3BLZA

Crystal structure of a ntf2-like protein of unknown function (sbal_0622) from shewanella baltica os155 at 1.75 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
124
structure length
124
Chain Sequence
NTTYVQEYHAIVEVLSKYNEGGKKADSTIMRPAFSSQATIFGVDVDNKLTGGPIQGLFDVIDNVFHPSPEAKAAIARIDIVGTAASARIDTDDISGFRFTDFFNLLKVEGKWTVVSKIYHTHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords NTF2-like protein of unknown function
publication title Crystal structure of a NTF2-like protein of unknown function (YP_001049020.1) from Shewanella baltica OS155 at 1.75 A resolution
rcsb
source organism Shewanella baltica
total genus 32
structure length 124
sequence length 124
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12893 Lumazine_bd_2 Putative lumazine-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3blzA00
3UJMA 1JKGB 1Q40A 3NUVA 1STDA 2CHCA 1JN5A 2W2CA 2HMMB 3GZRA 3EBTA 3B7CA 3LZAA 3KE7A 1NDOB 4L7KA 4R1KA 4HM2B 1OCVA 3T8UA 1OGZA 4RZMA 5D83A 3CNMA 3MSOA 4H3UA 1NWWA 5CF2A 2YFLB 4I4KA 2XRXB 4LMIA 1W6YA 2CKFB 3LYGA 1S5AA 4HZ9B 2BMOB 4J9AA 3F40A 4HM5B 2RGQA 6STDA 3F7SA 4XDVA 1JB5A 1QMAA 1OGXA 1UUWB 1GY6A 2I9WA 3FH1A 5DRVA 5JPUA 3T8NA 3MG1A 3GZBA 1ZO2A 1QJGA 1JN5B 1ISKA 5BXQA 1GY7A 4HM0B 3JUQA 3CU3A 1K41A 4OUQA 4XB5A 1IDPA 3OV4A 5KP3A 3HK4A 5AIFA 5AIGA 3JUPA 4OVMA 1TUHA 3MG2A 3DMCA 2XR8B 1JB2A 2Z7AA 3FF2A 1OH0A 3JUOA 1ULIB 5TGNA 4XBYA 1GS3A 1E97A 1UUVB 3EN8A 1Z1SA 4HVNA 3FF0A 3ER7A 4L8OA 4HM8B 5AEWB 1EA2A 3F8XA 1DMNA 4ORLA 1CQSA 3F8HA 5IENA 1A2KA 3NM2A 5EVHA 3DXOA 3FZWA 4U13A 3I0YA 4K1UA 3FKAA 4PEJA 3DZLA 5AI1A 5AIHA 2BMRB 4XDWA 3MKIA 1E3VA 1Q42A 4WP5A 5CK6A 1OF5B 1ZX2A 5STDA 4HM4B 3NV0A 3F14A 3EX9A 3D9RA 3EN1B 1NU3A 1C7HA 5AEUB 3RGRA 1GY5A 1TP6A 1U5OA 3K7CA 4R9KA 5DREA 4XBXA 7STDA 5IF6A 1OHOA 5IG3A 4IIAA 3OWSA 8CHOA 3JUMA 3SOYA 3KSPA 3BLZA 2B24B 5HGRA 3EBYA 1EG9B 3OWUA 3HZPA 3CPOA 1Q40B 2XSOB 3H51A 1WQLB 3NV0B 5D82A 2HMJB 2PZVA 3DUKA 2UX0A 5KP1A 3VGNA 3SOAA 5D81A 1SJWA 3KZTA 4WWUC 2OWPA 1DMMA 4HZBB 1O7PB 3WMDA 5IG4A 2A15A 3VSYA 1DMQA 1BUQA 1O7GB 4FCJA 5JPPA 5IERA 1W01A 3S5CA 3SEDA 4X2HA 2QGUA 1O7WB 4Q53A 5CXOA 3B4PA 4FCMA 4L8PA 5IG5A 2GBWB 3EF8A 5KP4A 5AIIA 3EJVA 3EC9A 1VZZA 3G8ZA 3MG3A 3NHXA 3A76A 3GZXB 1E3RA 2GBXB 2STDA 2F99A 2YFJB 4HM3B 3F9SA 2HMKB 3E99A 1OHSA 3B4OA 4X2OA 1W02A 3MYTA 1AR0A 5IG0A 2RFRA 2QIYA 2HMLB 3JUNA 3F7XA 1HKXA 4STDA 1GYBA 3Q90A 4HJLB 3EQQB 3ECFA 2HMOB 5BVBA 4WYKA 2XSHB 4K1VA 5IEOA 4GB5A 4R9LA 3ROBA 5CF1A 1O7MB 4LEHA 1W00A 1OHPA 1JB4A 4HM7B 2F86B 2HMNB 2GEXA 3OWYA 2BMQB 3G16A 4HKVB 4XM4A 5FW5A 3G0KA 2GEYA 3DM8A 2K54A 1OPYA 3KKGA 2Z76A 3HX8A 3H3HA 3GZYB 2R4IA 3FLJA 3EHCA 3NBRA 3M8CA 2RCDA 2F98A 2YFIB 3FSDA 4J8TA 4WYKB 4N3VA 3K0ZA 3B8LA 3OX9A 1OUNA 1JKGA 5IEPA 4HM6B 1OF5A 3BB9A 3GWRA 2B1XB 2IMJA 4XBTA 2JQ5A 3OXAA 2GXFA 4HM1B 4KVHA 4LGQA 5CLKA 3MHEA 1O7HB 4CDLA 4MJDA 3IPTA 2INXA 3GRDA 3RGAA 2BNGA 3CNXA 1ULJB 3UNLA 3NXJA 1O7NB 3FGYA 5G2GA 2Z77A 3STDA 1ASKA
chains in the Genus database with same CATH superfamily
1X1YA 2FGTA 4MMZB 3X3YA 3UJMA 4DKIA 1CEWI 1BNIA 1FGOA 2Q07A 1JKGB 2ML6A 1A90A 3WR2A 4BTWA 1K734 3Q3FA 4EBGA 1Q40A 1UDII 1STDA 3NUVA 1IVWA 1Q814 4KFFA 1SIIA 1GOVA 1BRHA 1I2GA 2CHCA 1JN5A 2W2CA 3DGYA 2HMMB 3GZRA 4HOHA 2CG0A 2MF7A 3EBTA 3S28A 3B7CA 3D3LA 3LZAA 3KE7A 1NDOB 4MMXB 4L7KA 4K61A 1RRHA 1WMOA 4R1KA 2QA43 3CMA3 1YVBI 2ML5A 4HM2B 1OCVA 3T8UA 1SARA 2D42A 1OGZA 1GMQA 3K5TA 1RGHA 4RZMA 2KF6A 1N8QA 4N6LA 5D83A 1J2BA 3SXXA 3CNMA 3MSOA 3A5EA 1RCKA 1NWWA 4H3UA 5CF2A 2YFLB 4FMCA 1NB5I 1RGKA 4I4KA 5M18A 2XRXB 1RCLA 3AMOA 3SX1A 2M7OA 1D6UA 3PXMA 1IQ8A 4HYZA 1VQL3 1GD4A 4EXRA 4MEIA 4LMIA 1W6YA 1BNGA 2CKFB 3LYGA 1S5AA 4HZ9B 2ZA4A 3I553 2BMOB 4J9AA 2CX0A 3U1WA 3F40A 2W56B 1RDSA 4HM5B 3G6E3 1W6CA 2RGQA 2W04A 6STDA 2R41A 2KCDA 5ELJA 1C54A 3F7SA 1RRLA 4XDVA 3V99A 4EYCA 1DETA 1JB5A 1RJOA 1QMAA 1M904 1OGXA 1ROVA 1UUWB 2H0GA 2BHMA 1GY6A 2FNQA 2I9WA 3CC23 3X40A 1DE3A 3FH1A 1B2SA 2HOHA 5DRVA 5JPUA 3D4AA 3T8NA 3MG1A 4TX4A 4I5QA 3KN4A 1TU5A 1BRJA 2Z6BA 3GZBA 1QJGA 1ZO2A 1JN5B 1ISKA 1LRAA 1PYLA 1GY7A 5BXQA 4HM0B 3JUQA 5GSPA 4N6TA 4IT7A 2W9QA 1K41A 3CU3A 4OUQA 3MWZA 3HIIA 4XB5A 1IDPA 1FGQA 4HBRA 1AQZA 3OV4A 5KP3A 1BSEA 1LOVA 3HK4A 3KCHA 4GHOA 5AIGA 5AIFA 2XGNA 3JUPA 3NBJA 1PU4A 4O02B 4OVMA 1TUHA 1UCIA 3K9MC 5LC7A 2YX9A 1RSNA 4O3VA 3S29A 2GSPA 2H0IA 3MG2A 2PNCA 3DMCA 2XR8B 2P0MA 1JB2A 2Z7AA 3AMOB 3FF2A 1OH0A 4O8SA 3WHOA 3FG3A 1ULIB 3JUOA 3LH4A 4XBYA 5TGNA 3TDGA 3X41A 3CCS3 1BRGA 3LXUX 1BU4A 1GS3A 1E97A 1FUWA 1UUVB 1B2MA 3EN8A 2W03A 3KFQC 3T0UA 1Z1SA 2E2TA 3WDGB 1FGMA 4HVNA 3AGOA 3FF0A 4MMYB 1LXEA 3ER7A 3DGNA 1W5ZA 1UUGB 4L8OA 1JBTA 1LOYA 4IPBA 1JBRA 1YIT3 2IUKA 1RGGA 2OCTA 3IJEB 2XFTA 3CCJ3 2KF4A 4HM8B 1VQ53 2SARA 5M1AA 5AEWB 1HYFA 1IU7A 3MPHA 3WOFB 2Y73A 1EA2A 4WFOA 2BU4A 2IUJA 3F8XA 1DMNA 3RDEA 3G4S3 4ORLA 1A2VA 3D79A 4LZIA 1CQSA 3PZWA 4HAAA 3F8HA 2KXGA 1EQKA 5IENA 1YGEA 1A2KA 3LT8A 2OOVA 3NM2A 5EVHA 1ZGXA 1U8CB 2K3DA 3DXOA 3CXC2 3DGOA 3FCSB 3FZWA 4GSPA 1FGTA 1GMRA 1UCKA 4U13A 1YNVX 5M19A 3I0YA 4K1UA 5EQLA 3FKAA 4PEJA 3DZLA 5AI1A 5AIHA 3V92A 4BU4A 2BMRB 1V58A 4XDWA 1GOUA 3MKIA 1SIHA 5AYSC 5LC6A 1VQN3 3WA3A 1BSAA 1E3VA 1BSCA 2V1LA 2WGQA 1Q42A 2OOVC 1CH0A 2K0MA 2KAAA 3LOYA 4RBNA 4WP5A 3CME3 2OQEC 5CK6A 1T3BA 3CCU3 3ZG5A 1QVF2 3UL6A 1UW1A 1OF5B 1ZX2A 2KF5A 4CJNA 5STDA 3HOHA 1VQM3 4BIRA 2UUGC 1PFPA 1QAKA 4H61A 1DYUA 4HM4B 3NV0A 1YHQ3 1Q864 1V57A 1YI23 3VF1A 1N9JA 2GU3A 3DGLA 3F14A 4KT3B 1BUJA 4GL6A 2MC8A 1FUTA 3D9RA 3EX9A 3HI7A 3WODG 3EN1B 3S67A 1NU3A 1C7HA 1IQXA 1TJDA 2KF3A 2H0HA 1YGWA 4ILFA 5AEUB 4NPBA 1TFKA 3FG1A 3ZFZA 2L4VA 3RGRA 3SLUA 1GOYA 1GY5A 1N9EA 1TP6A 1W6GA 1M1K4 1T2IA 1U5OA 2RNTA 1JRQA 3K7CA 3L0RA 1VQ83 2BT3A 1V74A 3J7Yd 4R9KA 5DREA 1I2EA 1RGFA 1BVIA 3HIGA 2CG1A 1Q7Y4 2BIRA 1FUSA 4XBXA 7STDA 1VQ43 5IF6A 3CCE3 1A2PA 3BU4A 1NJI4 1OHOA 1I2FA 3CD63 5IG3A 4IIAA 3K63A 1RN4A 3OWSA 3UB1A 8CHOA 1BNSA 3JUMA 3SOYA 2WOHA 3KSPA 1N8R4 1FW7A 1GMPA 3BLZA 2F5WA 1W2B2 2B24B 1R4YA 1Q7HA 2LYXA 3NM7A 4FMBA 4O2HA 5HGRA 3LTDA 3Q1CA 3EBYA 1MGWA 2WO0A 1R4CA 1MWSA 1EG9B 1IV7A 1M9GA 3OWUA 3PGBA 3SYUA 5ELUA 3HZPA 3CPOA 5I97A 1Q40B 2ZL8A 3KIIA 2IYJA 4BTXA 1JV2B 2XSOB 6RNTA 1MOLA 1BNRA 3H51A 1WQLB 2CFKA 2OTL3 4RNTA 2CX1A 3NV0B 3N9HA 1K9M4 4EV5A 2E2UA 5D82A 1N5HA 1RGCA 2HMJB 2PZVA 1RN1A 3DUKA 2UX0A 1STFI 1ZS7A 3BIRA 1VQO3 3WA2X 3URPA 4ZM8A 5KP1A 1BSDA 3VGNA 3SOAA 1US1A 1BRKA 5D81A 4BTYA 1SJWA 3KZTA 1LQGC 4WWUC 1D6ZA 1DMMA 2CFWA 2OWPA 4HZBB 1L5GB 3X42A 5IW9A 1T2HA 4JRFA 1O7PB 2IY2A 2XEPA 3WMDA 5IG4A 1FGRA 2A15A 2ZDJA 3Q2PA 4N6NB 3VSYA 2XH9A 1DMQA 1BSBA 2RSXA 3I563 1BUQA 2CH9A 3BNBA 1KC84 1O7GB 1W4NA 3O8YA 4FCJA 5JPPA 2XF3A 1KD14 3AHWA 1Q9EA 3DH2A 5IERA 1W01A 1QVG2 1HU9A 3QK9A 3S5CA 1BGSA 1LNIA 5BIRA 3SEDA 2ZHXB 1BAOA 2CWVA 2IA7A 4X2HA 2QGUA 3PYJA 3CCM3 1VQP3 4NREA 1O7WB 4Q53A 3FG4A 4N6OB 5CXOA 3B4PA 1RLSA 4FCMA 1F8NA 1SPUA 1T5YA 2GBWB 3EF8A 3NQYA 4L8PA 5IG5A 5KP4A 1I8VA 1BNFA 3BNDA 1DVDA 2UGIA 5AIIA 3LT9A 2J8XB 2O9UX 3PCRA 3EJVA 4JF8A 3EC9A 1BRIA 1RN7A 1VZZA 3G8ZA 3MG3A 1IT7A 4RNYA 1AY7A 2OQEA 3KSED 3NHXA 3CCR3 1G0TA 3WOEB 1YIJ3 1YJW3 3A76A 2CWUA 3GZXB 3JVCA 5HOHA 1E3RA 2GBXB 1G96A 2STDA 2JDIH 2C10A 5FGOA 2F99A 2YFJB 1I0VA 2AAEA 4N6MA 3RNTA 4BL2A 3EE1A 1WTHA 3AGNA 3EB8A 1IT8A 3IMAB 1K28A 1LNHA 4HM3B 6GSPA 1JNQA 3F9SA 4EW5A 1YJN3 2P38A 1MNLA 1B3SA 2HMKB 1W2ZA 3E99A 2SBLA 1OHSA 2O3OA 3B4OA 4X2OA 5AYRB 1RHLA 1MWRA 1N5PA 1W02A 1AR0A 3MYTA 2Y74A 3CC43 1Q824 1TTOA 5IG0A 3OW22 1X1UA 2RFRA 2QIYA 1B21A 2HMLB 4AEQA 3JUNA 4FCZA 1YJ93 2W0QA 1JZDA 1BIRA 4BL3A 1W7CA 2RBIA 3LTCA 4K90B 1X1WA 4J5KA 3F7XA 4CPKA 1EEJA 1HKXA 2CFDA 2LQVA 4STDA 1GYBA 2CWTA 4KFDA 2CFLA 3DY5A 1D6YA 1KWIA 3Q90A 2CIUA 1I3FA 1MWUA 2CW9A 3GSPA 3CCV3 4AKZA 4HJLB 1FA3A 5A0OB 2WGOA 3EQQB 3ECFA 4OK0A 2W9PA 4EC6A 1WNHA 1TIJA 2HMOB 3X3XA 1BRSA 5BVBA 1LOXA 3N8BA 2P0XA 4R4KA 4WYKA 2XSHB 4K1VA 1RNBA 1RMSA 3SVAA 2E2VA 1ROAA 2P09A 3BNEA 5IEOA 4GB5A 1UGHI 1WMNA 2P05A 2AADA 4EV2A 3N54B 4R9LA 3ROBA 3U97A 2F56A 1O7MB 5CF1A 1VQ93 1VQQA 3AHSA 4LEHA 1IYYA 1UGIA 4RNZA 1W00A 1QAFA 4WHAA 1OHPA 1JB4A 4KFEA 1JJ22 4HM7B 4FMAA 2F86B 2HMNB 1AV4A 3X3ZA 2GEXA 3G713 3D5IA 3OWYA 1B27A 2BMQB 1IVUA 1M1XB 3G16A 1UI7A 4HKVB 1TFOA 4XM4A 5FW5A 3LMLA 1GD3A 3G0KA 1B20A 3GAXA 1IK3A 2GEYA 3DGMA 3DM8A 2K54A 1B2ZA 1IVVA 1OPYA 1EUIC 3KKGA 1RGAA 2QEX3 1VQK3 2Z76A 3HX8A 2D1WA 1BNJA 3H3HA 1RTUA 1QALA 4N6V0 4LSOA 2W6JH 3S27A 1JZOA 1LVNA 3GZYB 2R4IA 1IVXA 3LTAA 3FLJA 3NX0A 1JBSA 3ALAA 1BNEA 3EHCA 3NBRA 3M8CA 2RCDA 4FR9A 5EEOA 4CCVA 2F98A 2YFIB 3FSDA 1NO3A 1MGRA 3QRDA 4J8TA 4WYKB 5G1LA 1S723 4N3VA 2C4BA 1UCJA 1SQWA 3UL5A 1UI8A 3CCQ3 3ZG0A 2XFSA 1TRPA 4AKYA 4LYLB 9RNTA 1RGLA 3K0ZA 1BRNL 4G1MB 2XGLA 1AVLA 1UCLA 4NHFA 1A67A 8RNTA 1NNVA 1I3IA 3B8LA 1I70A 3OX9A 1OUNA 1RNTA 1JKGA 1X1XA 3NBBA 1LOWA 4KZ1A 3NQZA 5IEPA 2WOFA 4HM6B 1OF5A 3BB9A 3GWRA 1G02A 1OACA 2B1XB 2IMJA 1WMPA 4XBTA 2JQ5A 3BNCA 3OXAA 2GXFA 1LQMB 2GU1A 4R80A 1K8A4 5JBSA 1I0XA 1BOXA 4HM1B 4QWTA 7GSPA 1VQ73 1HZ1A 3CCL3 1DVCA 1RGEA 4FMDA 4KVHA 4LGQA 5CLKA 3MHEA 7RNTA 2FXTA 2CFGA 3PS8A 4N6UA 1O7HB 3LTBA 2BO9B 1B2XA 3V98A 1AVKA 1BANA 2L1SA 1TRQA 4CDLA 3CC73 2CK3H 1GSPA 1PY3A 3D5GA 1Y4KA 2C11A 5BU4A 4MJDA 1EKMA 1IV9A 5G1KA 1VQ63 3IPTA 2CC3A 2OTJ3 2F4YA 1IQYA 1FYSA 2F5MA 2INXA 5RNTA 3GRDA 3RGAA 1B2UA 2BNGA 1RKYA 3CNXA 1ULJB 3UNLA 1YVSA 3NXJA 1O7NB 4J5GA 1FZUA 1CYUA 3FGYA 2W56A 1MWTA 3CPW2 1CYVA 5G2GA 3PCSA 1KSIA 2Z77A 1KQS2 3STDA 1ASKA 2KRTA 1NB3I
chains in the Genus database with same CATH topology
2FGTA 4MMZB 3X3YA 3UJMA 1CEWI 1FGOA 2Q07A 1A90A 1JKGB 2ML6A 4BTWA 1K734 4EBGA 1Q40A 3NUVA 1STDA 1Q814 1IVWA 4KFFA 1SIIA 2CHCA 1JN5A 2W2CA 2HMMB 3GZRA 2CG0A 2MF7A 3EBTA 3S28A 3B7CA 3D3LA 3LZAA 3KE7A 1NDOB 4MMXB 4L7KA 4K61A 1RRHA 1WMOA 4R1KA 2QA43 3CMA3 1YVBI 2ML5A 4HM2B 1OCVA 3T8UA 2D42A 1OGZA 3K5TA 4RZMA 1N8QA 4N6LA 5D83A 1J2BA 3SXXA 3CNMA 3MSOA 1NB5I 4H3UA 1NWWA 5CF2A 2YFLB 4FMCA 4I4KA 2XRXB 3AMOA 3SX1A 2M7OA 1D6UA 3PXMA 1IQ8A 4HYZA 1VQL3 1GD4A 4EXRA 4MEIA 4LMIA 1W6YA 2CKFB 3LYGA 1S5AA 4HZ9B 3I553 2BMOB 4J9AA 3U1WA 3F40A 2W56B 3G6E3 4HM5B 1W6CA 2RGQA 2W04A 6STDA 5ELJA 2KCDA 3F7SA 1RRLA 4XDVA 3V99A 4EYCA 1JB5A 1RJOA 1QMAA 1M904 1OGXA 1ROVA 1UUWB 2BHMA 1GY6A 2FNQA 2I9WA 3CC23 3X40A 3FH1A 5DRVA 5JPUA 3T8NA 3MG1A 4TX4A 1TU5A 3KN4A 2Z6BA 3GZBA 1QJGA 1ZO2A 1JN5B 1ISKA 5BXQA 1GY7A 4HM0B 3JUQA 4N6TA 4IT7A 2W9QA 1K41A 3CU3A 4OUQA 3MWZA 3HIIA 4XB5A 1IDPA 1FGQA 4HBRA 3OV4A 5KP3A 3HK4A 5AIFA 1PU4A 5AIGA 2XGNA 3JUPA 3NBJA 4O02B 4OVMA 1TUHA 3K9MC 5LC7A 2YX9A 4O3VA 3S29A 3MG2A 2PNCA 3DMCA 2XR8B 2P0MA 1JB2A 2Z7AA 3AMOB 3FF2A 1OH0A 4O8SA 3FG3A 1ULIB 3JUOA 3LH4A 4XBYA 5TGNA 3TDGA 3X41A 3CCS3 3LXUX 1GS3A 1E97A 1FUWA 1UUVB 3EN8A 2W03A 3KFQC 3T0UA 1Z1SA 2E2TA 3WDGB 1FGMA 4HVNA 3FF0A 4MMYB 1LXEA 3ER7A 3DGNA 1W5ZA 4L8OA 4IPBA 1YIT3 2IUKA 2OCTA 3IJEB 2XFTA 3CCJ3 4HM8B 1VQ53 5AEWB 3WOFB 1IU7A 3MPHA 2Y73A 1EA2A 4WFOA 2IUJA 3F8XA 1DMNA 3RDEA 3G4S3 4ORLA 1A2VA 4LZIA 1CQSA 3PZWA 3F8HA 2KXGA 1EQKA 5IENA 1YGEA 1A2KA 3LT8A 2OOVA 3NM2A 5EVHA 1U8CB 3DXOA 3CXC2 3DGOA 3FCSB 3FZWA 4U13A 1FGTA 3I0YA 4K1UA 5EQLA 3FKAA 4PEJA 3DZLA 5AI1A 5AIHA 3V92A 2BMRB 4XDWA 3MKIA 1SIHA 5AYSC 5LC6A 1VQN3 3WA3A 1E3VA 2V1LA 2WGQA 1Q42A 2OOVC 2K0MA 3LOYA 4RBNA 4WP5A 3CME3 2OQEC 5CK6A 3CCU3 1QVF2 3UL6A 1UW1A 1OF5B 1ZX2A 1VQM3 5STDA 1PFPA 1QAKA 4H61A 1DYUA 4HM4B 3NV0A 1YHQ3 1Q864 1YI23 3VF1A 1N9JA 2GU3A 3DGLA 3F14A 4GL6A 2MC8A 3EX9A 3D9RA 3HI7A 3WODG 3EN1B 3S67A 1NU3A 1C7HA 1IQXA 5AEUB 1TFKA 3FG1A 2L4VA 3RGRA 3SLUA 1GY5A 1N9EA 1TP6A 1W6GA 1M1K4 1U5OA 1JRQA 3K7CA 3L0RA 1VQ83 2BT3A 1V74A 3J7Yd 4R9KA 5DREA 3HIGA 2CG1A 1Q7Y4 4XBXA 7STDA 1VQ43 5IF6A 3CCE3 1NJI4 1OHOA 3CD63 5IG3A 4IIAA 3K63A 3OWSA 8CHOA 3UB1A 3JUMA 3SOYA 2WOHA 3KSPA 1N8R4 3BLZA 1W2B2 2B24B 4FMBA 2LYXA 3NM7A 4O2HA 5HGRA 3LTDA 3Q1CA 3EBYA 2WO0A 1R4CA 1EG9B 1IV7A 1M9GA 3OWUA 3PGBA 5ELUA 3HZPA 3CPOA 5I97A 1Q40B 2ZL8A 3KIIA 4BTXA 1JV2B 2XSOB 1MOLA 3H51A 1WQLB 2CFKA 2OTL3 3NV0B 3N9HA 1K9M4 4EV5A 2E2UA 5D82A 1N5HA 2HMJB 2PZVA 3DUKA 2UX0A 1STFI 1VQO3 3WA2X 4ZM8A 5KP1A 3VGNA 3SOAA 1US1A 5D81A 4BTYA 1SJWA 3KZTA 4WWUC 1D6ZA 1DMMA 2CFWA 2OWPA 4HZBB 1L5GB 3X42A 5IW9A 4JRFA 1O7PB 2XEPA 3WMDA 5IG4A 1FGRA 2A15A 2ZDJA 3Q2PA 4N6NB 3VSYA 2XH9A 1DMQA 2RSXA 3I563 1BUQA 2CH9A 3BNBA 1KC84 1O7GB 1W4NA 3O8YA 4FCJA 5JPPA 2XF3A 1KD14 5IERA 1W01A 1QVG2 1HU9A 3QK9A 3S5CA 3SEDA 2CWVA 2IA7A 4X2HA 2QGUA 3PYJA 3CCM3 1VQP3 4NREA 1O7WB 4Q53A 3FG4A 4N6OB 5CXOA 3B4PA 4FCMA 4L8PA 1F8NA 1SPUA 1T5YA 2GBWB 3EF8A 3NQYA 5IG5A 5KP4A 3BNDA 1DVDA 5AIIA 3LT9A 2O9UX 3PCRA 3EJVA 4JF8A 3EC9A 1RN7A 1VZZA 3G8ZA 3MG3A 1IT7A 4RNYA 2OQEA 1YIJ3 3KSED 3NHXA 3CCR3 3WOEB 1YJW3 3A76A 2CWUA 3GZXB 3JVCA 1E3RA 2GBXB 1G96A 2STDA 2JDIH 2C10A 5FGOA 2F99A 2YFJB 4N6MA 3EE1A 1WTHA 3EB8A 1IT8A 3IMAB 1K28A 1LNHA 4HM3B 1JNQA 3F9SA 1YJN3 2P38A 1MNLA 2HMKB 1W2ZA 3E99A 2SBLA 1OHSA 2O3OA 3B4OA 4X2OA 5AYRB 1N5PA 1W02A 1AR0A 3MYTA 2Y74A 3CC43 1Q824 5IG0A 3OW22 2RFRA 2QIYA 4AEQA 2HMLB 3JUNA 4FCZA 1YJ93 2W0QA 1W7CA 3LTCA 4K90B 3F7XA 1HKXA 2CFDA 2LQVA 4STDA 1GYBA 2CWTA 4KFDA 2CFLA 3DY5A 1D6YA 1KWIA 3Q90A 2CIUA 2CW9A 3CCV3 1FA3A 4AKZA 4HJLB 5A0OB 2WGOA 3EQQB 3ECFA 4OK0A 2W9PA 4EC6A 1WNHA 1TIJA 2HMOB 3X3XA 5BVBA 1LOXA 3N8BA 2P0XA 4R4KA 4WYKA 2XSHB 4K1VA 3SVAA 2E2VA 1ROAA 2P09A 3BNEA 5IEOA 4GB5A 1WMNA 2P05A 4EV2A 3N54B 4R9LA 3ROBA 3U97A 5CF1A 1O7MB 1VQ93 4LEHA 4RNZA 1W00A 1QAFA 4WHAA 1OHPA 1JB4A 4KFEA 1JJ22 4HM7B 4FMAA 2F86B 2HMNB 1AV4A 3X3ZA 2GEXA 3G713 3OWYA 2BMQB 1IVUA 1M1XB 3G16A 1UI7A 4HKVB 1TFOA 4XM4A 5FW5A 3LMLA 1GD3A 3G0KA 3GAXA 1IK3A 2GEYA 3DGMA 3DM8A 2K54A 1IVVA 1OPYA 3KKGA 1VQK3 2QEX3 2Z76A 3HX8A 2D1WA 3H3HA 1QALA 4N6V0 4LSOA 2W6JH 3S27A 1LVNA 3GZYB 2R4IA 1IVXA 3LTAA 3FLJA 3NX0A 3ALAA 3EHCA 3NBRA 3M8CA 2RCDA 4FR9A 5EEOA 4CCVA 2F98A 2YFIB 3FSDA 1NO3A 3QRDA 4J8TA 4WYKB 1S723 4N3VA 3UL5A 1SQWA 1UI8A 3CCQ3 2XFSA 4AKYA 3K0ZA 4G1MB 2XGLA 1AVLA 4NHFA 1A67A 3B8LA 3OX9A 1OUNA 4KZ1A 1JKGA 3NBBA 3NQZA 5IEPA 2WOFA 4HM6B 1OF5A 3BB9A 3GWRA 1OACA 2B1XB 2IMJA 1WMPA 4XBTA 2JQ5A 3BNCA 3OXAA 2GXFA 2GU1A 4R80A 1K8A4 5JBSA 4QWTA 4HM1B 1VQ73 3CCL3 1DVCA 4FMDA 4KVHA 4LGQA 5CLKA 3MHEA 2FXTA 2CFGA 3PS8A 4N6UA 1O7HB 3LTBA 2BO9B 3V98A 1AVKA 4CDLA 3CC73 2CK3H 1Y4KA 2C11A 4MJDA 1EKMA 1IV9A 1VQ63 2OTJ3 3IPTA 2CC3A 1IQYA 2INXA 3GRDA 3RGAA 2BNGA 1RKYA 3CNXA 1ULJB 3UNLA 3NXJA 1O7NB 1CYUA 3FGYA 2W56A 3CPW2 1CYVA 5G2GA 3PCSA 1KSIA 2Z77A 1KQS2 3STDA 1ASKA 2KRTA 1NB3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UJM A;  1JKG B;  1Q40 A;  3NUV A;  1STD A;  2CHC A;  1JN5 A;  2W2C A;  2HMM B;  3GZR A;  3EBT A;  3B7C A;  3LZA A;  3KE7 A;  1NDO B;  4L7K A;  4R1K A;  4HM2 B;  1OCV A;  3T8U A;  1OGZ A;  4RZM A;  5D83 A;  3CNM A;  3MSO A;  4H3U A;  1NWW A;  5CF2 A;  2YFL B;  4I4K A;  2XRX B;  4LMI A;  1W6Y A;  2CKF B;  3LYG A;  1S5A A;  4HZ9 B;  2BMO B;  4J9A A;  3F40 A;  4HM5 B;  2RGQ A;  6STD A;  3F7S A;  4XDV A;  1JB5 A;  1QMA A;  1OGX A;  1UUW B;  1GY6 A;  2I9W A;  3FH1 A;  5DRV A;  5JPU A;  3T8N A;  3MG1 A;  3GZB A;  1ZO2 A;  1QJG A;  1JN5 B;  1ISK A;  5BXQ A;  1GY7 A;  4HM0 B;  3JUQ A;  3CU3 A;  1K41 A;  4OUQ A;  4XB5 A;  1IDP A;  3OV4 A;  5KP3 A;  3HK4 A;  5AIF A;  5AIG A;  3JUP A;  4OVM A;  1TUH A;  3MG2 A;  3DMC A;  2XR8 B;  1JB2 A;  2Z7A A;  3FF2 A;  1OH0 A;  3JUO A;  1ULI B;  5TGN A;  4XBY A;  1GS3 A;  1E97 A;  1UUV B;  3EN8 A;  1Z1S A;  4HVN A;  3FF0 A;  3ER7 A;  4L8O A;  4HM8 B;  5AEW B;  1EA2 A;  3F8X A;  1DMN A;  4ORL A;  1CQS A;  3F8H A;  5IEN A;  1A2K A;  3NM2 A;  5EVH A;  3DXO A;  3FZW A;  4U13 A;  3I0Y A;  4K1U A;  3FKA A;  4PEJ A;  3DZL A;  5AI1 A;  5AIH A;  2BMR B;  4XDW A;  3MKI A;  1E3V A;  1Q42 A;  4WP5 A;  5CK6 A;  1OF5 B;  1ZX2 A;  5STD A;  4HM4 B;  3NV0 A;  3F14 A;  3EX9 A;  3D9R A;  3EN1 B;  1NU3 A;  1C7H A;  5AEU B;  3RGR A;  1GY5 A;  1TP6 A;  1U5O A;  3K7C A;  4R9K A;  5DRE A;  4XBX A;  7STD A;  5IF6 A;  1OHO A;  5IG3 A;  4IIA A;  3OWS A;  8CHO A;  3JUM A;  3SOY A;  3KSP A;  3BLZ A;  2B24 B;  5HGR A;  3EBY A;  1EG9 B;  3OWU A;  3HZP A;  3CPO A;  1Q40 B;  2XSO B;  3H51 A;  1WQL B;  3NV0 B;  5D82 A;  2HMJ B;  2PZV A;  3DUK A;  2UX0 A;  5KP1 A;  3VGN A;  3SOA A;  5D81 A;  1SJW A;  3KZT A;  4WWU C;  2OWP A;  1DMM A;  4HZB B;  1O7P B;  3WMD A;  5IG4 A;  2A15 A;  3VSY A;  1DMQ A;  1BUQ A;  1O7G B;  4FCJ A;  5JPP A;  5IER A;  1W01 A;  3S5C A;  3SED A;  4X2H A;  2QGU A;  1O7W B;  4Q53 A;  5CXO A;  3B4P A;  4FCM A;  4L8P A;  5IG5 A;  2GBW B;  3EF8 A;  5KP4 A;  5AII A;  3EJV A;  3EC9 A;  1VZZ A;  3G8Z A;  3MG3 A;  3NHX A;  3A76 A;  3GZX B;  1E3R A;  2GBX B;  2STD A;  2F99 A;  2YFJ B;  4HM3 B;  3F9S A;  2HMK B;  3E99 A;  1OHS A;  3B4O A;  4X2O A;  1W02 A;  3MYT A;  1AR0 A;  5IG0 A;  2RFR A;  2QIY A;  2HML B;  3JUN A;  3F7X A;  1HKX A;  4STD A;  1GYB A;  3Q90 A;  4HJL B;  3EQQ B;  3ECF A;  2HMO B;  5BVB A;  4WYK A;  2XSH B;  4K1V A;  5IEO A;  4GB5 A;  4R9L A;  3ROB A;  5CF1 A;  1O7M B;  4LEH A;  1W00 A;  1OHP A;  1JB4 A;  4HM7 B;  2F86 B;  2HMN B;  2GEX A;  3OWY A;  2BMQ B;  3G16 A;  4HKV B;  4XM4 A;  5FW5 A;  3G0K A;  2GEY A;  3DM8 A;  2K54 A;  1OPY A;  3KKG A;  2Z76 A;  3HX8 A;  3H3H A;  3GZY B;  2R4I A;  3FLJ A;  3EHC A;  3NBR A;  3M8C A;  2RCD A;  2F98 A;  2YFI B;  3FSD A;  4J8T A;  4WYK B;  4N3V A;  3K0Z A;  3B8L A;  3OX9 A;  1OUN A;  1JKG A;  5IEP A;  4HM6 B;  1OF5 A;  3BB9 A;  3GWR A;  2B1X B;  2IMJ A;  4XBT A;  2JQ5 A;  3OXA A;  2GXF A;  4HM1 B;  4KVH A;  4LGQ A;  5CLK A;  3MHE A;  1O7H B;  4CDL A;  4MJD A;  3IPT A;  2INX A;  3GRD A;  3RGA A;  2BNG A;  3CNX A;  1ULJ B;  3UNL A;  3NXJ A;  1O7N B;  3FGY A;  5G2G A;  2Z77 A;  3STD A;  1ASK A; 
#chains in the Genus database with same CATH topology
 1X1Y A;  2FGT A;  4MMZ B;  3X3Y A;  3UJM A;  4DKI A;  1CEW I;  1BNI A;  1FGO A;  2Q07 A;  1JKG B;  2ML6 A;  1A90 A;  3WR2 A;  4BTW A;  1K73 4;  3Q3F A;  4EBG A;  1Q40 A;  1UDI I;  1STD A;  3NUV A;  1IVW A;  1Q81 4;  4KFF A;  1SII A;  1GOV A;  1BRH A;  1I2G A;  2CHC A;  1JN5 A;  2W2C A;  3DGY A;  2HMM B;  3GZR A;  4HOH A;  2CG0 A;  2MF7 A;  3EBT A;  3S28 A;  3B7C A;  3D3L A;  3LZA A;  3KE7 A;  1NDO B;  4MMX B;  4L7K A;  4K61 A;  1RRH A;  1WMO A;  4R1K A;  2QA4 3;  3CMA 3;  1YVB I;  2ML5 A;  4HM2 B;  1OCV A;  3T8U A;  1SAR A;  2D42 A;  1OGZ A;  1GMQ A;  3K5T A;  1RGH A;  4RZM A;  2KF6 A;  1N8Q A;  4N6L A;  5D83 A;  1J2B A;  3SXX A;  3CNM A;  3MSO A;  3A5E A;  1RCK A;  1NWW A;  4H3U A;  5CF2 A;  2YFL B;  4FMC A;  1NB5 I;  1RGK A;  4I4K A;  5M18 A;  2XRX B;  1RCL A;  3AMO A;  3SX1 A;  2M7O A;  1D6U A;  3PXM A;  1IQ8 A;  4HYZ A;  1VQL 3;  1GD4 A;  4EXR A;  4MEI A;  4LMI A;  1W6Y A;  1BNG A;  2CKF B;  3LYG A;  1S5A A;  4HZ9 B;  2ZA4 A;  3I55 3;  2BMO B;  4J9A A;  2CX0 A;  3U1W A;  3F40 A;  2W56 B;  1RDS A;  4HM5 B;  3G6E 3;  1W6C A;  2RGQ A;  2W04 A;  6STD A;  2R41 A;  2KCD A;  5ELJ A;  1C54 A;  3F7S A;  1RRL A;  4XDV A;  3V99 A;  4EYC A;  1DET A;  1JB5 A;  1RJO A;  1QMA A;  1M90 4;  1OGX A;  1ROV A;  1UUW B;  2H0G A;  2BHM A;  1GY6 A;  2FNQ A;  2I9W A;  3CC2 3;  3X40 A;  1DE3 A;  3FH1 A;  1B2S A;  2HOH A;  5DRV A;  5JPU A;  3D4A A;  3T8N A;  3MG1 A;  4TX4 A;  4I5Q A;  3KN4 A;  1TU5 A;  1BRJ A;  2Z6B A;  3GZB A;  1QJG A;  1ZO2 A;  1JN5 B;  1ISK A;  1LRA A;  1PYL A;  1GY7 A;  5BXQ A;  4HM0 B;  3JUQ A;  5GSP A;  4N6T A;  4IT7 A;  2W9Q A;  1K41 A;  3CU3 A;  4OUQ A;  3MWZ A;  3HII A;  4XB5 A;  1IDP A;  1FGQ A;  4HBR A;  1AQZ A;  3OV4 A;  5KP3 A;  1BSE A;  1LOV A;  3HK4 A;  3KCH A;  4GHO A;  5AIG A;  5AIF A;  2XGN A;  3JUP A;  3NBJ A;  1PU4 A;  4O02 B;  4OVM A;  1TUH A;  1UCI A;  3K9M C;  5LC7 A;  2YX9 A;  1RSN A;  4O3V A;  3S29 A;  2GSP A;  2H0I A;  3MG2 A;  2PNC A;  3DMC A;  2XR8 B;  2P0M A;  1JB2 A;  2Z7A A;  3AMO B;  3FF2 A;  1OH0 A;  4O8S A;  3WHO A;  3FG3 A;  1ULI B;  3JUO A;  3LH4 A;  4XBY A;  5TGN A;  3TDG A;  3X41 A;  3CCS 3;  1BRG A;  3LXU X;  1BU4 A;  1GS3 A;  1E97 A;  1FUW A;  1UUV B;  1B2M A;  3EN8 A;  2W03 A;  3KFQ C;  3T0U A;  1Z1S A;  2E2T A;  3WDG B;  1FGM A;  4HVN A;  3AGO A;  3FF0 A;  4MMY B;  1LXE A;  3ER7 A;  3DGN A;  1W5Z A;  1UUG B;  4L8O A;  1JBT A;  1LOY A;  4IPB A;  1JBR A;  1YIT 3;  2IUK A;  1RGG A;  2OCT A;  3IJE B;  2XFT A;  3CCJ 3;  2KF4 A;  4HM8 B;  1VQ5 3;  2SAR A;  5M1A A;  5AEW B;  1HYF A;  1IU7 A;  3MPH A;  3WOF B;  2Y73 A;  1EA2 A;  4WFO A;  2BU4 A;  2IUJ A;  3F8X A;  1DMN A;  3RDE A;  3G4S 3;  4ORL A;  1A2V A;  3D79 A;  4LZI A;  1CQS A;  3PZW A;  4HAA A;  3F8H A;  2KXG A;  1EQK A;  5IEN A;  1YGE A;  1A2K A;  3LT8 A;  2OOV A;  3NM2 A;  5EVH A;  1ZGX A;  1U8C B;  2K3D A;  3DXO A;  3CXC 2;  3DGO A;  3FCS B;  3FZW A;  4GSP A;  1FGT A;  1GMR A;  1UCK A;  4U13 A;  1YNV X;  5M19 A;  3I0Y A;  4K1U A;  5EQL A;  3FKA A;  4PEJ A;  3DZL A;  5AI1 A;  5AIH A;  3V92 A;  4BU4 A;  2BMR B;  1V58 A;  4XDW A;  1GOU A;  3MKI A;  1SIH A;  5AYS C;  5LC6 A;  1VQN 3;  3WA3 A;  1BSA A;  1E3V A;  1BSC A;  2V1L A;  2WGQ A;  1Q42 A;  2OOV C;  1CH0 A;  2K0M A;  2KAA A;  3LOY A;  4RBN A;  4WP5 A;  3CME 3;  2OQE C;  5CK6 A;  1T3B A;  3CCU 3;  3ZG5 A;  1QVF 2;  3UL6 A;  1UW1 A;  1OF5 B;  1ZX2 A;  2KF5 A;  4CJN A;  5STD A;  3HOH A;  1VQM 3;  4BIR A;  2UUG C;  1PFP A;  1QAK A;  4H61 A;  1DYU A;  4HM4 B;  3NV0 A;  1YHQ 3;  1Q86 4;  1V57 A;  1YI2 3;  3VF1 A;  1N9J A;  2GU3 A;  3DGL A;  3F14 A;  4KT3 B;  1BUJ A;  4GL6 A;  2MC8 A;  1FUT A;  3D9R A;  3EX9 A;  3HI7 A;  3WOD G;  3EN1 B;  3S67 A;  1NU3 A;  1C7H A;  1IQX A;  1TJD A;  2KF3 A;  2H0H A;  1YGW A;  4ILF A;  5AEU B;  4NPB A;  1TFK A;  3FG1 A;  3ZFZ A;  2L4V A;  3RGR A;  3SLU A;  1GOY A;  1GY5 A;  1N9E A;  1TP6 A;  1W6G A;  1M1K 4;  1T2I A;  1U5O A;  2RNT A;  1JRQ A;  3K7C A;  3L0R A;  1VQ8 3;  2BT3 A;  1V74 A;  3J7Y d;  4R9K A;  5DRE A;  1I2E A;  1RGF A;  1BVI A;  3HIG A;  2CG1 A;  1Q7Y 4;  2BIR A;  1FUS A;  4XBX A;  7STD A;  1VQ4 3;  5IF6 A;  3CCE 3;  1A2P A;  3BU4 A;  1NJI 4;  1OHO A;  1I2F A;  3CD6 3;  5IG3 A;  4IIA A;  3K63 A;  1RN4 A;  3OWS A;  3UB1 A;  8CHO A;  1BNS A;  3JUM A;  3SOY A;  2WOH A;  3KSP A;  1N8R 4;  1FW7 A;  1GMP A;  3BLZ A;  2F5W A;  1W2B 2;  2B24 B;  1R4Y A;  1Q7H A;  2LYX A;  3NM7 A;  4FMB A;  4O2H A;  5HGR A;  3LTD A;  3Q1C A;  3EBY A;  1MGW A;  2WO0 A;  1R4C A;  1MWS A;  1EG9 B;  1IV7 A;  1M9G A;  3OWU A;  3PGB A;  3SYU A;  5ELU A;  3HZP A;  3CPO A;  5I97 A;  1Q40 B;  2ZL8 A;  3KII A;  2IYJ A;  4BTX A;  1JV2 B;  2XSO B;  6RNT A;  1MOL A;  1BNR A;  3H51 A;  1WQL B;  2CFK A;  2OTL 3;  4RNT A;  2CX1 A;  3NV0 B;  3N9H A;  1K9M 4;  4EV5 A;  2E2U A;  5D82 A;  1N5H A;  1RGC A;  2HMJ B;  2PZV A;  1RN1 A;  3DUK A;  2UX0 A;  1STF I;  1ZS7 A;  3BIR A;  1VQO 3;  3WA2 X;  3URP A;  4ZM8 A;  5KP1 A;  1BSD A;  3VGN A;  3SOA A;  1US1 A;  1BRK A;  5D81 A;  4BTY A;  1SJW A;  3KZT A;  1LQG C;  4WWU C;  1D6Z A;  1DMM A;  2CFW A;  2OWP A;  4HZB B;  1L5G B;  3X42 A;  5IW9 A;  1T2H A;  4JRF A;  1O7P B;  2IY2 A;  2XEP A;  3WMD A;  5IG4 A;  1FGR A;  2A15 A;  2ZDJ A;  3Q2P A;  4N6N B;  3VSY A;  2XH9 A;  1DMQ A;  1BSB A;  2RSX A;  3I56 3;  1BUQ A;  2CH9 A;  3BNB A;  1KC8 4;  1O7G B;  1W4N A;  3O8Y A;  4FCJ A;  5JPP A;  2XF3 A;  1KD1 4;  3AHW A;  1Q9E A;  3DH2 A;  5IER A;  1W01 A;  1QVG 2;  1HU9 A;  3QK9 A;  3S5C A;  1BGS A;  1LNI A;  5BIR A;  3SED A;  2ZHX B;  1BAO A;  2CWV A;  2IA7 A;  4X2H A;  2QGU A;  3PYJ A;  3CCM 3;  1VQP 3;  4NRE A;  1O7W B;  4Q53 A;  3FG4 A;  4N6O B;  5CXO A;  3B4P A;  1RLS A;  4FCM A;  1F8N A;  1SPU A;  1T5Y A;  2GBW B;  3EF8 A;  3NQY A;  4L8P A;  5IG5 A;  5KP4 A;  1I8V A;  1BNF A;  3BND A;  1DVD A;  2UGI A;  5AII A;  3LT9 A;  2J8X B;  2O9U X;  3PCR A;  3EJV A;  4JF8 A;  3EC9 A;  1BRI A;  1RN7 A;  1VZZ A;  3G8Z A;  3MG3 A;  1IT7 A;  4RNY A;  1AY7 A;  2OQE A;  3KSE D;  3NHX A;  3CCR 3;  1G0T A;  3WOE B;  1YIJ 3;  1YJW 3;  3A76 A;  2CWU A;  3GZX B;  3JVC A;  5HOH A;  1E3R A;  2GBX B;  1G96 A;  2STD A;  2JDI H;  2C10 A;  5FGO A;  2F99 A;  2YFJ B;  1I0V A;  2AAE A;  4N6M A;  3RNT A;  4BL2 A;  3EE1 A;  1WTH A;  3AGN A;  3EB8 A;  1IT8 A;  3IMA B;  1K28 A;  1LNH A;  4HM3 B;  6GSP A;  1JNQ A;  3F9S A;  4EW5 A;  1YJN 3;  2P38 A;  1MNL A;  1B3S A;  2HMK B;  1W2Z A;  3E99 A;  2SBL A;  1OHS A;  2O3O A;  3B4O A;  4X2O A;  5AYR B;  1RHL A;  1MWR A;  1N5P A;  1W02 A;  1AR0 A;  3MYT A;  2Y74 A;  3CC4 3;  1Q82 4;  1TTO A;  5IG0 A;  3OW2 2;  1X1U A;  2RFR A;  2QIY A;  1B21 A;  2HML B;  4AEQ A;  3JUN A;  4FCZ A;  1YJ9 3;  2W0Q A;  1JZD A;  1BIR A;  4BL3 A;  1W7C A;  2RBI A;  3LTC A;  4K90 B;  1X1W A;  4J5K A;  3F7X A;  4CPK A;  1EEJ A;  1HKX A;  2CFD A;  2LQV A;  4STD A;  1GYB A;  2CWT A;  4KFD A;  2CFL A;  3DY5 A;  1D6Y A;  1KWI A;  3Q90 A;  2CIU A;  1I3F A;  1MWU A;  2CW9 A;  3GSP A;  3CCV 3;  4AKZ A;  4HJL B;  1FA3 A;  5A0O B;  2WGO A;  3EQQ B;  3ECF A;  4OK0 A;  2W9P A;  4EC6 A;  1WNH A;  1TIJ A;  2HMO B;  3X3X A;  1BRS A;  5BVB A;  1LOX A;  3N8B A;  2P0X A;  4R4K A;  4WYK A;  2XSH B;  4K1V A;  1RNB A;  1RMS A;  3SVA A;  2E2V A;  1ROA A;  2P09 A;  3BNE A;  5IEO A;  4GB5 A;  1UGH I;  1WMN A;  2P05 A;  2AAD A;  4EV2 A;  3N54 B;  4R9L A;  3ROB A;  3U97 A;  2F56 A;  1O7M B;  5CF1 A;  1VQ9 3;  1VQQ A;  3AHS A;  4LEH A;  1IYY A;  1UGI A;  4RNZ A;  1W00 A;  1QAF A;  4WHA A;  1OHP A;  1JB4 A;  4KFE A;  1JJ2 2;  4HM7 B;  4FMA A;  2F86 B;  2HMN B;  1AV4 A;  3X3Z A;  2GEX A;  3G71 3;  3D5I A;  3OWY A;  1B27 A;  2BMQ B;  1IVU A;  1M1X B;  3G16 A;  1UI7 A;  4HKV B;  1TFO A;  4XM4 A;  5FW5 A;  3LML A;  1GD3 A;  3G0K A;  1B20 A;  3GAX A;  1IK3 A;  2GEY A;  3DGM A;  3DM8 A;  2K54 A;  1B2Z A;  1IVV A;  1OPY A;  1EUI C;  3KKG A;  1RGA A;  2QEX 3;  1VQK 3;  2Z76 A;  3HX8 A;  2D1W A;  1BNJ A;  3H3H A;  1RTU A;  1QAL A;  4N6V 0;  4LSO A;  2W6J H;  3S27 A;  1JZO A;  1LVN A;  3GZY B;  2R4I A;  1IVX A;  3LTA A;  3FLJ A;  3NX0 A;  1JBS A;  3ALA A;  1BNE A;  3EHC A;  3NBR A;  3M8C A;  2RCD A;  4FR9 A;  5EEO A;  4CCV A;  2F98 A;  2YFI B;  3FSD A;  1NO3 A;  1MGR A;  3QRD A;  4J8T A;  4WYK B;  5G1L A;  1S72 3;  4N3V A;  2C4B A;  1UCJ A;  1SQW A;  3UL5 A;  1UI8 A;  3CCQ 3;  3ZG0 A;  2XFS A;  1TRP A;  4AKY A;  4LYL B;  9RNT A;  1RGL A;  3K0Z A;  1BRN L;  4G1M B;  2XGL A;  1AVL A;  1UCL A;  4NHF A;  1A67 A;  8RNT A;  1NNV A;  1I3I A;  3B8L A;  1I70 A;  3OX9 A;  1OUN A;  1RNT A;  1JKG A;  1X1X A;  3NBB A;  1LOW A;  4KZ1 A;  3NQZ A;  5IEP A;  2WOF A;  4HM6 B;  1OF5 A;  3BB9 A;  3GWR A;  1G02 A;  1OAC A;  2B1X B;  2IMJ A;  1WMP A;  4XBT A;  2JQ5 A;  3BNC A;  3OXA A;  2GXF A;  1LQM B;  2GU1 A;  4R80 A;  1K8A 4;  5JBS A;  1I0X A;  1BOX A;  4HM1 B;  4QWT A;  7GSP A;  1VQ7 3;  1HZ1 A;  3CCL 3;  1DVC A;  1RGE A;  4FMD A;  4KVH A;  4LGQ A;  5CLK A;  3MHE A;  7RNT A;  2FXT A;  2CFG A;  3PS8 A;  4N6U A;  1O7H B;  3LTB A;  2BO9 B;  1B2X A;  3V98 A;  1AVK A;  1BAN A;  2L1S A;  1TRQ A;  4CDL A;  3CC7 3;  2CK3 H;  1GSP A;  1PY3 A;  3D5G A;  1Y4K A;  2C11 A;  5BU4 A;  4MJD A;  1EKM A;  1IV9 A;  5G1K A;  1VQ6 3;  3IPT A;  2CC3 A;  2OTJ 3;  2F4Y A;  1IQY A;  1FYS A;  2F5M A;  2INX A;  5RNT A;  3GRD A;  3RGA A;  1B2U A;  2BNG A;  1RKY A;  3CNX A;  1ULJ B;  3UNL A;  1YVS A;  3NXJ A;  1O7N B;  4J5G A;  1FZU A;  1CYU A;  3FGY A;  2W56 A;  1MWT A;  3CPW 2;  1CYV A;  5G2G A;  3PCS A;  1KSI A;  2Z77 A;  1KQS 2;  3STD A;  1ASK A;  2KRT A;  1NB3 I; 
#chains in the Genus database with same CATH homology
 2FGT A;  4MMZ B;  3X3Y A;  3UJM A;  1CEW I;  1FGO A;  2Q07 A;  1A90 A;  1JKG B;  2ML6 A;  4BTW A;  1K73 4;  4EBG A;  1Q40 A;  3NUV A;  1STD A;  1Q81 4;  1IVW A;  4KFF A;  1SII A;  2CHC A;  1JN5 A;  2W2C A;  2HMM B;  3GZR A;  2CG0 A;  2MF7 A;  3EBT A;  3S28 A;  3B7C A;  3D3L A;  3LZA A;  3KE7 A;  1NDO B;  4MMX B;  4L7K A;  4K61 A;  1RRH A;  1WMO A;  4R1K A;  2QA4 3;  3CMA 3;  1YVB I;  2ML5 A;  4HM2 B;  1OCV A;  3T8U A;  2D42 A;  1OGZ A;  3K5T A;  4RZM A;  1N8Q A;  4N6L A;  5D83 A;  1J2B A;  3SXX A;  3CNM A;  3MSO A;  1NB5 I;  4H3U A;  1NWW A;  5CF2 A;  2YFL B;  4FMC A;  4I4K A;  2XRX B;  3AMO A;  3SX1 A;  2M7O A;  1D6U A;  3PXM A;  1IQ8 A;  4HYZ A;  1VQL 3;  1GD4 A;  4EXR A;  4MEI A;  4LMI A;  1W6Y A;  2CKF B;  3LYG A;  1S5A A;  4HZ9 B;  3I55 3;  2BMO B;  4J9A A;  3U1W A;  3F40 A;  2W56 B;  3G6E 3;  4HM5 B;  1W6C A;  2RGQ A;  2W04 A;  6STD A;  5ELJ A;  2KCD A;  3F7S A;  1RRL A;  4XDV A;  3V99 A;  4EYC A;  1JB5 A;  1RJO A;  1QMA A;  1M90 4;  1OGX A;  1ROV A;  1UUW B;  2BHM A;  1GY6 A;  2FNQ A;  2I9W A;  3CC2 3;  3X40 A;  3FH1 A;  5DRV A;  5JPU A;  3T8N A;  3MG1 A;  4TX4 A;  1TU5 A;  3KN4 A;  2Z6B A;  3GZB A;  1QJG A;  1ZO2 A;  1JN5 B;  1ISK A;  5BXQ A;  1GY7 A;  4HM0 B;  3JUQ A;  4N6T A;  4IT7 A;  2W9Q A;  1K41 A;  3CU3 A;  4OUQ A;  3MWZ A;  3HII A;  4XB5 A;  1IDP A;  1FGQ A;  4HBR A;  3OV4 A;  5KP3 A;  3HK4 A;  5AIF A;  1PU4 A;  5AIG A;  2XGN A;  3JUP A;  3NBJ A;  4O02 B;  4OVM A;  1TUH A;  3K9M C;  5LC7 A;  2YX9 A;  4O3V A;  3S29 A;  3MG2 A;  2PNC A;  3DMC A;  2XR8 B;  2P0M A;  1JB2 A;  2Z7A A;  3AMO B;  3FF2 A;  1OH0 A;  4O8S A;  3FG3 A;  1ULI B;  3JUO A;  3LH4 A;  4XBY A;  5TGN A;  3TDG A;  3X41 A;  3CCS 3;  3LXU X;  1GS3 A;  1E97 A;  1FUW A;  1UUV B;  3EN8 A;  2W03 A;  3KFQ C;  3T0U A;  1Z1S A;  2E2T A;  3WDG B;  1FGM A;  4HVN A;  3FF0 A;  4MMY B;  1LXE A;  3ER7 A;  3DGN A;  1W5Z A;  4L8O A;  4IPB A;  1YIT 3;  2IUK A;  2OCT A;  3IJE B;  2XFT A;  3CCJ 3;  4HM8 B;  1VQ5 3;  5AEW B;  3WOF B;  1IU7 A;  3MPH A;  2Y73 A;  1EA2 A;  4WFO A;  2IUJ A;  3F8X A;  1DMN A;  3RDE A;  3G4S 3;  4ORL A;  1A2V A;  4LZI A;  1CQS A;  3PZW A;  3F8H A;  2KXG A;  1EQK A;  5IEN A;  1YGE A;  1A2K A;  3LT8 A;  2OOV A;  3NM2 A;  5EVH A;  1U8C B;  3DXO A;  3CXC 2;  3DGO A;  3FCS B;  3FZW A;  4U13 A;  1FGT A;  3I0Y A;  4K1U A;  5EQL A;  3FKA A;  4PEJ A;  3DZL A;  5AI1 A;  5AIH A;  3V92 A;  2BMR B;  4XDW A;  3MKI A;  1SIH A;  5AYS C;  5LC6 A;  1VQN 3;  3WA3 A;  1E3V A;  2V1L A;  2WGQ A;  1Q42 A;  2OOV C;  2K0M A;  3LOY A;  4RBN A;  4WP5 A;  3CME 3;  2OQE C;  5CK6 A;  3CCU 3;  1QVF 2;  3UL6 A;  1UW1 A;  1OF5 B;  1ZX2 A;  1VQM 3;  5STD A;  1PFP A;  1QAK A;  4H61 A;  1DYU A;  4HM4 B;  3NV0 A;  1YHQ 3;  1Q86 4;  1YI2 3;  3VF1 A;  1N9J A;  2GU3 A;  3DGL A;  3F14 A;  4GL6 A;  2MC8 A;  3EX9 A;  3D9R A;  3HI7 A;  3WOD G;  3EN1 B;  3S67 A;  1NU3 A;  1C7H A;  1IQX A;  5AEU B;  1TFK A;  3FG1 A;  2L4V A;  3RGR A;  3SLU A;  1GY5 A;  1N9E A;  1TP6 A;  1W6G A;  1M1K 4;  1U5O A;  1JRQ A;  3K7C A;  3L0R A;  1VQ8 3;  2BT3 A;  1V74 A;  3J7Y d;  4R9K A;  5DRE A;  3HIG A;  2CG1 A;  1Q7Y 4;  4XBX A;  7STD A;  1VQ4 3;  5IF6 A;  3CCE 3;  1NJI 4;  1OHO A;  3CD6 3;  5IG3 A;  4IIA A;  3K63 A;  3OWS A;  8CHO A;  3UB1 A;  3JUM A;  3SOY A;  2WOH A;  3KSP A;  1N8R 4;  3BLZ A;  1W2B 2;  2B24 B;  4FMB A;  2LYX A;  3NM7 A;  4O2H A;  5HGR A;  3LTD A;  3Q1C A;  3EBY A;  2WO0 A;  1R4C A;  1EG9 B;  1IV7 A;  1M9G A;  3OWU A;  3PGB A;  5ELU A;  3HZP A;  3CPO A;  5I97 A;  1Q40 B;  2ZL8 A;  3KII A;  4BTX A;  1JV2 B;  2XSO B;  1MOL A;  3H51 A;  1WQL B;  2CFK A;  2OTL 3;  3NV0 B;  3N9H A;  1K9M 4;  4EV5 A;  2E2U A;  5D82 A;  1N5H A;  2HMJ B;  2PZV A;  3DUK A;  2UX0 A;  1STF I;  1VQO 3;  3WA2 X;  4ZM8 A;  5KP1 A;  3VGN A;  3SOA A;  1US1 A;  5D81 A;  4BTY A;  1SJW A;  3KZT A;  4WWU C;  1D6Z A;  1DMM A;  2CFW A;  2OWP A;  4HZB B;  1L5G B;  3X42 A;  5IW9 A;  4JRF A;  1O7P B;  2XEP A;  3WMD A;  5IG4 A;  1FGR A;  2A15 A;  2ZDJ A;  3Q2P A;  4N6N B;  3VSY A;  2XH9 A;  1DMQ A;  2RSX A;  3I56 3;  1BUQ A;  2CH9 A;  3BNB A;  1KC8 4;  1O7G B;  1W4N A;  3O8Y A;  4FCJ A;  5JPP A;  2XF3 A;  1KD1 4;  5IER A;  1W01 A;  1QVG 2;  1HU9 A;  3QK9 A;  3S5C A;  3SED A;  2CWV A;  2IA7 A;  4X2H A;  2QGU A;  3PYJ A;  3CCM 3;  1VQP 3;  4NRE A;  1O7W B;  4Q53 A;  3FG4 A;  4N6O B;  5CXO A;  3B4P A;  4FCM A;  4L8P A;  1F8N A;  1SPU A;  1T5Y A;  2GBW B;  3EF8 A;  3NQY A;  5IG5 A;  5KP4 A;  3BND A;  1DVD A;  5AII A;  3LT9 A;  2O9U X;  3PCR A;  3EJV A;  4JF8 A;  3EC9 A;  1RN7 A;  1VZZ A;  3G8Z A;  3MG3 A;  1IT7 A;  4RNY A;  2OQE A;  1YIJ 3;  3KSE D;  3NHX A;  3CCR 3;  3WOE B;  1YJW 3;  3A76 A;  2CWU A;  3GZX B;  3JVC A;  1E3R A;  2GBX B;  1G96 A;  2STD A;  2JDI H;  2C10 A;  5FGO A;  2F99 A;  2YFJ B;  4N6M A;  3EE1 A;  1WTH A;  3EB8 A;  1IT8 A;  3IMA B;  1K28 A;  1LNH A;  4HM3 B;  1JNQ A;  3F9S A;  1YJN 3;  2P38 A;  1MNL A;  2HMK B;  1W2Z A;  3E99 A;  2SBL A;  1OHS A;  2O3O A;  3B4O A;  4X2O A;  5AYR B;  1N5P A;  1W02 A;  1AR0 A;  3MYT A;  2Y74 A;  3CC4 3;  1Q82 4;  5IG0 A;  3OW2 2;  2RFR A;  2QIY A;  4AEQ A;  2HML B;  3JUN A;  4FCZ A;  1YJ9 3;  2W0Q A;  1W7C A;  3LTC A;  4K90 B;  3F7X A;  1HKX A;  2CFD A;  2LQV A;  4STD A;  1GYB A;  2CWT A;  4KFD A;  2CFL A;  3DY5 A;  1D6Y A;  1KWI A;  3Q90 A;  2CIU A;  2CW9 A;  3CCV 3;  1FA3 A;  4AKZ A;  4HJL B;  5A0O B;  2WGO A;  3EQQ B;  3ECF A;  4OK0 A;  2W9P A;  4EC6 A;  1WNH A;  1TIJ A;  2HMO B;  3X3X A;  5BVB A;  1LOX A;  3N8B A;  2P0X A;  4R4K A;  4WYK A;  2XSH B;  4K1V A;  3SVA A;  2E2V A;  1ROA A;  2P09 A;  3BNE A;  5IEO A;  4GB5 A;  1WMN A;  2P05 A;  4EV2 A;  3N54 B;  4R9L A;  3ROB A;  3U97 A;  5CF1 A;  1O7M B;  1VQ9 3;  4LEH A;  4RNZ A;  1W00 A;  1QAF A;  4WHA A;  1OHP A;  1JB4 A;  4KFE A;  1JJ2 2;  4HM7 B;  4FMA A;  2F86 B;  2HMN B;  1AV4 A;  3X3Z A;  2GEX A;  3G71 3;  3OWY A;  2BMQ B;  1IVU A;  1M1X B;  3G16 A;  1UI7 A;  4HKV B;  1TFO A;  4XM4 A;  5FW5 A;  3LML A;  1GD3 A;  3G0K A;  3GAX A;  1IK3 A;  2GEY A;  3DGM A;  3DM8 A;  2K54 A;  1IVV A;  1OPY A;  3KKG A;  1VQK 3;  2QEX 3;  2Z76 A;  3HX8 A;  2D1W A;  3H3H A;  1QAL A;  4N6V 0;  4LSO A;  2W6J H;  3S27 A;  1LVN A;  3GZY B;  2R4I A;  1IVX A;  3LTA A;  3FLJ A;  3NX0 A;  3ALA A;  3EHC A;  3NBR A;  3M8C A;  2RCD A;  4FR9 A;  5EEO A;  4CCV A;  2F98 A;  2YFI B;  3FSD A;  1NO3 A;  3QRD A;  4J8T A;  4WYK B;  1S72 3;  4N3V A;  3UL5 A;  1SQW A;  1UI8 A;  3CCQ 3;  2XFS A;  4AKY A;  3K0Z A;  4G1M B;  2XGL A;  1AVL A;  4NHF A;  1A67 A;  3B8L A;  3OX9 A;  1OUN A;  4KZ1 A;  1JKG A;  3NBB A;  3NQZ A;  5IEP A;  2WOF A;  4HM6 B;  1OF5 A;  3BB9 A;  3GWR A;  1OAC A;  2B1X B;  2IMJ A;  1WMP A;  4XBT A;  2JQ5 A;  3BNC A;  3OXA A;  2GXF A;  2GU1 A;  4R80 A;  1K8A 4;  5JBS A;  4QWT A;  4HM1 B;  1VQ7 3;  3CCL 3;  1DVC A;  4FMD A;  4KVH A;  4LGQ A;  5CLK A;  3MHE A;  2FXT A;  2CFG A;  3PS8 A;  4N6U A;  1O7H B;  3LTB A;  2BO9 B;  3V98 A;  1AVK A;  4CDL A;  3CC7 3;  2CK3 H;  1Y4K A;  2C11 A;  4MJD A;  1EKM A;  1IV9 A;  1VQ6 3;  2OTJ 3;  3IPT A;  2CC3 A;  1IQY A;  2INX A;  3GRD A;  3RGA A;  2BNG A;  1RKY A;  3CNX A;  1ULJ B;  3UNL A;  3NXJ A;  1O7N B;  1CYU A;  3FGY A;  2W56 A;  3CPW 2;  1CYV A;  5G2G A;  3PCS A;  1KSI A;  2Z77 A;  1KQS 2;  3STD A;  1ASK A;  2KRT A;  1NB3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...