3BLZA

Crystal structure of a ntf2-like protein of unknown function (sbal_0622) from shewanella baltica os155 at 1.75 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
124
structure length
124
Chain Sequence
NTTYVQEYHAIVEVLSKYNEGGKKADSTIMRPAFSSQATIFGVDVDNKLTGGPIQGLFDVIDNVFHPSPEAKAAIARIDIVGTAASARIDTDDISGFRFTDFFNLLKVEGKWTVVSKIYHTHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NTF2-like protein of unknown function
publication title Crystal structure of a NTF2-like protein of unknown function (YP_001049020.1) from Shewanella baltica OS155 at 1.75 A resolution
rcsb
source organism Shewanella baltica
molecule tags Unknown function
total genus 32
structure length 124
sequence length 124
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12893 Lumazine_bd_2 Putative lumazine-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3blzA00
1E97A 4XB5A 1W02A 5IG4A 1O7NB 4J8TA 3E99A 3DUKA 1K41A 4K1VA 3OX9A 3LZAA 1ISKA 1GY6A 2F86B 1W6YA 3T8UA 3HK4A 3OWUA 4K1UA 2F99A 3UJMA 5IEOA 4HM7B 3RGRA 3CPOA 3BLZA 3EF8A 1EG9B 4GB5A 2RFRA 1O7HB 3B4OA 1VZZA 3H51A 1ASKA 1CQSA 3FKAA 3OWYA 1JB4A 3D9RA 3NM2A 1BUQA 3KKGA 3Q90A 2A15A 4R1KA 5AIGA 3BB9A 2BMOB 1SJWA 5TGNA 4LGQA 1OGZA 4HM3B 3OWSA 2HMJB 6STDA 2CHCA 2B1XB 4IIAA 5D83A 1O7GB 1HKXA 1OUNA 2GEXA 4LMIA 3JUOA 4N3VA 5AEUB 1GYBA 5BVBA 2HMOB 1JN5A 1STDA 3NXJA 4HM6B 4RZMA 5IERA 5AIFA 1NDOB 1OH0A 5CXOA 5BXQA 1NU3A 3B4PA 3KZTA 3EN8A 4FCMA 5HGRA 3DM8A 2UX0A 3NBRA 2HMLB 4L8PA 3B7CA 5CF2A 1GY7A 2I9WA 2HMMB 2XR8B 3FH1A 5STDA 2RCDA 5G2GA 3MG2A 3GZXB 1JN5B 3EBTA 2OWPA 3F7XA 3HZPA 3OV4A 1WQLB 2GXFA 3SEDA 4XM4A 4Q53A 4HJLB 2GBXB 5D82A 4HM1B 2XRXB 4WYKA 5IF6A 1OCVA 3T8NA 3ECFA 3F14A 3JUMA 5AIHA 2YFIB 3VSYA 1W00A 3RGAA 4HM0B 5AI1A 3EJVA 5D81A 5IG0A 4J9AA 4HVNA 3GWRA 3EX9A 3STDA 3K7CA 2BMRB 1E3VA 2JQ5A 1AR0A 5KP3A 4ORLA 4XBTA 3EHCA 1U5OA 3FGYA 4WYKB 1QJGA 3GZRA 5IG5A 2QIYA 3FZWA 4HZ9B 1QMAA 5FW5A 4KVHA 4WWUC 3WMDA 1ZX2A 4XDVA 3S5CA 2Z77A 1O7PB 1O7WB 3FLJA 5IEPA 2GEYA 4XBXA 3SOYA 2YFLB 4X2HA 4XBYA 3CU3A 1GS3A 4L8OA 3F7SA 5CLKA 3M8CA 3SOAA 1OF5B 2BNGA 5KP1A 4XDWA 2STDA 5IENA 1TP6A 1C7HA 2QGUA 2B24B 1JKGB 1OHOA 3A76A 1S5AA 1GY5A 2XSOB 3EBYA 4U13A 3CNXA 3F8XA 3EN1B 4FCJA 3GRDA 5AEWB 5AIIA 1Q40A 3FF0A 3I0YA 4MJDA 3FF2A 3EQQB 3B8LA 4HZBB 4HM4B 5CF1A 3UNLA 1DMQA 3GZBA 1OPYA 4WP5A 3F9SA 1Q42A 2R4IA 3G8ZA 3FSDA 4CDLA 3HX8A 5JPUA 4HM8B 1DMMA 4L7KA 2XSHB 1Q40B 1OHSA 1UUWB 1E3RA 3DMCA 3JUQA 1JB5A 3G0KA 3NUVA 3NV0B 1OF5A 1Z1SA 1ZO2A 7STDA 4HM5B 2Z76A 3DZLA 3EC9A 3MHEA 1JKGA 1O7MB 4I4KA 5EVHA 1TUHA 2CKFB 3H3HA 3KSPA 2W2CA 1ULIB 3KE7A 3DXOA 3G16A 3MSOA 4R9KA 1W01A 3NHXA 3K0ZA 2GBWB 4PEJA 1NWWA 5KP4A 5DRVA 2INXA 4HM2B 1OGXA 1EA2A 2K54A 1DMNA 2RGQA 1OHPA 3JUNA 3JUPA 4HKVB 2BMQB 2YFJB 4H3UA 3MG1A 3LYGA 3IPTA 2Z7AA 3ER7A 8CHOA 4OVMA 3F8HA 3MKIA 1A2KA 3OXAA 1ULJB 2IMJA 4OUQA 2HMKB 2F98A 4X2OA 4R9LA 2PZVA 3ROBA 3VGNA 1UUVB 5CK6A 3GZYB 4LEHA 1IDPA 3F40A 5DREA 3MG3A 3CNMA 3NV0A 4STDA 5JPPA 5IG3A 1JB2A 2HMNB 3MYTA
chains in the Genus database with same CATH superfamily
1YIJ3 1RN1A 1AQZA 2XFSA 1E97A 1RDSA 1JV2B 3LOYA 4XB5A 1MWUA 1W02A 1ZS7A 1LQGC 3LXUX 2OQEA 2UUGC 2P0XA 5IG4A 1O7NB 4J8TA 1Q7HA 3E99A 3DUKA 1K41A 4K1VA 4KZ1A 3OX9A 3LZAA 1ISKA 1GY6A 2F86B 4RNYA 1W6YA 2OTL3 1GOYA 3LTCA 4HAAA 3T8UA 1B27A 2L4VA 3HK4A 3OWUA 1W2B2 1BVIA 2R41A 2F99A 4K1UA 3UJMA 1RRHA 5IEOA 6GSPA 4J5GA 1FGTA 2Y74A 4HM7B 3RGRA 3CPOA 7RNTA 4N6NB 1BOXA 2W56B 3BLZA 1UCIA 1RMSA 3EF8A 1RLSA 1EG9B 1FUSA 3PYJA 5D83A 4G1MB 2RFRA 4GB5A 3DGOA 3PGBA 1O7HB 4BIRA 2P09A 1RJOA 3B4OA 4MEIA 1N8R4 1VZZA 3RDEA 2Q07A 1HU9A 1RNBA 3DY5A 3CCR3 1B2ZA 3H51A 2M7OA 4O8SA 1LVNA 3PXMA 1ASKA 1IV9A 1RNTA 1CQSA 3FKAA 3HIGA 1JBRA 3FCSB 3OWYA 1JB4A 3D9RA 2E2UA 3NM2A 1BUQA 2OOVA 3KKGA 3S67A 3Q90A 2A15A 1LOYA 4R1KA 1SIHA 2JDIH 2W6JH 2RBIA 3PZWA 3WR2A 1NJI4 1SARA 1B2XA 5HOHA 1X1YA 5AIGA 2CH9A 3BB9A 1T5YA 2BMOB 2BO9B 1SJWA 3CCQ3 1JZOA 2LQVA 5TGNA 1T3BA 4CPKA 4LGQA 1OGZA 3ALAA 4HM3B 2ML5A 3OWSA 3WA2X 1TFKA 4EV2A 2HMJB 4R4KA 2PNCA 1JRQA 1B20A 1GD4A 4BTWA 1QALA 2QA43 3LH4A 6STDA 3BNBA 2CHCA 3N8BA 1LNHA 2B1XB 2ZL8A 3MWZA 1SIIA 1O7GB 1HKXA 1OUNA 2AAEA 3NBJA 4IIAA 1N9EA 2GEXA 4LMIA 1BSDA 4NPBA 3JUOA 5I97A 4N3VA 3AGOA 5AEUB 5G1LA 3S28A 1TU5A 1VQM3 1BRGA 3NQYA 1B2MA 3BU4A 1GYBA 1V74A 1EUIC 1LXEA 1UI7A 4N6V0 4FMBA 3URPA 3AMOA 1RGFA 5M18A 2W9PA 5BVBA 1M1XB 1BNFA 1TFOA 2HMOB 3CD63 1JN5A 1TRQA 2OQEC 1RGGA 1BRKA 3CCV3 5BU4A 1STDA 3NXJA 1IT7A 4N6TA 1BNJA 4HM6B 4RZMA 1K734 1FGQA 5IERA 3SLUA 1I0VA 1I2FA 1NDOB 1Q9EA 5AIFA 1IVXA 1ROAA 1FUTA 1QAFA 1X1WA 5ELUA 1A90A 1YGWA 1OH0A 2OTJ3 1GMPA 5CXOA 3NX0A 1IV7A 1QVF2 2W04A 5BXQA 1NU3A 1A2PA 4FR9A 3B4PA 1LRAA 3X41A 3KZTA 1UCLA 9RNTA 1DVDA 3EN8A 2F56A 4HOHA 1BSBA 1FGMA 3IMAB 1Y4KA 4FCMA 3SYUA 2C11A 2CC3A 6RNTA 3AHWA 3PCSA 3ZG0A 5HGRA 2W56A 3DM8A 2UX0A 3BNCA 3NBRA 2HMLB 4L8PA 3B7CA 3JVCA 2IUJA 2QEX3 5CF2A 3GAXA 3K9MC 1WMNA 3KCHA 1GY7A 2I9WA 1WMOA 3LTBA 3GSPA 1BU4A 4FMCA 1VQO3 3EE1A 1NB3I 2IUKA 2HMMB 1GMQA 1VQ63 2XR8B 2OOVC 2SBLA 3FH1A 5STDA 3CXC2 3D3LA 2RCDA 5G2GA 3CCM3 2V1LA 1W5ZA 3MG2A 1STFI 7GSPA 3GZXB 1TRPA 2CIUA 1RKYA 4KFDA 1JN5B 2ZA4A 2OWPA 3EBTA 3F7XA 3HZPA 3OV4A 4QWTA 1WQLB 4OK0A 2GXFA 3SEDA 1LOWA 1G0TA 4N6LA 1JZDA 1KWIA 4XM4A 1YIT3 1RCKA 4Q53A 4HJLB 1W6CA 2GBXB 5D82A 1YVBI 4HM1B 4BTYA 1AVKA 2XRXB 3X40A 1D6UA 5ELJA 1C54A 1YGEA 4WYKA 1UUGB 5IF6A 1OCVA 1B21A 1N9JA 1JJ22 3T8NA 3ECFA 3MPHA 4GL6A 5RNTA 3BNEA 3F14A 3JUMA 2WGQA 2KCDA 3N9HA 4RNTA 1AV4A 2CG1A 5M19A 3PS8A 3G6E3 1FA3A 1FUWA 5AIHA 3O8YA 2YFIB 3DH2A 3VSYA 3CMA3 1BNEA 2IA7A 1PU4A 1W00A 3RGAA 1JBTA 1J2BA 4HM0B 1BNRA 5AI1A 5M1AA 3S27A 1UI8A 1CYUA 2W0QA 3EJVA 3KN4A 5D81A 5IG0A 1MNLA 4J9AA 4HVNA 1QVG2 1FW7A 2ZHXB 3GWRA 4EXRA 3EX9A 3KSED 4R80A 3STDA 2XGNA 3DGMA 3D4AA 3K7CA 1BRNL 2FNQA 3AHSA 1RGCA 1IU7A 3QK9A 2BMRB 3NQZA 3BNDA 1E3VA 2E2TA 4I5QA 2JQ5A 1I3FA 3WOEB 1AR0A 1TIJA 2CX1A 5KP3A 4ORLA 2HOHA 2O3OA 4RBNA 2KAAA 4XBTA 2BHMA 1HZ1A 2KF4A 2OCTA 1VQ53 2CX0A 3EHCA 1VQ43 3LT9A 1U5OA 1WNHA 1BNIA 3FGYA 5AYRB 3CC23 3D5GA 4EV5A 1AY7A 1TTOA 1FZUA 4AKYA 4WYKB 5LC7A 1LOVA 3WDGB 2CFWA 1QJGA 1KSIA 3GZRA 3SXXA 2F4YA 5IG5A 2J8XB 1LNIA 2QIYA 3FZWA 5G1KA 1RN4A 1GSPA 4H61A 5EEOA 4CJNA 1M1K4 1W7CA 2SARA 3DGYA 1UDII 1I8VA 4LSOA 1QMAA 4HZ9B 5A0OB 5FW5A 1GD3A 1NO3A 3X3ZA 4KVHA 1VQK3 1B2SA 3RNTA 1DVCA 4WWUC 3WMDA 4ZM8A 1GOUA 1DETA 1ZX2A 4XDVA 1KC84 1BRSA 2KF3A 1MWRA 4HBRA 3S5CA 2Z77A 4O2HA 1O7PB 1O7WB 3FLJA 5IEPA 2GEYA 3KIIA 4XBXA 4MMXB 1Q824 3SOYA 2YFLB 1N5PA 1V57A 1BRIA 1RN7A 1B2UA 4K90B 1RGEA 4X2HA 4XBYA 1I0XA 1EEJA 1OACA 1UGIA 3CU3A 3G4S3 1GS3A 1YHQ3 2MC8A 3J7Yd 4L8OA 3LMLA 3F7SA 1YJN3 2GU1A 5CLKA 3PCRA 2KF6A 3M8CA 1M9GA 1OF5B 2XH9A 3Q2PA 4LYLB 3SOAA 2BNGA 2KF5A 1BNSA 1EKMA 4XDWA 5KP1A 2STDA 5IENA 2AADA 2BU4A 1TP6A 2L1SA 1C7HA 1VQ93 1CYVA 3FG1A 4N6UA 1BSCA 1BSEA 1G96A 1X1UA 1MGRA 2QGUA 2B24B 1T2HA 4N6MA 1YNVX 3WODG 3I553 3X42A 1JKGB 1OHOA 1BNGA 2ZDJA 3A76A 4GSPA 3CCU3 1S5AA 2XFTA 1GY5A 4MMYB 2XSOB 1YI23 1MWSA 3LTDA 2LYXA 4IT7A 3EBYA 4U13A 3CCE3 3CNXA 2W9QA 1TJDA 1IVWA 3K5TA 3F8XA 1RSNA 2FGTA 3EN1B 1UW1A 4FCJA 3G713 4FCZA 2CFKA 3UL5A 4BU4A 3GRDA 2H0GA 5AEWB 2D1WA 1Q40A 5AIIA 3FF0A 1QAKA 3I0YA 1IQ8A 4KFEA 3HI7A 2E2VA 3CCS3 1MOLA 1YJ93 2BIRA 4MJDA 3A5EA 1SPUA 4IPBA 3FF2A 2ML6A 5IW9A 1FGOA 1IYYA 1K28A 3EQQB 3B8LA 3LTAA 2CK3H 1M904 4HZBB 4TX4A 3X3XA 2CFLA 3CCJ3 4BTXA 1IQXA 4HM4B 2GSPA 1UGHI 1G02A 3UNLA 5CF1A 4J5KA 1ROVA 1RGAA 4AEQA 1DMQA 3DGLA 3S29A 3GZBA 5LC6A 1OPYA 3SX1A 2K0MA 3D79A 3K63A 4WP5A 5AYSC 1CH0A 1RCLA 2P38A 1JBSA 1LQMB 1BGSA 1IK3A 3SVAA 3F9SA 1Q42A 1BUJA 2FXTA 2CWVA 2R4IA 3Q3FA 1NB5I 3G8ZA 3FSDA 4CDLA 1R4CA 4FMDA 2WOFA 2K3DA 1D6YA 3HX8A 3HIIA 2F5MA 5JPUA 1FGRA 1W4NA 2C10A 4HM8B 1DMMA 1X1XA 2KRTA 1WMPA 1I2EA 2H0HA 3UB1A 1RHLA 2RSXA 4NREA 3CCL3 3CPW2 4L7KA 2XSHB 1F8NA 1LOXA 1BIRA 1Q40B 1BRHA 2CG0A 2CWUA 1Q7Y4 3U1WA 1OHSA 3U97A 1UUWB 1W2ZA 2XEPA 2Z6BA 1E3RA 1B3SA 3DMCA 3JUQA 5FGOA 1JB5A 2BT3A 2MF7A 1VQQA 3G0KA 3NUVA 3NV0B 1OF5A 1GOVA 3VF1A 1Z1SA 3FG4A 3Q1CA 4EC6A 1ZO2A 4KT3B 2CFDA 4NHFA 4LZIA 3FG3A 4KFFA 4WHAA 4K61A 7STDA 2F5WA 4HM5B 5EQLA 3OW22 2Z76A 3AGNA 3DZLA 2P05A 1CEWI 3EC9A 1N8QA 2P0MA 2KXGA 3MHEA 4O3VA 1Q814 1JKGA 1O7MB 1BANA 4DKIA 3WOFB 3T0UA 4EW5A 1DE3A 4I4KA 1RRLA 1PFPA 5EVHA 1VQL3 1KD14 1TUHA 4GHOA 1W6GA 1VQN3 3CC73 3CC43 2CKFB 2RNTA 3H3HA 2GU3A 1UCKA 1K9M4 3KSPA 2W2CA 1ULIB 1EQKA 2CWTA 3KE7A 1YVSA 2O9UX 3DXOA 4JRFA 1I3IA 3L0RA 4BL3A 1I2GA 3G16A 3MSOA 4R9KA 3V99A 1W01A 3HOHA 3NHXA 3N54B 3I563 1PYLA 4CCVA 3UL6A 3K0ZA 3ZG5A 2GBWB 4ILFA 1ZGXA 5JBSA 3V98A 4PEJA 1NWWA 2CW9A 4AKZA 5BIRA 5KP4A 5DRVA 1L5GB 3QRDA 1DYUA 1S723 2INXA 4HM2B 1Q864 2XGLA 1K8A4 1OGXA 1EA2A 2K54A 1VQP3 1DMNA 2RGQA 4N6OB 1OHPA 3JUNA 1GMRA 1N5HA 2BMQB 2YFJB 3JUPA 4FMAA 4H3UA 4HKVB 3WA3A 3CME3 1R4YA 3NM7A 2CFGA 2XF3A 4JF8A 4EYCA 4MMZB 3MG1A 8RNTA 1VQ83 1RGLA 3LYGA 3IPTA 3V92A 1JNQA 1T2IA 4HYZA 2Z7AA 2WGOA 3ER7A 4OVMA 8CHOA 1IVUA 3ZFZA 3F8HA 3MKIA 1A2KA 2C4BA 3X3YA 2WO0A 1WTHA 1MWTA 1A2VA 1RGKA 3OXAA 1A67A 1ULJB 1HYFA 1US1A 1BRJA 4RNZA 5GSPA 1FYSA 1NNVA 2IMJA 2YX9A 4OUQA 3DGNA 2UGIA 2HMKB 2F98A 4X2OA 2H0IA 1UCJA 2Y73A 1PY3A 2PZVA 2W03A 4R9LA 2D42A 1MGWA 1IQYA 1BAOA 1D6ZA 3ROBA 3VGNA 4EBGA 1UUVB 1YJW3 4O02B 5CK6A 3WHOA 2IY2A 3KFQC 1AVLA 3GZYB 3LT8A 1IDPA 3F40A 4LEHA 5DREA 2WOHA 3CNMA 3MG3A 3D5IA 1KQS2 3NV0A 1IT8A 4BL2A 3TDGA 4STDA 1IVVA 5JPPA 1RGHA 3IJEB 1U8CB 1V58A 3NBBA 1RTUA 1I70A 3EB8A 1VQ73 3BIRA 5IG3A 1BSAA 1JB2A 2HMNB 2IYJA 3AMOB 3MYTA 1SQWA 4WFOA
chains in the Genus database with same CATH topology
1YIJ3 2XFSA 1E97A 4XB5A 1JV2B 3LOYA 1W02A 3LXUX 2OQEA 2P0XA 5IG4A 1O7NB 4J8TA 3E99A 3DUKA 1K41A 4K1VA 4KZ1A 3OX9A 3LZAA 1ISKA 1GY6A 2F86B 4RNYA 1W6YA 2OTL3 3T8UA 3LTCA 3HK4A 2L4VA 3OWUA 1W2B2 4K1UA 2F99A 3UJMA 1RRHA 5IEOA 1FGTA 2Y74A 4HM7B 3RGRA 3CPOA 4N6NB 2W56B 3BLZA 3EF8A 1EG9B 3PYJA 4G1MB 2RFRA 4GB5A 3DGOA 3PGBA 1O7HB 2P09A 1RJOA 3B4OA 4MEIA 1N8R4 1VZZA 3RDEA 2Q07A 1HU9A 3DY5A 3CCR3 3H51A 2M7OA 4O8SA 1LVNA 3PXMA 1ASKA 1IV9A 1CQSA 3FKAA 3HIGA 3FCSB 3OWYA 1JB4A 3D9RA 2E2UA 3NM2A 1BUQA 2OOVA 3KKGA 3S67A 3Q90A 2A15A 4R1KA 1SIHA 2JDIH 2W6JH 3PZWA 1NJI4 5AIGA 2CH9A 3BB9A 1T5YA 2BMOB 2BO9B 1SJWA 3CCQ3 2LQVA 5TGNA 4LGQA 1OGZA 3ALAA 4HM3B 2ML5A 3OWSA 3WA2X 1TFKA 4EV2A 2HMJB 4R4KA 2PNCA 1JRQA 1GD4A 4BTWA 1QALA 2QA43 3LH4A 6STDA 3BNBA 2CHCA 3N8BA 1LNHA 2B1XB 2ZL8A 3MWZA 1SIIA 1O7GB 1HKXA 1OUNA 3NBJA 4IIAA 5D83A 1N9EA 2GEXA 4LMIA 3JUOA 5I97A 4N3VA 5AEUB 3S28A 1TU5A 1VQM3 3NQYA 1GYBA 1V74A 1LXEA 1UI7A 4N6V0 4FMBA 3AMOA 2W9PA 5BVBA 1M1XB 1TFOA 2HMOB 3CD63 1JN5A 2OQEC 3CCV3 1STDA 3NXJA 1IT7A 4N6TA 4HM6B 4RZMA 1K734 1FGQA 5IERA 3SLUA 5AIFA 1NDOB 1IVXA 1ROAA 1QAFA 5ELUA 1A90A 1OH0A 2OTJ3 5CXOA 3NX0A 1IV7A 1QVF2 2W04A 5BXQA 1NU3A 4FR9A 3B4PA 3X41A 3KZTA 1DVDA 3EN8A 1FGMA 3IMAB 1Y4KA 4FCMA 2C11A 2CC3A 3PCSA 5HGRA 2W56A 3DM8A 2UX0A 3BNCA 3NBRA 2HMLB 4L8PA 3B7CA 3JVCA 2IUJA 2QEX3 5CF2A 3GAXA 3K9MC 1WMNA 1GY7A 2I9WA 1WMOA 3LTBA 4FMCA 1VQO3 3EE1A 1NB3I 2IUKA 2HMMB 1VQ63 2XR8B 2OOVC 2SBLA 3FH1A 5STDA 3CXC2 3D3LA 2RCDA 5G2GA 3CCM3 2V1LA 1W5ZA 3MG2A 1STFI 3GZXB 2CIUA 1RKYA 4KFDA 1JN5B 3EBTA 2OWPA 3F7XA 3HZPA 4QWTA 3OV4A 1WQLB 4OK0A 2GXFA 3SEDA 4N6LA 4XM4A 1KWIA 1YIT3 4Q53A 4HJLB 1W6CA 2GBXB 5D82A 1YVBI 4HM1B 4BTYA 1AVKA 2XRXB 3X40A 1D6UA 5ELJA 1YGEA 4WYKA 5IF6A 1OCVA 1N9JA 1JJ22 3T8NA 3ECFA 3MPHA 4GL6A 3BNEA 3F14A 3JUMA 2WGQA 2KCDA 3N9HA 2CG1A 1AV4A 1FA3A 3PS8A 3G6E3 1FUWA 5AIHA 3O8YA 2YFIB 3VSYA 3CMA3 2IA7A 1J2BA 1PU4A 1W00A 3RGAA 4HM0B 5AI1A 3S27A 1UI8A 1CYUA 2W0QA 3EJVA 3KN4A 5D81A 5IG0A 1MNLA 4J9AA 4HVNA 1QVG2 3GWRA 4EXRA 3EX9A 3KSED 4R80A 3STDA 2XGNA 3DGMA 3K7CA 2FNQA 1IU7A 3QK9A 2BMRB 3NQZA 3BNDA 1E3VA 2E2TA 2JQ5A 3WOEB 1AR0A 1TIJA 5KP3A 4ORLA 2O3OA 4RBNA 4XBTA 2BHMA 2OCTA 1VQ53 3EHCA 1VQ43 3LT9A 1U5OA 1WNHA 3CC23 3FGYA 5AYRB 4EV5A 4AKYA 4WYKB 5LC7A 3WDGB 2CFWA 1QJGA 1KSIA 3GZRA 3SXXA 5IG5A 2QIYA 3FZWA 4H61A 5EEOA 1M1K4 1W7CA 4LSOA 1QMAA 4HZ9B 5A0OB 5FW5A 1GD3A 1NO3A 3X3ZA 4KVHA 1VQK3 1DVCA 4WWUC 3WMDA 4ZM8A 1KC84 1ZX2A 4XDVA 3S5CA 4HBRA 2Z77A 4O2HA 1O7PB 1O7WB 3FLJA 5IEPA 2GEYA 3KIIA 4XBXA 4MMXB 1Q824 3SOYA 2YFLB 1N5PA 1RN7A 4K90B 4X2HA 4XBYA 1OACA 3CU3A 3G4S3 1GS3A 1YHQ3 2MC8A 3J7Yd 4L8OA 3LMLA 3F7SA 1YJN3 2GU1A 5CLKA 3PCRA 3M8CA 1M9GA 1OF5B 2XH9A 3Q2PA 3SOAA 2BNGA 1EKMA 4XDWA 5KP1A 2STDA 5IENA 1TP6A 1C7HA 1VQ93 1CYVA 3FG1A 4N6UA 1G96A 2QGUA 4N6MA 2B24B 3WODG 3I553 3X42A 1JKGB 1OHOA 2ZDJA 3A76A 3CCU3 1S5AA 2XFTA 1GY5A 4MMYB 2XSOB 1YI23 3LTDA 2LYXA 4IT7A 3EBYA 4U13A 3CCE3 3CNXA 2W9QA 1IVWA 3K5TA 3F8XA 2FGTA 3EN1B 1UW1A 4FCJA 3G713 4FCZA 2CFKA 3UL5A 3GRDA 5AEWB 2D1WA 1Q40A 5AIIA 3FF0A 1QAKA 3I0YA 1IQ8A 4KFEA 3HI7A 2E2VA 3CCS3 1MOLA 1YJ93 4MJDA 1SPUA 4IPBA 3FF2A 2ML6A 5IW9A 1FGOA 1K28A 3EQQB 3B8LA 3LTAA 2CK3H 1M904 4HZBB 4TX4A 3X3XA 2CFLA 3CCJ3 4BTXA 1IQXA 4HM4B 5CF1A 3UNLA 1ROVA 4AEQA 1DMQA 3DGLA 3S29A 3GZBA 5LC6A 1OPYA 3SX1A 2K0MA 3K63A 4WP5A 5AYSC 2P38A 1IK3A 3SVAA 3F9SA 1Q42A 2FXTA 2CWVA 2R4IA 1NB5I 3G8ZA 3FSDA 4CDLA 1R4CA 4FMDA 2WOFA 1D6YA 3HX8A 3HIIA 5JPUA 1FGRA 1W4NA 2C10A 4HM8B 1DMMA 2KRTA 1WMPA 3UB1A 2RSXA 4NREA 3CCL3 3CPW2 4L7KA 2XSHB 1F8NA 1LOXA 2CG0A 1Q40B 2CWUA 1Q7Y4 3U1WA 1OHSA 3U97A 1UUWB 1W2ZA 2XEPA 2Z6BA 1E3RA 3DMCA 3JUQA 5FGOA 1JB5A 2BT3A 2MF7A 3G0KA 3NUVA 3NV0B 1OF5A 4EC6A 3VF1A 1Z1SA 3FG4A 3Q1CA 1ZO2A 2CFDA 4NHFA 4LZIA 3FG3A 4KFFA 4WHAA 4K61A 7STDA 3OW22 4HM5B 5EQLA 2Z76A 3DZLA 2P05A 1CEWI 3EC9A 1N8QA 2P0MA 2KXGA 3MHEA 4O3VA 1Q814 1JKGA 1O7MB 3WOFB 3T0UA 4I4KA 1RRLA 1PFPA 5EVHA 1VQL3 1KD14 1TUHA 1W6GA 1VQN3 3CC73 3CC43 2CKFB 3H3HA 2GU3A 1K9M4 3KSPA 2W2CA 1ULIB 1EQKA 2CWTA 3KE7A 2O9UX 3DXOA 4JRFA 3L0RA 3G16A 3MSOA 4R9KA 3V99A 1W01A 3NHXA 3N54B 3I563 4CCVA 3UL6A 3K0ZA 2GBWB 5JBSA 3V98A 4PEJA 1NWWA 2CW9A 4AKZA 5KP4A 5DRVA 1L5GB 3QRDA 1DYUA 1S723 2INXA 4HM2B 1Q864 2XGLA 1K8A4 1OGXA 1EA2A 2K54A 1VQP3 1DMNA 2RGQA 4N6OB 1OHPA 3JUNA 1N5HA 3JUPA 2BMQB 2YFJB 4FMAA 4H3UA 4HKVB 3WA3A 3CME3 3NM7A 2CFGA 2XF3A 4JF8A 4EYCA 4MMZB 3MG1A 1VQ83 3LYGA 3IPTA 3V92A 1JNQA 4HYZA 2Z7AA 2WGOA 3ER7A 4OVMA 8CHOA 1IVUA 3F8HA 3MKIA 1A2KA 3X3YA 2WO0A 1WTHA 3OXAA 1A2VA 1A67A 1ULJB 1US1A 4RNZA 2IMJA 4OUQA 2YX9A 3DGNA 2HMKB 2F98A 4X2OA 2Y73A 4R9LA 2PZVA 2W03A 2D42A 1IQYA 3ROBA 1D6ZA 3VGNA 1YJW3 4EBGA 1UUVB 4O02B 5CK6A 3KFQC 1AVLA 3GZYB 3LT8A 1IDPA 3F40A 4LEHA 5DREA 2WOHA 3CNMA 3MG3A 1KQS2 3NV0A 1IT8A 3TDGA 4STDA 1IVVA 5JPPA 3IJEB 1U8CB 3NBBA 3EB8A 1VQ73 5IG3A 1JB2A 2HMNB 3AMOB 3MYTA 1SQWA 4WFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E97 A;  4XB5 A;  1W02 A;  5IG4 A;  1O7N B;  4J8T A;  3E99 A;  3DUK A;  1K41 A;  4K1V A;  3OX9 A;  3LZA A;  1ISK A;  1GY6 A;  2F86 B;  1W6Y A;  3T8U A;  3HK4 A;  3OWU A;  4K1U A;  2F99 A;  3UJM A;  5IEO A;  4HM7 B;  3RGR A;  3CPO A;  3BLZ A;  3EF8 A;  1EG9 B;  4GB5 A;  2RFR A;  1O7H B;  3B4O A;  1VZZ A;  3H51 A;  1ASK A;  1CQS A;  3FKA A;  3OWY A;  1JB4 A;  3D9R A;  3NM2 A;  1BUQ A;  3KKG A;  3Q90 A;  2A15 A;  4R1K A;  5AIG A;  3BB9 A;  2BMO B;  1SJW A;  5TGN A;  4LGQ A;  1OGZ A;  4HM3 B;  3OWS A;  2HMJ B;  6STD A;  2CHC A;  2B1X B;  4IIA A;  5D83 A;  1O7G B;  1HKX A;  1OUN A;  2GEX A;  4LMI A;  3JUO A;  4N3V A;  5AEU B;  1GYB A;  5BVB A;  2HMO B;  1JN5 A;  1STD A;  3NXJ A;  4HM6 B;  4RZM A;  5IER A;  5AIF A;  1NDO B;  1OH0 A;  5CXO A;  5BXQ A;  1NU3 A;  3B4P A;  3KZT A;  3EN8 A;  4FCM A;  5HGR A;  3DM8 A;  2UX0 A;  3NBR A;  2HML B;  4L8P A;  3B7C A;  5CF2 A;  1GY7 A;  2I9W A;  2HMM B;  2XR8 B;  3FH1 A;  5STD A;  2RCD A;  5G2G A;  3MG2 A;  3GZX B;  1JN5 B;  3EBT A;  2OWP A;  3F7X A;  3HZP A;  3OV4 A;  1WQL B;  2GXF A;  3SED A;  4XM4 A;  4Q53 A;  4HJL B;  2GBX B;  5D82 A;  4HM1 B;  2XRX B;  4WYK A;  5IF6 A;  1OCV A;  3T8N A;  3ECF A;  3F14 A;  3JUM A;  5AIH A;  2YFI B;  3VSY A;  1W00 A;  3RGA A;  4HM0 B;  5AI1 A;  3EJV A;  5D81 A;  5IG0 A;  4J9A A;  4HVN A;  3GWR A;  3EX9 A;  3STD A;  3K7C A;  2BMR B;  1E3V A;  2JQ5 A;  1AR0 A;  5KP3 A;  4ORL A;  4XBT A;  3EHC A;  1U5O A;  3FGY A;  4WYK B;  1QJG A;  3GZR A;  5IG5 A;  2QIY A;  3FZW A;  4HZ9 B;  1QMA A;  5FW5 A;  4KVH A;  4WWU C;  3WMD A;  1ZX2 A;  4XDV A;  3S5C A;  2Z77 A;  1O7P B;  1O7W B;  3FLJ A;  5IEP A;  2GEY A;  4XBX A;  3SOY A;  2YFL B;  4X2H A;  4XBY A;  3CU3 A;  1GS3 A;  4L8O A;  3F7S A;  5CLK A;  3M8C A;  3SOA A;  1OF5 B;  2BNG A;  5KP1 A;  4XDW A;  2STD A;  5IEN A;  1TP6 A;  1C7H A;  2QGU A;  2B24 B;  1JKG B;  1OHO A;  3A76 A;  1S5A A;  1GY5 A;  2XSO B;  3EBY A;  4U13 A;  3CNX A;  3F8X A;  3EN1 B;  4FCJ A;  3GRD A;  5AEW B;  5AII A;  1Q40 A;  3FF0 A;  3I0Y A;  4MJD A;  3FF2 A;  3EQQ B;  3B8L A;  4HZB B;  4HM4 B;  5CF1 A;  3UNL A;  1DMQ A;  3GZB A;  1OPY A;  4WP5 A;  3F9S A;  1Q42 A;  2R4I A;  3G8Z A;  3FSD A;  4CDL A;  3HX8 A;  5JPU A;  4HM8 B;  1DMM A;  4L7K A;  2XSH B;  1Q40 B;  1OHS A;  1UUW B;  1E3R A;  3DMC A;  3JUQ A;  1JB5 A;  3G0K A;  3NUV A;  3NV0 B;  1OF5 A;  1Z1S A;  1ZO2 A;  7STD A;  4HM5 B;  2Z76 A;  3DZL A;  3EC9 A;  3MHE A;  1JKG A;  1O7M B;  4I4K A;  5EVH A;  1TUH A;  2CKF B;  3H3H A;  3KSP A;  2W2C A;  1ULI B;  3KE7 A;  3DXO A;  3G16 A;  3MSO A;  4R9K A;  1W01 A;  3NHX A;  3K0Z A;  2GBW B;  4PEJ A;  1NWW A;  5KP4 A;  5DRV A;  2INX A;  4HM2 B;  1OGX A;  1EA2 A;  2K54 A;  1DMN A;  2RGQ A;  1OHP A;  3JUN A;  3JUP A;  4HKV B;  2BMQ B;  2YFJ B;  4H3U A;  3MG1 A;  3LYG A;  3IPT A;  2Z7A A;  3ER7 A;  8CHO A;  4OVM A;  3F8H A;  3MKI A;  1A2K A;  3OXA A;  1ULJ B;  2IMJ A;  4OUQ A;  2HMK B;  2F98 A;  4X2O A;  4R9L A;  2PZV A;  3ROB A;  3VGN A;  1UUV B;  5CK6 A;  3GZY B;  4LEH A;  1IDP A;  3F40 A;  5DRE A;  3MG3 A;  3CNM A;  3NV0 A;  4STD A;  5JPP A;  5IG3 A;  1JB2 A;  2HMN B;  3MYT A; 
#chains in the Genus database with same CATH topology
 1YIJ 3;  1RN1 A;  1AQZ A;  2XFS A;  1E97 A;  1RDS A;  1JV2 B;  3LOY A;  4XB5 A;  1MWU A;  1W02 A;  1ZS7 A;  1LQG C;  3LXU X;  2OQE A;  2UUG C;  2P0X A;  5IG4 A;  1O7N B;  4J8T A;  1Q7H A;  3E99 A;  3DUK A;  1K41 A;  4K1V A;  4KZ1 A;  3OX9 A;  3LZA A;  1ISK A;  1GY6 A;  2F86 B;  4RNY A;  1W6Y A;  2OTL 3;  1GOY A;  3LTC A;  4HAA A;  3T8U A;  1B27 A;  2L4V A;  3HK4 A;  3OWU A;  1W2B 2;  1BVI A;  2R41 A;  2F99 A;  4K1U A;  3UJM A;  1RRH A;  5IEO A;  6GSP A;  4J5G A;  1FGT A;  2Y74 A;  4HM7 B;  3RGR A;  3CPO A;  7RNT A;  4N6N B;  1BOX A;  2W56 B;  3BLZ A;  1UCI A;  1RMS A;  3EF8 A;  1RLS A;  1EG9 B;  1FUS A;  3PYJ A;  5D83 A;  4G1M B;  2RFR A;  4GB5 A;  3DGO A;  3PGB A;  1O7H B;  4BIR A;  2P09 A;  1RJO A;  3B4O A;  4MEI A;  1N8R 4;  1VZZ A;  3RDE A;  2Q07 A;  1HU9 A;  1RNB A;  3DY5 A;  3CCR 3;  1B2Z A;  3H51 A;  2M7O A;  4O8S A;  1LVN A;  3PXM A;  1ASK A;  1IV9 A;  1RNT A;  1CQS A;  3FKA A;  3HIG A;  1JBR A;  3FCS B;  3OWY A;  1JB4 A;  3D9R A;  2E2U A;  3NM2 A;  1BUQ A;  2OOV A;  3KKG A;  3S67 A;  3Q90 A;  2A15 A;  1LOY A;  4R1K A;  1SIH A;  2JDI H;  2W6J H;  2RBI A;  3PZW A;  3WR2 A;  1NJI 4;  1SAR A;  1B2X A;  5HOH A;  1X1Y A;  5AIG A;  2CH9 A;  3BB9 A;  1T5Y A;  2BMO B;  2BO9 B;  1SJW A;  3CCQ 3;  1JZO A;  2LQV A;  5TGN A;  1T3B A;  4CPK A;  4LGQ A;  1OGZ A;  3ALA A;  4HM3 B;  2ML5 A;  3OWS A;  3WA2 X;  1TFK A;  4EV2 A;  2HMJ B;  4R4K A;  2PNC A;  1JRQ A;  1B20 A;  1GD4 A;  4BTW A;  1QAL A;  2QA4 3;  3LH4 A;  6STD A;  3BNB A;  2CHC A;  3N8B A;  1LNH A;  2B1X B;  2ZL8 A;  3MWZ A;  1SII A;  1O7G B;  1HKX A;  1OUN A;  2AAE A;  3NBJ A;  4IIA A;  1N9E A;  2GEX A;  4LMI A;  1BSD A;  4NPB A;  3JUO A;  5I97 A;  4N3V A;  3AGO A;  5AEU B;  5G1L A;  3S28 A;  1TU5 A;  1VQM 3;  1BRG A;  3NQY A;  1B2M A;  3BU4 A;  1GYB A;  1V74 A;  1EUI C;  1LXE A;  1UI7 A;  4N6V 0;  4FMB A;  3URP A;  3AMO A;  1RGF A;  5M18 A;  2W9P A;  5BVB A;  1M1X B;  1BNF A;  1TFO A;  2HMO B;  3CD6 3;  1JN5 A;  1TRQ A;  2OQE C;  1RGG A;  1BRK A;  3CCV 3;  5BU4 A;  1STD A;  3NXJ A;  1IT7 A;  4N6T A;  1BNJ A;  4HM6 B;  4RZM A;  1K73 4;  1FGQ A;  5IER A;  3SLU A;  1I0V A;  1I2F A;  1NDO B;  1Q9E A;  5AIF A;  1IVX A;  1ROA A;  1FUT A;  1QAF A;  1X1W A;  5ELU A;  1A90 A;  1YGW A;  1OH0 A;  2OTJ 3;  1GMP A;  5CXO A;  3NX0 A;  1IV7 A;  1QVF 2;  2W04 A;  5BXQ A;  1NU3 A;  1A2P A;  4FR9 A;  3B4P A;  1LRA A;  3X41 A;  3KZT A;  1UCL A;  9RNT A;  1DVD A;  3EN8 A;  2F56 A;  4HOH A;  1BSB A;  1FGM A;  3IMA B;  1Y4K A;  4FCM A;  3SYU A;  2C11 A;  2CC3 A;  6RNT A;  3AHW A;  3PCS A;  3ZG0 A;  5HGR A;  2W56 A;  3DM8 A;  2UX0 A;  3BNC A;  3NBR A;  2HML B;  4L8P A;  3B7C A;  3JVC A;  2IUJ A;  2QEX 3;  5CF2 A;  3GAX A;  3K9M C;  1WMN A;  3KCH A;  1GY7 A;  2I9W A;  1WMO A;  3LTB A;  3GSP A;  1BU4 A;  4FMC A;  1VQO 3;  3EE1 A;  1NB3 I;  2IUK A;  2HMM B;  1GMQ A;  1VQ6 3;  2XR8 B;  2OOV C;  2SBL A;  3FH1 A;  5STD A;  3CXC 2;  3D3L A;  2RCD A;  5G2G A;  3CCM 3;  2V1L A;  1W5Z A;  3MG2 A;  1STF I;  7GSP A;  3GZX B;  1TRP A;  2CIU A;  1RKY A;  4KFD A;  1JN5 B;  2ZA4 A;  2OWP A;  3EBT A;  3F7X A;  3HZP A;  3OV4 A;  4QWT A;  1WQL B;  4OK0 A;  2GXF A;  3SED A;  1LOW A;  1G0T A;  4N6L A;  1JZD A;  1KWI A;  4XM4 A;  1YIT 3;  1RCK A;  4Q53 A;  4HJL B;  1W6C A;  2GBX B;  5D82 A;  1YVB I;  4HM1 B;  4BTY A;  1AVK A;  2XRX B;  3X40 A;  1D6U A;  5ELJ A;  1C54 A;  1YGE A;  4WYK A;  1UUG B;  5IF6 A;  1OCV A;  1B21 A;  1N9J A;  1JJ2 2;  3T8N A;  3ECF A;  3MPH A;  4GL6 A;  5RNT A;  3BNE A;  3F14 A;  3JUM A;  2WGQ A;  2KCD A;  3N9H A;  4RNT A;  1AV4 A;  2CG1 A;  5M19 A;  3PS8 A;  3G6E 3;  1FA3 A;  1FUW A;  5AIH A;  3O8Y A;  2YFI B;  3DH2 A;  3VSY A;  3CMA 3;  1BNE A;  2IA7 A;  1PU4 A;  1W00 A;  3RGA A;  1JBT A;  1J2B A;  4HM0 B;  1BNR A;  5AI1 A;  5M1A A;  3S27 A;  1UI8 A;  1CYU A;  2W0Q A;  3EJV A;  3KN4 A;  5D81 A;  5IG0 A;  1MNL A;  4J9A A;  4HVN A;  1QVG 2;  1FW7 A;  2ZHX B;  3GWR A;  4EXR A;  3EX9 A;  3KSE D;  4R80 A;  3STD A;  2XGN A;  3DGM A;  3D4A A;  3K7C A;  1BRN L;  2FNQ A;  3AHS A;  1RGC A;  1IU7 A;  3QK9 A;  2BMR B;  3NQZ A;  3BND A;  1E3V A;  2E2T A;  4I5Q A;  2JQ5 A;  1I3F A;  3WOE B;  1AR0 A;  1TIJ A;  2CX1 A;  5KP3 A;  4ORL A;  2HOH A;  2O3O A;  4RBN A;  2KAA A;  4XBT A;  2BHM A;  1HZ1 A;  2KF4 A;  2OCT A;  1VQ5 3;  2CX0 A;  3EHC A;  1VQ4 3;  3LT9 A;  1U5O A;  1WNH A;  1BNI A;  3FGY A;  5AYR B;  3CC2 3;  3D5G A;  4EV5 A;  1AY7 A;  1TTO A;  1FZU A;  4AKY A;  4WYK B;  5LC7 A;  1LOV A;  3WDG B;  2CFW A;  1QJG A;  1KSI A;  3GZR A;  3SXX A;  2F4Y A;  5IG5 A;  2J8X B;  1LNI A;  2QIY A;  3FZW A;  5G1K A;  1RN4 A;  1GSP A;  4H61 A;  5EEO A;  4CJN A;  1M1K 4;  1W7C A;  2SAR A;  3DGY A;  1UDI I;  1I8V A;  4LSO A;  1QMA A;  4HZ9 B;  5A0O B;  5FW5 A;  1GD3 A;  1NO3 A;  3X3Z A;  4KVH A;  1VQK 3;  1B2S A;  3RNT A;  1DVC A;  4WWU C;  3WMD A;  4ZM8 A;  1GOU A;  1DET A;  1ZX2 A;  4XDV A;  1KC8 4;  1BRS A;  2KF3 A;  1MWR A;  4HBR A;  3S5C A;  2Z77 A;  4O2H A;  1O7P B;  1O7W B;  3FLJ A;  5IEP A;  2GEY A;  3KII A;  4XBX A;  4MMX B;  1Q82 4;  3SOY A;  2YFL B;  1N5P A;  1V57 A;  1BRI A;  1RN7 A;  1B2U A;  4K90 B;  1RGE A;  4X2H A;  4XBY A;  1I0X A;  1EEJ A;  1OAC A;  1UGI A;  3CU3 A;  3G4S 3;  1GS3 A;  1YHQ 3;  2MC8 A;  3J7Y d;  4L8O A;  3LML A;  3F7S A;  1YJN 3;  2GU1 A;  5CLK A;  3PCR A;  2KF6 A;  3M8C A;  1M9G A;  1OF5 B;  2XH9 A;  3Q2P A;  4LYL B;  3SOA A;  2BNG A;  2KF5 A;  1BNS A;  1EKM A;  4XDW A;  5KP1 A;  2STD A;  5IEN A;  2AAD A;  2BU4 A;  1TP6 A;  2L1S A;  1C7H A;  1VQ9 3;  1CYV A;  3FG1 A;  4N6U A;  1BSC A;  1BSE A;  1G96 A;  1X1U A;  1MGR A;  2QGU A;  2B24 B;  1T2H A;  4N6M A;  1YNV X;  3WOD G;  3I55 3;  3X42 A;  1JKG B;  1OHO A;  1BNG A;  2ZDJ A;  3A76 A;  4GSP A;  3CCU 3;  1S5A A;  2XFT A;  1GY5 A;  4MMY B;  2XSO B;  1YI2 3;  1MWS A;  3LTD A;  2LYX A;  4IT7 A;  3EBY A;  4U13 A;  3CCE 3;  3CNX A;  2W9Q A;  1TJD A;  1IVW A;  3K5T A;  3F8X A;  1RSN A;  2FGT A;  3EN1 B;  1UW1 A;  4FCJ A;  3G71 3;  4FCZ A;  2CFK A;  3UL5 A;  4BU4 A;  3GRD A;  2H0G A;  5AEW B;  2D1W A;  1Q40 A;  5AII A;  3FF0 A;  1QAK A;  3I0Y A;  1IQ8 A;  4KFE A;  3HI7 A;  2E2V A;  3CCS 3;  1MOL A;  1YJ9 3;  2BIR A;  4MJD A;  3A5E A;  1SPU A;  4IPB A;  3FF2 A;  2ML6 A;  5IW9 A;  1FGO A;  1IYY A;  1K28 A;  3EQQ B;  3B8L A;  3LTA A;  2CK3 H;  1M90 4;  4HZB B;  4TX4 A;  3X3X A;  2CFL A;  3CCJ 3;  4BTX A;  1IQX A;  4HM4 B;  2GSP A;  1UGH I;  1G02 A;  3UNL A;  5CF1 A;  4J5K A;  1ROV A;  1RGA A;  4AEQ A;  1DMQ A;  3DGL A;  3S29 A;  3GZB A;  5LC6 A;  1OPY A;  3SX1 A;  2K0M A;  3D79 A;  3K63 A;  4WP5 A;  5AYS C;  1CH0 A;  1RCL A;  2P38 A;  1JBS A;  1LQM B;  1BGS A;  1IK3 A;  3SVA A;  3F9S A;  1Q42 A;  1BUJ A;  2FXT A;  2CWV A;  2R4I A;  3Q3F A;  1NB5 I;  3G8Z A;  3FSD A;  4CDL A;  1R4C A;  4FMD A;  2WOF A;  2K3D A;  1D6Y A;  3HX8 A;  3HII A;  2F5M A;  5JPU A;  1FGR A;  1W4N A;  2C10 A;  4HM8 B;  1DMM A;  1X1X A;  2KRT A;  1WMP A;  1I2E A;  2H0H A;  3UB1 A;  1RHL A;  2RSX A;  4NRE A;  3CCL 3;  3CPW 2;  4L7K A;  2XSH B;  1F8N A;  1LOX A;  1BIR A;  1Q40 B;  1BRH A;  2CG0 A;  2CWU A;  1Q7Y 4;  3U1W A;  1OHS A;  3U97 A;  1UUW B;  1W2Z A;  2XEP A;  2Z6B A;  1E3R A;  1B3S A;  3DMC A;  3JUQ A;  5FGO A;  1JB5 A;  2BT3 A;  2MF7 A;  1VQQ A;  3G0K A;  3NUV A;  3NV0 B;  1OF5 A;  1GOV A;  3VF1 A;  1Z1S A;  3FG4 A;  3Q1C A;  4EC6 A;  1ZO2 A;  4KT3 B;  2CFD A;  4NHF A;  4LZI A;  3FG3 A;  4KFF A;  4WHA A;  4K61 A;  7STD A;  2F5W A;  4HM5 B;  5EQL A;  3OW2 2;  2Z76 A;  3AGN A;  3DZL A;  2P05 A;  1CEW I;  3EC9 A;  1N8Q A;  2P0M A;  2KXG A;  3MHE A;  4O3V A;  1Q81 4;  1JKG A;  1O7M B;  1BAN A;  4DKI A;  3WOF B;  3T0U A;  4EW5 A;  1DE3 A;  4I4K A;  1RRL A;  1PFP A;  5EVH A;  1VQL 3;  1KD1 4;  1TUH A;  4GHO A;  1W6G A;  1VQN 3;  3CC7 3;  3CC4 3;  2CKF B;  2RNT A;  3H3H A;  2GU3 A;  1UCK A;  1K9M 4;  3KSP A;  2W2C A;  1ULI B;  1EQK A;  2CWT A;  3KE7 A;  1YVS A;  2O9U X;  3DXO A;  4JRF A;  1I3I A;  3L0R A;  4BL3 A;  1I2G A;  3G16 A;  3MSO A;  4R9K A;  3V99 A;  1W01 A;  3HOH A;  3NHX A;  3N54 B;  3I56 3;  1PYL A;  4CCV A;  3UL6 A;  3K0Z A;  3ZG5 A;  2GBW B;  4ILF A;  1ZGX A;  5JBS A;  3V98 A;  4PEJ A;  1NWW A;  2CW9 A;  4AKZ A;  5BIR A;  5KP4 A;  5DRV A;  1L5G B;  3QRD A;  1DYU A;  1S72 3;  2INX A;  4HM2 B;  1Q86 4;  2XGL A;  1K8A 4;  1OGX A;  1EA2 A;  2K54 A;  1VQP 3;  1DMN A;  2RGQ A;  4N6O B;  1OHP A;  3JUN A;  1GMR A;  1N5H A;  2BMQ B;  2YFJ B;  3JUP A;  4FMA A;  4H3U A;  4HKV B;  3WA3 A;  3CME 3;  1R4Y A;  3NM7 A;  2CFG A;  2XF3 A;  4JF8 A;  4EYC A;  4MMZ B;  3MG1 A;  8RNT A;  1VQ8 3;  1RGL A;  3LYG A;  3IPT A;  3V92 A;  1JNQ A;  1T2I A;  4HYZ A;  2Z7A A;  2WGO A;  3ER7 A;  4OVM A;  8CHO A;  1IVU A;  3ZFZ A;  3F8H A;  3MKI A;  1A2K A;  2C4B A;  3X3Y A;  2WO0 A;  1WTH A;  1MWT A;  1A2V A;  1RGK A;  3OXA A;  1A67 A;  1ULJ B;  1HYF A;  1US1 A;  1BRJ A;  4RNZ A;  5GSP A;  1FYS A;  1NNV A;  2IMJ A;  2YX9 A;  4OUQ A;  3DGN A;  2UGI A;  2HMK B;  2F98 A;  4X2O A;  2H0I A;  1UCJ A;  2Y73 A;  1PY3 A;  2PZV A;  2W03 A;  4R9L A;  2D42 A;  1MGW A;  1IQY A;  1BAO A;  1D6Z A;  3ROB A;  3VGN A;  4EBG A;  1UUV B;  1YJW 3;  4O02 B;  5CK6 A;  3WHO A;  2IY2 A;  3KFQ C;  1AVL A;  3GZY B;  3LT8 A;  1IDP A;  3F40 A;  4LEH A;  5DRE A;  2WOH A;  3CNM A;  3MG3 A;  3D5I A;  1KQS 2;  3NV0 A;  1IT8 A;  4BL2 A;  3TDG A;  4STD A;  1IVV A;  5JPP A;  1RGH A;  3IJE B;  1U8C B;  1V58 A;  3NBB A;  1RTU A;  1I70 A;  3EB8 A;  1VQ7 3;  3BIR A;  5IG3 A;  1BSA A;  1JB2 A;  2HMN B;  2IYJ A;  3AMO B;  3MYT A;  1SQW A;  4WFO A; 
#chains in the Genus database with same CATH homology
 1YIJ 3;  2XFS A;  1E97 A;  4XB5 A;  1JV2 B;  3LOY A;  1W02 A;  3LXU X;  2OQE A;  2P0X A;  5IG4 A;  1O7N B;  4J8T A;  3E99 A;  3DUK A;  1K41 A;  4K1V A;  4KZ1 A;  3OX9 A;  3LZA A;  1ISK A;  1GY6 A;  2F86 B;  4RNY A;  1W6Y A;  2OTL 3;  3T8U A;  3LTC A;  3HK4 A;  2L4V A;  3OWU A;  1W2B 2;  4K1U A;  2F99 A;  3UJM A;  1RRH A;  5IEO A;  1FGT A;  2Y74 A;  4HM7 B;  3RGR A;  3CPO A;  4N6N B;  2W56 B;  3BLZ A;  3EF8 A;  1EG9 B;  3PYJ A;  4G1M B;  2RFR A;  4GB5 A;  3DGO A;  3PGB A;  1O7H B;  2P09 A;  1RJO A;  3B4O A;  4MEI A;  1N8R 4;  1VZZ A;  3RDE A;  2Q07 A;  1HU9 A;  3DY5 A;  3CCR 3;  3H51 A;  2M7O A;  4O8S A;  1LVN A;  3PXM A;  1ASK A;  1IV9 A;  1CQS A;  3FKA A;  3HIG A;  3FCS B;  3OWY A;  1JB4 A;  3D9R A;  2E2U A;  3NM2 A;  1BUQ A;  2OOV A;  3KKG A;  3S67 A;  3Q90 A;  2A15 A;  4R1K A;  1SIH A;  2JDI H;  2W6J H;  3PZW A;  1NJI 4;  5AIG A;  2CH9 A;  3BB9 A;  1T5Y A;  2BMO B;  2BO9 B;  1SJW A;  3CCQ 3;  2LQV A;  5TGN A;  4LGQ A;  1OGZ A;  3ALA A;  4HM3 B;  2ML5 A;  3OWS A;  3WA2 X;  1TFK A;  4EV2 A;  2HMJ B;  4R4K A;  2PNC A;  1JRQ A;  1GD4 A;  4BTW A;  1QAL A;  2QA4 3;  3LH4 A;  6STD A;  3BNB A;  2CHC A;  3N8B A;  1LNH A;  2B1X B;  2ZL8 A;  3MWZ A;  1SII A;  1O7G B;  1HKX A;  1OUN A;  3NBJ A;  4IIA A;  5D83 A;  1N9E A;  2GEX A;  4LMI A;  3JUO A;  5I97 A;  4N3V A;  5AEU B;  3S28 A;  1TU5 A;  1VQM 3;  3NQY A;  1GYB A;  1V74 A;  1LXE A;  1UI7 A;  4N6V 0;  4FMB A;  3AMO A;  2W9P A;  5BVB A;  1M1X B;  1TFO A;  2HMO B;  3CD6 3;  1JN5 A;  2OQE C;  3CCV 3;  1STD A;  3NXJ A;  1IT7 A;  4N6T A;  4HM6 B;  4RZM A;  1K73 4;  1FGQ A;  5IER A;  3SLU A;  5AIF A;  1NDO B;  1IVX A;  1ROA A;  1QAF A;  5ELU A;  1A90 A;  1OH0 A;  2OTJ 3;  5CXO A;  3NX0 A;  1IV7 A;  1QVF 2;  2W04 A;  5BXQ A;  1NU3 A;  4FR9 A;  3B4P A;  3X41 A;  3KZT A;  1DVD A;  3EN8 A;  1FGM A;  3IMA B;  1Y4K A;  4FCM A;  2C11 A;  2CC3 A;  3PCS A;  5HGR A;  2W56 A;  3DM8 A;  2UX0 A;  3BNC A;  3NBR A;  2HML B;  4L8P A;  3B7C A;  3JVC A;  2IUJ A;  2QEX 3;  5CF2 A;  3GAX A;  3K9M C;  1WMN A;  1GY7 A;  2I9W A;  1WMO A;  3LTB A;  4FMC A;  1VQO 3;  3EE1 A;  1NB3 I;  2IUK A;  2HMM B;  1VQ6 3;  2XR8 B;  2OOV C;  2SBL A;  3FH1 A;  5STD A;  3CXC 2;  3D3L A;  2RCD A;  5G2G A;  3CCM 3;  2V1L A;  1W5Z A;  3MG2 A;  1STF I;  3GZX B;  2CIU A;  1RKY A;  4KFD A;  1JN5 B;  3EBT A;  2OWP A;  3F7X A;  3HZP A;  4QWT A;  3OV4 A;  1WQL B;  4OK0 A;  2GXF A;  3SED A;  4N6L A;  4XM4 A;  1KWI A;  1YIT 3;  4Q53 A;  4HJL B;  1W6C A;  2GBX B;  5D82 A;  1YVB I;  4HM1 B;  4BTY A;  1AVK A;  2XRX B;  3X40 A;  1D6U A;  5ELJ A;  1YGE A;  4WYK A;  5IF6 A;  1OCV A;  1N9J A;  1JJ2 2;  3T8N A;  3ECF A;  3MPH A;  4GL6 A;  3BNE A;  3F14 A;  3JUM A;  2WGQ A;  2KCD A;  3N9H A;  2CG1 A;  1AV4 A;  1FA3 A;  3PS8 A;  3G6E 3;  1FUW A;  5AIH A;  3O8Y A;  2YFI B;  3VSY A;  3CMA 3;  2IA7 A;  1J2B A;  1PU4 A;  1W00 A;  3RGA A;  4HM0 B;  5AI1 A;  3S27 A;  1UI8 A;  1CYU A;  2W0Q A;  3EJV A;  3KN4 A;  5D81 A;  5IG0 A;  1MNL A;  4J9A A;  4HVN A;  1QVG 2;  3GWR A;  4EXR A;  3EX9 A;  3KSE D;  4R80 A;  3STD A;  2XGN A;  3DGM A;  3K7C A;  2FNQ A;  1IU7 A;  3QK9 A;  2BMR B;  3NQZ A;  3BND A;  1E3V A;  2E2T A;  2JQ5 A;  3WOE B;  1AR0 A;  1TIJ A;  5KP3 A;  4ORL A;  2O3O A;  4RBN A;  4XBT A;  2BHM A;  2OCT A;  1VQ5 3;  3EHC A;  1VQ4 3;  3LT9 A;  1U5O A;  1WNH A;  3CC2 3;  3FGY A;  5AYR B;  4EV5 A;  4AKY A;  4WYK B;  5LC7 A;  3WDG B;  2CFW A;  1QJG A;  1KSI A;  3GZR A;  3SXX A;  5IG5 A;  2QIY A;  3FZW A;  4H61 A;  5EEO A;  1M1K 4;  1W7C A;  4LSO A;  1QMA A;  4HZ9 B;  5A0O B;  5FW5 A;  1GD3 A;  1NO3 A;  3X3Z A;  4KVH A;  1VQK 3;  1DVC A;  4WWU C;  3WMD A;  4ZM8 A;  1KC8 4;  1ZX2 A;  4XDV A;  3S5C A;  4HBR A;  2Z77 A;  4O2H A;  1O7P B;  1O7W B;  3FLJ A;  5IEP A;  2GEY A;  3KII A;  4XBX A;  4MMX B;  1Q82 4;  3SOY A;  2YFL B;  1N5P A;  1RN7 A;  4K90 B;  4X2H A;  4XBY A;  1OAC A;  3CU3 A;  3G4S 3;  1GS3 A;  1YHQ 3;  2MC8 A;  3J7Y d;  4L8O A;  3LML A;  3F7S A;  1YJN 3;  2GU1 A;  5CLK A;  3PCR A;  3M8C A;  1M9G A;  1OF5 B;  2XH9 A;  3Q2P A;  3SOA A;  2BNG A;  1EKM A;  4XDW A;  5KP1 A;  2STD A;  5IEN A;  1TP6 A;  1C7H A;  1VQ9 3;  1CYV A;  3FG1 A;  4N6U A;  1G96 A;  2QGU A;  4N6M A;  2B24 B;  3WOD G;  3I55 3;  3X42 A;  1JKG B;  1OHO A;  2ZDJ A;  3A76 A;  3CCU 3;  1S5A A;  2XFT A;  1GY5 A;  4MMY B;  2XSO B;  1YI2 3;  3LTD A;  2LYX A;  4IT7 A;  3EBY A;  4U13 A;  3CCE 3;  3CNX A;  2W9Q A;  1IVW A;  3K5T A;  3F8X A;  2FGT A;  3EN1 B;  1UW1 A;  4FCJ A;  3G71 3;  4FCZ A;  2CFK A;  3UL5 A;  3GRD A;  5AEW B;  2D1W A;  1Q40 A;  5AII A;  3FF0 A;  1QAK A;  3I0Y A;  1IQ8 A;  4KFE A;  3HI7 A;  2E2V A;  3CCS 3;  1MOL A;  1YJ9 3;  4MJD A;  1SPU A;  4IPB A;  3FF2 A;  2ML6 A;  5IW9 A;  1FGO A;  1K28 A;  3EQQ B;  3B8L A;  3LTA A;  2CK3 H;  1M90 4;  4HZB B;  4TX4 A;  3X3X A;  2CFL A;  3CCJ 3;  4BTX A;  1IQX A;  4HM4 B;  5CF1 A;  3UNL A;  1ROV A;  4AEQ A;  1DMQ A;  3DGL A;  3S29 A;  3GZB A;  5LC6 A;  1OPY A;  3SX1 A;  2K0M A;  3K63 A;  4WP5 A;  5AYS C;  2P38 A;  1IK3 A;  3SVA A;  3F9S A;  1Q42 A;  2FXT A;  2CWV A;  2R4I A;  1NB5 I;  3G8Z A;  3FSD A;  4CDL A;  1R4C A;  4FMD A;  2WOF A;  1D6Y A;  3HX8 A;  3HII A;  5JPU A;  1FGR A;  1W4N A;  2C10 A;  4HM8 B;  1DMM A;  2KRT A;  1WMP A;  3UB1 A;  2RSX A;  4NRE A;  3CCL 3;  3CPW 2;  4L7K A;  2XSH B;  1F8N A;  1LOX A;  2CG0 A;  1Q40 B;  2CWU A;  1Q7Y 4;  3U1W A;  1OHS A;  3U97 A;  1UUW B;  1W2Z A;  2XEP A;  2Z6B A;  1E3R A;  3DMC A;  3JUQ A;  5FGO A;  1JB5 A;  2BT3 A;  2MF7 A;  3G0K A;  3NUV A;  3NV0 B;  1OF5 A;  4EC6 A;  3VF1 A;  1Z1S A;  3FG4 A;  3Q1C A;  1ZO2 A;  2CFD A;  4NHF A;  4LZI A;  3FG3 A;  4KFF A;  4WHA A;  4K61 A;  7STD A;  3OW2 2;  4HM5 B;  5EQL A;  2Z76 A;  3DZL A;  2P05 A;  1CEW I;  3EC9 A;  1N8Q A;  2P0M A;  2KXG A;  3MHE A;  4O3V A;  1Q81 4;  1JKG A;  1O7M B;  3WOF B;  3T0U A;  4I4K A;  1RRL A;  1PFP A;  5EVH A;  1VQL 3;  1KD1 4;  1TUH A;  1W6G A;  1VQN 3;  3CC7 3;  3CC4 3;  2CKF B;  3H3H A;  2GU3 A;  1K9M 4;  3KSP A;  2W2C A;  1ULI B;  1EQK A;  2CWT A;  3KE7 A;  2O9U X;  3DXO A;  4JRF A;  3L0R A;  3G16 A;  3MSO A;  4R9K A;  3V99 A;  1W01 A;  3NHX A;  3N54 B;  3I56 3;  4CCV A;  3UL6 A;  3K0Z A;  2GBW B;  5JBS A;  3V98 A;  4PEJ A;  1NWW A;  2CW9 A;  4AKZ A;  5KP4 A;  5DRV A;  1L5G B;  3QRD A;  1DYU A;  1S72 3;  2INX A;  4HM2 B;  1Q86 4;  2XGL A;  1K8A 4;  1OGX A;  1EA2 A;  2K54 A;  1VQP 3;  1DMN A;  2RGQ A;  4N6O B;  1OHP A;  3JUN A;  1N5H A;  3JUP A;  2BMQ B;  2YFJ B;  4FMA A;  4H3U A;  4HKV B;  3WA3 A;  3CME 3;  3NM7 A;  2CFG A;  2XF3 A;  4JF8 A;  4EYC A;  4MMZ B;  3MG1 A;  1VQ8 3;  3LYG A;  3IPT A;  3V92 A;  1JNQ A;  4HYZ A;  2Z7A A;  2WGO A;  3ER7 A;  4OVM A;  8CHO A;  1IVU A;  3F8H A;  3MKI A;  1A2K A;  3X3Y A;  2WO0 A;  1WTH A;  3OXA A;  1A2V A;  1A67 A;  1ULJ B;  1US1 A;  4RNZ A;  2IMJ A;  4OUQ A;  2YX9 A;  3DGN A;  2HMK B;  2F98 A;  4X2O A;  2Y73 A;  4R9L A;  2PZV A;  2W03 A;  2D42 A;  1IQY A;  3ROB A;  1D6Z A;  3VGN A;  1YJW 3;  4EBG A;  1UUV B;  4O02 B;  5CK6 A;  3KFQ C;  1AVL A;  3GZY B;  3LT8 A;  1IDP A;  3F40 A;  4LEH A;  5DRE A;  2WOH A;  3CNM A;  3MG3 A;  1KQS 2;  3NV0 A;  1IT8 A;  3TDG A;  4STD A;  1IVV A;  5JPP A;  3IJE B;  1U8C B;  3NBB A;  3EB8 A;  1VQ7 3;  5IG3 A;  1JB2 A;  2HMN B;  3AMO B;  3MYT A;  1SQW A;  4WFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...