2OCTA

Stefin b (cystatin b) tetramer
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
b'MSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKSLTLSNYQTNKAKHDELTYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin B
publication title Essential role of proline isomerization in stefin B tetramer formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 15
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2octA00
3MWZA 1A67A 2BO9B 5A0OB 1FUWA 2O9UX 1IV9A 3IMAB 3PXMA 3QRDA 1LXEA 1G96A 1R4CA 4N6OB 3S67A 3KSED 3PYJA 3L0RA 2W9QA 1IV7A 4TX4A 4N6NB 1DVCA 3GAXA 2KXGA 1DVDA 2OCTA 1NB3I 5LC7A 1CEWI 1PFPA 1MOLA 5LC6A 1FA3A 1MNLA 1N9JA 4IT7A 1ROAA 1CYUA 1TIJA 3PS8A 3SVAA 2CH9A 4N6LA 1M9GA 4CCVA 4N6TA 1A90A 2W9PA 1KWIA 1STFI 3KFQC 1YVBI 1N5PA 1RN7A 3UL6A 5ELJA 4LZIA 3NX0A 4N6V0 4N6MA 3K9MC 1WNHA 1NB5I 5EQLA 4ZM8A 3LH4A 3UL5A 1CYVA 3Q2PA 4N6UA 5ELUA 1EQKA 4EYCA 1GD4A 1N5HA 1GD3A
chains in the Genus database with same CATH superfamily
3BNEA 1OHSA 1K8A4 3MWZA 1JBSA 3MYTA 1ZX2A 4LYLB 5STDA 2W03A 3EHCA 3CCL3 1IQ8A 1I0XA 4OK0A 4WFOA 5EVHA 3EQQB 1GMRA 1OACA 4G1MB 5IW9A 1UI7A 3DUKA 4H61A 2H0GA 1WMNA 4XDWA 1NJI4 4FCZA 1YJ93 5AEUB 2P09A 2OTL3 1RGEA 2F5MA 3O8YA 4IPBA 3CPW2 1I2FA 3WDGB 5D83A 1IQXA 2F4YA 2HMKB 5FW5A 3QRDA 4LEHA 4HVNA 4EV2A 1BRNL 3BB9A 4L8PA 1TRPA 1W6GA 3EBYA 1BNSA 1V58A 1VZZA 4MMXB 1G96A 1FGQA 3EB8A 3LTCA 5HOHA 3PYJA 3N54B 1ZGXA 2I9WA 4N3VA 1UCJA 5AIIA 1BRGA 1UUGB 1VQQA 4EV5A 1IV7A 1RMSA 2JQ5A 5DRVA 1A2KA 2W6JH 4FCJA 1NNVA 4FR9A 1FGRA 2CFWA 2D1WA 5IEPA 4EC6A 3CNXA 1IQYA 1A2PA 1SIHA 2KXGA 4RNZA 1IVUA 4HM0B 1DYUA 3IJEB 1VQ73 4LSOA 1GOUA 1UGIA 6STDA 4KVHA 1CEWI 2IY2A 4GL6A 3OV4A 3X3XA 5BIRA 1PFPA 5IERA 3GWRA 3BNDA 2HMJB 2RSXA 3SYUA 3G6E3 3CCR3 2CWUA 1S5AA 1SARA 3NHXA 3F7XA 1N9EA 1BRHA 3DGNA 1MNLA 4JF8A 6RNTA 4O8SA 3CU3A 3FLJA 1VQ43 3CPOA 3CXC2 1TIJA 1ZS7A 4X2OA 3CMA3 1O7PB 4OVMA 3CCM3 1X1YA 1BNFA 2C10A 2KCDA 4MMZB 3SVAA 4N6LA 1M9GA 2RNTA 3F9SA 3JUQA 4CCVA 3KN4A 2KF6A 5AIFA 1FZUA 1KWIA 1OF5A 3U1WA 3D5IA 2B24B 5AIGA 1NU3A 1YVBI 5D81A 7STDA 4GB5A 3EX9A 1LNIA 3OX9A 3D9RA 1IT8A 3CNMA 1E3RA 1US1A 2RGQA 5IG3A 1VQ63 1JJ22 3AMOA 3NBBA 1GSPA 1QAFA 4LZIA 3UL6A 4J5GA 1GYBA 2J8XB 4HM1B 2ML5A 1UUWB 1GMPA 4N6MA 1LOXA 1OH0A 4GHOA 1RGGA 2BNGA 3JUNA 2E2VA 3DY5A 4GSPA 2CFLA 2XRXB 1Q7Y4 3LTDA 1IVXA 4ORLA 4RZMA 1B21A 1RGCA 4BTYA 5CXOA 3D79A 1YI23 4XB5A 5JPPA 2GU1A 4HYZA 1O7MB 1W00A 1NDOB 1SIIA 3OWSA 1BSBA 1O7GB 3RGAA 2FNQA 1UCLA 2GSPA 1DMNA 3QK9A 1W02A 1N5HA 2GXFA 2XFSA 3CCE3 2F86B 5G1KA 1X1XA 1RGLA 1BRJA 1BNIA 1B2MA 4WP5A 3ALAA 1BNGA 1U8CB 4O2HA 2YFIB 3SX1A 3CME3 1OUNA 1JZOA 1JBTA 3WMDA 1W2ZA 1OHOA 3T8UA 1I8VA 1B2SA 1T3BA 3KZTA 4K90B 1BAOA 3PCSA 1KC84 1MWSA 3S5CA 1GY5A 1AVLA 3WODG 1KD14 1BNJA 2P05A 4I4KA 2O9UX 3N8BA 1YIJ3 1FW7A 2BT3A 1I2EA 1JRQA 3FKAA 3FSDA 1PYLA 1W6CA 1O7WB 3KE7A 3S27A 4XBTA 3K7CA 1IT7A 5RNTA 3OW22 3DMCA 2YFLB 5GSPA 3DGMA 2Y73A 5G2GA 2XEPA 3I553 1MWUA 1R4CA 1BIRA 2W04A 4LMIA 1BSCA 2KF4A 5HGRA 1TUHA 1LOWA 1L5GB 1B20A 1YJW3 1IVWA 2YX9A 3S28A 3UNLA 5KP4A 1Y4KA 1W4NA 3DGYA 1BOXA 1PU4A 1E3VA 4N6NB 4CPKA 2INXA 2F99A 1JN5B 2XH9A 4K1UA 4AEQA 1S723 2WOHA 3ZG5A 4EW5A 3GAXA 1OHPA 2RCDA 3NQYA 4KZ1A 3G713 3OWYA 3BLZA 4J9AA 2W0QA 1SPUA 3K0ZA 1R4YA 2CX1A 3UB1A 1DMMA 9RNTA 1Q814 1NB3I 3LMLA 2UX0A 1PY3A 1K28A 2Z7AA 3EJVA 4FMCA 3X3ZA 1YJN3 1MOLA 1BANA 3LOYA 1KQS2 3V98A 3D4AA 2LYXA 2STDA 3G0KA 2SBLA 4BL3A 1BSDA 1JB4A 3CC23 3CCS3 1M1XB 1UDII 1G0TA 2XSOB 1TRQA 2E2UA 2OOVA 3BIRA 3NV0B 3HX8A 1BNRA 2CFDA 1G02A 2ZDJA 3PS8A 3FF0A 1RDSA 3NM2A 4RNTA 1KSIA 7GSPA 2H0HA 4XBYA 4LGQA 2CG0A 4BTWA 3FH1A 4HM3B 3CCJ3 3KKGA 3CD63 2K0MA 5FGOA 3CC73 1D6YA 2C11A 1TP6A 2XGNA 1WMPA 1BRSA 5AEWB 1BU4A 1UCKA 3A5EA 3LZAA 3KSPA 1OGXA 1RKYA 5M19A 1HZ1A 1RHLA 5G1LA 5ELJA 3URPA 3NX0A 3GRDA 1YGWA 1Q40B 4J8TA 1V74A 3K9MC 3WOFB 4CJNA 1GOVA 3FZWA 1M1K4 1WNHA 3SOAA 1VQ83 5IG4A 2K3DA 1E97A 3LT9A 1BRKA 5EQLA 5KP3A 3M8CA 3F8HA 3UL5A 2HMNB 1IYYA 1CYVA 1D6ZA 1UI8A 2CG1A 1YGEA 1UGHI 3Q2PA 1B2XA 5CF1A 4MJDA 1TFKA 4N6UA 2D42A 3T0UA 3GZXB 5AYSC 2CK3H 3GZRA 2E2TA 4HM7B 1I2GA 3FF2A 4HAAA 1GD3A 4Q53A 3VF1A 1JNQA 1RN1A 3X41A 1RGFA 3NUVA 3IPTA 1RCLA 1B2ZA 2P38A 2B1XB 4BIRA 5JPUA 4HM8B 4BTXA 1A67A 1LQMB 1YNVX 1JV2B 1WQLB 2BO9B 2L1SA 1Q42A 5A0OB 1Q864 3EC9A 1QJGA 3AHWA 1FYSA 2CKFB 1Q9EA 1ULIB 1FUWA 5IG0A 2KRTA 3IMAB 3OWUA 1OPYA 3JUOA 3PXMA 2AAEA 3Q1CA 3GSPA 3RDEA 1RSNA 2BU4A 4WYKB 1JBRA 2GEYA 3I0YA 1T2HA 3UJMA 1LXEA 3G4S3 1A2VA 4HBRA 1K41A 2CHCA 3S67A 3F14A 1FGOA 1ULJB 2C4BA 3F7SA 3MSOA 1GY7A 2OTJ3 4PEJA 2A15A 3H51A 3GZYB 3AGNA 3G16A 1IK3A 2W56B 2ZA4A 3WA3A 4HM5B 2W9QA 4HJLB 3A76A 4CDLA 1AR0A 2V1LA 1DVCA 3B4OA 1QMAA 2OQEA 2XFTA 1BGSA 3ER7A 3JUPA 4HM4B 5BXQA 5M18A 4ILFA 3WOEB 2K54A 2F56A 1TFOA 1ZO2A 1LQGC 2LQVA 3AMOB 3MG1A 4HKVB 4AKYA 3FG4A 3MG2A 5M1AA 3CCU3 1Q824 1ROVA 3Q90A 1UCIA 1FGMA 2GEXA 1WTHA 2ZL8A 1JN5A 1LOVA 4U13A 3J7Yd 3B4PA 2IYJA 1BSEA 3LTBA 5LC6A 1BSAA 4EBGA 1RRHA 1FA3A 1MWRA 1O7NB 3V99A 3HI7A 1NWWA 4K1VA 5BU4A 1TU5A 2UGIA 2GBWB 2Q07A 3T8NA 2HOHA 1W7CA 1RGKA 5TGNA 1CYUA 1B27A 1WMOA 4IIAA 4NPBA 1W2B2 4MMYB 1N8R4 2Z76A 5DREA 1RNTA 4MEIA 1VQN3 3EE1A 2BMOB 3ZG0A 2P0MA 3HOHA 4N6TA 1VQO3 2OOVC 1A90A 3FG1A 3PCRA 3U97A 1K734 1X1WA 2AADA 3NV0A 1STFI 3KFQC 1YHQ3 1OGZA 1U5OA 2R41A 1RGHA 3F8XA 3NQZA 4K61A 4NHFA 5AYRB 7RNTA 3NBJA 1N5PA 3V92A 1JKGB 1TTOA 3MPHA 2OWPA 4R80A 3PGBA 1VQ53 3SXXA 3RNTA 3GZBA 1T5YA 4FMBA 4FMDA 2IUJA 4HM2B 2O3OA 2KAAA 3BNBA 4N6V0 3WA2X 3PZWA 1RRLA 2FXTA 4DKIA 2CIUA 1RNBA 3B8LA 5IG5A 1DETA 1LRAA 3CC43 1X1UA 3LH4A 5IEOA 2R4IA 3NXJA 1QAKA 2WGQA 3AHSA 4X2HA 4XDVA 2MF7A 1EA2A 1RCKA 2CW9A 1GY6A 1Q40A 1BUJA 3D3LA 3BNCA 1AQZA 2H0IA 3VSYA 5CLKA 3X3YA 5ELUA 3SLUA 4HZBB 5CF2A 1EQKA 2BMQB 1GMQA 4EYCA 1GD4A 3DGLA 3NBRA 1FGTA 1Z1SA 2W2CA 2XSHB 4RNYA 8CHOA 1HYFA 4R1KA 4L7KA 8RNTA 2JDIH 2PNCA 1SJWA 4HM6B 3FG3A 1ISKA 1C54A 5KP1A 1QVF2 1B2UA 3Q3FA 1I3FA 2XR8B 3DXOA 1EG9B 4KFFA 4H3UA 2IMJA 3K63A 1BNEA 3DH2A 5EEOA 1FUSA 1NO3A 3SEDA 3ZFZA 1CH0A 1J2BA 2RBIA 1CQSA 2WO0A 1IV9A 1N8QA 1EKMA 3D5GA 1MGRA 4FMAA 5AI1A 3HK4A 4STDA 1VQM3 1HKXA 1IDPA 1MWTA 3BU4A 4I5QA 2WGOA 1W6YA 1TJDA 1V57A 2GU3A 2CFGA 4N6OB 1LOYA 4R9KA 3KSED 3KIIA 3HIGA 3I563 2IUKA 3EBTA 5IF6A 4R4KA 1F8NA 2CWVA 4WYKA 1GOYA 2HMMB 4WHAA 4NREA 1C7HA 3L0RA 3NM7A 4TX4A 2MC8A 1AVKA 3MG3A 4OUQA 1BVIA 1QVG2 1YVSA 2PZVA 5CK6A 2QIYA 5BVBA 2IA7A 4HOHA 1RJOA 3WHOA 2HMOB 1FUTA 2QGUA 3SOYA 4KFEA 1DVDA 2W56A 2OCTA 2OQEC 1O7HB 5LC7A 4KFDA 1STDA 2P0XA 4O02B 4RBNA 1K9M4 2M7OA 1DE3A 2ML6A 1LVNA 3G8ZA 2GBXB 1JB5A 4FCMA 4AKZA 6GSPA 1BRIA 2Z6BA 2HMLB 1JB2A 2Z77A 4R9LA 3WR2A 4WWUC 5JBSA 3TDGA 1YIT3 1EEJA 2BHMA 2F5WA 3DZLA 3FCSB 1N9JA 3MKIA 4IT7A 2L4VA 1OF5B 1ROAA 3K5TA 1VQL3 3HIIA 2CWTA 4HZ9B 4O3VA 3CCQ3 4L8OA 1I3IA 2BMRB 2KF5A 4BL2A 4JRFA 1I0VA 2CH9A 1LNHA 1RN4A 1MGWA 3FGYA 5AIHA 3DGOA 1VQP3 3EN8A 2SARA 3N9HA 2W9PA 3STDA 1VQ93 2BIRA 3RGRA 3B7CA 3JVCA 3X42A 3HZPA 3CCV3 1OCVA 1RN7A 2CX0A 1IU7A 1VQK3 3E99A 3EN1B 1DMQA 2FGTA 1RTUA 1EUIC 1UUVB 1QALA 2UUGC 1RLSA 1D6UA 1W01A 3DM8A 3ECFA 3LXUX 2CFKA 3VGNA 2RFRA 4EXRA 1BUQA 4XBXA 1M904 2XGLA 2KF3A 2XF3A 4J5KA 1NB5I 1UW1A 1JKGA 2ZHXB 3AGOA 3F40A 4KT3B 3H3HA 4ZM8A 3KCHA 1T2IA 1SQWA 1W5ZA 2WOFA 1Q7HA 3OXAA 5IENA 1ASKA 2F98A 2YFJB 3LTAA 3LYGA 4BU4A 3JUMA 3EF8A 2QEX3 1HU9A 4QWTA 1AY7A 1I70A 5D82A 5I97A 3S29A 2QA43 3MHEA 1RGAA 3LT8A 2Y74A 1JZDA 3ROBA 1IVVA 4XM4A 2CC3A 1GS3A 3X40A 1AV4A 1B3SA
chains in the Genus database with same CATH topology
3BNEA 1OHSA 1K8A4 3MWZA 3MYTA 1ZX2A 5STDA 2W03A 3EHCA 3CCL3 1IQ8A 4OK0A 4WFOA 5EVHA 3EQQB 1OACA 5IW9A 4G1MB 1UI7A 3DUKA 4H61A 4XDWA 1WMNA 1NJI4 4FCZA 1YJ93 5AEUB 2P09A 2OTL3 3O8YA 4IPBA 3CPW2 3WDGB 5D83A 1IQXA 2HMKB 5FW5A 4EV2A 3QRDA 4LEHA 4HVNA 3BB9A 4L8PA 1W6GA 3EBYA 1VZZA 4MMXB 1G96A 1FGQA 3EB8A 3LTCA 3PYJA 3N54B 2I9WA 4N3VA 4EV5A 5AIIA 1IV7A 2JQ5A 5DRVA 1A2KA 2W6JH 4FCJA 4FR9A 1FGRA 2CFWA 2D1WA 5IEPA 4EC6A 3CNXA 1IQYA 1SIHA 2KXGA 4RNZA 1IVUA 4HM0B 1DYUA 3IJEB 1VQ73 4LSOA 6STDA 4KVHA 1CEWI 4GL6A 3OV4A 3X3XA 1PFPA 5IERA 3GWRA 3BNDA 2HMJB 2RSXA 3G6E3 3CCR3 2CWUA 1S5AA 3NHXA 3F7XA 1N9EA 3DGNA 1MNLA 4JF8A 4O8SA 3CU3A 3FLJA 1VQ43 3CPOA 3CXC2 1TIJA 4X2OA 3CMA3 1O7PB 4OVMA 3CCM3 2C10A 2KCDA 4MMZB 3SVAA 4N6LA 1M9GA 3F9SA 3JUQA 4CCVA 5AIFA 1KWIA 1OF5A 3U1WA 2B24B 5AIGA 1NU3A 1YVBI 5D81A 7STDA 4GB5A 3EX9A 3OX9A 3D9RA 1IT8A 3CNMA 1E3RA 1US1A 2RGQA 5IG3A 1VQ63 1JJ22 3AMOA 3NBBA 1QAFA 3UL6A 4LZIA 1GYBA 4HM1B 2ML5A 1UUWB 4N6MA 1LOXA 1OH0A 2BNGA 3JUNA 2E2VA 3DY5A 2CFLA 2XRXB 1Q7Y4 3LTDA 1IVXA 4ORLA 4RZMA 4BTYA 5CXOA 1YI23 4XB5A 5JPPA 2GU1A 4HYZA 1O7MB 1W00A 1NDOB 1SIIA 3OWSA 3RGAA 1O7GB 2FNQA 3QK9A 1DMNA 1W02A 1N5HA 2GXFA 2XFSA 3CCE3 2F86B 4WP5A 3ALAA 3SX1A 1U8CB 4O2HA 2YFIB 3CME3 1OUNA 3WMDA 1W2ZA 1OHOA 3T8UA 3KZTA 4K90B 3PCSA 1KC84 3S5CA 1GY5A 1AVLA 3WODG 1KD14 4I4KA 2P05A 2O9UX 3N8BA 1YIJ3 2BT3A 1JRQA 3FKAA 3FSDA 1W6CA 1O7WB 3KE7A 3S27A 4XBTA 3K7CA 1IT7A 3OW22 3DMCA 2YFLB 3DGMA 2Y73A 5G2GA 2XEPA 3I553 1R4CA 2W04A 4LMIA 5HGRA 1TUHA 1L5GB 1YJW3 1IVWA 2YX9A 3S28A 3UNLA 5KP4A 1Y4KA 1W4NA 1PU4A 1E3VA 4N6NB 2INXA 2F99A 1JN5B 2XH9A 4K1UA 4AEQA 1S723 2WOHA 3GAXA 1OHPA 2RCDA 3NQYA 4KZ1A 3G713 3OWYA 3BLZA 4J9AA 2W0QA 1SPUA 3K0ZA 3UB1A 1DMMA 1Q814 1NB3I 3LMLA 2UX0A 2Z7AA 1K28A 3EJVA 4FMCA 3X3ZA 1YJN3 1MOLA 1KQS2 3LOYA 3V98A 3G0KA 2LYXA 2STDA 2SBLA 1JB4A 3CC23 3CCS3 1M1XB 2XSOB 2E2UA 2OOVA 3NV0B 3HX8A 2CFDA 2ZDJA 3PS8A 3FF0A 3NM2A 1KSIA 4XBYA 4LGQA 2CG0A 4BTWA 3FH1A 4HM3B 3CCJ3 3KKGA 3CD63 2K0MA 5FGOA 3CC73 1D6YA 2C11A 1TP6A 2XGNA 1WMPA 5AEWB 3LZAA 3KSPA 1OGXA 1RKYA 5ELJA 3NX0A 3GRDA 1Q40B 4J8TA 1V74A 3K9MC 3WOFB 3FZWA 1M1K4 1WNHA 3SOAA 1VQ83 5IG4A 3LT9A 1E97A 5EQLA 5KP3A 3M8CA 3F8HA 3UL5A 2HMNB 1CYVA 1D6ZA 1UI8A 2CG1A 1YGEA 3Q2PA 5CF1A 4MJDA 1TFKA 4N6UA 2D42A 3T0UA 3GZXB 5AYSC 2CK3H 3GZRA 2E2TA 4HM7B 3FF2A 1GD3A 4Q53A 3VF1A 1JNQA 3X41A 3NUVA 3IPTA 2P38A 5JPUA 2B1XB 4HM8B 4BTXA 1A67A 1JV2B 1WQLB 2BO9B 1Q42A 5A0OB 1Q864 3EC9A 1QJGA 2CKFB 1FUWA 1ULIB 5IG0A 2KRTA 3IMAB 3OWUA 1OPYA 3JUOA 3PXMA 3Q1CA 3RDEA 3CCQ3 4WYKB 2GEYA 3I0YA 3UJMA 1LXEA 3G4S3 1A2VA 4HBRA 1K41A 2CHCA 3S67A 3F14A 1FGOA 1ULJB 3F7SA 3MSOA 1GY7A 2OTJ3 4PEJA 2A15A 3H51A 3GZYB 3G16A 1IK3A 2W56B 3WA3A 4HM5B 2W9QA 4HJLB 3A76A 4CDLA 2V1LA 1AR0A 1DVCA 3B4OA 1QMAA 2OQEA 2XFTA 3ER7A 3JUPA 4HM4B 5BXQA 3WOEB 2K54A 2LQVA 1TFOA 1ZO2A 3AMOB 3MG1A 4HKVB 4AKYA 3FG4A 3MG2A 1Q824 3CCU3 1ROVA 3Q90A 2ZL8A 1FGMA 1WTHA 2GEXA 1JN5A 3J7Yd 4U13A 3B4PA 3LTBA 5LC6A 4EBGA 1RRHA 1FA3A 1O7NB 3V99A 3HI7A 1NWWA 4K1VA 1TU5A 2GBWB 2Q07A 3T8NA 1W7CA 5TGNA 1CYUA 1WMOA 4IIAA 1W2B2 4MMYB 1N8R4 2Z76A 5DREA 4MEIA 1VQN3 3EE1A 2BMOB 2P0MA 4N6TA 1VQO3 2OOVC 1A90A 3FG1A 3PCRA 3U97A 1K734 3NV0A 1STFI 3KFQC 1YHQ3 1OGZA 1U5OA 3F8XA 3NQZA 5AYRB 4K61A 4NHFA 3NBJA 1N5PA 3V92A 1JKGB 3MPHA 2OWPA 4R80A 3PGBA 1VQ53 3SXXA 3GZBA 1T5YA 4FMBA 2IUJA 4HM2B 2O3OA 3BNBA 4N6V0 3WA2X 3PZWA 1RRLA 2FXTA 2CIUA 3B8LA 5IG5A 3CC43 3LH4A 5IEOA 2R4IA 3NXJA 1QAKA 2WGQA 4X2HA 4XDVA 2MF7A 1EA2A 2CW9A 1GY6A 1Q40A 3D3LA 3BNCA 3VSYA 5CLKA 3X3YA 5ELUA 3SLUA 4HZBB 5CF2A 1EQKA 2BMQB 4EYCA 1GD4A 3DGLA 3NBRA 1FGTA 1Z1SA 2W2CA 2XSHB 4RNYA 8CHOA 4R1KA 4L7KA 2JDIH 2PNCA 1SJWA 4HM6B 3FG3A 1ISKA 5KP1A 1QVF2 2XR8B 3DXOA 1EG9B 4KFFA 4H3UA 2IMJA 3K63A 5EEOA 1NO3A 3SEDA 1J2BA 1CQSA 2WO0A 1IV9A 1N8QA 1EKMA 5AI1A 4FMAA 3HK4A 4STDA 1VQM3 1HKXA 1IDPA 2WGOA 1W6YA 2GU3A 2CFGA 4N6OB 4R9KA 3KSED 3KIIA 3HIGA 3I563 2IUKA 3EBTA 5IF6A 4R4KA 1F8NA 2CWVA 4WYKA 2HMMB 4WHAA 4NREA 1C7HA 3L0RA 3NM7A 4TX4A 2MC8A 1AVKA 3MG3A 4OUQA 1QVG2 2PZVA 5CK6A 2QIYA 5BVBA 2IA7A 1RJOA 2HMOB 2QGUA 3SOYA 4KFEA 1DVDA 2W56A 2OCTA 2OQEC 1O7HB 5LC7A 4KFDA 1STDA 2P0XA 4O02B 4RBNA 1K9M4 2M7OA 2ML6A 1LVNA 3G8ZA 2GBXB 1JB5A 4FCMA 4AKZA 2Z6BA 2HMLB 1JB2A 2Z77A 4R9LA 4WWUC 5JBSA 3TDGA 1YIT3 2BHMA 3DZLA 3FCSB 1N9JA 3MKIA 4IT7A 2L4VA 1OF5B 1ROAA 3K5TA 1VQL3 3HIIA 2CWTA 4HZ9B 4O3VA 4L8OA 2BMRB 4JRFA 2CH9A 1LNHA 3FGYA 5AIHA 3DGOA 1VQP3 3EN8A 3N9HA 2W9PA 3STDA 1VQ93 3RGRA 3B7CA 3JVCA 3X42A 3HZPA 3CCV3 1OCVA 1RN7A 1IU7A 1VQK3 3E99A 3EN1B 1DMQA 2FGTA 1UUVB 3KN4A 3DM8A 1QALA 3LXUX 1D6UA 1W01A 3ECFA 3VGNA 1BUQA 2CFKA 2RFRA 4EXRA 4XBXA 1M904 2XGLA 2XF3A 1NB5I 1UW1A 1JKGA 3F40A 4ZM8A 3H3HA 1SQWA 1W5ZA 2WOFA 3OXAA 5IENA 1ASKA 2F98A 2YFJB 3LTAA 3LYGA 3JUMA 3EF8A 2QEX3 1HU9A 4QWTA 5D82A 5I97A 3S29A 2QA43 3MHEA 3LT8A 2Y74A 3ROBA 1IVVA 4XM4A 2CC3A 1GS3A 3X40A 1AV4A 4FMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MWZ A;  1A67 A;  2BO9 B;  5A0O B;  1FUW A;  2O9U X;  1IV9 A;  3IMA B;  3PXM A;  3QRD A;  1LXE A;  1G96 A;  1R4C A;  4N6O B;  3S67 A;  3KSE D;  3PYJ A;  3L0R A;  2W9Q A;  1IV7 A;  4TX4 A;  4N6N B;  1DVC A;  3GAX A;  2KXG A;  1DVD A;  2OCT A;  1NB3 I;  5LC7 A;  1CEW I;  1PFP A;  1MOL A;  5LC6 A;  1FA3 A;  1MNL A;  1N9J A;  4IT7 A;  1ROA A;  1CYU A;  1TIJ A;  3PS8 A;  3SVA A;  2CH9 A;  4N6L A;  1M9G A;  4CCV A;  4N6T A;  1A90 A;  2W9P A;  1KWI A;  1STF I;  3KFQ C;  1YVB I;  1N5P A;  1RN7 A;  3UL6 A;  5ELJ A;  4LZI A;  3NX0 A;  4N6V 0;  4N6M A;  3K9M C;  1WNH A;  1NB5 I;  5EQL A;  4ZM8 A;  3LH4 A;  3UL5 A;  1CYV A;  3Q2P A;  4N6U A;  5ELU A;  1EQK A;  4EYC A;  1GD4 A;  1N5H A;  1GD3 A; 
#chains in the Genus database with same CATH topology
 3BNE A;  1OHS A;  1K8A 4;  3MWZ A;  1JBS A;  3MYT A;  1ZX2 A;  4LYL B;  5STD A;  2W03 A;  3EHC A;  3CCL 3;  1IQ8 A;  1I0X A;  4OK0 A;  4WFO A;  5EVH A;  3EQQ B;  1GMR A;  1OAC A;  4G1M B;  5IW9 A;  1UI7 A;  3DUK A;  4H61 A;  2H0G A;  1WMN A;  4XDW A;  1NJI 4;  4FCZ A;  1YJ9 3;  5AEU B;  2P09 A;  2OTL 3;  1RGE A;  2F5M A;  3O8Y A;  4IPB A;  3CPW 2;  1I2F A;  3WDG B;  5D83 A;  1IQX A;  2F4Y A;  2HMK B;  5FW5 A;  3QRD A;  4LEH A;  4HVN A;  4EV2 A;  1BRN L;  3BB9 A;  4L8P A;  1TRP A;  1W6G A;  3EBY A;  1BNS A;  1V58 A;  1VZZ A;  4MMX B;  1G96 A;  1FGQ A;  3EB8 A;  3LTC A;  5HOH A;  3PYJ A;  3N54 B;  1ZGX A;  2I9W A;  4N3V A;  1UCJ A;  5AII A;  1BRG A;  1UUG B;  1VQQ A;  4EV5 A;  1IV7 A;  1RMS A;  2JQ5 A;  5DRV A;  1A2K A;  2W6J H;  4FCJ A;  1NNV A;  4FR9 A;  1FGR A;  2CFW A;  2D1W A;  5IEP A;  4EC6 A;  3CNX A;  1IQY A;  1A2P A;  1SIH A;  2KXG A;  4RNZ A;  1IVU A;  4HM0 B;  1DYU A;  3IJE B;  1VQ7 3;  4LSO A;  1GOU A;  1UGI A;  6STD A;  4KVH A;  1CEW I;  2IY2 A;  4GL6 A;  3OV4 A;  3X3X A;  5BIR A;  1PFP A;  5IER A;  3GWR A;  3BND A;  2HMJ B;  2RSX A;  3SYU A;  3G6E 3;  3CCR 3;  2CWU A;  1S5A A;  1SAR A;  3NHX A;  3F7X A;  1N9E A;  1BRH A;  3DGN A;  1MNL A;  4JF8 A;  6RNT A;  4O8S A;  3CU3 A;  3FLJ A;  1VQ4 3;  3CPO A;  3CXC 2;  1TIJ A;  1ZS7 A;  4X2O A;  3CMA 3;  1O7P B;  4OVM A;  3CCM 3;  1X1Y A;  1BNF A;  2C10 A;  2KCD A;  4MMZ B;  3SVA A;  4N6L A;  1M9G A;  2RNT A;  3F9S A;  3JUQ A;  4CCV A;  3KN4 A;  2KF6 A;  5AIF A;  1FZU A;  1KWI A;  1OF5 A;  3U1W A;  3D5I A;  2B24 B;  5AIG A;  1NU3 A;  1YVB I;  5D81 A;  7STD A;  4GB5 A;  3EX9 A;  1LNI A;  3OX9 A;  3D9R A;  1IT8 A;  3CNM A;  1E3R A;  1US1 A;  2RGQ A;  5IG3 A;  1VQ6 3;  1JJ2 2;  3AMO A;  3NBB A;  1GSP A;  1QAF A;  4LZI A;  3UL6 A;  4J5G A;  1GYB A;  2J8X B;  4HM1 B;  2ML5 A;  1UUW B;  1GMP A;  4N6M A;  1LOX A;  1OH0 A;  4GHO A;  1RGG A;  2BNG A;  3JUN A;  2E2V A;  3DY5 A;  4GSP A;  2CFL A;  2XRX B;  1Q7Y 4;  3LTD A;  1IVX A;  4ORL A;  4RZM A;  1B21 A;  1RGC A;  4BTY A;  5CXO A;  3D79 A;  1YI2 3;  4XB5 A;  5JPP A;  2GU1 A;  4HYZ A;  1O7M B;  1W00 A;  1NDO B;  1SII A;  3OWS A;  1BSB A;  1O7G B;  3RGA A;  2FNQ A;  1UCL A;  2GSP A;  1DMN A;  3QK9 A;  1W02 A;  1N5H A;  2GXF A;  2XFS A;  3CCE 3;  2F86 B;  5G1K A;  1X1X A;  1RGL A;  1BRJ A;  1BNI A;  1B2M A;  4WP5 A;  3ALA A;  1BNG A;  1U8C B;  4O2H A;  2YFI B;  3SX1 A;  3CME 3;  1OUN A;  1JZO A;  1JBT A;  3WMD A;  1W2Z A;  1OHO A;  3T8U A;  1I8V A;  1B2S A;  1T3B A;  3KZT A;  4K90 B;  1BAO A;  3PCS A;  1KC8 4;  1MWS A;  3S5C A;  1GY5 A;  1AVL A;  3WOD G;  1KD1 4;  1BNJ A;  2P05 A;  4I4K A;  2O9U X;  3N8B A;  1YIJ 3;  1FW7 A;  2BT3 A;  1I2E A;  1JRQ A;  3FKA A;  3FSD A;  1PYL A;  1W6C A;  1O7W B;  3KE7 A;  3S27 A;  4XBT A;  3K7C A;  1IT7 A;  5RNT A;  3OW2 2;  3DMC A;  2YFL B;  5GSP A;  3DGM A;  2Y73 A;  5G2G A;  2XEP A;  3I55 3;  1MWU A;  1R4C A;  1BIR A;  2W04 A;  4LMI A;  1BSC A;  2KF4 A;  5HGR A;  1TUH A;  1LOW A;  1L5G B;  1B20 A;  1YJW 3;  1IVW A;  2YX9 A;  3S28 A;  3UNL A;  5KP4 A;  1Y4K A;  1W4N A;  3DGY A;  1BOX A;  1PU4 A;  1E3V A;  4N6N B;  4CPK A;  2INX A;  2F99 A;  1JN5 B;  2XH9 A;  4K1U A;  4AEQ A;  1S72 3;  2WOH A;  3ZG5 A;  4EW5 A;  3GAX A;  1OHP A;  2RCD A;  3NQY A;  4KZ1 A;  3G71 3;  3OWY A;  3BLZ A;  4J9A A;  2W0Q A;  1SPU A;  3K0Z A;  1R4Y A;  2CX1 A;  3UB1 A;  1DMM A;  9RNT A;  1Q81 4;  1NB3 I;  3LML A;  2UX0 A;  1PY3 A;  1K28 A;  2Z7A A;  3EJV A;  4FMC A;  3X3Z A;  1YJN 3;  1MOL A;  1BAN A;  3LOY A;  1KQS 2;  3V98 A;  3D4A A;  2LYX A;  2STD A;  3G0K A;  2SBL A;  4BL3 A;  1BSD A;  1JB4 A;  3CC2 3;  3CCS 3;  1M1X B;  1UDI I;  1G0T A;  2XSO B;  1TRQ A;  2E2U A;  2OOV A;  3BIR A;  3NV0 B;  3HX8 A;  1BNR A;  2CFD A;  1G02 A;  2ZDJ A;  3PS8 A;  3FF0 A;  1RDS A;  3NM2 A;  4RNT A;  1KSI A;  7GSP A;  2H0H A;  4XBY A;  4LGQ A;  2CG0 A;  4BTW A;  3FH1 A;  4HM3 B;  3CCJ 3;  3KKG A;  3CD6 3;  2K0M A;  5FGO A;  3CC7 3;  1D6Y A;  2C11 A;  1TP6 A;  2XGN A;  1WMP A;  1BRS A;  5AEW B;  1BU4 A;  1UCK A;  3A5E A;  3LZA A;  3KSP A;  1OGX A;  1RKY A;  5M19 A;  1HZ1 A;  1RHL A;  5G1L A;  5ELJ A;  3URP A;  3NX0 A;  3GRD A;  1YGW A;  1Q40 B;  4J8T A;  1V74 A;  3K9M C;  3WOF B;  4CJN A;  1GOV A;  3FZW A;  1M1K 4;  1WNH A;  3SOA A;  1VQ8 3;  5IG4 A;  2K3D A;  1E97 A;  3LT9 A;  1BRK A;  5EQL A;  5KP3 A;  3M8C A;  3F8H A;  3UL5 A;  2HMN B;  1IYY A;  1CYV A;  1D6Z A;  1UI8 A;  2CG1 A;  1YGE A;  1UGH I;  3Q2P A;  1B2X A;  5CF1 A;  4MJD A;  1TFK A;  4N6U A;  2D42 A;  3T0U A;  3GZX B;  5AYS C;  2CK3 H;  3GZR A;  2E2T A;  4HM7 B;  1I2G A;  3FF2 A;  4HAA A;  1GD3 A;  4Q53 A;  3VF1 A;  1JNQ A;  1RN1 A;  3X41 A;  1RGF A;  3NUV A;  3IPT A;  1RCL A;  1B2Z A;  2P38 A;  2B1X B;  4BIR A;  5JPU A;  4HM8 B;  4BTX A;  1A67 A;  1LQM B;  1YNV X;  1JV2 B;  1WQL B;  2BO9 B;  2L1S A;  1Q42 A;  5A0O B;  1Q86 4;  3EC9 A;  1QJG A;  3AHW A;  1FYS A;  2CKF B;  1Q9E A;  1ULI B;  1FUW A;  5IG0 A;  2KRT A;  3IMA B;  3OWU A;  1OPY A;  3JUO A;  3PXM A;  2AAE A;  3Q1C A;  3GSP A;  3RDE A;  1RSN A;  2BU4 A;  4WYK B;  1JBR A;  2GEY A;  3I0Y A;  1T2H A;  3UJM A;  1LXE A;  3G4S 3;  1A2V A;  4HBR A;  1K41 A;  2CHC A;  3S67 A;  3F14 A;  1FGO A;  1ULJ B;  2C4B A;  3F7S A;  3MSO A;  1GY7 A;  2OTJ 3;  4PEJ A;  2A15 A;  3H51 A;  3GZY B;  3AGN A;  3G16 A;  1IK3 A;  2W56 B;  2ZA4 A;  3WA3 A;  4HM5 B;  2W9Q A;  4HJL B;  3A76 A;  4CDL A;  1AR0 A;  2V1L A;  1DVC A;  3B4O A;  1QMA A;  2OQE A;  2XFT A;  1BGS A;  3ER7 A;  3JUP A;  4HM4 B;  5BXQ A;  5M18 A;  4ILF A;  3WOE B;  2K54 A;  2F56 A;  1TFO A;  1ZO2 A;  1LQG C;  2LQV A;  3AMO B;  3MG1 A;  4HKV B;  4AKY A;  3FG4 A;  3MG2 A;  5M1A A;  3CCU 3;  1Q82 4;  1ROV A;  3Q90 A;  1UCI A;  1FGM A;  2GEX A;  1WTH A;  2ZL8 A;  1JN5 A;  1LOV A;  4U13 A;  3J7Y d;  3B4P A;  2IYJ A;  1BSE A;  3LTB A;  5LC6 A;  1BSA A;  4EBG A;  1RRH A;  1FA3 A;  1MWR A;  1O7N B;  3V99 A;  3HI7 A;  1NWW A;  4K1V A;  5BU4 A;  1TU5 A;  2UGI A;  2GBW B;  2Q07 A;  3T8N A;  2HOH A;  1W7C A;  1RGK A;  5TGN A;  1CYU A;  1B27 A;  1WMO A;  4IIA A;  4NPB A;  1W2B 2;  4MMY B;  1N8R 4;  2Z76 A;  5DRE A;  1RNT A;  4MEI A;  1VQN 3;  3EE1 A;  2BMO B;  3ZG0 A;  2P0M A;  3HOH A;  4N6T A;  1VQO 3;  2OOV C;  1A90 A;  3FG1 A;  3PCR A;  3U97 A;  1K73 4;  1X1W A;  2AAD A;  3NV0 A;  1STF I;  3KFQ C;  1YHQ 3;  1OGZ A;  1U5O A;  2R41 A;  1RGH A;  3F8X A;  3NQZ A;  4K61 A;  4NHF A;  5AYR B;  7RNT A;  3NBJ A;  1N5P A;  3V92 A;  1JKG B;  1TTO A;  3MPH A;  2OWP A;  4R80 A;  3PGB A;  1VQ5 3;  3SXX A;  3RNT A;  3GZB A;  1T5Y A;  4FMB A;  4FMD A;  2IUJ A;  4HM2 B;  2O3O A;  2KAA A;  3BNB A;  4N6V 0;  3WA2 X;  3PZW A;  1RRL A;  2FXT A;  4DKI A;  2CIU A;  1RNB A;  3B8L A;  5IG5 A;  1DET A;  1LRA A;  3CC4 3;  1X1U A;  3LH4 A;  5IEO A;  2R4I A;  3NXJ A;  1QAK A;  2WGQ A;  3AHS A;  4X2H A;  4XDV A;  2MF7 A;  1EA2 A;  1RCK A;  2CW9 A;  1GY6 A;  1Q40 A;  1BUJ A;  3D3L A;  3BNC A;  1AQZ A;  2H0I A;  3VSY A;  5CLK A;  3X3Y A;  5ELU A;  3SLU A;  4HZB B;  5CF2 A;  1EQK A;  2BMQ B;  1GMQ A;  4EYC A;  1GD4 A;  3DGL A;  3NBR A;  1FGT A;  1Z1S A;  2W2C A;  2XSH B;  4RNY A;  8CHO A;  1HYF A;  4R1K A;  4L7K A;  8RNT A;  2JDI H;  2PNC A;  1SJW A;  4HM6 B;  3FG3 A;  1ISK A;  1C54 A;  5KP1 A;  1QVF 2;  1B2U A;  3Q3F A;  1I3F A;  2XR8 B;  3DXO A;  1EG9 B;  4KFF A;  4H3U A;  2IMJ A;  3K63 A;  1BNE A;  3DH2 A;  5EEO A;  1FUS A;  1NO3 A;  3SED A;  3ZFZ A;  1CH0 A;  1J2B A;  2RBI A;  1CQS A;  2WO0 A;  1IV9 A;  1N8Q A;  1EKM A;  3D5G A;  1MGR A;  4FMA A;  5AI1 A;  3HK4 A;  4STD A;  1VQM 3;  1HKX A;  1IDP A;  1MWT A;  3BU4 A;  4I5Q A;  2WGO A;  1W6Y A;  1TJD A;  1V57 A;  2GU3 A;  2CFG A;  4N6O B;  1LOY A;  4R9K A;  3KSE D;  3KII A;  3HIG A;  3I56 3;  2IUK A;  3EBT A;  5IF6 A;  4R4K A;  1F8N A;  2CWV A;  4WYK A;  1GOY A;  2HMM B;  4WHA A;  4NRE A;  1C7H A;  3L0R A;  3NM7 A;  4TX4 A;  2MC8 A;  1AVK A;  3MG3 A;  4OUQ A;  1BVI A;  1QVG 2;  1YVS A;  2PZV A;  5CK6 A;  2QIY A;  5BVB A;  2IA7 A;  4HOH A;  1RJO A;  3WHO A;  2HMO B;  1FUT A;  2QGU A;  3SOY A;  4KFE A;  1DVD A;  2W56 A;  2OCT A;  2OQE C;  1O7H B;  5LC7 A;  4KFD A;  1STD A;  2P0X A;  4O02 B;  4RBN A;  1K9M 4;  2M7O A;  1DE3 A;  2ML6 A;  1LVN A;  3G8Z A;  2GBX B;  1JB5 A;  4FCM A;  4AKZ A;  6GSP A;  1BRI A;  2Z6B A;  2HML B;  1JB2 A;  2Z77 A;  4R9L A;  3WR2 A;  4WWU C;  5JBS A;  3TDG A;  1YIT 3;  1EEJ A;  2BHM A;  2F5W A;  3DZL A;  3FCS B;  1N9J A;  3MKI A;  4IT7 A;  2L4V A;  1OF5 B;  1ROA A;  3K5T A;  1VQL 3;  3HII A;  2CWT A;  4HZ9 B;  4O3V A;  3CCQ 3;  4L8O A;  1I3I A;  2BMR B;  2KF5 A;  4BL2 A;  4JRF A;  1I0V A;  2CH9 A;  1LNH A;  1RN4 A;  1MGW A;  3FGY A;  5AIH A;  3DGO A;  1VQP 3;  3EN8 A;  2SAR A;  3N9H A;  2W9P A;  3STD A;  1VQ9 3;  2BIR A;  3RGR A;  3B7C A;  3JVC A;  3X42 A;  3HZP A;  3CCV 3;  1OCV A;  1RN7 A;  2CX0 A;  1IU7 A;  1VQK 3;  3E99 A;  3EN1 B;  1DMQ A;  2FGT A;  1RTU A;  1EUI C;  1UUV B;  1QAL A;  2UUG C;  1RLS A;  1D6U A;  1W01 A;  3DM8 A;  3ECF A;  3LXU X;  2CFK A;  3VGN A;  2RFR A;  4EXR A;  1BUQ A;  4XBX A;  1M90 4;  2XGL A;  2KF3 A;  2XF3 A;  4J5K A;  1NB5 I;  1UW1 A;  1JKG A;  2ZHX B;  3AGO A;  3F40 A;  4KT3 B;  3H3H A;  4ZM8 A;  3KCH A;  1T2I A;  1SQW A;  1W5Z A;  2WOF A;  1Q7H A;  3OXA A;  5IEN A;  1ASK A;  2F98 A;  2YFJ B;  3LTA A;  3LYG A;  4BU4 A;  3JUM A;  3EF8 A;  2QEX 3;  1HU9 A;  4QWT A;  1AY7 A;  1I70 A;  5D82 A;  5I97 A;  3S29 A;  2QA4 3;  3MHE A;  1RGA A;  3LT8 A;  2Y74 A;  1JZD A;  3ROB A;  1IVV A;  4XM4 A;  2CC3 A;  1GS3 A;  3X40 A;  1AV4 A;  1B3S A; 
#chains in the Genus database with same CATH homology
 3BNE A;  1OHS A;  1K8A 4;  3MWZ A;  3MYT A;  1ZX2 A;  5STD A;  2W03 A;  3EHC A;  3CCL 3;  1IQ8 A;  4OK0 A;  4WFO A;  5EVH A;  3EQQ B;  1OAC A;  5IW9 A;  4G1M B;  1UI7 A;  3DUK A;  4H61 A;  4XDW A;  1WMN A;  1NJI 4;  4FCZ A;  1YJ9 3;  5AEU B;  2P09 A;  2OTL 3;  3O8Y A;  4IPB A;  3CPW 2;  3WDG B;  5D83 A;  1IQX A;  2HMK B;  5FW5 A;  4EV2 A;  3QRD A;  4LEH A;  4HVN A;  3BB9 A;  4L8P A;  1W6G A;  3EBY A;  1VZZ A;  4MMX B;  1G96 A;  1FGQ A;  3EB8 A;  3LTC A;  3PYJ A;  3N54 B;  2I9W A;  4N3V A;  4EV5 A;  5AII A;  1IV7 A;  2JQ5 A;  5DRV A;  1A2K A;  2W6J H;  4FCJ A;  4FR9 A;  1FGR A;  2CFW A;  2D1W A;  5IEP A;  4EC6 A;  3CNX A;  1IQY A;  1SIH A;  2KXG A;  4RNZ A;  1IVU A;  4HM0 B;  1DYU A;  3IJE B;  1VQ7 3;  4LSO A;  6STD A;  4KVH A;  1CEW I;  4GL6 A;  3OV4 A;  3X3X A;  1PFP A;  5IER A;  3GWR A;  3BND A;  2HMJ B;  2RSX A;  3G6E 3;  3CCR 3;  2CWU A;  1S5A A;  3NHX A;  3F7X A;  1N9E A;  3DGN A;  1MNL A;  4JF8 A;  4O8S A;  3CU3 A;  3FLJ A;  1VQ4 3;  3CPO A;  3CXC 2;  1TIJ A;  4X2O A;  3CMA 3;  1O7P B;  4OVM A;  3CCM 3;  2C10 A;  2KCD A;  4MMZ B;  3SVA A;  4N6L A;  1M9G A;  3F9S A;  3JUQ A;  4CCV A;  5AIF A;  1KWI A;  1OF5 A;  3U1W A;  2B24 B;  5AIG A;  1NU3 A;  1YVB I;  5D81 A;  7STD A;  4GB5 A;  3EX9 A;  3OX9 A;  3D9R A;  1IT8 A;  3CNM A;  1E3R A;  1US1 A;  2RGQ A;  5IG3 A;  1VQ6 3;  1JJ2 2;  3AMO A;  3NBB A;  1QAF A;  3UL6 A;  4LZI A;  1GYB A;  4HM1 B;  2ML5 A;  1UUW B;  4N6M A;  1LOX A;  1OH0 A;  2BNG A;  3JUN A;  2E2V A;  3DY5 A;  2CFL A;  2XRX B;  1Q7Y 4;  3LTD A;  1IVX A;  4ORL A;  4RZM A;  4BTY A;  5CXO A;  1YI2 3;  4XB5 A;  5JPP A;  2GU1 A;  4HYZ A;  1O7M B;  1W00 A;  1NDO B;  1SII A;  3OWS A;  3RGA A;  1O7G B;  2FNQ A;  3QK9 A;  1DMN A;  1W02 A;  1N5H A;  2GXF A;  2XFS A;  3CCE 3;  2F86 B;  4WP5 A;  3ALA A;  3SX1 A;  1U8C B;  4O2H A;  2YFI B;  3CME 3;  1OUN A;  3WMD A;  1W2Z A;  1OHO A;  3T8U A;  3KZT A;  4K90 B;  3PCS A;  1KC8 4;  3S5C A;  1GY5 A;  1AVL A;  3WOD G;  1KD1 4;  4I4K A;  2P05 A;  2O9U X;  3N8B A;  1YIJ 3;  2BT3 A;  1JRQ A;  3FKA A;  3FSD A;  1W6C A;  1O7W B;  3KE7 A;  3S27 A;  4XBT A;  3K7C A;  1IT7 A;  3OW2 2;  3DMC A;  2YFL B;  3DGM A;  2Y73 A;  5G2G A;  2XEP A;  3I55 3;  1R4C A;  2W04 A;  4LMI A;  5HGR A;  1TUH A;  1L5G B;  1YJW 3;  1IVW A;  2YX9 A;  3S28 A;  3UNL A;  5KP4 A;  1Y4K A;  1W4N A;  1PU4 A;  1E3V A;  4N6N B;  2INX A;  2F99 A;  1JN5 B;  2XH9 A;  4K1U A;  4AEQ A;  1S72 3;  2WOH A;  3GAX A;  1OHP A;  2RCD A;  3NQY A;  4KZ1 A;  3G71 3;  3OWY A;  3BLZ A;  4J9A A;  2W0Q A;  1SPU A;  3K0Z A;  3UB1 A;  1DMM A;  1Q81 4;  1NB3 I;  3LML A;  2UX0 A;  2Z7A A;  1K28 A;  3EJV A;  4FMC A;  3X3Z A;  1YJN 3;  1MOL A;  1KQS 2;  3LOY A;  3V98 A;  3G0K A;  2LYX A;  2STD A;  2SBL A;  1JB4 A;  3CC2 3;  3CCS 3;  1M1X B;  2XSO B;  2E2U A;  2OOV A;  3NV0 B;  3HX8 A;  2CFD A;  2ZDJ A;  3PS8 A;  3FF0 A;  3NM2 A;  1KSI A;  4XBY A;  4LGQ A;  2CG0 A;  4BTW A;  3FH1 A;  4HM3 B;  3CCJ 3;  3KKG A;  3CD6 3;  2K0M A;  5FGO A;  3CC7 3;  1D6Y A;  2C11 A;  1TP6 A;  2XGN A;  1WMP A;  5AEW B;  3LZA A;  3KSP A;  1OGX A;  1RKY A;  5ELJ A;  3NX0 A;  3GRD A;  1Q40 B;  4J8T A;  1V74 A;  3K9M C;  3WOF B;  3FZW A;  1M1K 4;  1WNH A;  3SOA A;  1VQ8 3;  5IG4 A;  3LT9 A;  1E97 A;  5EQL A;  5KP3 A;  3M8C A;  3F8H A;  3UL5 A;  2HMN B;  1CYV A;  1D6Z A;  1UI8 A;  2CG1 A;  1YGE A;  3Q2P A;  5CF1 A;  4MJD A;  1TFK A;  4N6U A;  2D42 A;  3T0U A;  3GZX B;  5AYS C;  2CK3 H;  3GZR A;  2E2T A;  4HM7 B;  3FF2 A;  1GD3 A;  4Q53 A;  3VF1 A;  1JNQ A;  3X41 A;  3NUV A;  3IPT A;  2P38 A;  5JPU A;  2B1X B;  4HM8 B;  4BTX A;  1A67 A;  1JV2 B;  1WQL B;  2BO9 B;  1Q42 A;  5A0O B;  1Q86 4;  3EC9 A;  1QJG A;  2CKF B;  1FUW A;  1ULI B;  5IG0 A;  2KRT A;  3IMA B;  3OWU A;  1OPY A;  3JUO A;  3PXM A;  3Q1C A;  3RDE A;  3CCQ 3;  4WYK B;  2GEY A;  3I0Y A;  3UJM A;  1LXE A;  3G4S 3;  1A2V A;  4HBR A;  1K41 A;  2CHC A;  3S67 A;  3F14 A;  1FGO A;  1ULJ B;  3F7S A;  3MSO A;  1GY7 A;  2OTJ 3;  4PEJ A;  2A15 A;  3H51 A;  3GZY B;  3G16 A;  1IK3 A;  2W56 B;  3WA3 A;  4HM5 B;  2W9Q A;  4HJL B;  3A76 A;  4CDL A;  2V1L A;  1AR0 A;  1DVC A;  3B4O A;  1QMA A;  2OQE A;  2XFT A;  3ER7 A;  3JUP A;  4HM4 B;  5BXQ A;  3WOE B;  2K54 A;  2LQV A;  1TFO A;  1ZO2 A;  3AMO B;  3MG1 A;  4HKV B;  4AKY A;  3FG4 A;  3MG2 A;  1Q82 4;  3CCU 3;  1ROV A;  3Q90 A;  2ZL8 A;  1FGM A;  1WTH A;  2GEX A;  1JN5 A;  3J7Y d;  4U13 A;  3B4P A;  3LTB A;  5LC6 A;  4EBG A;  1RRH A;  1FA3 A;  1O7N B;  3V99 A;  3HI7 A;  1NWW A;  4K1V A;  1TU5 A;  2GBW B;  2Q07 A;  3T8N A;  1W7C A;  5TGN A;  1CYU A;  1WMO A;  4IIA A;  1W2B 2;  4MMY B;  1N8R 4;  2Z76 A;  5DRE A;  4MEI A;  1VQN 3;  3EE1 A;  2BMO B;  2P0M A;  4N6T A;  1VQO 3;  2OOV C;  1A90 A;  3FG1 A;  3PCR A;  3U97 A;  1K73 4;  3NV0 A;  1STF I;  3KFQ C;  1YHQ 3;  1OGZ A;  1U5O A;  3F8X A;  3NQZ A;  5AYR B;  4K61 A;  4NHF A;  3NBJ A;  1N5P A;  3V92 A;  1JKG B;  3MPH A;  2OWP A;  4R80 A;  3PGB A;  1VQ5 3;  3SXX A;  3GZB A;  1T5Y A;  4FMB A;  2IUJ A;  4HM2 B;  2O3O A;  3BNB A;  4N6V 0;  3WA2 X;  3PZW A;  1RRL A;  2FXT A;  2CIU A;  3B8L A;  5IG5 A;  3CC4 3;  3LH4 A;  5IEO A;  2R4I A;  3NXJ A;  1QAK A;  2WGQ A;  4X2H A;  4XDV A;  2MF7 A;  1EA2 A;  2CW9 A;  1GY6 A;  1Q40 A;  3D3L A;  3BNC A;  3VSY A;  5CLK A;  3X3Y A;  5ELU A;  3SLU A;  4HZB B;  5CF2 A;  1EQK A;  2BMQ B;  4EYC A;  1GD4 A;  3DGL A;  3NBR A;  1FGT A;  1Z1S A;  2W2C A;  2XSH B;  4RNY A;  8CHO A;  4R1K A;  4L7K A;  2JDI H;  2PNC A;  1SJW A;  4HM6 B;  3FG3 A;  1ISK A;  5KP1 A;  1QVF 2;  2XR8 B;  3DXO A;  1EG9 B;  4KFF A;  4H3U A;  2IMJ A;  3K63 A;  5EEO A;  1NO3 A;  3SED A;  1J2B A;  1CQS A;  2WO0 A;  1IV9 A;  1N8Q A;  1EKM A;  5AI1 A;  4FMA A;  3HK4 A;  4STD A;  1VQM 3;  1HKX A;  1IDP A;  2WGO A;  1W6Y A;  2GU3 A;  2CFG A;  4N6O B;  4R9K A;  3KSE D;  3KII A;  3HIG A;  3I56 3;  2IUK A;  3EBT A;  5IF6 A;  4R4K A;  1F8N A;  2CWV A;  4WYK A;  2HMM B;  4WHA A;  4NRE A;  1C7H A;  3L0R A;  3NM7 A;  4TX4 A;  2MC8 A;  1AVK A;  3MG3 A;  4OUQ A;  1QVG 2;  2PZV A;  5CK6 A;  2QIY A;  5BVB A;  2IA7 A;  1RJO A;  2HMO B;  2QGU A;  3SOY A;  4KFE A;  1DVD A;  2W56 A;  2OCT A;  2OQE C;  1O7H B;  5LC7 A;  4KFD A;  1STD A;  2P0X A;  4O02 B;  4RBN A;  1K9M 4;  2M7O A;  2ML6 A;  1LVN A;  3G8Z A;  2GBX B;  1JB5 A;  4FCM A;  4AKZ A;  2Z6B A;  2HML B;  1JB2 A;  2Z77 A;  4R9L A;  4WWU C;  5JBS A;  3TDG A;  1YIT 3;  2BHM A;  3DZL A;  3FCS B;  1N9J A;  3MKI A;  4IT7 A;  2L4V A;  1OF5 B;  1ROA A;  3K5T A;  1VQL 3;  3HII A;  2CWT A;  4HZ9 B;  4O3V A;  4L8O A;  2BMR B;  4JRF A;  2CH9 A;  1LNH A;  3FGY A;  5AIH A;  3DGO A;  1VQP 3;  3EN8 A;  3N9H A;  2W9P A;  3STD A;  1VQ9 3;  3RGR A;  3B7C A;  3JVC A;  3X42 A;  3HZP A;  3CCV 3;  1OCV A;  1RN7 A;  1IU7 A;  1VQK 3;  3E99 A;  3EN1 B;  1DMQ A;  2FGT A;  1UUV B;  3KN4 A;  3DM8 A;  1QAL A;  3LXU X;  1D6U A;  1W01 A;  3ECF A;  3VGN A;  1BUQ A;  2CFK A;  2RFR A;  4EXR A;  4XBX A;  1M90 4;  2XGL A;  2XF3 A;  1NB5 I;  1UW1 A;  1JKG A;  3F40 A;  4ZM8 A;  3H3H A;  1SQW A;  1W5Z A;  2WOF A;  3OXA A;  5IEN A;  1ASK A;  2F98 A;  2YFJ B;  3LTA A;  3LYG A;  3JUM A;  3EF8 A;  2QEX 3;  1HU9 A;  4QWT A;  5D82 A;  5I97 A;  3S29 A;  2QA4 3;  3MHE A;  3LT8 A;  2Y74 A;  3ROB A;  1IVV A;  4XM4 A;  2CC3 A;  1GS3 A;  3X40 A;  1AV4 A;  4FMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...