K5T A;  5KP3 A;  4FCJ A;  1YJN 3;  1AR0 A;  3BNE A;  4RNZ A;  2R4I A;  1NDO B;  2GU3 A;  2B24 B;  3U1W A;  4BTX A;  3DGL A;  3LOY A;  3WOD G;  3LH4 A;  2CFK A;  1S72 3;  1QJG A;  4WHA A;  3MG2 A;  3T0U A;  3CC7 3;  2RGQ A;  3Q1C A;  3B7C A;  3CCR 3;  1N8R 4;  3VF1 A;  4QWT A;  3T8U A;  1US1 A;  4FMB A;  4TX4 A;  1E97 A;  1CQS A;  1RRL A;  1GYB A;  2WO0 A;  3F7X A;  3HII A;  4X2O A;  5FGO A;  3JUM A;  5LC7 A;  3V92 A;  3ER7 A;  1DMQ A;  3CCS 3;  1J2B A;  1JB5 A;  3OW2 2;  2CFG A;  3WOE B;  2W0Q A;  3KSP A;  4U13 A;  4HM6 B;  4XBX A;  3HK4 A;  3GZB A;  5DRE A;  3DUK A;  4L8O A;  1ZO2 A;  1OHO A;  3G6E 3;  4K1U A;  4CCV A;  3DXO A;  1SPU A;  2FXT A;  3FLJ A;  3DY5 A;  4IT7 A;  3LT9 A;  2JQ5 A;  2CIU A;  4Q53 A;  1IT8 A;  2GEY A;  2QEX 3;  4XM4 A;  1GY6 A;  5IF6 A;  3WMD A;  1JJ2 2;  1E3R A;  2F86 B;  1YVB I;  3J7Y d;  3U97 A;  1N9E A;  1STD A;  4N3V A;  3X3Y A;  4N6T A;  2XEP A;  3X42 A;  3S29 A;  1NWW A;  2WGQ A;  1VQP 3;  3FSD A;  1W6C A;  3F9S A;  2WGO A;  2O9U X;  2W9Q A;  3SED A;  2GBX B;  4RNY A;  2XFS A;  1NO3 A;  2OWP A;  1WQL B;  1PFP A;  2W56 A;  2CG1 A;  1RRH A;  3K0Z A;  4J8T A;  5AIH A;  2KXG A;  2PZV A;  3LTA A;  8CHO A;  1IK3 A;  3RGA A;  3EBY A;  3SX1 A;  1JV2 B;  3ECF A;  3SOY A;  4XB5 A;  1A2K A;  3BNC A;  3MWZ A;  3OXA A;  3X3Z A;  3RGR A;  3S28 A;  4WP5 A;  3EX9 A;  2L4V A;  5IEP A;  2OOV A;  3EF8 A;  3BLZ A;  3PCS A;  1FGO A;  2HMJ B;  4R9K A;  4N6O B;  1Q7Y 4;  1M90 4;  2W2C A;  2P05 A;  2HMM B;  3F8X A;  3MG1 A;  3SOA A;  3IPT A;  2CFL A;  3HI7 A;  4NRE A;  2D1W A;  1W2Z A;  3FKA A;  1N5H A;  1N8Q A;  1EKM A;  5HGR A;  2XGN A;  6STD A;  4KFE A;  2CKF B;  2W03 A;  4MJD A;  1VQ9 3;  1NJI 4;  3KFQ C;  3HIG A;  4XDV A;  3EB8 A;  1KSI A;  1OCV A;  5D81 A;  4HM4 B;  3GZY B;  3DZL A;  1ROV A;  2FNQ A;  2XGL A;  3LZA A;  3OV4 A;  1IDP A;  1NB5 I;  3UJM A;  5IG5 A;  4R9L A;  1TFO A;  3WDG B;  3LXU X;  2OTJ 3;  5AYR B;  4HYZ A;  4GL6 A;  3X3X A;  3K7C A;  4G1M B;  1OHP A;  2Z77 A;  1VQ5 3;  3Q90 A;  1VQK 3;  1FGT A;  3F7S A;  4K61 A;  3MSO A;  3NHX A;  2P0M A;  1AVK A;  3T8N A;  1W6Y A;  3CD6 3;  2KRT A;  2YX9 A;  1K28 A;  1DMM A;  1QAL A;  3DMC A;  3PYJ A;  4EXR A;  1VQM 3;  3IMA B;  3JVC A;  3PS8 A;  2QIY A;  1AV4 A;  1M1X B;  4L7K A;  4RZM A;  1LNH A;  4EV2 A;  3G71 3;  3ALA A;  1IQX A;  4HKV B;  3EC9 A;  5AIG A;  3EHC A;  4HM1 B;  3QK9 A;  2HMN B;  3KII A;  2OOV C;  3CPO A;  4N6V 0;  1SQW A;  4WYK B;  5DRV A;  3NV0 B;  4LGQ A;  4ORL A;  3FGY A;  4O02 B;  1IU7 A;  2IA7 A;  4JF8 A;  1W5Z A;  1VQ8 3;  3KE7 A;  5IW9 A;  3M8C A;  1IVX A;  2UX0 A;  4WYK A;  1MNL A;  3KN4 A;  5D82 A;  1R4C A;  4HM8 B;  3GZR A;  4HBR A;  5BVB A;  1G96 A;  3NBB A;  3L0R A;  1YJW 3;  3FF2 A;  3FH1 A;  2GXF A;  3NBR A;  4HM3 B;  1K9M 4;  3Q2P A;  4BTY A;  5FW5 A;  2W9P A;  1YIT 3;  1Q81 4;  1SJW A;  3GWR A;  3HZP A;  3GAX A;  4EC6 A;  1EG9 B;  5AII A;  1IVW A;  4ZM8 A;  1UW1 A;  1K8A 4;  3S67 A;  4OK0 A;  1TUH A;  4XBY A;  3I55 3;  2CFD A;  3DM8 A;  3EN1 B;  5ELU A;  4FMD A;  3G4S 3;  1O7W B;  3DGO A;  3CCM 3;  2LQV A;  5D83 A;  4AKY A;  4HVN A;  4J9A A;  5AI1 A;  3OX9 A;  3FG1 A;  3WOF B;  3CNM A;  1Q40 B;  2D42 A;  2V1L A;  4LEH A;  1A67 A;  1IT7 A;  1OF5 B;  5AEU B;  2RCD A;  2CH9 A;  2GU1 A;  3KSE D;  3LYG A;  5AIF A;  3GZX B;  3MYT A;  1WTH A;  3JUP A;  1A90 A;  1W01 A;  5G2G A;  4LSO A;  2RSX A;  1W6G A;  1TU5 A;  4R80 A;  3BND A;  3N54 B;  3NUV A;  3K9M C;  4R1K A;  2STD A;  2SBL A;  1WMP A;  3GRD A;  3PCR A;  1RN7 A;  2BHM A;  1UI7 A;  3G0K A;  3CC4 3;  1D6U A;  4MEI A;  1VZZ A;  4MMZ B;  1YIJ 3;  3OWU A;  3V98 A;  2CK3 H;  4HM2 B;  3BNB A;  5JPU A;  2ZDJ A;  1STF I;  3HX8 A;  3FG3 A;  1IQY A;  3S5C A;  5IEN A;  1VQN 3;  1EA2 A;  1N5P A;  3FCS B;  1LOX A;  1QAF A;  4FCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...