2WGOA

Structure of ranaspumin-2, a surfactant protein from the foam nests of a tropical frog
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
GSLILDGDLLKDKLKLPVIDNLFGKELLDKFQDDIKDKYGVDTKDLKILKTSEDKRFYYVSVDAGDGEKCKFKIRKDVDVPKMVGRKCRKDDDDDDGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ranaspumin-2: Structure and Function of a Surfactant Protein from the Foam Nests of a Tropical Frog.
pubmed doi rcsb
source organism Engystomops pustulosus
molecule tags Surfactant protein
molecule keywords RANASPUMIN-2
total genus 24
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2009-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.260 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2wgoA00
2WGOA
chains in the Genus database with same CATH superfamily
4GB5A 3X40A 1BSAA 1UDII 3WODG 1NO3A 1RRLA 2BO9B 2YX9A 4WYKA 3U97A 2RBIA 4XDVA 4WYKB 3DGMA 1IT7A 1L5GB 1ZO2A 6RNTA 2O9UX 1RCLA 3NBJA 1RN1A 4GL6A 1S723 1KSIA 5G2GA 2H0IA 2UX0A 4AKZA 5FW5A 8RNTA 1MNLA 1SARA 1AR0A 1TFOA 2IYJA 2KRTA 1CEWI 4HZBB 1D6ZA 1GD4A 1E3VA 4LSOA 1PFPA 5JPPA 1IVUA 1Q7HA 2CIUA 2HMKB 1BRJA 1RHLA 2P05A 2P0MA 3Q3FA 2F86B 1OHPA 4MMZB 2IUKA 2HMLB 3T8NA 1LOYA 2OWPA 1T2IA 2FNQA 3CMA3 2Y73A 3DGOA 1BU4A 2B1XB 1OHSA 3CCJ3 2XSHB 1SJWA 3X3YA 3AHSA 2GEYA 1VQ53 3HZPA 4J5KA 2XR8B 4LYLB 4KT3B 1TFKA 2RFRA 4R4KA 2OTL3 1AQZA 2SARA 1K734 2I9WA 1JKGB 1NB5I 3CCM3 4ILFA 3MG1A 1LQGC 2F56A 1E3RA 1RNBA 1RCKA 1STDA 5ELUA 1WMPA 3E99A 4HM2B 3FSDA 1FGQA 3NBRA 3PXMA 1ROVA 1FUTA 1FGRA 3STDA 3DGLA 3JUPA 2PNCA 3DH2A 1LNIA 4HM0B 3K7CA 1N8QA 2KF4A 4Q53A 3CCL3 1LOXA 3FGYA 3HOHA 3GZRA 1B21A 2RCDA 3MSOA 3V92A 3GSPA 1VQ83 1BNRA 1GMRA 3OWUA 1A2KA 1EKMA 3T8UA 3HIIA 4XBXA 3F40A 3CCV3 3X3XA 3ZG5A 1Q40B 5HOHA 3PZWA 3SX1A 3ALAA 4HM8B 3G0KA 2CFLA 1YJN3 4N6OB 2CWUA 3VGNA 1MWRA 3VSYA 1HYFA 1BRIA 3FZWA 3F7SA 1OF5A 1KQS2 3D5IA 2O3OA 4DKIA 1FGOA 1MOLA 1TP6A 1QJGA 5BIRA 4EYCA 1N8R4 4N6MA 4BL3A 1JZOA 5JPUA 1M904 1RGGA 2QGUA 3F8XA 3O8YA 4AEQA 3CC23 3WR2A 1JB4A 7GSPA 1E97A 1GSPA 4OK0A 2C11A 1W2ZA 5IEPA 1Q824 1BRNL 2OTJ3 1RLSA 1O7MB 4RNZA 1TJDA 2BIRA 2WOHA 1VQQA 5D83A 2XFTA 1MWTA 2ZL8A 3V98A 1KD14 4QWTA 1RJOA 2IMJA 4HM7B 2ZA4A 2GSPA 1QAFA 2K54A 2KF6A 2W56A 3GZXB 5IENA 5EEOA 1OF5B 3B4PA 4K61A 4BIRA 1GOYA 1N5HA 1UCJA 4L8PA 1B20A 1BVIA 1IQXA 4XM4A 3KE7A 5IF6A 3N54B 1BRSA 1D6UA 1MWSA 3J7Yd 4NPBA 4RNTA 1JBRA 1GY6A 1UGHI 1BRGA 3QRDA 1JNQA 1I3IA 1BSEA 5A0OB 3CCR3 3DXOA 3G4S3 4H61A 1FZUA 1UUWB 2GBXB 2KXGA 4BL2A 3DM8A 3V99A 1I2GA 3EB8A 2HMJB 4HZ9B 1W00A 3LXUX 4R9KA 1GS3A 2W9QA 5KP3A 3S28A 1VQM3 4MMXB 1B2ZA 2K0MA 2BMRB 2HMNB 3BNEA 2LQVA 2OOVC 3OXAA 2A15A 3NQZA 5CK6A 2L1SA 2PZVA 2CHCA 4FR9A 1CYUA 3Q2PA 1YGEA 3NM7A 1I8VA 1YGWA 1I2EA 4L7KA 2OQEC 3TDGA 3KKGA 3DGYA 4BTWA 1GOUA 5KP1A 1IVVA 2SBLA 4K1UA 1NWWA 2W2CA 1PYLA 5AIIA 2ML6A 1Q864 1YI23 1BSDA 2IY2A 2F4YA 3FG3A 1CH0A 2F5WA 3G713 3CCU3 3A5EA 4J8TA 2RNTA 4MMYB 2XRXB 1VQ43 2F5MA 2W0QA 4FMBA 3NX0A 4AKYA 2LYXA 3JVCA 2OQEA 3MPHA 4WP5A 1RGHA 3LT8A 4CJNA 2GU1A 3F8HA 2V1LA 5STDA 2XGLA 1M9GA 4RNYA 2INXA 1YVSA 3LZAA 3SLUA 5CF1A 3CCE3 1OGZA 2CX1A 1SIHA 3K0ZA 3WOFB 5CXOA 4EV5A 3D79A 2Y74A 4JRFA 1R4YA 1CQSA 1ZGXA 1UI7A 2H0HA 2STDA 5FGOA 4N3VA 3RGAA 3CD63 1EUIC 1T3BA 3BB9A 3FKAA 2GXFA 3F14A 1AVLA 5LC7A 4EV2A 1JZDA 1NNVA 1WMNA 3LTCA 1Q814 2B24B 1RSNA 2MF7A 2Z76A 3IMAB 7RNTA 1Q42A 2BMOB 4KFDA 2HMMB 1UUGB 1UI8A 3LT9A 3EX9A 5M18A 1Q40A 5BVBA 3CME3 1OHOA 5GSPA 5IEOA 3KSED 2Q07A 1BUQA 2M7OA 3OX9A 1K8A4 2CH9A 2WO0A 3N8BA 2GEXA 4IPBA 1W6YA 2E2UA 4LZIA 1W01A 3X42A 3EC9A 1K28A 1GMQA 3AMOA 3BLZA 1US1A 4HM4B 1FYSA 2CWTA 6STDA 1TRPA 2KAAA 1BAOA 1B2MA 1O7HB 1BUJA 1DMNA 1JJ22 3H51A 3LYGA 1AV4A 2P09A 2P38A 1BRKA 4RZMA 2BNGA 5DREA 3EN1B 1GY5A 4J9AA 4K90B 3D5GA 1OPYA 5G1KA 4H3UA 3FG1A 1RGKA 4J5GA 1HZ1A 3NV0B 1IYYA 1ROAA 1RGAA 2BT3A 1O7WB 5IG0A 1U5OA 1DETA 3CC73 2P0XA 3WOEB 3NV0A 1M1XB 1OCVA 2FGTA 1JV2B 1FGMA 3PCSA 4FMDA 1Z1SA 4LMIA 1QVF2 2F98A 3K5TA 1UCIA 3MG2A 3ECFA 7STDA 1W4NA 1ASKA 3AMOB 3VF1A 3NUVA 1LQMB 4N6NB 2C4BA 5IERA 1QMAA 1LOVA 5IG5A 3BNDA 3T0UA 1JB2A 1JN5A 3DGNA 4HOHA 1FW7A 5I97A 1B2XA 3UJMA 4KZ1A 1T5YA 1ZX2A 1Q7Y4 1LNHA 3KSPA 5AI1A 1JKGA 1UCKA 2E2VA 3FH1A 3KIIA 2CFKA 1A2PA 1G02A 3D3LA 4N6TA 4TX4A 4ZM8A 5D82A 3LH4A 1C54A 9RNTA 3OW22 3F7XA 3SXXA 2HMOB 4WHAA 4JF8A 4N6V0 1B27A 1KWIA 1V57A 3WHOA 1RTUA 2KF3A 1YHQ3 2BMQB 1OH0A 2BHMA 2Z77A 4KFEA 4PEJA 4WWUC 5AYSC 1F8NA 3B7CA 1I0XA 3OWSA 1B2UA 5G1LA 1X1XA 4EW5A 3LOYA 3MKIA 4MJDA 2HOHA 4FCZA 1O7NB 3DUKA 1VQL3 1FUSA 4FCMA 5D81A 4IT7A 1EQKA 2W9PA 1FA3A 3PGBA 1BNFA 3G16A 3KCHA 1I70A 3GZBA 1TU5A 3FCSB 4FCJA 2F99A 1IT8A 3RNTA 1VQO3 3FF0A 1QVG2 3BIRA 1NJI4 2IUJA 3EE1A 3CU3A 3SYUA 2JQ5A 3LMLA 1JBSA 3D4AA 1GD3A 2MC8A 4XBYA 1LVNA 1JB5A 2UGIA 3MG3A 3DZLA 1IQYA 3CXC2 1TRQA 3SOYA 1DVCA 1YJ93 2XEPA 5AIGA 3K63A 4FMAA 1RGLA 4L8OA 5AIFA 3H3HA 2E2TA 2L4VA 4KVHA 1N9JA 3B8LA 3IPTA 3SOAA 3MWZA 1BANA 1UGIA 5AEUB 1RRHA 4XB5A 1DVDA 1G0TA 3EJVA 3CPW2 3PCRA 3BU4A 1RGEA 1NU3A 3N9HA 1YIT3 3HK4A 1J2BA 1RNTA 2CFDA 1LOWA 3JUOA 3NBBA 3ER7A 3CPOA 3RDEA 2D42A 3S29A 1VQ93 3HI7A 2Z7AA 3FF2A 4R80A 1IU7A 2GBWB 1YJW3 2CFGA 3X41A 4OVMA 3SVAA 1GMPA 5KP4A 1M1K4 1IV9A 4HBRA 4N6UA 1NB3I 1WMOA 2QA43 1YNVX 4HAAA 3NM2A 3F9SA 2YFLB 1O7PB 3I0YA 3CC43 3EHCA 1S5AA 3NXJA 4I4KA 4XBTA 3AGNA 3B4OA 1X1WA 1GY7A 5AYRB 8CHOA 1BNEA 3DMCA 3Q90A 3EBTA 5IW9A 3DY5A 5BU4A 3G6E3 2IA7A 1RMSA 1AY7A 3LTDA 4CDLA 1RGCA 3UL5A 1EG9B 1A90A 1BSCA 6GSPA 2JDIH 3UNLA 2BU4A 4EBGA 3M8CA 2AADA 5AEWB 1FUWA 3LTBA 4HYZA 1B2SA 3K9MC 4K1VA 3CNXA 3BNCA 1UW1A 5CLKA 1A67A 3D9RA 1MGWA 3ZG0A 3RGRA 5CF2A 3X3ZA 5RNTA 4EC6A 2XSOB 3EN8A 3WMDA 3PYJA 2K3DA 4HM5B 4X2HA 1IDPA 1W6GA 1B3SA 2WOFA 3SEDA 2ZDJA 1W5ZA 4CCVA 1T2HA 4KFFA 1UCLA 1RN7A 1OACA 1N5PA 4U13A 1EA2A 1HU9A 1V58A 2KF5A 4R1KA 1NDOB 2CFWA 1QAKA 1OUNA 4MEIA 1VQP3 1KC84 1SIIA 1ULIB 1W6CA 1WQLB 2C10A 3CNMA 4RBNA 5TGNA 1VQ63 3I553 4GSPA 1GYBA 1BOXA 3G8ZA 1JBTA 1VZZA 1C7HA 4I5QA 1QALA 3UL6A 1WTHA 3KZTA 3OV4A 3CCQ3 2UUGC 3U1WA 1IV7A 2W03A 1EEJA 1HKXA 1RN4A 5IG3A 3GAXA 2H0GA 1UUVB 3FG4A 3CCS3 4O2HA 3I563 1MWUA 2XF3A 4O3VA 1VQK3 4GHOA 2AAEA 1X1UA 2CW9A 1W02A 1OGXA 5JBSA 3L0RA 3Q1CA 2WGQA 2XFSA 5BXQA 3EBYA 2OOVA 2XH9A 1AVKA 1X1YA 4CPKA 2R41A 1TUHA 5HGRA 3KN4A 2CC3A 1CYVA 1LRAA 3GWRA 1ULJB 3PS8A 1U8CB 3GZYB 4EXRA 2CG1A 4LGQA 3MYTA 2CWVA 1BNIA 1IK3A 1RKYA 3HX8A 4ORLA 4NHFA 4OUQA 5M1AA 4HJLB 2FXTA 1G96A 2CX0A 1SQWA 2R4IA 3BNBA 2XGNA 4HM6B 1IVWA 1DYUA 1SPUA 1BNGA 5EQLA 1VQN3 1K41A 2OCTA 1IVXA 4G1MB 1JRQA 1ISKA 3ROBA 3OWYA 4N6LA 4WFOA 3S5CA 1GOVA 1O7GB 5DRVA 5M19A 1BSBA 3AHWA 2W6JH 1YVBI 5ELJA 3NHXA 1D6YA 1FGTA 2QEX3 3EQQB 1BGSA 3A76A 1DE3A 1LXEA 2RSXA 2W56B 1TIJA 1YIJ3 1TTOA 1V74A 1K9M4 3UB1A 3AGOA 4BTYA 2D1WA 3MHEA 3QK9A 1RDSA 4HKVB 3URPA 3HIGA 4XDWA 1PY3A 1I0VA 1I2FA 1VQ73 2YFJB 3S27A 1A2VA 1DMQA 4FMCA 3JUMA 4IIAA 1PU4A 1Q9EA 1JN5B 4O02B 4X2OA 2RGQA 3WA3A 3IJEB 1WNHA 1BRHA 1W7CA 1IQ8A 3NQYA 3WDGB 2W04A 5LC6A 3KFQC 3WA2X 3ZFZA 4BU4A 3S67A 1W2B2 4LEHA 4STDA 4BTXA 3FLJA 3JUNA 1R4CA 2KCDA 4HM3B 2GU3A 2ML5A 2ZHXB 4HVNA 4NREA 3LTAA 1RGFA 1Y4KA 2YFIB 5IG4A 2QIYA 1I3FA 1N9EA 2J8XB 5EVHA 2CKFB 2CK3H 2WGOA 3JUQA 1BNSA 2Z6BA 4O8SA 5AIHA 3GRDA 4HM1B 4R9LA 1DMMA 3EF8A 1BNJA 1ZS7A 2CG0A 1STFI 1MGRA 1BIRA
chains in the Genus database with same CATH topology
4GB5A 3X40A 3WODG 1NO3A 1RRLA 2BO9B 2YX9A 4WYKA 3U97A 4XDVA 4WYKB 3DGMA 1IT7A 1L5GB 1ZO2A 2O9UX 3NBJA 4GL6A 1S723 1KSIA 5G2GA 2UX0A 4AKZA 5FW5A 1MNLA 1AR0A 1TFOA 2KRTA 4HZBB 1CEWI 4LSOA 1D6ZA 1GD4A 1E3VA 1PFPA 5JPPA 1IVUA 2CIUA 2HMKB 2P0MA 2P05A 2F86B 1OHPA 4MMZB 2IUKA 2HMLB 3T8NA 2OWPA 2FNQA 3CMA3 2Y73A 3DGOA 2B1XB 1OHSA 3CCJ3 2XSHB 1SJWA 3X3YA 2GEYA 1VQ53 3HZPA 2XR8B 1TFKA 2RFRA 4R4KA 2OTL3 1K734 2I9WA 1JKGB 1NB5I 3CCM3 3MG1A 1E3RA 1STDA 5ELUA 1WMPA 3E99A 4HM2B 3FSDA 1FGQA 3NBRA 1ROVA 1FGRA 3STDA 3DGLA 3JUPA 2PNCA 4HM0B 3K7CA 1N8QA 3CCL3 4Q53A 1LOXA 3FGYA 3GZRA 2RCDA 1VQ83 3MSOA 3V92A 3OWUA 1A2KA 1EKMA 3T8UA 3HIIA 4XBXA 3F40A 3CCV3 3X3XA 1Q40B 3PZWA 3SX1A 3ALAA 4HM8B 3G0KA 2CFLA 1YJN3 4N6OB 2CWUA 3VGNA 3VSYA 3FZWA 3F7SA 1OF5A 1KQS2 2O3OA 1MOLA 1FGOA 1TP6A 1QJGA 1N8R4 4EYCA 4N6MA 5JPUA 1M904 3O8YA 2QGUA 3F8XA 3CC23 4AEQA 1JB4A 1E97A 4OK0A 2C11A 1W2ZA 5IEPA 1Q824 2OTJ3 1O7MB 4RNZA 2WOHA 5D83A 2XFTA 3V98A 2ZL8A 1KD14 4QWTA 1RJOA 2IMJA 4HM7B 1QAFA 2K54A 2W56A 3GZXB 5IENA 5EEOA 1OF5B 3B4PA 4K61A 1N5HA 4L8PA 1IQXA 4XM4A 3KE7A 5IF6A 3N54B 3J7Yd 1D6UA 1GY6A 3QRDA 5A0OB 1JNQA 3CCR3 3DXOA 3G4S3 4H61A 1UUWB 2GBXB 2KXGA 3DM8A 3V99A 3EB8A 2HMJB 4HZ9B 1W00A 3LXUX 4R9KA 1GS3A 2W9QA 5KP3A 3S28A 1VQM3 4MMXB 2K0MA 2BMRB 2HMNB 3BNEA 2LQVA 2OOVC 3OXAA 2A15A 3NQZA 5CK6A 2PZVA 4FR9A 2CHCA 1CYUA 3Q2PA 1YGEA 3NM7A 4L7KA 2OQEC 3TDGA 3KKGA 4BTWA 5KP1A 1IVVA 2SBLA 4K1UA 1NWWA 2W2CA 5AIIA 2ML6A 1Q864 1YI23 3FG3A 3G713 3CCU3 4J8TA 4MMYB 1VQ43 2XRXB 4FMBA 2W0QA 3NX0A 4AKYA 2LYXA 3JVCA 2OQEA 3MPHA 4WP5A 3LT8A 2GU1A 3F8HA 2V1LA 5STDA 2XGLA 1M9GA 4RNYA 2INXA 3LZAA 3SLUA 5CF1A 3CCE3 1OGZA 1SIHA 3K0ZA 3WOFB 5CXOA 4EV5A 2Y74A 4JRFA 1CQSA 2STDA 1UI7A 3RGAA 5FGOA 4N3VA 3CD63 3BB9A 3FKAA 2GXFA 3F14A 1AVLA 5LC7A 4EV2A 1WMNA 3LTCA 1Q814 2B24B 2Z76A 2MF7A 3IMAB 1Q42A 2BMOB 4KFDA 2HMMB 3LT9A 1UI8A 3EX9A 1Q40A 5BVBA 3CME3 1OHOA 5IEOA 3KSED 2Q07A 1BUQA 2M7OA 3OX9A 1K8A4 2CH9A 2WO0A 3N8BA 2GEXA 4IPBA 1W6YA 2E2UA 4LZIA 1W01A 3X42A 3EC9A 1K28A 3BLZA 3AMOA 1US1A 4HM4B 2CWTA 6STDA 1O7HB 1DMNA 1JJ22 3H51A 3LYGA 1AV4A 2P09A 2P38A 4RZMA 2BNGA 5DREA 3EN1B 1GY5A 4J9AA 4K90B 1OPYA 4H3UA 3FG1A 3NV0B 1ROAA 2BT3A 1O7WB 5IG0A 1U5OA 3CC73 2P0XA 3WOEB 3NV0A 1M1XB 2FGTA 1OCVA 1JV2B 1FGMA 3PCSA 4FMDA 1Z1SA 4LMIA 1QVF2 2F98A 3K5TA 3MG2A 3ECFA 7STDA 1W4NA 3AMOB 1ASKA 3VF1A 3NUVA 4N6NB 5IERA 1QMAA 5IG5A 3BNDA 3T0UA 1JB2A 1JN5A 3DGNA 5I97A 3UJMA 4KZ1A 1T5YA 1ZX2A 1Q7Y4 1LNHA 3KSPA 5AI1A 1JKGA 2E2VA 3FH1A 3KIIA 2CFKA 3D3LA 4N6TA 4TX4A 4ZM8A 5D82A 3LH4A 3OW22 3F7XA 3SXXA 2HMOB 4WHAA 4JF8A 1KWIA 1YHQ3 2BMQB 1OH0A 2BHMA 2Z77A 4KFEA 4PEJA 4WWUC 5AYSC 1F8NA 3B7CA 3OWSA 3LOYA 3MKIA 4MJDA 4FCZA 1O7NB 3DUKA 1VQL3 5D81A 4FCMA 4IT7A 1EQKA 2W9PA 1FA3A 3PGBA 3G16A 3GZBA 1TU5A 3FCSB 4FCJA 2F99A 1IT8A 1VQO3 1QVG2 3FF0A 1NJI4 2IUJA 3EE1A 3CU3A 2JQ5A 3LMLA 1GD3A 2MC8A 4XBYA 1LVNA 1JB5A 3MG3A 3DZLA 1IQYA 3CXC2 3SOYA 1DVCA 1YJ93 2XEPA 5AIGA 3K63A 4FMAA 4L8OA 5AIFA 3H3HA 2E2TA 2L4VA 4KVHA 1N9JA 3B8LA 3IPTA 3SOAA 3MWZA 5AEUB 1RRHA 4XB5A 1DVDA 3EJVA 3CPW2 3PCRA 1NU3A 3N9HA 1YIT3 3HK4A 1J2BA 2CFDA 3JUOA 3NBBA 3ER7A 3CPOA 3RDEA 2D42A 3S29A 1VQ93 3HI7A 2Z7AA 3FF2A 4R80A 1IU7A 2GBWB 1YJW3 2CFGA 3X41A 4OVMA 3SVAA 5KP4A 1M1K4 1IV9A 4HBRA 4N6UA 1NB3I 1WMOA 2QA43 3NM2A 3F9SA 2YFLB 1O7PB 3I0YA 3CC43 3EHCA 1S5AA 3NXJA 4I4KA 4XBTA 3B4OA 1GY7A 5AYRB 8CHOA 3DMCA 3Q90A 3EBTA 5IW9A 3DY5A 3G6E3 2IA7A 4CDLA 3LTDA 3UL5A 1EG9B 1A90A 2JDIH 3UNLA 5AEWB 4EBGA 3M8CA 1FUWA 3LTBA 4HYZA 3K9MC 4K1VA 3CNXA 3BNCA 1UW1A 5CLKA 1A67A 3D9RA 5CF2A 3RGRA 3X3ZA 4EC6A 2XSOB 3EN8A 3WMDA 3PYJA 4HM5B 4X2HA 1IDPA 1W6GA 2WOFA 3SEDA 2ZDJA 1W5ZA 4CCVA 4KFFA 1RN7A 1OACA 1N5PA 4U13A 1EA2A 1HU9A 4R1KA 1NDOB 2CFWA 1QAKA 1OUNA 4MEIA 1VQP3 1KC84 1SIIA 1ULIB 1W6CA 1WQLB 2C10A 3CNMA 4RBNA 5TGNA 1VQ63 1GYBA 3G8ZA 1VZZA 1C7HA 1QALA 3UL6A 1WTHA 3KZTA 3OV4A 3CCQ3 3U1WA 1IV7A 2W03A 1HKXA 5IG3A 3GAXA 1UUVB 3FG4A 3CCS3 4O2HA 3I563 2XF3A 4O3VA 1VQK3 2CW9A 1W02A 1OGXA 5JBSA 3L0RA 3Q1CA 2WGQA 2XFSA 5BXQA 3EBYA 2OOVA 2XH9A 1AVKA 1TUHA 5HGRA 3KN4A 2CC3A 1CYVA 3GWRA 1ULJB 3PS8A 1U8CB 3GZYB 4EXRA 2CG1A 4LGQA 3MYTA 2CWVA 1IK3A 1RKYA 3HX8A 4ORLA 4NHFA 4OUQA 4HJLB 2FXTA 1G96A 2R4IA 1SQWA 4N6V0 3BNBA 2XGNA 4HM6B 1IVWA 1DYUA 1SPUA 5EQLA 1VQN3 1K41A 2OCTA 1IVXA 4G1MB 1JRQA 1ISKA 3ROBA 3OWYA 4N6LA 4WFOA 3S5CA 1O7GB 5DRVA 2W6JH 1YVBI 5ELJA 3NHXA 1D6YA 1FGTA 2QEX3 3EQQB 3A76A 1LXEA 2RSXA 2W56B 1TIJA 1YIJ3 1V74A 1K9M4 3UB1A 4BTYA 2D1WA 3MHEA 3QK9A 4HKVB 3HIGA 4XDWA 1VQ73 2YFJB 3S27A 1A2VA 1DMQA 4FMCA 3JUMA 4IIAA 1PU4A 4O02B 1JN5B 4X2OA 3WA3A 2RGQA 3IJEB 1WNHA 1W7CA 1IQ8A 3NQYA 3WDGB 2W04A 5LC6A 3KFQC 3WA2X 3I553 1W2B2 3S67A 4LEHA 4STDA 4BTXA 3FLJA 3JUNA 1R4CA 2KCDA 4HM3B 2GU3A 2ML5A 4HVNA 4NREA 3LTAA 1Y4KA 2YFIB 5IG4A 2QIYA 1N9EA 5EVHA 2WGOA 2CK3H 2CKFB 3JUQA 2Z6BA 4O8SA 5AIHA 3GRDA 4HM1B 4R9LA 1DMMA 3EF8A 2CG0A 1STFI 3PXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGO A; 
#chains in the Genus database with same CATH topology
 4GB5 A;  3X40 A;  1BSA A;  1UDI I;  3WOD G;  1NO3 A;  1RRL A;  2BO9 B;  2YX9 A;  4WYK A;  3U97 A;  2RBI A;  4XDV A;  4WYK B;  3DGM A;  1IT7 A;  1L5G B;  1ZO2 A;  6RNT A;  2O9U X;  1RCL A;  3NBJ A;  1RN1 A;  4GL6 A;  1S72 3;  1KSI A;  5G2G A;  2H0I A;  2UX0 A;  4AKZ A;  5FW5 A;  8RNT A;  1MNL A;  1SAR A;  1AR0 A;  1TFO A;  2IYJ A;  2KRT A;  1CEW I;  4HZB B;  1D6Z A;  1GD4 A;  1E3V A;  4LSO A;  1PFP A;  5JPP A;  1IVU A;  1Q7H A;  2CIU A;  2HMK B;  1BRJ A;  1RHL A;  2P05 A;  2P0M A;  3Q3F A;  2F86 B;  1OHP A;  4MMZ B;  2IUK A;  2HML B;  3T8N A;  1LOY A;  2OWP A;  1T2I A;  2FNQ A;  3CMA 3;  2Y73 A;  3DGO A;  1BU4 A;  2B1X B;  1OHS A;  3CCJ 3;  2XSH B;  1SJW A;  3X3Y A;  3AHS A;  2GEY A;  1VQ5 3;  3HZP A;  4J5K A;  2XR8 B;  4LYL B;  4KT3 B;  1TFK A;  2RFR A;  4R4K A;  2OTL 3;  1AQZ A;  2SAR A;  1K73 4;  2I9W A;  1JKG B;  1NB5 I;  3CCM 3;  4ILF A;  3MG1 A;  1LQG C;  2F56 A;  1E3R A;  1RNB A;  1RCK A;  1STD A;  5ELU A;  1WMP A;  3E99 A;  4HM2 B;  3FSD A;  1FGQ A;  3NBR A;  3PXM A;  1ROV A;  1FUT A;  1FGR A;  3STD A;  3DGL A;  3JUP A;  2PNC A;  3DH2 A;  1LNI A;  4HM0 B;  3K7C A;  1N8Q A;  2KF4 A;  4Q53 A;  3CCL 3;  1LOX A;  3FGY A;  3HOH A;  3GZR A;  1B21 A;  2RCD A;  3MSO A;  3V92 A;  3GSP A;  1VQ8 3;  1BNR A;  1GMR A;  3OWU A;  1A2K A;  1EKM A;  3T8U A;  3HII A;  4XBX A;  3F40 A;  3CCV 3;  3X3X A;  3ZG5 A;  1Q40 B;  5HOH A;  3PZW A;  3SX1 A;  3ALA A;  4HM8 B;  3G0K A;  2CFL A;  1YJN 3;  4N6O B;  2CWU A;  3VGN A;  1MWR A;  3VSY A;  1HYF A;  1BRI A;  3FZW A;  3F7S A;  1OF5 A;  1KQS 2;  3D5I A;  2O3O A;  4DKI A;  1FGO A;  1MOL A;  1TP6 A;  1QJG A;  5BIR A;  4EYC A;  1N8R 4;  4N6M A;  4BL3 A;  1JZO A;  5JPU A;  1M90 4;  1RGG A;  2QGU A;  3F8X A;  3O8Y A;  4AEQ A;  3CC2 3;  3WR2 A;  1JB4 A;  7GSP A;  1E97 A;  1GSP A;  4OK0 A;  2C11 A;  1W2Z A;  5IEP A;  1Q82 4;  1BRN L;  2OTJ 3;  1RLS A;  1O7M B;  4RNZ A;  1TJD A;  2BIR A;  2WOH A;  1VQQ A;  5D83 A;  2XFT A;  1MWT A;  2ZL8 A;  3V98 A;  1KD1 4;  4QWT A;  1RJO A;  2IMJ A;  4HM7 B;  2ZA4 A;  2GSP A;  1QAF A;  2K54 A;  2KF6 A;  2W56 A;  3GZX B;  5IEN A;  5EEO A;  1OF5 B;  3B4P A;  4K61 A;  4BIR A;  1GOY A;  1N5H A;  1UCJ A;  4L8P A;  1B20 A;  1BVI A;  1IQX A;  4XM4 A;  3KE7 A;  5IF6 A;  3N54 B;  1BRS A;  1D6U A;  1MWS A;  3J7Y d;  4NPB A;  4RNT A;  1JBR A;  1GY6 A;  1UGH I;  1BRG A;  3QRD A;  1JNQ A;  1I3I A;  1BSE A;  5A0O B;  3CCR 3;  3DXO A;  3G4S 3;  4H61 A;  1FZU A;  1UUW B;  2GBX B;  2KXG A;  4BL2 A;  3DM8 A;  3V99 A;  1I2G A;  3EB8 A;  2HMJ B;  4HZ9 B;  1W00 A;  3LXU X;  4R9K A;  1GS3 A;  2W9Q A;  5KP3 A;  3S28 A;  1VQM 3;  4MMX B;  1B2Z A;  2K0M A;  2BMR B;  2HMN B;  3BNE A;  2LQV A;  2OOV C;  3OXA A;  2A15 A;  3NQZ A;  5CK6 A;  2L1S A;  2PZV A;  2CHC A;  4FR9 A;  1CYU A;  3Q2P A;  1YGE A;  3NM7 A;  1I8V A;  1YGW A;  1I2E A;  4L7K A;  2OQE C;  3TDG A;  3KKG A;  3DGY A;  4BTW A;  1GOU A;  5KP1 A;  1IVV A;  2SBL A;  4K1U A;  1NWW A;  2W2C A;  1PYL A;  5AII A;  2ML6 A;  1Q86 4;  1YI2 3;  1BSD A;  2IY2 A;  2F4Y A;  3FG3 A;  1CH0 A;  2F5W A;  3G71 3;  3CCU 3;  3A5E A;  4J8T A;  2RNT A;  4MMY B;  2XRX B;  1VQ4 3;  2F5M A;  2W0Q A;  4FMB A;  3NX0 A;  4AKY A;  2LYX A;  3JVC A;  2OQE A;  3MPH A;  4WP5 A;  1RGH A;  3LT8 A;  4CJN A;  2GU1 A;  3F8H A;  2V1L A;  5STD A;  2XGL A;  1M9G A;  4RNY A;  2INX A;  1YVS A;  3LZA A;  3SLU A;  5CF1 A;  3CCE 3;  1OGZ A;  2CX1 A;  1SIH A;  3K0Z A;  3WOF B;  5CXO A;  4EV5 A;  3D79 A;  2Y74 A;  4JRF A;  1R4Y A;  1CQS A;  1ZGX A;  1UI7 A;  2H0H A;  2STD A;  5FGO A;  4N3V A;  3RGA A;  3CD6 3;  1EUI C;  1T3B A;  3BB9 A;  3FKA A;  2GXF A;  3F14 A;  1AVL A;  5LC7 A;  4EV2 A;  1JZD A;  1NNV A;  1WMN A;  3LTC A;  1Q81 4;  2B24 B;  1RSN A;  2MF7 A;  2Z76 A;  3IMA B;  7RNT A;  1Q42 A;  2BMO B;  4KFD A;  2HMM B;  1UUG B;  1UI8 A;  3LT9 A;  3EX9 A;  5M18 A;  1Q40 A;  5BVB A;  3CME 3;  1OHO A;  5GSP A;  5IEO A;  3KSE D;  2Q07 A;  1BUQ A;  2M7O A;  3OX9 A;  1K8A 4;  2CH9 A;  2WO0 A;  3N8B A;  2GEX A;  4IPB A;  1W6Y A;  2E2U A;  4LZI A;  1W01 A;  3X42 A;  3EC9 A;  1K28 A;  1GMQ A;  3AMO A;  3BLZ A;  1US1 A;  4HM4 B;  1FYS A;  2CWT A;  6STD A;  1TRP A;  2KAA A;  1BAO A;  1B2M A;  1O7H B;  1BUJ A;  1DMN A;  1JJ2 2;  3H51 A;  3LYG A;  1AV4 A;  2P09 A;  2P38 A;  1BRK A;  4RZM A;  2BNG A;  5DRE A;  3EN1 B;  1GY5 A;  4J9A A;  4K90 B;  3D5G A;  1OPY A;  5G1K A;  4H3U A;  3FG1 A;  1RGK A;  4J5G A;  1HZ1 A;  3NV0 B;  1IYY A;  1ROA A;  1RGA A;  2BT3 A;  1O7W B;  5IG0 A;  1U5O A;  1DET A;  3CC7 3;  2P0X A;  3WOE B;  3NV0 A;  1M1X B;  1OCV A;  2FGT A;  1JV2 B;  1FGM A;  3PCS A;  4FMD A;  1Z1S A;  4LMI A;  1QVF 2;  2F98 A;  3K5T A;  1UCI A;  3MG2 A;  3ECF A;  7STD A;  1W4N A;  1ASK A;  3AMO B;  3VF1 A;  3NUV A;  1LQM B;  4N6N B;  2C4B A;  5IER A;  1QMA A;  1LOV A;  5IG5 A;  3BND A;  3T0U A;  1JB2 A;  1JN5 A;  3DGN A;  4HOH A;  1FW7 A;  5I97 A;  1B2X A;  3UJM A;  4KZ1 A;  1T5Y A;  1ZX2 A;  1Q7Y 4;  1LNH A;  3KSP A;  5AI1 A;  1JKG A;  1UCK A;  2E2V A;  3FH1 A;  3KII A;  2CFK A;  1A2P A;  1G02 A;  3D3L A;  4N6T A;  4TX4 A;  4ZM8 A;  5D82 A;  3LH4 A;  1C54 A;  9RNT A;  3OW2 2;  3F7X A;  3SXX A;  2HMO B;  4WHA A;  4JF8 A;  4N6V 0;  1B27 A;  1KWI A;  1V57 A;  3WHO A;  1RTU A;  2KF3 A;  1YHQ 3;  2BMQ B;  1OH0 A;  2BHM A;  2Z77 A;  4KFE A;  4PEJ A;  4WWU C;  5AYS C;  1F8N A;  3B7C A;  1I0X A;  3OWS A;  1B2U A;  5G1L A;  1X1X A;  4EW5 A;  3LOY A;  3MKI A;  4MJD A;  2HOH A;  4FCZ A;  1O7N B;  3DUK A;  1VQL 3;  1FUS A;  4FCM A;  5D81 A;  4IT7 A;  1EQK A;  2W9P A;  1FA3 A;  3PGB A;  1BNF A;  3G16 A;  3KCH A;  1I70 A;  3GZB A;  1TU5 A;  3FCS B;  4FCJ A;  2F99 A;  1IT8 A;  3RNT A;  1VQO 3;  3FF0 A;  1QVG 2;  3BIR A;  1NJI 4;  2IUJ A;  3EE1 A;  3CU3 A;  3SYU A;  2JQ5 A;  3LML A;  1JBS A;  3D4A A;  1GD3 A;  2MC8 A;  4XBY A;  1LVN A;  1JB5 A;  2UGI A;  3MG3 A;  3DZL A;  1IQY A;  3CXC 2;  1TRQ A;  3SOY A;  1DVC A;  1YJ9 3;  2XEP A;  5AIG A;  3K63 A;  4FMA A;  1RGL A;  4L8O A;  5AIF A;  3H3H A;  2E2T A;  2L4V A;  4KVH A;  1N9J A;  3B8L A;  3IPT A;  3SOA A;  3MWZ A;  1BAN A;  1UGI A;  5AEU B;  1RRH A;  4XB5 A;  1DVD A;  1G0T A;  3EJV A;  3CPW 2;  3PCR A;  3BU4 A;  1RGE A;  1NU3 A;  3N9H A;  1YIT 3;  3HK4 A;  1J2B A;  1RNT A;  2CFD A;  1LOW A;  3JUO A;  3NBB A;  3ER7 A;  3CPO A;  3RDE A;  2D42 A;  3S29 A;  1VQ9 3;  3HI7 A;  2Z7A A;  3FF2 A;  4R80 A;  1IU7 A;  2GBW B;  1YJW 3;  2CFG A;  3X41 A;  4OVM A;  3SVA A;  1GMP A;  5KP4 A;  1M1K 4;  1IV9 A;  4HBR A;  4N6U A;  1NB3 I;  1WMO A;  2QA4 3;  1YNV X;  4HAA A;  3NM2 A;  3F9S A;  2YFL B;  1O7P B;  3I0Y A;  3CC4 3;  3EHC A;  1S5A A;  3NXJ A;  4I4K A;  4XBT A;  3AGN A;  3B4O A;  1X1W A;  1GY7 A;  5AYR B;  8CHO A;  1BNE A;  3DMC A;  3Q90 A;  3EBT A;  5IW9 A;  3DY5 A;  5BU4 A;  3G6E 3;  2IA7 A;  1RMS A;  1AY7 A;  3LTD A;  4CDL A;  1RGC A;  3UL5 A;  1EG9 B;  1A90 A;  1BSC A;  6GSP A;  2JDI H;  3UNL A;  2BU4 A;  4EBG A;  3M8C A;  2AAD A;  5AEW B;  1FUW A;  3LTB A;  4HYZ A;  1B2S A;  3K9M C;  4K1V A;  3CNX A;  3BNC A;  1UW1 A;  5CLK A;  1A67 A;  3D9R A;  1MGW A;  3ZG0 A;  3RGR A;  5CF2 A;  3X3Z A;  5RNT A;  4EC6 A;  2XSO B;  3EN8 A;  3WMD A;  3PYJ A;  2K3D A;  4HM5 B;  4X2H A;  1IDP A;  1W6G A;  1B3S A;  2WOF A;  3SED A;  2ZDJ A;  1W5Z A;  4CCV A;  1T2H A;  4KFF A;  1UCL A;  1RN7 A;  1OAC A;  1N5P A;  4U13 A;  1EA2 A;  1HU9 A;  1V58 A;  2KF5 A;  4R1K A;  1NDO B;  2CFW A;  1QAK A;  1OUN A;  4MEI A;  1VQP 3;  1KC8 4;  1SII A;  1ULI B;  1W6C A;  1WQL B;  2C10 A;  3CNM A;  4RBN A;  5TGN A;  1VQ6 3;  3I55 3;  4GSP A;  1GYB A;  1BOX A;  3G8Z A;  1JBT A;  1VZZ A;  1C7H A;  4I5Q A;  1QAL A;  3UL6 A;  1WTH A;  3KZT A;  3OV4 A;  3CCQ 3;  2UUG C;  3U1W A;  1IV7 A;  2W03 A;  1EEJ A;  1HKX A;  1RN4 A;  5IG3 A;  3GAX A;  2H0G A;  1UUV B;  3FG4 A;  3CCS 3;  4O2H A;  3I56 3;  1MWU A;  2XF3 A;  4O3V A;  1VQK 3;  4GHO A;  2AAE A;  1X1U A;  2CW9 A;  1W02 A;  1OGX A;  5JBS A;  3L0R A;  3Q1C A;  2WGQ A;  2XFS A;  5BXQ A;  3EBY A;  2OOV A;  2XH9 A;  1AVK A;  1X1Y A;  4CPK A;  2R41 A;  1TUH A;  5HGR A;  3KN4 A;  2CC3 A;  1CYV A;  1LRA A;  3GWR A;  1ULJ B;  3PS8 A;  1U8C B;  3GZY B;  4EXR A;  2CG1 A;  4LGQ A;  3MYT A;  2CWV A;  1BNI A;  1IK3 A;  1RKY A;  3HX8 A;  4ORL A;  4NHF A;  4OUQ A;  5M1A A;  4HJL B;  2FXT A;  1G96 A;  2CX0 A;  1SQW A;  2R4I A;  3BNB A;  2XGN A;  4HM6 B;  1IVW A;  1DYU A;  1SPU A;  1BNG A;  5EQL A;  1VQN 3;  1K41 A;  2OCT A;  1IVX A;  4G1M B;  1JRQ A;  1ISK A;  3ROB A;  3OWY A;  4N6L A;  4WFO A;  3S5C A;  1GOV A;  1O7G B;  5DRV A;  5M19 A;  1BSB A;  3AHW A;  2W6J H;  1YVB I;  5ELJ A;  3NHX A;  1D6Y A;  1FGT A;  2QEX 3;  3EQQ B;  1BGS A;  3A76 A;  1DE3 A;  1LXE A;  2RSX A;  2W56 B;  1TIJ A;  1YIJ 3;  1TTO A;  1V74 A;  1K9M 4;  3UB1 A;  3AGO A;  4BTY A;  2D1W A;  3MHE A;  3QK9 A;  1RDS A;  4HKV B;  3URP A;  3HIG A;  4XDW A;  1PY3 A;  1I0V A;  1I2F A;  1VQ7 3;  2YFJ B;  3S27 A;  1A2V A;  1DMQ A;  4FMC A;  3JUM A;  4IIA A;  1PU4 A;  1Q9E A;  1JN5 B;  4O02 B;  4X2O A;  2RGQ A;  3WA3 A;  3IJE B;  1WNH A;  1BRH A;  1W7C A;  1IQ8 A;  3NQY A;  3WDG B;  2W04 A;  5LC6 A;  3KFQ C;  3WA2 X;  3ZFZ A;  4BU4 A;  3S67 A;  1W2B 2;  4LEH A;  4STD A;  4BTX A;  3FLJ A;  3JUN A;  1R4C A;  2KCD A;  4HM3 B;  2GU3 A;  2ML5 A;  2ZHX B;  4HVN A;  4NRE A;  3LTA A;  1RGF A;  1Y4K A;  2YFI B;  5IG4 A;  2QIY A;  1I3F A;  1N9E A;  2J8X B;  5EVH A;  2CKF B;  2CK3 H;  2WGO A;  3JUQ A;  1BNS A;  2Z6B A;  4O8S A;  5AIH A;  3GRD A;  4HM1 B;  4R9L A;  1DMM A;  3EF8 A;  1BNJ A;  1ZS7 A;  2CG0 A;  1STF I;  1MGR A;  1BIR A; 
#chains in the Genus database with same CATH homology
 4GB5 A;  3X40 A;  3WOD G;  1NO3 A;  1RRL A;  2BO9 B;  2YX9 A;  4WYK A;  3U97 A;  4XDV A;  4WYK B;  3DGM A;  1IT7 A;  1L5G B;  1ZO2 A;  2O9U X;  3NBJ A;  4GL6 A;  1S72 3;  1KSI A;  5G2G A;  2UX0 A;  4AKZ A;  5FW5 A;  1MNL A;  1AR0 A;  1TFO A;  2KRT A;  4HZB B;  1CEW I;  4LSO A;  1D6Z A;  1GD4 A;  1E3V A;  1PFP A;  5JPP A;  1IVU A;  2CIU A;  2HMK B;  2P0M A;  2P05 A;  2F86 B;  1OHP A;  4MMZ B;  2IUK A;  2HML B;  3T8N A;  2OWP A;  2FNQ A;  3CMA 3;  2Y73 A;  3DGO A;  2B1X B;  1OHS A;  3CCJ 3;  2XSH B;  1SJW A;  3X3Y A;  2GEY A;  1VQ5 3;  3HZP A;  2XR8 B;  1TFK A;  2RFR A;  4R4K A;  2OTL 3;  1K73 4;  2I9W A;  1JKG B;  1NB5 I;  3CCM 3;  3MG1 A;  1E3R A;  1STD A;  5ELU A;  1WMP A;  3E99 A;  4HM2 B;  3FSD A;  1FGQ A;  3NBR A;  1ROV A;  1FGR A;  3STD A;  3DGL A;  3JUP A;  2PNC A;  4HM0 B;  3K7C A;  1N8Q A;  3CCL 3;  4Q53 A;  1LOX A;  3FGY A;  3GZR A;  2RCD A;  1VQ8 3;  3MSO A;  3V92 A;  3OWU A;  1A2K A;  1EKM A;  3T8U A;  3HII A;  4XBX A;  3F40 A;  3CCV 3;  3X3X A;  1Q40 B;  3PZW A;  3SX1 A;  3ALA A;  4HM8 B;  3G0K A;  2CFL A;  1YJN 3;  4N6O B;  2CWU A;  3VGN A;  3VSY A;  3FZW A;  3F7S A;  1OF5 A;  1KQS 2;  2O3O A;  1MOL A;  1FGO A;  1TP6 A;  1QJG A;  1N8R 4;  4EYC A;  4N6M A;  5JPU A;  1M90 4;  3O8Y A;  2QGU A;  3F8X A;  3CC2 3;  4AEQ A;  1JB4 A;  1E97 A;  4OK0 A;  2C11 A;  1W2Z A;  5IEP A;  1Q82 4;  2OTJ 3;  1O7M B;  4RNZ A;  2WOH A;  5D83 A;  2XFT A;  3V98 A;  2ZL8 A;  1KD1 4;  4QWT A;  1RJO A;  2IMJ A;  4HM7 B;  1QAF A;  2K54 A;  2W56 A;  3GZX B;  5IEN A;  5EEO A;  1OF5 B;  3B4P A;  4K61 A;  1N5H A;  4L8P A;  1IQX A;  4XM4 A;  3KE7 A;  5IF6 A;  3N54 B;  3J7Y d;  1D6U A;  1GY6 A;  3QRD A;  5A0O B;  1JNQ A;  3CCR 3;  3DXO A;  3G4S 3;  4H61 A;  1UUW B;  2GBX B;  2KXG A;  3DM8 A;  3V99 A;  3EB8 A;  2HMJ B;  4HZ9 B;  1W00 A;  3LXU X;  4R9K A;  1GS3 A;  2W9Q A;  5KP3 A;  3S28 A;  1VQM 3;  4MMX B;  2K0M A;  2BMR B;  2HMN B;  3BNE A;  2LQV A;  2OOV C;  3OXA A;  2A15 A;  3NQZ A;  5CK6 A;  2PZV A;  4FR9 A;  2CHC A;  1CYU A;  3Q2P A;  1YGE A;  3NM7 A;  4L7K A;  2OQE C;  3TDG A;  3KKG A;  4BTW A;  5KP1 A;  1IVV A;  2SBL A;  4K1U A;  1NWW A;  2W2C A;  5AII A;  2ML6 A;  1Q86 4;  1YI2 3;  3FG3 A;  3G71 3;  3CCU 3;  4J8T A;  4MMY B;  1VQ4 3;  2XRX B;  4FMB A;  2W0Q A;  3NX0 A;  4AKY A;  2LYX A;  3JVC A;  2OQE A;  3MPH A;  4WP5 A;  3LT8 A;  2GU1 A;  3F8H A;  2V1L A;  5STD A;  2XGL A;  1M9G A;  4RNY A;  2INX A;  3LZA A;  3SLU A;  5CF1 A;  3CCE 3;  1OGZ A;  1SIH A;  3K0Z A;  3WOF B;  5CXO A;  4EV5 A;  2Y74 A;  4JRF A;  1CQS A;  2STD A;  1UI7 A;  3RGA A;  5FGO A;  4N3V A;  3CD6 3;  3BB9 A;  3FKA A;  2GXF A;  3F14 A;  1AVL A;  5LC7 A;  4EV2 A;  1WMN A;  3LTC A;  1Q81 4;  2B24 B;  2Z76 A;  2MF7 A;  3IMA B;  1Q42 A;  2BMO B;  4KFD A;  2HMM B;  3LT9 A;  1UI8 A;  3EX9 A;  1Q40 A;  5BVB A;  3CME 3;  1OHO A;  5IEO A;  3KSE D;  2Q07 A;  1BUQ A;  2M7O A;  3OX9 A;  1K8A 4;  2CH9 A;  2WO0 A;  3N8B A;  2GEX A;  4IPB A;  1W6Y A;  2E2U A;  4LZI A;  1W01 A;  3X42 A;  3EC9 A;  1K28 A;  3BLZ A;  3AMO A;  1US1 A;  4HM4 B;  2CWT A;  6STD A;  1O7H B;  1DMN A;  1JJ2 2;  3H51 A;  3LYG A;  1AV4 A;  2P09 A;  2P38 A;  4RZM A;  2BNG A;  5DRE A;  3EN1 B;  1GY5 A;  4J9A A;  4K90 B;  1OPY A;  4H3U A;  3FG1 A;  3NV0 B;  1ROA A;  2BT3 A;  1O7W B;  5IG0 A;  1U5O A;  3CC7 3;  2P0X A;  3WOE B;  3NV0 A;  1M1X B;  2FGT A;  1OCV A;  1JV2 B;  1FGM A;  3PCS A;  4FMD A;  1Z1S A;  4LMI A;  1QVF 2;  2F98 A;  3K5T A;  3MG2 A;  3ECF A;  7STD A;  1W4N A;  3AMO B;  1ASK A;  3VF1 A;  3NUV A;  4N6N B;  5IER A;  1QMA A;  5IG5 A;  3BND A;  3T0U A;  1JB2 A;  1JN5 A;  3DGN A;  5I97 A;  3UJM A;  4KZ1 A;  1T5Y A;  1ZX2 A;  1Q7Y 4;  1LNH A;  3KSP A;  5AI1 A;  1JKG A;  2E2V A;  3FH1 A;  3KII A;  2CFK A;  3D3L A;  4N6T A;  4TX4 A;  4ZM8 A;  5D82 A;  3LH4 A;  3OW2 2;  3F7X A;  3SXX A;  2HMO B;  4WHA A;  4JF8 A;  1KWI A;  1YHQ 3;  2BMQ B;  1OH0 A;  2BHM A;  2Z77 A;  4KFE A;  4PEJ A;  4WWU C;  5AYS C;  1F8N A;  3B7C A;  3OWS A;  3LOY A;  3MKI A;  4MJD A;  4FCZ A;  1O7N B;  3DUK A;  1VQL 3;  5D81 A;  4FCM A;  4IT7 A;  1EQK A;  2W9P A;  1FA3 A;  3PGB A;  3G16 A;  3GZB A;  1TU5 A;  3FCS B;  4FCJ A;  2F99 A;  1IT8 A;  1VQO 3;  1QVG 2;  3FF0 A;  1NJI 4;  2IUJ A;  3EE1 A;  3CU3 A;  2JQ5 A;  3LML A;  1GD3 A;  2MC8 A;  4XBY A;  1LVN A;  1JB5 A;  3MG3 A;  3DZL A;  1IQY A;  3CXC 2;  3SOY A;  1DVC A;  1YJ9 3;  2XEP A;  5AIG A;  3K63 A;  4FMA A;  4L8O A;  5AIF A;  3H3H A;  2E2T A;  2L4V A;  4KVH A;  1N9J A;  3B8L A;  3IPT A;  3SOA A;  3MWZ A;  5AEU B;  1RRH A;  4XB5 A;  1DVD A;  3EJV A;  3CPW 2;  3PCR A;  1NU3 A;  3N9H A;  1YIT 3;  3HK4 A;  1J2B A;  2CFD A;  3JUO A;  3NBB A;  3ER7 A;  3CPO A;  3RDE A;  2D42 A;  3S29 A;  1VQ9 3;  3HI7 A;  2Z7A A;  3FF2 A;  4R80 A;  1IU7 A;  2GBW B;  1YJW 3;  2CFG A;  3X41 A;  4OVM A;  3SVA A;  5KP4 A;  1M1K 4;  1IV9 A;  4HBR A;  4N6U A;  1NB3 I;  1WMO A;  2QA4 3;  3NM2 A;  3F9S A;  2YFL B;  1O7P B;  3I0Y A;  3CC4 3;  3EHC A;  1S5A A;  3NXJ A;  4I4K A;  4XBT A;  3B4O A;  1GY7 A;  5AYR B;  8CHO A;  3DMC A;  3Q90 A;  3EBT A;  5IW9 A;  3DY5 A;  3G6E 3;  2IA7 A;  4CDL A;  3LTD A;  3UL5 A;  1EG9 B;  1A90 A;  2JDI H;  3UNL A;  5AEW B;  4EBG A;  3M8C A;  1FUW A;  3LTB A;  4HYZ A;  3K9M C;  4K1V A;  3CNX A;  3BNC A;  1UW1 A;  5CLK A;  1A67 A;  3D9R A;  5CF2 A;  3RGR A;  3X3Z A;  4EC6 A;  2XSO B;  3EN8 A;  3WMD A;  3PYJ A;  4HM5 B;  4X2H A;  1IDP A;  1W6G A;  2WOF A;  3SED A;  2ZDJ A;  1W5Z A;  4CCV A;  4KFF A;  1RN7 A;  1OAC A;  1N5P A;  4U13 A;  1EA2 A;  1HU9 A;  4R1K A;  1NDO B;  2CFW A;  1QAK A;  1OUN A;  4MEI A;  1VQP 3;  1KC8 4;  1SII A;  1ULI B;  1W6C A;  1WQL B;  2C10 A;  3CNM A;  4RBN A;  5TGN A;  1VQ6 3;  1GYB A;  3G8Z A;  1VZZ A;  1C7H A;  1QAL A;  3UL6 A;  1WTH A;  3KZT A;  3OV4 A;  3CCQ 3;  3U1W A;  1IV7 A;  2W03 A;  1HKX A;  5IG3 A;  3GAX A;  1UUV B;  3FG4 A;  3CCS 3;  4O2H A;  3I56 3;  2XF3 A;  4O3V A;  1VQK 3;  2CW9 A;  1W02 A;  1OGX A;  5JBS A;  3L0R A;  3Q1C A;  2WGQ A;  2XFS A;  5BXQ A;  3EBY A;  2OOV A;  2XH9 A;  1AVK A;  1TUH A;  5HGR A;  3KN4 A;  2CC3 A;  1CYV A;  3GWR A;  1ULJ B;  3PS8 A;  1U8C B;  3GZY B;  4EXR A;  2CG1 A;  4LGQ A;  3MYT A;  2CWV A;  1IK3 A;  1RKY A;  3HX8 A;  4ORL A;  4NHF A;  4OUQ A;  4HJL B;  2FXT A;  1G96 A;  2R4I A;  1SQW A;  4N6V 0;  3BNB A;  2XGN A;  4HM6 B;  1IVW A;  1DYU A;  1SPU A;  5EQL A;  1VQN 3;  1K41 A;  2OCT A;  1IVX A;  4G1M B;  1JRQ A;  1ISK A;  3ROB A;  3OWY A;  4N6L A;  4WFO A;  3S5C A;  1O7G B;  5DRV A;  2W6J H;  1YVB I;  5ELJ A;  3NHX A;  1D6Y A;  1FGT A;  2QEX 3;  3EQQ B;  3A76 A;  1LXE A;  2RSX A;  2W56 B;  1TIJ A;  1YIJ 3;  1V74 A;  1K9M 4;  3UB1 A;  4BTY A;  2D1W A;  3MHE A;  3QK9 A;  4HKV B;  3HIG A;  4XDW A;  1VQ7 3;  2YFJ B;  3S27 A;  1A2V A;  1DMQ A;  4FMC A;  3JUM A;  4IIA A;  1PU4 A;  4O02 B;  1JN5 B;  4X2O A;  3WA3 A;  2RGQ A;  3IJE B;  1WNH A;  1W7C A;  1IQ8 A;  3NQY A;  3WDG B;  2W04 A;  5LC6 A;  3KFQ C;  3WA2 X;  3I55 3;  1W2B 2;  3S67 A;  4LEH A;  4STD A;  4BTX A;  3FLJ A;  3JUN A;  1R4C A;  2KCD A;  4HM3 B;  2GU3 A;  2ML5 A;  4HVN A;  4NRE A;  3LTA A;  1Y4K A;  2YFI B;  5IG4 A;  2QIY A;  1N9E A;  5EVH A;  2WGO A;  2CK3 H;  2CKF B;  3JUQ A;  2Z6B A;  4O8S A;  5AIH A;  3GRD A;  4HM1 B;  4R9L A;  1DMM A;  3EF8 A;  2CG0 A;  1STF I;  3PXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...