2WGOA

Structure of ranaspumin-2, a surfactant protein from the foam nests of a tropical frog
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
GSLILDGDLLKDKLKLPVIDNLFGKELLDKFQDDIKDKYGVDTKDLKILKTSEDKRFYYVSVDAGDGEKCKFKIRKDVDVPKMVGRKCRKDDDDDDGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RANASPUMIN-2
publication title Ranaspumin-2: Structure and Function of a Surfactant Protein from the Foam Nests of a Tropical Frog.
pubmed doi rcsb
source organism Engystomops pustulosus
molecule tags Surfactant protein
total genus 24
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2009-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.260 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2wgoA00
2WGOA
chains in the Genus database with same CATH superfamily
2YFJB 1VQ63 2R4IA 1NB3I 4H61A 4CJNA 1DETA 1G0TA 1W00A 2ZHXB 3KSED 3EBYA 5BVBA 3S29A 1ASKA 1GS3A 3EE1A 3G713 1UUWB 1MGRA 2CFLA 1IK3A 2IUKA 3UL5A 2OOVC 2UUGC 1LOWA 1IT8A 3LT8A 2W56A 1VQO3 3GZYB 1UGIA 2Y73A 3ALAA 3N8BA 4WFOA 3EX9A 4GB5A 2BMRB 1IQ8A 2IA7A 1JBRA 2FGTA 5DREA 2H0HA 1YVBI 1IVXA 3Q1CA 2P0XA 2CFGA 5BXQA 1B21A 3F8XA 3OWUA 1TU5A 4BL3A 4XBTA 3FCSB 4R9KA 4OUQA 2RNTA 4N6TA 4K90B 4K61A 3BB9A 5KP3A 4KFFA 1YHQ3 1YIJ3 4X2HA 1L5GB 2YX9A 3CCS3 1GD4A 2CX0A 1W02A 1V58A 2WGQA 3WOFB 3AMOA 1UI7A 2QIYA 1JJ22 3EC9A 3F7SA 3LYGA 2B1XB 2YFIB 4FMBA 4HM0B 3VF1A 3GWRA 3EN1B 2INXA 1YGWA 5STDA 3GRDA 1BNFA 4N6NB 1ULJB 3HK4A 4IPBA 2C11A 2D1WA 2I9WA 4HBRA 2B24B 4HJLB 5LC7A 1N5HA 3KSPA 1EEJA 3CME3 1F8NA 4U13A 1Q814 3Q90A 2C4BA 3NQZA 4O3VA 2W9PA 5AIIA 4JRFA 4CDLA 3URPA 3NM7A 1CQSA 1BRGA 1W6GA 4KFDA 2CFKA 1VQ43 4K1VA 5HOHA 3CD63 1V57A 1SARA 2XR8B 2R41A 3FF2A 4MJDA 3HIIA 4N6MA 3MKIA 1OHOA 2UGIA 4BTXA 1T3BA 2ZA4A 3I0YA 1BNSA 2ZL8A 3RGAA 4XDVA 4TX4A 2W9QA 2ML6A 4HZ9B 3CPW2 1RGGA 1ZX2A 4HM4B 4R80A 3CCV3 2OCTA 2V1LA 1QAKA 1HKXA 1Q40A 3F9SA 4EV5A 4MMXB 2PNCA 4J9AA 1EA2A 5JBSA 3JVCA 1UW1A 2CIUA 3FH1A 1LOVA 4Q53A 3CCR3 2PZVA 3M8CA 4G1MB 4CCVA 2L4VA 1MWUA 1OGZA 3FG1A 3L0RA 2BNGA 2P38A 3B8LA 9RNTA 2WOFA 5D82A 1IYYA 2K0MA 3JUQA 1FYSA 1FUTA 1LQMB 5LC6A 1O7HB 5IF6A 1VQM3 1TFOA 1BSCA 4EYCA 1C54A 1E97A 3DXOA 1KSIA 5M18A 4IT7A 1ROVA 1CEWI 2HMKB 1OF5A 2WOHA 2XGLA 2L1SA 3LMLA 2RFRA 4HKVB 5G1LA 1TFKA 1FA3A 1ZO2A 2YFLB 1UCIA 1Z1SA 3K63A 3N54B 1RGCA 1DVDA 1R4YA 3PXMA 1RRLA 3ECFA 3O8YA 3G6E3 2OOVA 4RZMA 2C10A 3MHEA 1UUVB 5IEOA 1FGQA 1B20A 2CW9A 1Q864 2H0IA 3EB8A 3RDEA 3V98A 2KF6A 1JB2A 1K41A 2O9UX 2QEX3 1QAFA 4XM4A 3NHXA 4HZBB 1FW7A 1VQ73 1YNVX 4HM3B 2GXFA 3G0KA 1IVVA 1BNEA 3LZAA 2LYXA 4FMDA 4KVHA 3T8UA 1DYUA 2BMQB 3DGOA 3LTDA 4K1UA 3LTAA 1S5AA 1W7CA 4RNTA 3CC43 1W6YA 4MMYB 3SX1A 2XSOB 1K8A4 2BU4A 3NX0A 1UGHI 2E2VA 3A5EA 3B7CA 4KFEA 1ZS7A 1G02A 2CH9A 2CWUA 5CLKA 2UX0A 5IG4A 3NV0B 5TGNA 4ILFA 5IW9A 2WO0A 1GY5A 3BNCA 4L8OA 3I563 1MNLA 5FW5A 1TIJA 1I0VA 1KD14 3KCHA 2A15A 4LYLB 3TDGA 2AADA 1VQ93 1LNHA 3OXAA 3JUNA 1VQL3 2W2CA 1S723 5IERA 3CCU3 2HMLB 3HZPA 5AYRB 1NB5I 1JB5A 1UCJA 1G96A 4RNZA 2XRXB 5IG5A 4R1KA 1UUGB 5IEPA 5RNTA 1EQKA 3DMCA 3LTCA 4XBYA 3X3YA 1STDA 1LOYA 1DMQA 1STFI 2KF3A 3I553 1M1K4 3KN4A 3LH4A 3NBBA 1IVUA 1OHSA 3EQQB 3DGYA 5BIRA 1NNVA 3X40A 4R9LA 4LZIA 1B2UA 3UL6A 1WMPA 3LOYA 4OK0A 3D79A 3LT9A 1OHPA 3MYTA 4HM2B 5JPPA 4NHFA 3QK9A 4N6OB 1FUWA 4EBGA 1DMMA 1IV9A 1N9JA 1QJGA 1RLSA 3U1WA 5G2GA 4QWTA 5IG3A 4HOHA 4L7KA 1RGHA 1WNHA 3WDGB 3KE7A 4EXRA 7RNTA 1TP6A 1JN5B 1NU3A 1TTOA 1Q824 4LSOA 3IPTA 4H3UA 1V74A 1SJWA 1BNJA 3NV0A 1PYLA 1M904 1RGFA 3IJEB 1ISKA 1I2FA 1AR0A 2CWVA 1OCVA 1J2BA 1RNTA 4PEJA 1JNQA 2KRTA 2BT3A 4BL2A 2RGQA 1AY7A 1BVIA 3VSYA 3NQYA 2Z76A 1JRQA 1OPYA 3CNMA 1GY7A 1RGAA 3SYUA 4FMCA 5FGOA 4HM8B 3X3ZA 3K7CA 2W6JH 4KZ1A 2BO9B 3PS8A 1RKYA 1Q7Y4 3CCE3 2Z6BA 5AIFA 1VQK3 3J7Yd 2Z7AA 1GMRA 1AVKA 2RCDA 4EV2A 5A0OB 1YJW3 1T2IA 1QMAA 2F4YA 2Y74A 3EBTA 5ELUA 1DE3A 2F99A 4AKZA 2F56A 5AEUB 1O7WB 3ROBA 1LVNA 1RTUA 2SBLA 4N6LA 4NPBA 2P05A 4FR9A 3K0ZA 3T0UA 1BRNL 1BNIA 1B3SA 1AVLA 1HZ1A 3BU4A 3MG2A 1PY3A 2OQEC 4O8SA 3S28A 1B2XA 2BIRA 1D6ZA 1I8VA 1MGWA 3D9RA 3KFQC 4J8TA 1LQGC 3FLJA 5I97A 5CK6A 1FGRA 4JF8A 3S5CA 3JUPA 3WOEB 2ZDJA 4HVNA 4X2OA 1MWTA 5G1KA 5BU4A 3LXUX 1JN5A 4WWUC 1DMNA 1FUSA 3FZWA 2IY2A 2W0QA 5D81A 1JB4A 2RBIA 3PCSA 4XB5A 1FGTA 2GU1A 2H0GA 2E2UA 1I3FA 4XBXA 3WA3A 2JQ5A 2E2TA 3OW22 2F98A 2XGNA 3UB1A 2CFDA 3WR2A 1AV4A 3KKGA 1RGLA 3CPOA 1RMSA 2M7OA 3LTBA 3PYJA 3X41A 3PGBA 1SIHA 3EN8A 3D5IA 1ULIB 1SPUA 1X1UA 1BRSA 1VZZA 3ZFZA 1N8QA 2CK3H 1US1A 2GBWB 1NWWA 2STDA 4OVMA 2XFTA 1WTHA 3FKAA 2LQVA 3U97A 1SQWA 6GSPA 4LMIA 3AGNA 4LEHA 1I2GA 3S67A 3DGNA 2HMJB 1RGKA 3HI7A 3GAXA 1YJ93 1RJOA 3DZLA 1GMPA 4GSPA 1IT7A 2W56B 3MG3A 1GOVA 4FCZA 1C7HA 4R4KA 2XF3A 4WYKB 1E3VA 3SEDA 4HYZA 4ZM8A 1IV7A 3KZTA 5JPUA 1K9M4 2GBXB 1JKGB 1TRPA 3F7XA 5EQLA 5CF2A 1FGOA 4BIRA 4BTYA 2P0MA 2KAAA 3GZRA 1RGEA 4EW5A 2W03A 3CU3A 3K9MC 3MWZA 1MWRA 3N9HA 1OUNA 1RCLA 3NBRA 4ORLA 2O3OA 1B27A 1O7NB 3NXJA 4HM6B 3SVAA 4BTWA 1QVG2 2Q07A 2ML5A 7STDA 1IVWA 1I3IA 3HX8A 2GSPA 4FCMA 3BIRA 1T5YA 2OTJ3 3KIIA 4EC6A 2CFWA 3PCRA 4STDA 3STDA 1R4CA 2XFSA 3NM2A 1A67A 1RN4A 3DH2A 3SOYA 1BSDA 1OGXA 1BANA 3EHCA 3H3HA 3JUOA 1PFPA 3JUMA 3V99A 3AHSA 3H51A 4O2HA 1BAOA 4WP5A 1GY6A 4IIAA 1YGEA 3CCJ3 4CPKA 2F5MA 1I0XA 1I2EA 2HMNB 4HM5B 4GHOA 1ROAA 1QALA 4LGQA 1RRHA 1NO3A 2RSXA 4AKYA 2K3DA 1IQXA 2CWTA 1O7PB 3FF0A 1U8CB 1KQS2 2OQEA 4DKIA 3SLUA 4WHAA 5CXOA 3DM8A 4HAAA 3QRDA 5ELJA 1EUIC 1IQYA 1UCLA 3WMDA 1AQZA 3HIGA 3RNTA 3OV4A 3ZG5A 3RGRA 1LXEA 4WYKA 1A90A 1N8R4 4HM1B 3F14A 1YVSA 1N5PA 1CYVA 2XEPA 1JKGA 5GSPA 8RNTA 5KP1A 2AAEA 3CMA3 3EJVA 4FMAA 1Q40B 1BRJA 3G4S3 3CC23 5AYSC 1FZUA 2OWPA 1BUQA 5AEWB 1UI8A 2WGOA 2FNQA 3CNXA 3D3LA 4N6UA 2CG1A 2XH9A 4MEIA 1W2B2 1RCKA 4AEQA 3DGLA 3GSPA 1EKMA 1CYUA 1UDII 4L8PA 1UCKA 2IUJA 1RNBA 2CC3A 1JV2B 3CCQ3 4N3VA 3NUVA 5D83A 1OF5B 1Q9EA 1RHLA 1DVCA 2CHCA 3FGYA 1MWSA 1BIRA 3ZG0A 4N6V0 3X42A 1RDSA 4NREA 2KF4A 1GSPA 1HU9A 1GOUA 1HYFA 5AIGA 3DUKA 2MF7A 3F40A 1M1XB 1BNGA 4MMZB 1IU7A 3WHOA 3X3XA 1JBTA 1BRHA 3CCL3 1TUHA 1LRAA 1BOXA 5HGRA 3UJMA 3Q2PA 1A2VA 2F5WA 1BSAA 6RNTA 1BUJA 3AHWA 4FCJA 5AIHA 1Q42A 2P09A 3VGNA 3T8NA 4RNYA 3GZXB 1X1WA 2MC8A 1B2MA 3FSDA 3NBJA 3FG3A 4O02B 1VQ53 2K54A 4KT3B 2GEYA 1K28A 1VQN3 1X1XA 3SOAA 1KC84 1LNIA 1RN7A 2GU3A 1TJDA 1T2HA 2OTL3 1GOYA 1OH0A 1PU4A 4J5KA 3CC73 5AI1A 1NJI4 2BHMA 1U5OA 3V92A 1FGMA 2J8XB 3BNDA 2CG0A 3AGOA 2D42A 3IMAB 2KF5A 3OWYA 3MG1A 4GL6A 5DRVA 2CX1A 1NDOB 1Q7HA 5M1AA 2CKFB 1A2KA 4RBNA 1WMOA 2XSHB 2QGUA 5EEOA 1SIIA 1RSNA 3EF8A 1WQLB 4J5GA 3UNLA 3A76A 1BU4A 3OWSA 1I70A 1WMNA 1B2SA 5CF1A 2QA43 4I4KA 1VQQA 3CXC2 2Z77A 3Q3FA 1O7GB 5IG0A 8CHOA 3BNEA 2IYJA 1GD3A 2KCDA 3B4OA 2SARA 3FG4A 3SXXA 4BU4A 1M9GA 1E3RA 3DY5A 1O7MB 2IMJA 3GZBA 5KP4A 3S27A 1GMQA 1VQ83 3G16A 3WA2X 1BSBA 1YJN3 1K734 2F86B 3K5TA 1EG9B 1QVF2 1W01A 1YIT3 1RN1A 3PZWA 3WODG 3E99A 1JBSA 3MPHA 6STDA 3G8ZA 3DGMA 1KWIA 2FXTA 3B4PA 7GSPA 1A2PA 5EVHA 1D6UA 2HMOB 1B2ZA 1W2ZA 1BRKA 1MOLA 1ZGXA 1Y4KA 3D4AA 2BMOB 1BGSA 1LOXA 1W6CA 3D5GA 1GYBA 3OX9A 1N9EA 3BLZA 1JZOA 2HOHA 1OACA 1W5ZA 1YI23 3AMOB 1TRQA 2HMMB 3F8HA 1W4NA 4I5QA 2GEXA 1VQP3 1BSEA 3HOHA 3CCM3 1IDPA 2JDIH 1JZDA 3BNBA 4HM7B 4XDWA 1BNRA 1D6YA 1X1YA 5IENA 5M19A 3MSOA 1CH0A 1BRIA 2KXGA 3ER7A 2W04A
chains in the Genus database with same CATH topology
2YFJB 1VQ63 2R4IA 1NB3I 4H61A 1W00A 3KSED 3EBYA 5BVBA 3S29A 1ASKA 1GS3A 3EE1A 3G713 1UUWB 2CFLA 1IK3A 2IUKA 3UL5A 2OOVC 1IT8A 3LT8A 2W56A 1VQO3 3GZYB 2Y73A 3ALAA 3N8BA 4WFOA 3EX9A 4GB5A 2BMRB 1IQ8A 2IA7A 2FGTA 5DREA 1YVBI 1IVXA 3Q1CA 2P0XA 2CFGA 5BXQA 3F8XA 3OWUA 1TU5A 4XBTA 3FCSB 4R9KA 4OUQA 4N6TA 4K90B 4K61A 3BB9A 5KP3A 4KFFA 1YHQ3 1YIJ3 4X2HA 1L5GB 2YX9A 3CCS3 1GD4A 1W02A 2WGQA 3WOFB 3AMOA 1UI7A 2QIYA 1JJ22 3EC9A 3F7SA 3LYGA 2B1XB 2YFIB 4FMBA 4HM0B 3VF1A 3GWRA 3EN1B 2INXA 5STDA 3GRDA 4N6NB 1ULJB 3HK4A 4IPBA 2C11A 2D1WA 2I9WA 4HBRA 2B24B 4HJLB 5LC7A 1N5HA 3KSPA 3CME3 1F8NA 4U13A 1Q814 3Q90A 3NQZA 4O3VA 2W9PA 5AIIA 4JRFA 4CDLA 3NM7A 1CQSA 1W6GA 4KFDA 3CD63 2CFKA 1VQ43 4K1VA 2XR8B 3FF2A 4MJDA 3HIIA 4N6MA 3MKIA 1OHOA 4BTXA 3I0YA 2ZL8A 3RGAA 4XDVA 4TX4A 2W9QA 2ML6A 4HZ9B 3CPW2 1ZX2A 4HM4B 4R80A 3CCV3 2OCTA 2V1LA 1QAKA 1HKXA 1Q40A 3F9SA 4EV5A 4MMXB 2PNCA 4J9AA 1EA2A 5JBSA 3JVCA 1UW1A 2CIUA 3FH1A 4Q53A 3CCR3 2PZVA 3M8CA 4G1MB 4CCVA 2L4VA 1OGZA 3FG1A 3L0RA 2BNGA 2P38A 3B8LA 2WOFA 5D82A 2K0MA 3JUQA 5LC6A 1O7HB 5IF6A 1VQM3 1TFOA 4EYCA 1E97A 3DXOA 1KSIA 4IT7A 1ROVA 1CEWI 2HMKB 1OF5A 2WOHA 2XGLA 3LMLA 2RFRA 4HKVB 1FA3A 1TFKA 1ZO2A 2YFLB 3K63A 1Z1SA 1DVDA 3N54B 3PXMA 1RRLA 3ECFA 3O8YA 3G6E3 2OOVA 4RZMA 2C10A 3MHEA 1UUVB 5IEOA 1FGQA 2CW9A 1Q864 3EB8A 3RDEA 3V98A 2QEX3 1JB2A 1K41A 2O9UX 1QAFA 4XM4A 3NHXA 4HZBB 1VQ73 4HM3B 2GXFA 3G0KA 1IVVA 3LZAA 2LYXA 4FMDA 4KVHA 3T8UA 1DYUA 2BMQB 3DGOA 3LTDA 4K1UA 3LTAA 1S5AA 1W7CA 3CC43 1W6YA 4MMYB 3SX1A 2XSOB 1K8A4 3NX0A 2E2VA 3B7CA 5CLKA 4KFEA 5IG4A 2CH9A 2CWUA 2UX0A 3NV0B 5TGNA 5IW9A 2WO0A 1GY5A 3BNCA 4L8OA 3I563 1MNLA 5FW5A 1TIJA 1KD14 2A15A 3TDGA 1VQ93 1LNHA 3OXAA 3JUNA 1VQL3 2W2CA 1S723 5IERA 3CCU3 2HMLB 3HZPA 5AYRB 1NB5I 1JB5A 1G96A 4RNZA 2XRXB 5IG5A 4R1KA 5IEPA 1EQKA 3DMCA 3LTCA 4XBYA 3X3YA 1STDA 1STFI 1DMQA 3I553 1M1K4 3KN4A 3LH4A 3NBBA 1IVUA 1OHSA 3EQQB 3X40A 4R9LA 4LZIA 3UL6A 1WMPA 3LOYA 4OK0A 3LT9A 1OHPA 3MYTA 4HM2B 5JPPA 4NHFA 3QK9A 4N6OB 1FUWA 4EBGA 1DMMA 1IV9A 1N9JA 1QJGA 3U1WA 5G2GA 4QWTA 5IG3A 4L7KA 3WDGB 1WNHA 3KE7A 4EXRA 1TP6A 1JN5B 1NU3A 1Q824 4LSOA 3IPTA 4H3UA 1V74A 1SJWA 3NV0A 1M904 3IJEB 1ISKA 1AR0A 2CWVA 1OCVA 1J2BA 4PEJA 1JNQA 2KRTA 2BT3A 2RGQA 3VSYA 3NQYA 2Z76A 1JRQA 1OPYA 3CNMA 1GY7A 4FMCA 5FGOA 4HM8B 3X3ZA 3K7CA 2W6JH 4KZ1A 2BO9B 3PS8A 1RKYA 1Q7Y4 3CCE3 2Z6BA 5AIFA 1VQK3 3J7Yd 2Z7AA 1AVKA 2RCDA 4EV2A 5A0OB 1YJW3 1QMAA 5ELUA 2Y74A 3EBTA 2F99A 4AKZA 5AEUB 1O7WB 3ROBA 1LVNA 2SBLA 4N6LA 3T0UA 2P05A 4FR9A 3K0ZA 1AVLA 3MG2A 2OQEC 4O8SA 3S28A 1D6ZA 3D9RA 3KFQC 4J8TA 5I97A 3FLJA 5CK6A 1FGRA 4JF8A 3S5CA 3JUPA 3WOEB 2ZDJA 4HVNA 4X2OA 3LXUX 1JN5A 4WWUC 1DMNA 3FZWA 2W0QA 5D81A 1JB4A 3PCSA 4XB5A 1FGTA 2GU1A 2E2UA 4XBXA 3WA3A 2JQ5A 2E2TA 3OW22 2F98A 2XGNA 3UB1A 2CFDA 1AV4A 3KKGA 3CPOA 3LTBA 2M7OA 3PYJA 3X41A 3PGBA 1SIHA 3EN8A 1ULIB 1SPUA 1VZZA 1N8QA 2CK3H 1US1A 2GBWB 1NWWA 2STDA 4OVMA 2XFTA 1WTHA 3FKAA 2LQVA 3U97A 1SQWA 4LMIA 4LEHA 3S67A 3DGNA 2HMJB 3HI7A 3GAXA 1RJOA 3DZLA 1IT7A 2W56B 3MG3A 4FCZA 1C7HA 4R4KA 2XF3A 4WYKB 1E3VA 3SEDA 4HYZA 4ZM8A 1IV7A 3KZTA 5JPUA 1K9M4 2GBXB 1JKGB 3F7XA 5EQLA 5CF2A 1FGOA 4BTYA 2P0MA 3GZRA 2W03A 3CU3A 3K9MC 3MWZA 3N9HA 1OUNA 3NBRA 4ORLA 2O3OA 1O7NB 3NXJA 4HM6B 3SVAA 4BTWA 1QVG2 2Q07A 2ML5A 7STDA 1IVWA 3HX8A 4FCMA 1T5YA 2OTJ3 3KIIA 4EC6A 2CFWA 3PCRA 4STDA 3STDA 1R4CA 2XFSA 3NM2A 1A67A 3SOYA 1OGXA 3EHCA 3H3HA 3JUOA 1PFPA 3JUMA 3V99A 3H51A 4O2HA 4WP5A 1GY6A 4IIAA 1YGEA 3CCJ3 2HMNB 4HM5B 1ROAA 1QALA 4LGQA 2RSXA 1RRHA 1NO3A 4AKYA 1IQXA 2CWTA 1O7PB 3FF0A 1U8CB 1KQS2 2OQEA 3SLUA 4WHAA 5CXOA 3DM8A 3QRDA 5ELJA 1IQYA 3WMDA 3HIGA 3OV4A 3RGRA 1LXEA 4WYKA 1N8R4 4HM1B 3F14A 1N5PA 1CYVA 2XEPA 1JKGA 5KP1A 3CMA3 3EJVA 4FMAA 1Q40B 3CC23 3G4S3 5AYSC 2OWPA 1BUQA 5AEWB 1UI8A 2WGOA 2FNQA 3CNXA 3D3LA 4N6UA 2CG1A 2XH9A 4MEIA 1W2B2 4AEQA 3DGLA 1EKMA 1CYUA 2IUJA 4L8PA 2CC3A 1JV2B 3CCQ3 4N3VA 3NUVA 5D83A 1OF5B 2CHCA 1DVCA 3FGYA 4N6V0 3X42A 4NREA 1HU9A 5AIGA 3DUKA 2MF7A 3F40A 1M1XB 4MMZB 1IU7A 3X3XA 3CCL3 1TUHA 5HGRA 3UJMA 3Q2PA 1A2VA 4FCJA 5AIHA 1Q42A 2P09A 3VGNA 3T8NA 4RNYA 3GZXB 2MC8A 1VQ53 3FSDA 3NBJA 3FG3A 4O02B 2K54A 2GEYA 1K28A 1VQN3 3SOAA 1KC84 1RN7A 2GU3A 2OTL3 1OH0A 1PU4A 3CC73 5AI1A 1NJI4 2BHMA 1U5OA 3V92A 1FGMA 4GL6A 3BNDA 2CG0A 3IMAB 2D42A 3OWYA 5DRVA 1YJ93 3MG1A 1A90A 1NDOB 2CKFB 1A2KA 4RBNA 1WMOA 2XSHB 2QGUA 5EEOA 1SIIA 3EF8A 1WQLB 3UNLA 3A76A 3OWSA 5CF1A 1WMNA 2QA43 4I4KA 3CXC2 2Z77A 5IG0A 1O7GB 8CHOA 3BNEA 3B4OA 1GD3A 2KCDA 3FG4A 3SXXA 1M9GA 1E3RA 3DY5A 1O7MB 2IMJA 3GZBA 5KP4A 3S27A 1VQ83 3G16A 3WA2X 1YJN3 1K734 2F86B 3K5TA 1EG9B 1QVF2 1W01A 1YIT3 3PZWA 3WODG 3E99A 3MPHA 6STDA 3G8ZA 3DGMA 1KWIA 2FXTA 3B4PA 5EVHA 1D6UA 2HMOB 1W2ZA 1MOLA 1Y4KA 2BMOB 1W6CA 1LOXA 1GYBA 3OX9A 1N9EA 3BLZA 1OACA 1W5ZA 1YI23 3AMOB 2HMMB 3F8HA 1W4NA 2GEXA 1VQP3 3CCM3 1IDPA 2JDIH 3BNBA 4HM7B 4XDWA 1D6YA 5IENA 3MSOA 2KXGA 3ER7A 2W04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGO A; 
#chains in the Genus database with same CATH topology
 2YFJ B;  1VQ6 3;  2R4I A;  1NB3 I;  4H61 A;  4CJN A;  1DET A;  1G0T A;  1W00 A;  2ZHX B;  3KSE D;  3EBY A;  5BVB A;  3S29 A;  1ASK A;  1GS3 A;  3EE1 A;  3G71 3;  1UUW B;  1MGR A;  2CFL A;  1IK3 A;  2IUK A;  3UL5 A;  2OOV C;  2UUG C;  1LOW A;  1IT8 A;  3LT8 A;  2W56 A;  1VQO 3;  3GZY B;  1UGI A;  2Y73 A;  3ALA A;  3N8B A;  4WFO A;  3EX9 A;  4GB5 A;  2BMR B;  1IQ8 A;  2IA7 A;  1JBR A;  2FGT A;  5DRE A;  2H0H A;  1YVB I;  1IVX A;  3Q1C A;  2P0X A;  2CFG A;  5BXQ A;  1B21 A;  3F8X A;  3OWU A;  1TU5 A;  4BL3 A;  4XBT A;  3FCS B;  4R9K A;  4OUQ A;  2RNT A;  4N6T A;  4K90 B;  4K61 A;  3BB9 A;  5KP3 A;  4KFF A;  1YHQ 3;  1YIJ 3;  4X2H A;  1L5G B;  2YX9 A;  3CCS 3;  1GD4 A;  2CX0 A;  1W02 A;  1V58 A;  2WGQ A;  3WOF B;  3AMO A;  1UI7 A;  2QIY A;  1JJ2 2;  3EC9 A;  3F7S A;  3LYG A;  2B1X B;  2YFI B;  4FMB A;  4HM0 B;  3VF1 A;  3GWR A;  3EN1 B;  2INX A;  1YGW A;  5STD A;  3GRD A;  1BNF A;  4N6N B;  1ULJ B;  3HK4 A;  4IPB A;  2C11 A;  2D1W A;  2I9W A;  4HBR A;  2B24 B;  4HJL B;  5LC7 A;  1N5H A;  3KSP A;  1EEJ A;  3CME 3;  1F8N A;  4U13 A;  1Q81 4;  3Q90 A;  2C4B A;  3NQZ A;  4O3V A;  2W9P A;  5AII A;  4JRF A;  4CDL A;  3URP A;  3NM7 A;  1CQS A;  1BRG A;  1W6G A;  4KFD A;  2CFK A;  1VQ4 3;  4K1V A;  5HOH A;  3CD6 3;  1V57 A;  1SAR A;  2XR8 B;  2R41 A;  3FF2 A;  4MJD A;  3HII A;  4N6M A;  3MKI A;  1OHO A;  2UGI A;  4BTX A;  1T3B A;  2ZA4 A;  3I0Y A;  1BNS A;  2ZL8 A;  3RGA A;  4XDV A;  4TX4 A;  2W9Q A;  2ML6 A;  4HZ9 B;  3CPW 2;  1RGG A;  1ZX2 A;  4HM4 B;  4R80 A;  3CCV 3;  2OCT A;  2V1L A;  1QAK A;  1HKX A;  1Q40 A;  3F9S A;  4EV5 A;  4MMX B;  2PNC A;  4J9A A;  1EA2 A;  5JBS A;  3JVC A;  1UW1 A;  2CIU A;  3FH1 A;  1LOV A;  4Q53 A;  3CCR 3;  2PZV A;  3M8C A;  4G1M B;  4CCV A;  2L4V A;  1MWU A;  1OGZ A;  3FG1 A;  3L0R A;  2BNG A;  2P38 A;  3B8L A;  9RNT A;  2WOF A;  5D82 A;  1IYY A;  2K0M A;  3JUQ A;  1FYS A;  1FUT A;  1LQM B;  5LC6 A;  1O7H B;  5IF6 A;  1VQM 3;  1TFO A;  1BSC A;  4EYC A;  1C54 A;  1E97 A;  3DXO A;  1KSI A;  5M18 A;  4IT7 A;  1ROV A;  1CEW I;  2HMK B;  1OF5 A;  2WOH A;  2XGL A;  2L1S A;  3LML A;  2RFR A;  4HKV B;  5G1L A;  1TFK A;  1FA3 A;  1ZO2 A;  2YFL B;  1UCI A;  1Z1S A;  3K63 A;  3N54 B;  1RGC A;  1DVD A;  1R4Y A;  3PXM A;  1RRL A;  3ECF A;  3O8Y A;  3G6E 3;  2OOV A;  4RZM A;  2C10 A;  3MHE A;  1UUV B;  5IEO A;  1FGQ A;  1B20 A;  2CW9 A;  1Q86 4;  2H0I A;  3EB8 A;  3RDE A;  3V98 A;  2KF6 A;  1JB2 A;  1K41 A;  2O9U X;  2QEX 3;  1QAF A;  4XM4 A;  3NHX A;  4HZB B;  1FW7 A;  1VQ7 3;  1YNV X;  4HM3 B;  2GXF A;  3G0K A;  1IVV A;  1BNE A;  3LZA A;  2LYX A;  4FMD A;  4KVH A;  3T8U A;  1DYU A;  2BMQ B;  3DGO A;  3LTD A;  4K1U A;  3LTA A;  1S5A A;  1W7C A;  4RNT A;  3CC4 3;  1W6Y A;  4MMY B;  3SX1 A;  2XSO B;  1K8A 4;  2BU4 A;  3NX0 A;  1UGH I;  2E2V A;  3A5E A;  3B7C A;  4KFE A;  1ZS7 A;  1G02 A;  2CH9 A;  2CWU A;  5CLK A;  2UX0 A;  5IG4 A;  3NV0 B;  5TGN A;  4ILF A;  5IW9 A;  2WO0 A;  1GY5 A;  3BNC A;  4L8O A;  3I56 3;  1MNL A;  5FW5 A;  1TIJ A;  1I0V A;  1KD1 4;  3KCH A;  2A15 A;  4LYL B;  3TDG A;  2AAD A;  1VQ9 3;  1LNH A;  3OXA A;  3JUN A;  1VQL 3;  2W2C A;  1S72 3;  5IER A;  3CCU 3;  2HML B;  3HZP A;  5AYR B;  1NB5 I;  1JB5 A;  1UCJ A;  1G96 A;  4RNZ A;  2XRX B;  5IG5 A;  4R1K A;  1UUG B;  5IEP A;  5RNT A;  1EQK A;  3DMC A;  3LTC A;  4XBY A;  3X3Y A;  1STD A;  1LOY A;  1DMQ A;  1STF I;  2KF3 A;  3I55 3;  1M1K 4;  3KN4 A;  3LH4 A;  3NBB A;  1IVU A;  1OHS A;  3EQQ B;  3DGY A;  5BIR A;  1NNV A;  3X40 A;  4R9L A;  4LZI A;  1B2U A;  3UL6 A;  1WMP A;  3LOY A;  4OK0 A;  3D79 A;  3LT9 A;  1OHP A;  3MYT A;  4HM2 B;  5JPP A;  4NHF A;  3QK9 A;  4N6O B;  1FUW A;  4EBG A;  1DMM A;  1IV9 A;  1N9J A;  1QJG A;  1RLS A;  3U1W A;  5G2G A;  4QWT A;  5IG3 A;  4HOH A;  4L7K A;  1RGH A;  1WNH A;  3WDG B;  3KE7 A;  4EXR A;  7RNT A;  1TP6 A;  1JN5 B;  1NU3 A;  1TTO A;  1Q82 4;  4LSO A;  3IPT A;  4H3U A;  1V74 A;  1SJW A;  1BNJ A;  3NV0 A;  1PYL A;  1M90 4;  1RGF A;  3IJE B;  1ISK A;  1I2F A;  1AR0 A;  2CWV A;  1OCV A;  1J2B A;  1RNT A;  4PEJ A;  1JNQ A;  2KRT A;  2BT3 A;  4BL2 A;  2RGQ A;  1AY7 A;  1BVI A;  3VSY A;  3NQY A;  2Z76 A;  1JRQ A;  1OPY A;  3CNM A;  1GY7 A;  1RGA A;  3SYU A;  4FMC A;  5FGO A;  4HM8 B;  3X3Z A;  3K7C A;  2W6J H;  4KZ1 A;  2BO9 B;  3PS8 A;  1RKY A;  1Q7Y 4;  3CCE 3;  2Z6B A;  5AIF A;  1VQK 3;  3J7Y d;  2Z7A A;  1GMR A;  1AVK A;  2RCD A;  4EV2 A;  5A0O B;  1YJW 3;  1T2I A;  1QMA A;  2F4Y A;  2Y74 A;  3EBT A;  5ELU A;  1DE3 A;  2F99 A;  4AKZ A;  2F56 A;  5AEU B;  1O7W B;  3ROB A;  1LVN A;  1RTU A;  2SBL A;  4N6L A;  4NPB A;  2P05 A;  4FR9 A;  3K0Z A;  3T0U A;  1BRN L;  1BNI A;  1B3S A;  1AVL A;  1HZ1 A;  3BU4 A;  3MG2 A;  1PY3 A;  2OQE C;  4O8S A;  3S28 A;  1B2X A;  2BIR A;  1D6Z A;  1I8V A;  1MGW A;  3D9R A;  3KFQ C;  4J8T A;  1LQG C;  3FLJ A;  5I97 A;  5CK6 A;  1FGR A;  4JF8 A;  3S5C A;  3JUP A;  3WOE B;  2ZDJ A;  4HVN A;  4X2O A;  1MWT A;  5G1K A;  5BU4 A;  3LXU X;  1JN5 A;  4WWU C;  1DMN A;  1FUS A;  3FZW A;  2IY2 A;  2W0Q A;  5D81 A;  1JB4 A;  2RBI A;  3PCS A;  4XB5 A;  1FGT A;  2GU1 A;  2H0G A;  2E2U A;  1I3F A;  4XBX A;  3WA3 A;  2JQ5 A;  2E2T A;  3OW2 2;  2F98 A;  2XGN A;  3UB1 A;  2CFD A;  3WR2 A;  1AV4 A;  3KKG A;  1RGL A;  3CPO A;  1RMS A;  2M7O A;  3LTB A;  3PYJ A;  3X41 A;  3PGB A;  1SIH A;  3EN8 A;  3D5I A;  1ULI B;  1SPU A;  1X1U A;  1BRS A;  1VZZ A;  3ZFZ A;  1N8Q A;  2CK3 H;  1US1 A;  2GBW B;  1NWW A;  2STD A;  4OVM A;  2XFT A;  1WTH A;  3FKA A;  2LQV A;  3U97 A;  1SQW A;  6GSP A;  4LMI A;  3AGN A;  4LEH A;  1I2G A;  3S67 A;  3DGN A;  2HMJ B;  1RGK A;  3HI7 A;  3GAX A;  1YJ9 3;  1RJO A;  3DZL A;  1GMP A;  4GSP A;  1IT7 A;  2W56 B;  3MG3 A;  1GOV A;  4FCZ A;  1C7H A;  4R4K A;  2XF3 A;  4WYK B;  1E3V A;  3SED A;  4HYZ A;  4ZM8 A;  1IV7 A;  3KZT A;  5JPU A;  1K9M 4;  2GBX B;  1JKG B;  1TRP A;  3F7X A;  5EQL A;  5CF2 A;  1FGO A;  4BIR A;  4BTY A;  2P0M A;  2KAA A;  3GZR A;  1RGE A;  4EW5 A;  2W03 A;  3CU3 A;  3K9M C;  3MWZ A;  1MWR A;  3N9H A;  1OUN A;  1RCL A;  3NBR A;  4ORL A;  2O3O A;  1B27 A;  1O7N B;  3NXJ A;  4HM6 B;  3SVA A;  4BTW A;  1QVG 2;  2Q07 A;  2ML5 A;  7STD A;  1IVW A;  1I3I A;  3HX8 A;  2GSP A;  4FCM A;  3BIR A;  1T5Y A;  2OTJ 3;  3KII A;  4EC6 A;  2CFW A;  3PCR A;  4STD A;  3STD A;  1R4C A;  2XFS A;  3NM2 A;  1A67 A;  1RN4 A;  3DH2 A;  3SOY A;  1BSD A;  1OGX A;  1BAN A;  3EHC A;  3H3H A;  3JUO A;  1PFP A;  3JUM A;  3V99 A;  3AHS A;  3H51 A;  4O2H A;  1BAO A;  4WP5 A;  1GY6 A;  4IIA A;  1YGE A;  3CCJ 3;  4CPK A;  2F5M A;  1I0X A;  1I2E A;  2HMN B;  4HM5 B;  4GHO A;  1ROA A;  1QAL A;  4LGQ A;  1RRH A;  1NO3 A;  2RSX A;  4AKY A;  2K3D A;  1IQX A;  2CWT A;  1O7P B;  3FF0 A;  1U8C B;  1KQS 2;  2OQE A;  4DKI A;  3SLU A;  4WHA A;  5CXO A;  3DM8 A;  4HAA A;  3QRD A;  5ELJ A;  1EUI C;  1IQY A;  1UCL A;  3WMD A;  1AQZ A;  3HIG A;  3RNT A;  3OV4 A;  3ZG5 A;  3RGR A;  1LXE A;  4WYK A;  1A90 A;  1N8R 4;  4HM1 B;  3F14 A;  1YVS A;  1N5P A;  1CYV A;  2XEP A;  1JKG A;  5GSP A;  8RNT A;  5KP1 A;  2AAE A;  3CMA 3;  3EJV A;  4FMA A;  1Q40 B;  1BRJ A;  3G4S 3;  3CC2 3;  5AYS C;  1FZU A;  2OWP A;  1BUQ A;  5AEW B;  1UI8 A;  2WGO A;  2FNQ A;  3CNX A;  3D3L A;  4N6U A;  2CG1 A;  2XH9 A;  4MEI A;  1W2B 2;  1RCK A;  4AEQ A;  3DGL A;  3GSP A;  1EKM A;  1CYU A;  1UDI I;  4L8P A;  1UCK A;  2IUJ A;  1RNB A;  2CC3 A;  1JV2 B;  3CCQ 3;  4N3V A;  3NUV A;  5D83 A;  1OF5 B;  1Q9E A;  1RHL A;  1DVC A;  2CHC A;  3FGY A;  1MWS A;  1BIR A;  3ZG0 A;  4N6V 0;  3X42 A;  1RDS A;  4NRE A;  2KF4 A;  1GSP A;  1HU9 A;  1GOU A;  1HYF A;  5AIG A;  3DUK A;  2MF7 A;  3F40 A;  1M1X B;  1BNG A;  4MMZ B;  1IU7 A;  3WHO A;  3X3X A;  1JBT A;  1BRH A;  3CCL 3;  1TUH A;  1LRA A;  1BOX A;  5HGR A;  3UJM A;  3Q2P A;  1A2V A;  2F5W A;  1BSA A;  6RNT A;  1BUJ A;  3AHW A;  4FCJ A;  5AIH A;  1Q42 A;  2P09 A;  3VGN A;  3T8N A;  4RNY A;  3GZX B;  1X1W A;  2MC8 A;  1B2M A;  3FSD A;  3NBJ A;  3FG3 A;  4O02 B;  1VQ5 3;  2K54 A;  4KT3 B;  2GEY A;  1K28 A;  1VQN 3;  1X1X A;  3SOA A;  1KC8 4;  1LNI A;  1RN7 A;  2GU3 A;  1TJD A;  1T2H A;  2OTL 3;  1GOY A;  1OH0 A;  1PU4 A;  4J5K A;  3CC7 3;  5AI1 A;  1NJI 4;  2BHM A;  1U5O A;  3V92 A;  1FGM A;  2J8X B;  3BND A;  2CG0 A;  3AGO A;  2D42 A;  3IMA B;  2KF5 A;  3OWY A;  3MG1 A;  4GL6 A;  5DRV A;  2CX1 A;  1NDO B;  1Q7H A;  5M1A A;  2CKF B;  1A2K A;  4RBN A;  1WMO A;  2XSH B;  2QGU A;  5EEO A;  1SII A;  1RSN A;  3EF8 A;  1WQL B;  4J5G A;  3UNL A;  3A76 A;  1BU4 A;  3OWS A;  1I70 A;  1WMN A;  1B2S A;  5CF1 A;  2QA4 3;  4I4K A;  1VQQ A;  3CXC 2;  2Z77 A;  3Q3F A;  1O7G B;  5IG0 A;  8CHO A;  3BNE A;  2IYJ A;  1GD3 A;  2KCD A;  3B4O A;  2SAR A;  3FG4 A;  3SXX A;  4BU4 A;  1M9G A;  1E3R A;  3DY5 A;  1O7M B;  2IMJ A;  3GZB A;  5KP4 A;  3S27 A;  1GMQ A;  1VQ8 3;  3G16 A;  3WA2 X;  1BSB A;  1YJN 3;  1K73 4;  2F86 B;  3K5T A;  1EG9 B;  1QVF 2;  1W01 A;  1YIT 3;  1RN1 A;  3PZW A;  3WOD G;  3E99 A;  1JBS A;  3MPH A;  6STD A;  3G8Z A;  3DGM A;  1KWI A;  2FXT A;  3B4P A;  7GSP A;  1A2P A;  5EVH A;  1D6U A;  2HMO B;  1B2Z A;  1W2Z A;  1BRK A;  1MOL A;  1ZGX A;  1Y4K A;  3D4A A;  2BMO B;  1BGS A;  1LOX A;  1W6C A;  3D5G A;  1GYB A;  3OX9 A;  1N9E A;  3BLZ A;  1JZO A;  2HOH A;  1OAC A;  1W5Z A;  1YI2 3;  3AMO B;  1TRQ A;  2HMM B;  3F8H A;  1W4N A;  4I5Q A;  2GEX A;  1VQP 3;  1BSE A;  3HOH A;  3CCM 3;  1IDP A;  2JDI H;  1JZD A;  3BNB A;  4HM7 B;  4XDW A;  1BNR A;  1D6Y A;  1X1Y A;  5IEN A;  5M19 A;  3MSO A;  1CH0 A;  1BRI A;  2KXG A;  3ER7 A;  2W04 A; 
#chains in the Genus database with same CATH homology
 2YFJ B;  1VQ6 3;  2R4I A;  1NB3 I;  4H61 A;  1W00 A;  3KSE D;  3EBY A;  5BVB A;  3S29 A;  1ASK A;  1GS3 A;  3EE1 A;  3G71 3;  1UUW B;  2CFL A;  1IK3 A;  2IUK A;  3UL5 A;  2OOV C;  1IT8 A;  3LT8 A;  2W56 A;  1VQO 3;  3GZY B;  2Y73 A;  3ALA A;  3N8B A;  4WFO A;  3EX9 A;  4GB5 A;  2BMR B;  1IQ8 A;  2IA7 A;  2FGT A;  5DRE A;  1YVB I;  1IVX A;  3Q1C A;  2P0X A;  2CFG A;  5BXQ A;  3F8X A;  3OWU A;  1TU5 A;  4XBT A;  3FCS B;  4R9K A;  4OUQ A;  4N6T A;  4K90 B;  4K61 A;  3BB9 A;  5KP3 A;  4KFF A;  1YHQ 3;  1YIJ 3;  4X2H A;  1L5G B;  2YX9 A;  3CCS 3;  1GD4 A;  1W02 A;  2WGQ A;  3WOF B;  3AMO A;  1UI7 A;  2QIY A;  1JJ2 2;  3EC9 A;  3F7S A;  3LYG A;  2B1X B;  2YFI B;  4FMB A;  4HM0 B;  3VF1 A;  3GWR A;  3EN1 B;  2INX A;  5STD A;  3GRD A;  4N6N B;  1ULJ B;  3HK4 A;  4IPB A;  2C11 A;  2D1W A;  2I9W A;  4HBR A;  2B24 B;  4HJL B;  5LC7 A;  1N5H A;  3KSP A;  3CME 3;  1F8N A;  4U13 A;  1Q81 4;  3Q90 A;  3NQZ A;  4O3V A;  2W9P A;  5AII A;  4JRF A;  4CDL A;  3NM7 A;  1CQS A;  1W6G A;  4KFD A;  3CD6 3;  2CFK A;  1VQ4 3;  4K1V A;  2XR8 B;  3FF2 A;  4MJD A;  3HII A;  4N6M A;  3MKI A;  1OHO A;  4BTX A;  3I0Y A;  2ZL8 A;  3RGA A;  4XDV A;  4TX4 A;  2W9Q A;  2ML6 A;  4HZ9 B;  3CPW 2;  1ZX2 A;  4HM4 B;  4R80 A;  3CCV 3;  2OCT A;  2V1L A;  1QAK A;  1HKX A;  1Q40 A;  3F9S A;  4EV5 A;  4MMX B;  2PNC A;  4J9A A;  1EA2 A;  5JBS A;  3JVC A;  1UW1 A;  2CIU A;  3FH1 A;  4Q53 A;  3CCR 3;  2PZV A;  3M8C A;  4G1M B;  4CCV A;  2L4V A;  1OGZ A;  3FG1 A;  3L0R A;  2BNG A;  2P38 A;  3B8L A;  2WOF A;  5D82 A;  2K0M A;  3JUQ A;  5LC6 A;  1O7H B;  5IF6 A;  1VQM 3;  1TFO A;  4EYC A;  1E97 A;  3DXO A;  1KSI A;  4IT7 A;  1ROV A;  1CEW I;  2HMK B;  1OF5 A;  2WOH A;  2XGL A;  3LML A;  2RFR A;  4HKV B;  1FA3 A;  1TFK A;  1ZO2 A;  2YFL B;  3K63 A;  1Z1S A;  1DVD A;  3N54 B;  3PXM A;  1RRL A;  3ECF A;  3O8Y A;  3G6E 3;  2OOV A;  4RZM A;  2C10 A;  3MHE A;  1UUV B;  5IEO A;  1FGQ A;  2CW9 A;  1Q86 4;  3EB8 A;  3RDE A;  3V98 A;  2QEX 3;  1JB2 A;  1K41 A;  2O9U X;  1QAF A;  4XM4 A;  3NHX A;  4HZB B;  1VQ7 3;  4HM3 B;  2GXF A;  3G0K A;  1IVV A;  3LZA A;  2LYX A;  4FMD A;  4KVH A;  3T8U A;  1DYU A;  2BMQ B;  3DGO A;  3LTD A;  4K1U A;  3LTA A;  1S5A A;  1W7C A;  3CC4 3;  1W6Y A;  4MMY B;  3SX1 A;  2XSO B;  1K8A 4;  3NX0 A;  2E2V A;  3B7C A;  5CLK A;  4KFE A;  5IG4 A;  2CH9 A;  2CWU A;  2UX0 A;  3NV0 B;  5TGN A;  5IW9 A;  2WO0 A;  1GY5 A;  3BNC A;  4L8O A;  3I56 3;  1MNL A;  5FW5 A;  1TIJ A;  1KD1 4;  2A15 A;  3TDG A;  1VQ9 3;  1LNH A;  3OXA A;  3JUN A;  1VQL 3;  2W2C A;  1S72 3;  5IER A;  3CCU 3;  2HML B;  3HZP A;  5AYR B;  1NB5 I;  1JB5 A;  1G96 A;  4RNZ A;  2XRX B;  5IG5 A;  4R1K A;  5IEP A;  1EQK A;  3DMC A;  3LTC A;  4XBY A;  3X3Y A;  1STD A;  1STF I;  1DMQ A;  3I55 3;  1M1K 4;  3KN4 A;  3LH4 A;  3NBB A;  1IVU A;  1OHS A;  3EQQ B;  3X40 A;  4R9L A;  4LZI A;  3UL6 A;  1WMP A;  3LOY A;  4OK0 A;  3LT9 A;  1OHP A;  3MYT A;  4HM2 B;  5JPP A;  4NHF A;  3QK9 A;  4N6O B;  1FUW A;  4EBG A;  1DMM A;  1IV9 A;  1N9J A;  1QJG A;  3U1W A;  5G2G A;  4QWT A;  5IG3 A;  4L7K A;  3WDG B;  1WNH A;  3KE7 A;  4EXR A;  1TP6 A;  1JN5 B;  1NU3 A;  1Q82 4;  4LSO A;  3IPT A;  4H3U A;  1V74 A;  1SJW A;  3NV0 A;  1M90 4;  3IJE B;  1ISK A;  1AR0 A;  2CWV A;  1OCV A;  1J2B A;  4PEJ A;  1JNQ A;  2KRT A;  2BT3 A;  2RGQ A;  3VSY A;  3NQY A;  2Z76 A;  1JRQ A;  1OPY A;  3CNM A;  1GY7 A;  4FMC A;  5FGO A;  4HM8 B;  3X3Z A;  3K7C A;  2W6J H;  4KZ1 A;  2BO9 B;  3PS8 A;  1RKY A;  1Q7Y 4;  3CCE 3;  2Z6B A;  5AIF A;  1VQK 3;  3J7Y d;  2Z7A A;  1AVK A;  2RCD A;  4EV2 A;  5A0O B;  1YJW 3;  1QMA A;  5ELU A;  2Y74 A;  3EBT A;  2F99 A;  4AKZ A;  5AEU B;  1O7W B;  3ROB A;  1LVN A;  2SBL A;  4N6L A;  3T0U A;  2P05 A;  4FR9 A;  3K0Z A;  1AVL A;  3MG2 A;  2OQE C;  4O8S A;  3S28 A;  1D6Z A;  3D9R A;  3KFQ C;  4J8T A;  5I97 A;  3FLJ A;  5CK6 A;  1FGR A;  4JF8 A;  3S5C A;  3JUP A;  3WOE B;  2ZDJ A;  4HVN A;  4X2O A;  3LXU X;  1JN5 A;  4WWU C;  1DMN A;  3FZW A;  2W0Q A;  5D81 A;  1JB4 A;  3PCS A;  4XB5 A;  1FGT A;  2GU1 A;  2E2U A;  4XBX A;  3WA3 A;  2JQ5 A;  2E2T A;  3OW2 2;  2F98 A;  2XGN A;  3UB1 A;  2CFD A;  1AV4 A;  3KKG A;  3CPO A;  3LTB A;  2M7O A;  3PYJ A;  3X41 A;  3PGB A;  1SIH A;  3EN8 A;  1ULI B;  1SPU A;  1VZZ A;  1N8Q A;  2CK3 H;  1US1 A;  2GBW B;  1NWW A;  2STD A;  4OVM A;  2XFT A;  1WTH A;  3FKA A;  2LQV A;  3U97 A;  1SQW A;  4LMI A;  4LEH A;  3S67 A;  3DGN A;  2HMJ B;  3HI7 A;  3GAX A;  1RJO A;  3DZL A;  1IT7 A;  2W56 B;  3MG3 A;  4FCZ A;  1C7H A;  4R4K A;  2XF3 A;  4WYK B;  1E3V A;  3SED A;  4HYZ A;  4ZM8 A;  1IV7 A;  3KZT A;  5JPU A;  1K9M 4;  2GBX B;  1JKG B;  3F7X A;  5EQL A;  5CF2 A;  1FGO A;  4BTY A;  2P0M A;  3GZR A;  2W03 A;  3CU3 A;  3K9M C;  3MWZ A;  3N9H A;  1OUN A;  3NBR A;  4ORL A;  2O3O A;  1O7N B;  3NXJ A;  4HM6 B;  3SVA A;  4BTW A;  1QVG 2;  2Q07 A;  2ML5 A;  7STD A;  1IVW A;  3HX8 A;  4FCM A;  1T5Y A;  2OTJ 3;  3KII A;  4EC6 A;  2CFW A;  3PCR A;  4STD A;  3STD A;  1R4C A;  2XFS A;  3NM2 A;  1A67 A;  3SOY A;  1OGX A;  3EHC A;  3H3H A;  3JUO A;  1PFP A;  3JUM A;  3V99 A;  3H51 A;  4O2H A;  4WP5 A;  1GY6 A;  4IIA A;  1YGE A;  3CCJ 3;  2HMN B;  4HM5 B;  1ROA A;  1QAL A;  4LGQ A;  2RSX A;  1RRH A;  1NO3 A;  4AKY A;  1IQX A;  2CWT A;  1O7P B;  3FF0 A;  1U8C B;  1KQS 2;  2OQE A;  3SLU A;  4WHA A;  5CXO A;  3DM8 A;  3QRD A;  5ELJ A;  1IQY A;  3WMD A;  3HIG A;  3OV4 A;  3RGR A;  1LXE A;  4WYK A;  1N8R 4;  4HM1 B;  3F14 A;  1N5P A;  1CYV A;  2XEP A;  1JKG A;  5KP1 A;  3CMA 3;  3EJV A;  4FMA A;  1Q40 B;  3CC2 3;  3G4S 3;  5AYS C;  2OWP A;  1BUQ A;  5AEW B;  1UI8 A;  2WGO A;  2FNQ A;  3CNX A;  3D3L A;  4N6U A;  2CG1 A;  2XH9 A;  4MEI A;  1W2B 2;  4AEQ A;  3DGL A;  1EKM A;  1CYU A;  2IUJ A;  4L8P A;  2CC3 A;  1JV2 B;  3CCQ 3;  4N3V A;  3NUV A;  5D83 A;  1OF5 B;  2CHC A;  1DVC A;  3FGY A;  4N6V 0;  3X42 A;  4NRE A;  1HU9 A;  5AIG A;  3DUK A;  2MF7 A;  3F40 A;  1M1X B;  4MMZ B;  1IU7 A;  3X3X A;  3CCL 3;  1TUH A;  5HGR A;  3UJM A;  3Q2P A;  1A2V A;  4FCJ A;  5AIH A;  1Q42 A;  2P09 A;  3VGN A;  3T8N A;  4RNY A;  3GZX B;  2MC8 A;  1VQ5 3;  3FSD A;  3NBJ A;  3FG3 A;  4O02 B;  2K54 A;  2GEY A;  1K28 A;  1VQN 3;  3SOA A;  1KC8 4;  1RN7 A;  2GU3 A;  2OTL 3;  1OH0 A;  1PU4 A;  3CC7 3;  5AI1 A;  1NJI 4;  2BHM A;  1U5O A;  3V92 A;  1FGM A;  4GL6 A;  3BND A;  2CG0 A;  3IMA B;  2D42 A;  3OWY A;  5DRV A;  1YJ9 3;  3MG1 A;  1A90 A;  1NDO B;  2CKF B;  1A2K A;  4RBN A;  1WMO A;  2XSH B;  2QGU A;  5EEO A;  1SII A;  3EF8 A;  1WQL B;  3UNL A;  3A76 A;  3OWS A;  5CF1 A;  1WMN A;  2QA4 3;  4I4K A;  3CXC 2;  2Z77 A;  5IG0 A;  1O7G B;  8CHO A;  3BNE A;  3B4O A;  1GD3 A;  2KCD A;  3FG4 A;  3SXX A;  1M9G A;  1E3R A;  3DY5 A;  1O7M B;  2IMJ A;  3GZB A;  5KP4 A;  3S27 A;  1VQ8 3;  3G16 A;  3WA2 X;  1YJN 3;  1K73 4;  2F86 B;  3K5T A;  1EG9 B;  1QVF 2;  1W01 A;  1YIT 3;  3PZW A;  3WOD G;  3E99 A;  3MPH A;  6STD A;  3G8Z A;  3DGM A;  1KWI A;  2FXT A;  3B4P A;  5EVH A;  1D6U A;  2HMO B;  1W2Z A;  1MOL A;  1Y4K A;  2BMO B;  1W6C A;  1LOX A;  1GYB A;  3OX9 A;  1N9E A;  3BLZ A;  1OAC A;  1W5Z A;  1YI2 3;  3AMO B;  2HMM B;  3F8H A;  1W4N A;  2GEX A;  1VQP 3;  3CCM 3;  1IDP A;  2JDI H;  3BNB A;  4HM7 B;  4XDW A;  1D6Y A;  5IEN A;  3MSO A;  2KXG A;  3ER7 A;  2W04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...