2WGOA

Structure of ranaspumin-2, a surfactant protein from the foam nests of a tropical frog
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
GSLILDGDLLKDKLKLPVIDNLFGKELLDKFQDDIKDKYGVDTKDLKILKTSEDKRFYYVSVDAGDGEKCKFKIRKDVDVPKMVGRKCRKDDDDDDGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Surfactant protein
molecule keywords RANASPUMIN-2
publication title Ranaspumin-2: Structure and Function of a Surfactant Protein from the Foam Nests of a Tropical Frog.
pubmed doi rcsb
source organism Engystomops pustulosus
total genus 24
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2009-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.260 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2wgoA00
2WGOA
chains in the Genus database with same CATH superfamily
3VF1A 1FUWA 1DE3A 3F9SA 3CCE3 2A15A 2XGNA 3BNCA 2HMLB 1RN4A 4N6OB 2GSPA 3Q1CA 5HGRA 1M904 2CWVA 5CXOA 1RDSA 3WOFB 1QAFA 4H61A 2MC8A 1VQ73 2YX9A 1FGTA 1MWUA 3X3ZA 5BXQA 3BNDA 1IV9A 1YVSA 3JUQA 4GL6A 5GSPA 1T2HA 3F14A 2IA7A 2CX1A 4X2HA 3PYJA 1JJ22 4LYLB 3EC9A 4XBXA 1OH0A 3GZRA 2O3OA 5TGNA 2CIUA 4N6NB 2CFGA 3PCSA 1HZ1A 1RGAA 3TDGA 4L7KA 4BL3A 1VQM3 1VQ43 3HOHA 4J5GA 4IIAA 1NWWA 2SARA 3LOYA 2UGIA 3BU4A 4J9AA 3STDA 1FA3A 1OGZA 1WMNA 3NBJA 3CCS3 1YJ93 1BUJA 1B2XA 2KAAA 2ZHXB 4I5QA 2BMOB 4K90B 3MWZA 1SARA 5AI1A 2OTJ3 4GHOA 4XBYA 5M18A 1F8NA 3MSOA 1TP6A 1RKYA 3ZFZA 3AGNA 3FG1A 3F8XA 1BSBA 1BSEA 3GRDA 5ELJA 1RGEA 2P0XA 3H3HA 3LT8A 4N6V0 3CCL3 1NB5I 3G0KA 2CFWA 1W2B2 1B27A 1HKXA 3KE7A 3PCRA 4RNZA 1IQYA 3DGMA 2HMJB 1CEWI 3NXJA 1HYFA 1N8R4 2K54A 2CH9A 4HJLB 2B24B 1SQWA 4HM4B 5IERA 1ISKA 3EE1A 1LOVA 4HM2B 2Z77A 7STDA 1SIHA 2PNCA 4OK0A 3E99A 4MMYB 2L4VA 4NHFA 2CK3H 3F7SA 3ER7A 1RNTA 5M19A 2XRXB 3FH1A 3A5EA 3B4PA 3I553 3G6E3 1I3IA 4ZM8A 1O7MB 4L8PA 1RNBA 1K28A 4HBRA 1US1A 4O8SA 1DYUA 3OW22 1BIRA 3J7Yd 3LT9A 1I0VA 3WOEB 2HOHA 1IQ8A 5CK6A 3AGOA 3X42A 3CPW2 1GSPA 1FUTA 2OQEC 1FZUA 1GY6A 3Q90A 1A90A 1EKMA 3CC73 4ILFA 1BUQA 5I97A 3NV0B 5BU4A 1IVVA 1W01A 4BTYA 4BL2A 1MGWA 1BRKA 1W4NA 2R4IA 3NBBA 3G8ZA 3H51A 2UX0A 5G1LA 4EC6A 1EG9B 1GMPA 4HZ9B 1K41A 1TRQA 3DH2A 1K8A4 2WGOA 4BIRA 3KSED 1RGKA 3S67A 1BANA 1BRHA 1DVCA 2BT3A 1PY3A 1I70A 3DMCA 3K0ZA 1BSAA 3SLUA 4WYKA 2XH9A 1Q9EA 1RGGA 3BIRA 4PEJA 1MWSA 2FGTA 3EB8A 3CXC2 1I2EA 3FSDA 2F98A 1JN5B 3JUPA 5KP3A 5ELUA 2OOVA 1JB4A 3KN4A 3S27A 2CC3A 2GEYA 1LOWA 3MKIA 1IDPA 3N9HA 1BNIA 2OCTA 4RNTA 2F5WA 4KVHA 1V58A 2RNTA 1B21A 4I4KA 2CW9A 1BSDA 1DMQA 2IMJA 3DGYA 3FKAA 1X1XA 1UUVB 3EHCA 2BO9B 2C11A 1A2PA 4LZIA 4N6LA 3UB1A 4DKIA 1FW7A 1NJI4 4FMBA 3I0YA 4R9KA 1N9EA 1WMOA 1EEJA 3HZPA 3NM2A 1CQSA 2CG1A 3HIGA 5IW9A 1K734 8RNTA 1DVDA 1JB5A 3QRDA 4EV2A 2W2CA 3LMLA 1GMQA 5AIGA 3CMA3 1TIJA 3D79A 2D42A 2QGUA 2F99A 1KC84 1W6GA 3B4OA 3V92A 3CME3 1B2MA 2Z6BA 4OUQA 3WDGB 1GOVA 2KF3A 3BLZA 1JKGB 1RRLA 4HM7B 3RDEA 1CYVA 3BNBA 1Q824 3DGLA 5CF2A 1TFOA 2W9QA 2Y73A 1GOUA 1O7GB 3OXAA 1LOXA 1RMSA 3DY5A 5FW5A 1S5AA 3WA2X 3GSPA 3CCU3 5AYSC 2YFJB 2Z7AA 2IUJA 2ZA4A 3LTDA 3X41A 1JNQA 2LYXA 3NBRA 2OOVC 2HMNB 3JVCA 1B2UA 1W2ZA 1WMPA 3MPHA 3V99A 2QIYA 4STDA 3OWYA 4XB5A 2PZVA 1T5YA 2H0IA 3SOYA 2P0MA 4LGQA 1UI7A 1VQ93 2XR8B 1QVF2 2WGQA 1SIIA 3HK4A 1YJW3 1B20A 2HMKB 3KKGA 1FGMA 3PXMA 4KT3B 2CKFB 1A2KA 4LMIA 1O7NB 5JPUA 2JQ5A 5DRVA 3K5TA 4XM4A 2YFLB 3GAXA 1MOLA 4RZMA 3Q3FA 3S5CA 1MWRA 3SEDA 3FG3A 3WMDA 3RNTA 3KIIA 3N54B 4HVNA 1IQXA 2MF7A 1FUSA 4CPKA 4N3VA 2KRTA 1IK3A 2GEXA 2H0GA 5BVBA 1GY5A 3BNEA 3MG1A 1BNEA 4BTWA 4WHAA 4U13A 5M1AA 3CNXA 1EA2A 1STDA 3DXOA 4JF8A 6STDA 1MWTA 6GSPA 3UNLA 2E2UA 3BB9A 5AEWB 2OQEA 1UCKA 3ROBA 2CG0A 2J8XB 3GZBA 4HM1B 3FCSB 1BNGA 1V74A 1FGOA 1NNVA 1WQLB 3UL5A 1BNFA 1ROAA 1BAOA 1OF5B 1NO3A 4O3VA 1ASKA 4HKVB 3KSPA 7GSPA 1IYYA 1UDII 3UJMA 7RNTA 1O7PB 1GOYA 1LQGC 1A67A 1Q40B 2L1SA 5G2GA 1YVBI 2E2TA 5STDA 4J5KA 1E97A 3T0UA 2W04A 1RGFA 4H3UA 3GZYB 5IG5A 1VQN3 4EYCA 4N6UA 1BGSA 5IEOA 1PFPA 1GY7A 3VSYA 3V98A 4BTXA 2K3DA 3SOAA 2AADA 1UGIA 1W02A 2XSHB 3CPOA 1JBSA 1QJGA 2XSOB 1B3SA 1VQQA 1YGEA 3NQYA 3SX1A 3NQZA 5EEOA 1YIT3 4AKZA 3NV0A 2RBIA 1T3BA 2E2VA 4K1VA 1WNHA 5LC6A 1K9M4 5IF6A 2KF4A 1AY7A 3MYTA 1D6UA 3LTCA 2M7OA 6RNTA 4IPBA 1ULJB 1GMRA 3G16A 1IVUA 3B8LA 1W7CA 1LVNA 3KFQC 4RNYA 1BRGA 1Q864 3FF2A 2GBWB 1KWIA 1EQKA 1OPYA 3VGNA 5JBSA 1JN5A 1O7WB 2P09A 3CCQ3 1RTUA 3CC43 1X1YA 1UCLA 1G02A 5D81A 4FR9A 5IG0A 1Z1SA 3CNMA 2WOHA 5IG4A 1AVLA 4AKYA 1CH0A 2KF5A 1UCJA 2QEX3 3AMOB 2XF3A 1ZGXA 1A2VA 5BIRA 1BRNL 1CYUA 1GS3A 3T8NA 1JBTA 2ML6A 2I9WA 1X1WA 1RSNA 3PZWA 3ECFA 3NUVA 2CFDA 4O02B 1BOXA 3SVAA 2BMQB 2RSXA 2BHMA 2LQVA 2UUGC 2FNQA 1LNIA 1C7HA 1N5HA 1OACA 2IY2A 3EBYA 1JV2B 1N8QA 2ML5A 4HZBB 1W6YA 1N5PA 4KZ1A 4MMZB 4AEQA 1VQP3 1TFKA 3DZLA 2STDA 3L0RA 1AVKA 1OCVA 4J8TA 1AR0A 3Q2PA 1BSCA 1JKGA 1VQL3 3WHOA 4KFFA 1AV4A 5AIIA 1I0XA 2C4BA 2CHCA 3LXUX 4N6MA 4Q53A 4HOHA 3PS8A 2Q07A 3K7CA 3PGBA 1IU7A 1I2FA 3X40A 2ZL8A 4X2OA 1VQ83 4WFOA 1UUWB 4CCVA 1GD3A 2JDIH 2Y74A 1RHLA 1C54A 4BU4A 3I563 2WOFA 1TRPA 3LZAA 1R4YA 4EXRA 1VQ63 2CWTA 2BU4A 4HM6B 1JZOA 1Q7Y4 4EBGA 2F56A 5DREA 2C10A 2K0MA 4FCMA 2YFIB 5JPPA 5EQLA 3FZWA 1U8CB 1LOYA 1DMNA 1OHSA 2XFSA 1GD4A 2HMOB 4FCJA 2GU3A 4ORLA 1AQZA 3OWSA 1UI8A 2F5MA 1FGQA 5RNTA 3FF0A 1D6YA 3X3YA 1O7HB 3FG4A 4EV5A 1BNJA 5CF1A 3DUKA 1BRIA 2BMRB 2R41A 3MG2A 5IEPA 4XBTA 2H0HA 4GB5A 1DETA 4FMCA 1JB2A 1ZS7A 4LSOA 1HU9A 3IJEB 3EN8A 5D82A 4R9LA 3S28A 2BIRA 1YGWA 1TJDA 2OTL3 3NM7A 3MG3A 4FMAA 2W9PA 3WR2A 1B2SA 1BNSA 1FYSA 1IT7A 1OHPA 1GYBA 1QALA 4GSPA 4QWTA 4RBNA 1KQS2 3D5IA 1IVXA 3MHEA 4HM5B 3A76A 1LXEA 4K61A 3CU3A 2CFKA 2D1WA 2XGLA 3D9RA 3K63A 1BRSA 1RRHA 2GU1A 3OV4A 1L5GB 1T2IA 1OF5A 9RNTA 1VQO3 1RGHA 4KFDA 1U5OA 1VQ53 4K1UA 1NB3I 1ZX2A 1X1UA 2W0QA 3NHXA 1ZO2A 3QK9A 4CJNA 1Q40A 1IV7A 1TUHA 3GWRA 1N9JA 4R4KA 5D83A 3HIIA 3ALAA 3D5GA 3D4AA 5CLKA 2KCDA 5IG3A 3LTAA 4WWUC 3DGNA 2XEPA 1RCKA 1RJOA 3JUMA 1QVG2 3JUNA 4R1KA 3ZG0A 1RGCA 3IMAB 3AHWA 2CWUA 1UGHI 1EUIC 1BU4A 2RGQA 1KSIA 2P05A 8CHOA 1R4CA 1I2GA 4EW5A 1Q7HA 1M9GA 4HYZA 5AEUB 3URPA 3AHSA 3EN1B 3HX8A 1VQK3 5KP1A 1Y4KA 3F40A 3M8CA 3OX9A 3RGRA 4N6TA 4MJDA 2IYJA 1FGRA 1TTOA 1YI23 5AIFA 3FLJA 4WP5A 2HMMB 4LEHA 1KD14 5LC7A 1Q814 2BNGA 1RN1A 1WTHA 1TU5A 4FMDA 3LH4A 1IT8A 1LNHA 5AYRB 1VZZA 3IPTA 1NU3A 2P38A 3LYGA 3KCHA 1E3VA 3EF8A 3EBTA 1QAKA 1NDOB 1OHOA 4FCZA 1RN7A 4HM0B 2RCDA 3AMOA 2B1XB 1QMAA 3LTBA 3HI7A 1S723 1JRQA 3G713 1SPUA 1BRJA 4R80A 1IVWA 2WO0A 3CCV3 1MGRA 1PU4A 5KP4A 3O8YA 3UL6A 1YIJ3 4NREA 3S29A 2QA43 1M1K4 3D3LA 1YJN3 3SYUA 2KXGA 1W6CA 3DGOA 1W00A 2FXTA 1G96A 4OVMA 1JZDA 1UUGB 3WA3A 2XFTA 1B2ZA 1YNVX 3U1WA 5IENA 2AAEA 1D6ZA 1Q42A 5A0OB 1RGLA 1YHQ3 1OGXA 1UCIA 2CFLA 1UW1A 5EVHA 1SJWA 1W5ZA 1OUNA 1MNLA 3EQQB 3U97A 2GBXB 4HAAA 4O2HA 4HM8B 4JRFA 1PYLA 1ROVA 3NX0A 3OWUA 3G4S3 1STFI 4HM3B 3X3XA 1G0TA 5FGOA 2W56A 1BVIA 2SBLA 5AIHA 4XDVA 3N8BA 3DM8A 1E3RA 2OWPA 5HOHA 1RLSA 2F4YA 1LQMB 3GZXB 3EX9A 4L8OA 4NPBA 1BNRA 3EJVA 3K9MC 3F8HA 2Z76A 3JUOA 4KFEA 2F86B 2KF6A 2V1LA 2O9UX 3B7CA 4MMXB 4XDWA 5G1KA 3F7XA 3FGYA 3RGAA 2W56B 3CC23 4TX4A 3CD63 4IT7A 1M1XB 1LRAA 4WYKB 4MEIA 3CCM3 1DMMA 1J2BA 2IUKA 2INXA 3KZTA 1I3FA 2ZDJA 4CDLA 4G1MB 1V57A 2RFRA 1RCLA 3T8UA 3ZG5A 1I8VA 3CCR3 3WODG 3SXXA 1ULIB 2CX0A 3CCJ3 2W03A 1JBRA 2GXFA 2W6JH
chains in the Genus database with same CATH topology
3VF1A 1FUWA 3F9SA 3CCE3 2A15A 2XGNA 3BNCA 2HMLB 4N6OB 3Q1CA 5HGRA 1M904 2CWVA 5CXOA 3WOFB 1QAFA 4H61A 2MC8A 1VQ73 2YX9A 1FGTA 3X3ZA 5BXQA 3BNDA 1IV9A 3JUQA 4GL6A 3F14A 2IA7A 4X2HA 3PYJA 1JJ22 3EC9A 4XBXA 1OH0A 3GZRA 2O3OA 5TGNA 2CIUA 4N6NB 2CFGA 3PCSA 3TDGA 4L7KA 1VQ43 1VQM3 4IIAA 1NWWA 3LOYA 4J9AA 3STDA 1FA3A 1OGZA 1WMNA 3NBJA 3CCS3 1YJ93 2BMOB 4K90B 3MWZA 2OTJ3 5AI1A 4XBYA 1F8NA 3MSOA 1TP6A 1RKYA 3FG1A 3F8XA 3GRDA 5ELJA 2P0XA 3H3HA 3LT8A 4N6V0 3CCL3 1NB5I 3G0KA 2CFWA 1W2B2 1HKXA 3KE7A 3PCRA 4RNZA 3CCR3 1IQYA 3DGMA 2HMJB 1CEWI 3NXJA 1N8R4 2K54A 2CH9A 4HJLB 2B24B 1SQWA 4HM4B 5IERA 1ISKA 3EE1A 4HM2B 2Z77A 7STDA 1SIHA 2PNCA 4OK0A 3E99A 4MMYB 2L4VA 4NHFA 2CK3H 3F7SA 3ER7A 2XRXB 3FH1A 3I553 3B4PA 3G6E3 4ZM8A 1O7MB 4L8PA 1K28A 4HBRA 1US1A 4O8SA 1DYUA 3OW22 3LT9A 3WOEB 1IQ8A 5CK6A 3X42A 3CPW2 2OQEC 1GY6A 3Q90A 1A90A 1EKMA 3CC73 1BUQA 5I97A 3NV0B 1IVVA 1W01A 4BTYA 4EC6A 1W4NA 2R4IA 3NBBA 3G8ZA 3H51A 2UX0A 3J7Yd 1K8A4 1EG9B 4HZ9B 1K41A 2WGOA 3KSED 3S67A 2BT3A 1DVCA 3K0ZA 3SLUA 3DMCA 4WYKA 2XH9A 3CXC2 4PEJA 2FGTA 3EB8A 5A0OB 3FSDA 2F98A 1JN5B 3JUPA 5KP3A 5ELUA 2OOVA 1JB4A 3KN4A 3S27A 2CC3A 2GEYA 3MKIA 3WMDA 1IDPA 3N9HA 2OCTA 4KVHA 4I4KA 2CW9A 1DMQA 2IMJA 3FKAA 1UUVB 3EHCA 2BO9B 2C11A 3UB1A 4LZIA 4N6LA 1NJI4 4FMBA 3I0YA 4R9KA 1N9EA 1WMOA 3HZPA 3NM2A 2CG1A 1CQSA 5IW9A 3HIGA 1K734 1DVDA 1JB5A 3QRDA 4EV2A 2W2CA 3LMLA 5AIGA 3CMA3 1TIJA 2D42A 2QGUA 2F99A 1KC84 1W6GA 3B4OA 3V92A 3CME3 2Z6BA 4OUQA 3WDGB 3BLZA 1JKGB 1RRLA 4HM7B 3RDEA 1CYVA 3BNBA 1Q824 3DGLA 5CF2A 1TFOA 2W9QA 2Y73A 1O7GB 3OXAA 1LOXA 3DY5A 5FW5A 1S5AA 3WA2X 3CCU3 5AYSC 2YFJB 2Z7AA 2IUJA 3LTDA 3X41A 1JNQA 2LYXA 3NBRA 2OOVC 2HMNB 3JVCA 1WMPA 1W2ZA 3V99A 3MPHA 2QIYA 4STDA 3OWYA 4XB5A 2PZVA 1T5YA 3SOYA 2P0MA 4LGQA 1UI7A 1VQ93 2XR8B 1QVF2 2WGQA 1SIIA 3HK4A 1YJW3 2HMKB 3KKGA 1FGMA 3PXMA 2CKFB 1A2KA 4LMIA 1O7NB 5JPUA 2JQ5A 5DRVA 3K5TA 4XM4A 2YFLB 3GAXA 1MOLA 4RZMA 3S5CA 3SEDA 3FG3A 3KIIA 3N54B 4HVNA 1IQXA 2MF7A 4N3VA 2KRTA 1IK3A 2GEXA 5BVBA 1GY5A 3BNEA 3MG1A 4BTWA 4WHAA 4U13A 3CNXA 1EA2A 1STDA 3DXOA 4JF8A 6STDA 3UNLA 2E2UA 3BB9A 5AEWB 2OQEA 3ROBA 2CG0A 3GZBA 4HM1B 3FCSB 1V74A 1FGOA 1WQLB 3UL5A 1ROAA 1OF5B 1NO3A 4O3VA 1ASKA 4HKVB 3KSPA 3UJMA 1A67A 1O7PB 1Q40B 5G2GA 5STDA 1YVBI 2E2TA 3T0UA 1E97A 2W04A 4H3UA 3GZYB 5IG5A 1VQN3 4EYCA 4N6UA 5IEOA 1PFPA 1GY7A 3VSYA 3V98A 3SOAA 1W02A 2XSHB 3CPOA 1QJGA 2XSOB 1YGEA 3NQYA 3SX1A 3NQZA 5EEOA 1YIT3 4AKZA 3NV0A 2E2VA 4K1VA 1WNHA 5LC6A 1K9M4 5IF6A 3MYTA 1D6UA 3LTCA 2M7OA 4IPBA 1ULJB 3G16A 1IVUA 3B8LA 1W7CA 1LVNA 3KFQC 4RNYA 1Q864 3FF2A 2GBWB 1KWIA 1EQKA 1OPYA 3VGNA 5JBSA 1JN5A 1O7WB 2P09A 3CCQ3 3CC43 5D81A 4FR9A 5IG0A 1Z1SA 3CNMA 2WOHA 5IG4A 1AVLA 4AKYA 2QEX3 3AMOB 2XF3A 1A2VA 1CYUA 1GS3A 3T8NA 2ML6A 2I9WA 3PZWA 3ECFA 3NUVA 2CFDA 4O02B 3SVAA 2BMQB 2RSXA 2BHMA 2LQVA 2FNQA 1C7HA 1N5HA 1OACA 3EBYA 1JV2B 1N8QA 2ML5A 4HZBB 1W6YA 1N5PA 4KZ1A 4MMZB 4AEQA 1VQP3 1TFKA 3DZLA 2STDA 3L0RA 1AVKA 1OCVA 4J8TA 1AR0A 3Q2PA 1JKGA 1VQL3 4KFFA 1AV4A 5AIIA 4N6MA 2CHCA 3LXUX 4Q53A 3PS8A 2Q07A 3K7CA 3PGBA 1IU7A 3X40A 2ZL8A 4X2OA 1VQ83 4WFOA 1UUWB 4CCVA 2Y74A 1GD3A 2JDIH 3I563 2WOFA 3LZAA 1VQ63 4EXRA 2CWTA 4HM6B 1Q7Y4 4EBGA 5DREA 2C10A 2K0MA 4FCMA 2YFIB 5JPPA 5EQLA 3FZWA 1U8CB 1DMNA 1OHSA 2XFSA 1GD4A 2HMOB 4FCJA 2GU3A 4ORLA 3OWSA 1UI8A 1FGQA 3FF0A 1D6YA 3X3YA 1O7HB 3FG4A 4EV5A 5CF1A 3DUKA 2BMRB 5IEPA 3MG2A 4XBTA 4GB5A 4FMCA 1JB2A 4LSOA 1HU9A 3IJEB 3EN8A 5D82A 4R9LA 3S28A 2OTL3 3NM7A 3MG3A 4FMAA 2W9PA 1QALA 1IT7A 1OHPA 1GYBA 4QWTA 1KQS2 4RBNA 3MHEA 1IVXA 4HM5B 3A76A 1LXEA 4K61A 3CU3A 2CFKA 2D1WA 2XGLA 3D9RA 3K63A 1RRHA 2GU1A 3OV4A 1L5GB 1OF5A 1VQO3 4KFDA 1U5OA 1VQ53 4K1UA 1NB3I 1ZX2A 3NHXA 2W0QA 1ZO2A 3QK9A 1Q40A 1IV7A 1TUHA 3GWRA 1N9JA 4R4KA 5D83A 3HIIA 3ALAA 4BTXA 5CLKA 2KCDA 5IG3A 3LTAA 4WWUC 3DGNA 2XEPA 3JUMA 1RJOA 1QVG2 3JUNA 4R1KA 3IMAB 2CWUA 2RGQA 1KSIA 2P05A 8CHOA 1R4CA 1M9GA 4HYZA 5AEUB 3EN1B 3HX8A 1VQK3 5KP1A 1Y4KA 3F40A 3M8CA 3OX9A 3RGRA 4N6TA 4MJDA 1FGRA 1YI23 5AIFA 3FLJA 4WP5A 2HMMB 4LEHA 1KD14 5LC7A 1Q814 2BNGA 1WTHA 1TU5A 4FMDA 3LH4A 1LNHA 1IT8A 5AYRB 1VZZA 3IPTA 1NU3A 2P38A 3LYGA 1E3VA 3EF8A 3EBTA 1QAKA 1NDOB 1OHOA 4FCZA 1RN7A 4HM0B 2RCDA 3AMOA 2B1XB 1QMAA 3LTBA 3HI7A 1S723 1JRQA 3G713 1SPUA 4R80A 1IVWA 2WO0A 3CCV3 1PU4A 5KP4A 3O8YA 3UL6A 1YIJ3 4NREA 3S29A 2QA43 1M1K4 3D3LA 1YJN3 2KXGA 1W6CA 3DGOA 1W00A 2FXTA 1G96A 4OVMA 3WA3A 2XFTA 5IENA 3U1WA 1D6ZA 1Q42A 1YHQ3 1OGXA 2CFLA 1UW1A 5EVHA 1SJWA 1W5ZA 1OUNA 1MNLA 3EQQB 3U97A 2GBXB 4O2HA 4HM8B 4JRFA 1ROVA 3NX0A 3OWUA 3G4S3 1STFI 4HM3B 3X3XA 5FGOA 2W56A 2SBLA 5AIHA 4XDVA 3N8BA 3DM8A 1E3RA 2OWPA 3GZXB 4L8OA 3EX9A 3EJVA 3K9MC 3F8HA 2Z76A 3JUOA 4KFEA 2F86B 4XDWA 2V1LA 2O9UX 3B7CA 4MMXB 3RGAA 3F7XA 3FGYA 3CC23 2W56B 4TX4A 3CD63 4IT7A 1M1XB 4WYKB 4MEIA 3CCM3 1DMMA 1J2BA 2IUKA 2INXA 3KZTA 2ZDJA 4CDLA 4G1MB 2RFRA 3T8UA 3WODG 3SXXA 1ULIB 3CCJ3 2W03A 2GXFA 2W6JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGO A; 
#chains in the Genus database with same CATH topology
 3VF1 A;  1FUW A;  1DE3 A;  3F9S A;  3CCE 3;  2A15 A;  2XGN A;  3BNC A;  2HML B;  1RN4 A;  4N6O B;  2GSP A;  3Q1C A;  5HGR A;  1M90 4;  2CWV A;  5CXO A;  1RDS A;  3WOF B;  1QAF A;  4H61 A;  2MC8 A;  1VQ7 3;  2YX9 A;  1FGT A;  1MWU A;  3X3Z A;  5BXQ A;  3BND A;  1IV9 A;  1YVS A;  3JUQ A;  4GL6 A;  5GSP A;  1T2H A;  3F14 A;  2IA7 A;  2CX1 A;  4X2H A;  3PYJ A;  1JJ2 2;  4LYL B;  3EC9 A;  4XBX A;  1OH0 A;  3GZR A;  2O3O A;  5TGN A;  2CIU A;  4N6N B;  2CFG A;  3PCS A;  1HZ1 A;  1RGA A;  3TDG A;  4L7K A;  4BL3 A;  1VQM 3;  1VQ4 3;  3HOH A;  4J5G A;  4IIA A;  1NWW A;  2SAR A;  3LOY A;  2UGI A;  3BU4 A;  4J9A A;  3STD A;  1FA3 A;  1OGZ A;  1WMN A;  3NBJ A;  3CCS 3;  1YJ9 3;  1BUJ A;  1B2X A;  2KAA A;  2ZHX B;  4I5Q A;  2BMO B;  4K90 B;  3MWZ A;  1SAR A;  5AI1 A;  2OTJ 3;  4GHO A;  4XBY A;  5M18 A;  1F8N A;  3MSO A;  1TP6 A;  1RKY A;  3ZFZ A;  3AGN A;  3FG1 A;  3F8X A;  1BSB A;  1BSE A;  3GRD A;  5ELJ A;  1RGE A;  2P0X A;  3H3H A;  3LT8 A;  4N6V 0;  3CCL 3;  1NB5 I;  3G0K A;  2CFW A;  1W2B 2;  1B27 A;  1HKX A;  3KE7 A;  3PCR A;  4RNZ A;  1IQY A;  3DGM A;  2HMJ B;  1CEW I;  3NXJ A;  1HYF A;  1N8R 4;  2K54 A;  2CH9 A;  4HJL B;  2B24 B;  1SQW A;  4HM4 B;  5IER A;  1ISK A;  3EE1 A;  1LOV A;  4HM2 B;  2Z77 A;  7STD A;  1SIH A;  2PNC A;  4OK0 A;  3E99 A;  4MMY B;  2L4V A;  4NHF A;  2CK3 H;  3F7S A;  3ER7 A;  1RNT A;  5M19 A;  2XRX B;  3FH1 A;  3A5E A;  3B4P A;  3I55 3;  3G6E 3;  1I3I A;  4ZM8 A;  1O7M B;  4L8P A;  1RNB A;  1K28 A;  4HBR A;  1US1 A;  4O8S A;  1DYU A;  3OW2 2;  1BIR A;  3J7Y d;  3LT9 A;  1I0V A;  3WOE B;  2HOH A;  1IQ8 A;  5CK6 A;  3AGO A;  3X42 A;  3CPW 2;  1GSP A;  1FUT A;  2OQE C;  1FZU A;  1GY6 A;  3Q90 A;  1A90 A;  1EKM A;  3CC7 3;  4ILF A;  1BUQ A;  5I97 A;  3NV0 B;  5BU4 A;  1IVV A;  1W01 A;  4BTY A;  4BL2 A;  1MGW A;  1BRK A;  1W4N A;  2R4I A;  3NBB A;  3G8Z A;  3H51 A;  2UX0 A;  5G1L A;  4EC6 A;  1EG9 B;  1GMP A;  4HZ9 B;  1K41 A;  1TRQ A;  3DH2 A;  1K8A 4;  2WGO A;  4BIR A;  3KSE D;  1RGK A;  3S67 A;  1BAN A;  1BRH A;  1DVC A;  2BT3 A;  1PY3 A;  1I70 A;  3DMC A;  3K0Z A;  1BSA A;  3SLU A;  4WYK A;  2XH9 A;  1Q9E A;  1RGG A;  3BIR A;  4PEJ A;  1MWS A;  2FGT A;  3EB8 A;  3CXC 2;  1I2E A;  3FSD A;  2F98 A;  1JN5 B;  3JUP A;  5KP3 A;  5ELU A;  2OOV A;  1JB4 A;  3KN4 A;  3S27 A;  2CC3 A;  2GEY A;  1LOW A;  3MKI A;  1IDP A;  3N9H A;  1BNI A;  2OCT A;  4RNT A;  2F5W A;  4KVH A;  1V58 A;  2RNT A;  1B21 A;  4I4K A;  2CW9 A;  1BSD A;  1DMQ A;  2IMJ A;  3DGY A;  3FKA A;  1X1X A;  1UUV B;  3EHC A;  2BO9 B;  2C11 A;  1A2P A;  4LZI A;  4N6L A;  3UB1 A;  4DKI A;  1FW7 A;  1NJI 4;  4FMB A;  3I0Y A;  4R9K A;  1N9E A;  1WMO A;  1EEJ A;  3HZP A;  3NM2 A;  1CQS A;  2CG1 A;  3HIG A;  5IW9 A;  1K73 4;  8RNT A;  1DVD A;  1JB5 A;  3QRD A;  4EV2 A;  2W2C A;  3LML A;  1GMQ A;  5AIG A;  3CMA 3;  1TIJ A;  3D79 A;  2D42 A;  2QGU A;  2F99 A;  1KC8 4;  1W6G A;  3B4O A;  3V92 A;  3CME 3;  1B2M A;  2Z6B A;  4OUQ A;  3WDG B;  1GOV A;  2KF3 A;  3BLZ A;  1JKG B;  1RRL A;  4HM7 B;  3RDE A;  1CYV A;  3BNB A;  1Q82 4;  3DGL A;  5CF2 A;  1TFO A;  2W9Q A;  2Y73 A;  1GOU A;  1O7G B;  3OXA A;  1LOX A;  1RMS A;  3DY5 A;  5FW5 A;  1S5A A;  3WA2 X;  3GSP A;  3CCU 3;  5AYS C;  2YFJ B;  2Z7A A;  2IUJ A;  2ZA4 A;  3LTD A;  3X41 A;  1JNQ A;  2LYX A;  3NBR A;  2OOV C;  2HMN B;  3JVC A;  1B2U A;  1W2Z A;  1WMP A;  3MPH A;  3V99 A;  2QIY A;  4STD A;  3OWY A;  4XB5 A;  2PZV A;  1T5Y A;  2H0I A;  3SOY A;  2P0M A;  4LGQ A;  1UI7 A;  1VQ9 3;  2XR8 B;  1QVF 2;  2WGQ A;  1SII A;  3HK4 A;  1YJW 3;  1B20 A;  2HMK B;  3KKG A;  1FGM A;  3PXM A;  4KT3 B;  2CKF B;  1A2K A;  4LMI A;  1O7N B;  5JPU A;  2JQ5 A;  5DRV A;  3K5T A;  4XM4 A;  2YFL B;  3GAX A;  1MOL A;  4RZM A;  3Q3F A;  3S5C A;  1MWR A;  3SED A;  3FG3 A;  3WMD A;  3RNT A;  3KII A;  3N54 B;  4HVN A;  1IQX A;  2MF7 A;  1FUS A;  4CPK A;  4N3V A;  2KRT A;  1IK3 A;  2GEX A;  2H0G A;  5BVB A;  1GY5 A;  3BNE A;  3MG1 A;  1BNE A;  4BTW A;  4WHA A;  4U13 A;  5M1A A;  3CNX A;  1EA2 A;  1STD A;  3DXO A;  4JF8 A;  6STD A;  1MWT A;  6GSP A;  3UNL A;  2E2U A;  3BB9 A;  5AEW B;  2OQE A;  1UCK A;  3ROB A;  2CG0 A;  2J8X B;  3GZB A;  4HM1 B;  3FCS B;  1BNG A;  1V74 A;  1FGO A;  1NNV A;  1WQL B;  3UL5 A;  1BNF A;  1ROA A;  1BAO A;  1OF5 B;  1NO3 A;  4O3V A;  1ASK A;  4HKV B;  3KSP A;  7GSP A;  1IYY A;  1UDI I;  3UJM A;  7RNT A;  1O7P B;  1GOY A;  1LQG C;  1A67 A;  1Q40 B;  2L1S A;  5G2G A;  1YVB I;  2E2T A;  5STD A;  4J5K A;  1E97 A;  3T0U A;  2W04 A;  1RGF A;  4H3U A;  3GZY B;  5IG5 A;  1VQN 3;  4EYC A;  4N6U A;  1BGS A;  5IEO A;  1PFP A;  1GY7 A;  3VSY A;  3V98 A;  4BTX A;  2K3D A;  3SOA A;  2AAD A;  1UGI A;  1W02 A;  2XSH B;  3CPO A;  1JBS A;  1QJG A;  2XSO B;  1B3S A;  1VQQ A;  1YGE A;  3NQY A;  3SX1 A;  3NQZ A;  5EEO A;  1YIT 3;  4AKZ A;  3NV0 A;  2RBI A;  1T3B A;  2E2V A;  4K1V A;  1WNH A;  5LC6 A;  1K9M 4;  5IF6 A;  2KF4 A;  1AY7 A;  3MYT A;  1D6U A;  3LTC A;  2M7O A;  6RNT A;  4IPB A;  1ULJ B;  1GMR A;  3G16 A;  1IVU A;  3B8L A;  1W7C A;  1LVN A;  3KFQ C;  4RNY A;  1BRG A;  1Q86 4;  3FF2 A;  2GBW B;  1KWI A;  1EQK A;  1OPY A;  3VGN A;  5JBS A;  1JN5 A;  1O7W B;  2P09 A;  3CCQ 3;  1RTU A;  3CC4 3;  1X1Y A;  1UCL A;  1G02 A;  5D81 A;  4FR9 A;  5IG0 A;  1Z1S A;  3CNM A;  2WOH A;  5IG4 A;  1AVL A;  4AKY A;  1CH0 A;  2KF5 A;  1UCJ A;  2QEX 3;  3AMO B;  2XF3 A;  1ZGX A;  1A2V A;  5BIR A;  1BRN L;  1CYU A;  1GS3 A;  3T8N A;  1JBT A;  2ML6 A;  2I9W A;  1X1W A;  1RSN A;  3PZW A;  3ECF A;  3NUV A;  2CFD A;  4O02 B;  1BOX A;  3SVA A;  2BMQ B;  2RSX A;  2BHM A;  2LQV A;  2UUG C;  2FNQ A;  1LNI A;  1C7H A;  1N5H A;  1OAC A;  2IY2 A;  3EBY A;  1JV2 B;  1N8Q A;  2ML5 A;  4HZB B;  1W6Y A;  1N5P A;  4KZ1 A;  4MMZ B;  4AEQ A;  1VQP 3;  1TFK A;  3DZL A;  2STD A;  3L0R A;  1AVK A;  1OCV A;  4J8T A;  1AR0 A;  3Q2P A;  1BSC A;  1JKG A;  1VQL 3;  3WHO A;  4KFF A;  1AV4 A;  5AII A;  1I0X A;  2C4B A;  2CHC A;  3LXU X;  4N6M A;  4Q53 A;  4HOH A;  3PS8 A;  2Q07 A;  3K7C A;  3PGB A;  1IU7 A;  1I2F A;  3X40 A;  2ZL8 A;  4X2O A;  1VQ8 3;  4WFO A;  1UUW B;  4CCV A;  1GD3 A;  2JDI H;  2Y74 A;  1RHL A;  1C54 A;  4BU4 A;  3I56 3;  2WOF A;  1TRP A;  3LZA A;  1R4Y A;  4EXR A;  1VQ6 3;  2CWT A;  2BU4 A;  4HM6 B;  1JZO A;  1Q7Y 4;  4EBG A;  2F56 A;  5DRE A;  2C10 A;  2K0M A;  4FCM A;  2YFI B;  5JPP A;  5EQL A;  3FZW A;  1U8C B;  1LOY A;  1DMN A;  1OHS A;  2XFS A;  1GD4 A;  2HMO B;  4FCJ A;  2GU3 A;  4ORL A;  1AQZ A;  3OWS A;  1UI8 A;  2F5M A;  1FGQ A;  5RNT A;  3FF0 A;  1D6Y A;  3X3Y A;  1O7H B;  3FG4 A;  4EV5 A;  1BNJ A;  5CF1 A;  3DUK A;  1BRI A;  2BMR B;  2R41 A;  3MG2 A;  5IEP A;  4XBT A;  2H0H A;  4GB5 A;  1DET A;  4FMC A;  1JB2 A;  1ZS7 A;  4LSO A;  1HU9 A;  3IJE B;  3EN8 A;  5D82 A;  4R9L A;  3S28 A;  2BIR A;  1YGW A;  1TJD A;  2OTL 3;  3NM7 A;  3MG3 A;  4FMA A;  2W9P A;  3WR2 A;  1B2S A;  1BNS A;  1FYS A;  1IT7 A;  1OHP A;  1GYB A;  1QAL A;  4GSP A;  4QWT A;  4RBN A;  1KQS 2;  3D5I A;  1IVX A;  3MHE A;  4HM5 B;  3A76 A;  1LXE A;  4K61 A;  3CU3 A;  2CFK A;  2D1W A;  2XGL A;  3D9R A;  3K63 A;  1BRS A;  1RRH A;  2GU1 A;  3OV4 A;  1L5G B;  1T2I A;  1OF5 A;  9RNT A;  1VQO 3;  1RGH A;  4KFD A;  1U5O A;  1VQ5 3;  4K1U A;  1NB3 I;  1ZX2 A;  1X1U A;  2W0Q A;  3NHX A;  1ZO2 A;  3QK9 A;  4CJN A;  1Q40 A;  1IV7 A;  1TUH A;  3GWR A;  1N9J A;  4R4K A;  5D83 A;  3HII A;  3ALA A;  3D5G A;  3D4A A;  5CLK A;  2KCD A;  5IG3 A;  3LTA A;  4WWU C;  3DGN A;  2XEP A;  1RCK A;  1RJO A;  3JUM A;  1QVG 2;  3JUN A;  4R1K A;  3ZG0 A;  1RGC A;  3IMA B;  3AHW A;  2CWU A;  1UGH I;  1EUI C;  1BU4 A;  2RGQ A;  1KSI A;  2P05 A;  8CHO A;  1R4C A;  1I2G A;  4EW5 A;  1Q7H A;  1M9G A;  4HYZ A;  5AEU B;  3URP A;  3AHS A;  3EN1 B;  3HX8 A;  1VQK 3;  5KP1 A;  1Y4K A;  3F40 A;  3M8C A;  3OX9 A;  3RGR A;  4N6T A;  4MJD A;  2IYJ A;  1FGR A;  1TTO A;  1YI2 3;  5AIF A;  3FLJ A;  4WP5 A;  2HMM B;  4LEH A;  1KD1 4;  5LC7 A;  1Q81 4;  2BNG A;  1RN1 A;  1WTH A;  1TU5 A;  4FMD A;  3LH4 A;  1IT8 A;  1LNH A;  5AYR B;  1VZZ A;  3IPT A;  1NU3 A;  2P38 A;  3LYG A;  3KCH A;  1E3V A;  3EF8 A;  3EBT A;  1QAK A;  1NDO B;  1OHO A;  4FCZ A;  1RN7 A;  4HM0 B;  2RCD A;  3AMO A;  2B1X B;  1QMA A;  3LTB A;  3HI7 A;  1S72 3;  1JRQ A;  3G71 3;  1SPU A;  1BRJ A;  4R80 A;  1IVW A;  2WO0 A;  3CCV 3;  1MGR A;  1PU4 A;  5KP4 A;  3O8Y A;  3UL6 A;  1YIJ 3;  4NRE A;  3S29 A;  2QA4 3;  1M1K 4;  3D3L A;  1YJN 3;  3SYU A;  2KXG A;  1W6C A;  3DGO A;  1W00 A;  2FXT A;  1G96 A;  4OVM A;  1JZD A;  1UUG B;  3WA3 A;  2XFT A;  1B2Z A;  1YNV X;  3U1W A;  5IEN A;  2AAE A;  1D6Z A;  1Q42 A;  5A0O B;  1RGL A;  1YHQ 3;  1OGX A;  1UCI A;  2CFL A;  1UW1 A;  5EVH A;  1SJW A;  1W5Z A;  1OUN A;  1MNL A;  3EQQ B;  3U97 A;  2GBX B;  4HAA A;  4O2H A;  4HM8 B;  4JRF A;  1PYL A;  1ROV A;  3NX0 A;  3OWU A;  3G4S 3;  1STF I;  4HM3 B;  3X3X A;  1G0T A;  5FGO A;  2W56 A;  1BVI A;  2SBL A;  5AIH A;  4XDV A;  3N8B A;  3DM8 A;  1E3R A;  2OWP A;  5HOH A;  1RLS A;  2F4Y A;  1LQM B;  3GZX B;  3EX9 A;  4L8O A;  4NPB A;  1BNR A;  3EJV A;  3K9M C;  3F8H A;  2Z76 A;  3JUO A;  4KFE A;  2F86 B;  2KF6 A;  2V1L A;  2O9U X;  3B7C A;  4MMX B;  4XDW A;  5G1K A;  3F7X A;  3FGY A;  3RGA A;  2W56 B;  3CC2 3;  4TX4 A;  3CD6 3;  4IT7 A;  1M1X B;  1LRA A;  4WYK B;  4MEI A;  3CCM 3;  1DMM A;  1J2B A;  2IUK A;  2INX A;  3KZT A;  1I3F A;  2ZDJ A;  4CDL A;  4G1M B;  1V57 A;  2RFR A;  1RCL A;  3T8U A;  3ZG5 A;  1I8V A;  3CCR 3;  3WOD G;  3SXX A;  1ULI B;  2CX0 A;  3CCJ 3;  2W03 A;  1JBR A;  2GXF A;  2W6J H; 
#chains in the Genus database with same CATH homology
 3VF1 A;  1FUW A;  3F9S A;  3CCE 3;  2A15 A;  2XGN A;  3BNC A;  2HML B;  4N6O B;  3Q1C A;  5HGR A;  1M90 4;  2CWV A;  5CXO A;  3WOF B;  1QAF A;  4H61 A;  2MC8 A;  1VQ7 3;  2YX9 A;  1FGT A;  3X3Z A;  5BXQ A;  3BND A;  1IV9 A;  3JUQ A;  4GL6 A;  3F14 A;  2IA7 A;  4X2H A;  3PYJ A;  1JJ2 2;  3EC9 A;  4XBX A;  1OH0 A;  3GZR A;  2O3O A;  5TGN A;  2CIU A;  4N6N B;  2CFG A;  3PCS A;  3TDG A;  4L7K A;  1VQ4 3;  1VQM 3;  4IIA A;  1NWW A;  3LOY A;  4J9A A;  3STD A;  1FA3 A;  1OGZ A;  1WMN A;  3NBJ A;  3CCS 3;  1YJ9 3;  2BMO B;  4K90 B;  3MWZ A;  2OTJ 3;  5AI1 A;  4XBY A;  1F8N A;  3MSO A;  1TP6 A;  1RKY A;  3FG1 A;  3F8X A;  3GRD A;  5ELJ A;  2P0X A;  3H3H A;  3LT8 A;  4N6V 0;  3CCL 3;  1NB5 I;  3G0K A;  2CFW A;  1W2B 2;  1HKX A;  3KE7 A;  3PCR A;  4RNZ A;  3CCR 3;  1IQY A;  3DGM A;  2HMJ B;  1CEW I;  3NXJ A;  1N8R 4;  2K54 A;  2CH9 A;  4HJL B;  2B24 B;  1SQW A;  4HM4 B;  5IER A;  1ISK A;  3EE1 A;  4HM2 B;  2Z77 A;  7STD A;  1SIH A;  2PNC A;  4OK0 A;  3E99 A;  4MMY B;  2L4V A;  4NHF A;  2CK3 H;  3F7S A;  3ER7 A;  2XRX B;  3FH1 A;  3I55 3;  3B4P A;  3G6E 3;  4ZM8 A;  1O7M B;  4L8P A;  1K28 A;  4HBR A;  1US1 A;  4O8S A;  1DYU A;  3OW2 2;  3LT9 A;  3WOE B;  1IQ8 A;  5CK6 A;  3X42 A;  3CPW 2;  2OQE C;  1GY6 A;  3Q90 A;  1A90 A;  1EKM A;  3CC7 3;  1BUQ A;  5I97 A;  3NV0 B;  1IVV A;  1W01 A;  4BTY A;  4EC6 A;  1W4N A;  2R4I A;  3NBB A;  3G8Z A;  3H51 A;  2UX0 A;  3J7Y d;  1K8A 4;  1EG9 B;  4HZ9 B;  1K41 A;  2WGO A;  3KSE D;  3S67 A;  2BT3 A;  1DVC A;  3K0Z A;  3SLU A;  3DMC A;  4WYK A;  2XH9 A;  3CXC 2;  4PEJ A;  2FGT A;  3EB8 A;  5A0O B;  3FSD A;  2F98 A;  1JN5 B;  3JUP A;  5KP3 A;  5ELU A;  2OOV A;  1JB4 A;  3KN4 A;  3S27 A;  2CC3 A;  2GEY A;  3MKI A;  3WMD A;  1IDP A;  3N9H A;  2OCT A;  4KVH A;  4I4K A;  2CW9 A;  1DMQ A;  2IMJ A;  3FKA A;  1UUV B;  3EHC A;  2BO9 B;  2C11 A;  3UB1 A;  4LZI A;  4N6L A;  1NJI 4;  4FMB A;  3I0Y A;  4R9K A;  1N9E A;  1WMO A;  3HZP A;  3NM2 A;  2CG1 A;  1CQS A;  5IW9 A;  3HIG A;  1K73 4;  1DVD A;  1JB5 A;  3QRD A;  4EV2 A;  2W2C A;  3LML A;  5AIG A;  3CMA 3;  1TIJ A;  2D42 A;  2QGU A;  2F99 A;  1KC8 4;  1W6G A;  3B4O A;  3V92 A;  3CME 3;  2Z6B A;  4OUQ A;  3WDG B;  3BLZ A;  1JKG B;  1RRL A;  4HM7 B;  3RDE A;  1CYV A;  3BNB A;  1Q82 4;  3DGL A;  5CF2 A;  1TFO A;  2W9Q A;  2Y73 A;  1O7G B;  3OXA A;  1LOX A;  3DY5 A;  5FW5 A;  1S5A A;  3WA2 X;  3CCU 3;  5AYS C;  2YFJ B;  2Z7A A;  2IUJ A;  3LTD A;  3X41 A;  1JNQ A;  2LYX A;  3NBR A;  2OOV C;  2HMN B;  3JVC A;  1WMP A;  1W2Z A;  3V99 A;  3MPH A;  2QIY A;  4STD A;  3OWY A;  4XB5 A;  2PZV A;  1T5Y A;  3SOY A;  2P0M A;  4LGQ A;  1UI7 A;  1VQ9 3;  2XR8 B;  1QVF 2;  2WGQ A;  1SII A;  3HK4 A;  1YJW 3;  2HMK B;  3KKG A;  1FGM A;  3PXM A;  2CKF B;  1A2K A;  4LMI A;  1O7N B;  5JPU A;  2JQ5 A;  5DRV A;  3K5T A;  4XM4 A;  2YFL B;  3GAX A;  1MOL A;  4RZM A;  3S5C A;  3SED A;  3FG3 A;  3KII A;  3N54 B;  4HVN A;  1IQX A;  2MF7 A;  4N3V A;  2KRT A;  1IK3 A;  2GEX A;  5BVB A;  1GY5 A;  3BNE A;  3MG1 A;  4BTW A;  4WHA A;  4U13 A;  3CNX A;  1EA2 A;  1STD A;  3DXO A;  4JF8 A;  6STD A;  3UNL A;  2E2U A;  3BB9 A;  5AEW B;  2OQE A;  3ROB A;  2CG0 A;  3GZB A;  4HM1 B;  3FCS B;  1V74 A;  1FGO A;  1WQL B;  3UL5 A;  1ROA A;  1OF5 B;  1NO3 A;  4O3V A;  1ASK A;  4HKV B;  3KSP A;  3UJM A;  1A67 A;  1O7P B;  1Q40 B;  5G2G A;  5STD A;  1YVB I;  2E2T A;  3T0U A;  1E97 A;  2W04 A;  4H3U A;  3GZY B;  5IG5 A;  1VQN 3;  4EYC A;  4N6U A;  5IEO A;  1PFP A;  1GY7 A;  3VSY A;  3V98 A;  3SOA A;  1W02 A;  2XSH B;  3CPO A;  1QJG A;  2XSO B;  1YGE A;  3NQY A;  3SX1 A;  3NQZ A;  5EEO A;  1YIT 3;  4AKZ A;  3NV0 A;  2E2V A;  4K1V A;  1WNH A;  5LC6 A;  1K9M 4;  5IF6 A;  3MYT A;  1D6U A;  3LTC A;  2M7O A;  4IPB A;  1ULJ B;  3G16 A;  1IVU A;  3B8L A;  1W7C A;  1LVN A;  3KFQ C;  4RNY A;  1Q86 4;  3FF2 A;  2GBW B;  1KWI A;  1EQK A;  1OPY A;  3VGN A;  5JBS A;  1JN5 A;  1O7W B;  2P09 A;  3CCQ 3;  3CC4 3;  5D81 A;  4FR9 A;  5IG0 A;  1Z1S A;  3CNM A;  2WOH A;  5IG4 A;  1AVL A;  4AKY A;  2QEX 3;  3AMO B;  2XF3 A;  1A2V A;  1CYU A;  1GS3 A;  3T8N A;  2ML6 A;  2I9W A;  3PZW A;  3ECF A;  3NUV A;  2CFD A;  4O02 B;  3SVA A;  2BMQ B;  2RSX A;  2BHM A;  2LQV A;  2FNQ A;  1C7H A;  1N5H A;  1OAC A;  3EBY A;  1JV2 B;  1N8Q A;  2ML5 A;  4HZB B;  1W6Y A;  1N5P A;  4KZ1 A;  4MMZ B;  4AEQ A;  1VQP 3;  1TFK A;  3DZL A;  2STD A;  3L0R A;  1AVK A;  1OCV A;  4J8T A;  1AR0 A;  3Q2P A;  1JKG A;  1VQL 3;  4KFF A;  1AV4 A;  5AII A;  4N6M A;  2CHC A;  3LXU X;  4Q53 A;  3PS8 A;  2Q07 A;  3K7C A;  3PGB A;  1IU7 A;  3X40 A;  2ZL8 A;  4X2O A;  1VQ8 3;  4WFO A;  1UUW B;  4CCV A;  2Y74 A;  1GD3 A;  2JDI H;  3I56 3;  2WOF A;  3LZA A;  1VQ6 3;  4EXR A;  2CWT A;  4HM6 B;  1Q7Y 4;  4EBG A;  5DRE A;  2C10 A;  2K0M A;  4FCM A;  2YFI B;  5JPP A;  5EQL A;  3FZW A;  1U8C B;  1DMN A;  1OHS A;  2XFS A;  1GD4 A;  2HMO B;  4FCJ A;  2GU3 A;  4ORL A;  3OWS A;  1UI8 A;  1FGQ A;  3FF0 A;  1D6Y A;  3X3Y A;  1O7H B;  3FG4 A;  4EV5 A;  5CF1 A;  3DUK A;  2BMR B;  5IEP A;  3MG2 A;  4XBT A;  4GB5 A;  4FMC A;  1JB2 A;  4LSO A;  1HU9 A;  3IJE B;  3EN8 A;  5D82 A;  4R9L A;  3S28 A;  2OTL 3;  3NM7 A;  3MG3 A;  4FMA A;  2W9P A;  1QAL A;  1IT7 A;  1OHP A;  1GYB A;  4QWT A;  1KQS 2;  4RBN A;  3MHE A;  1IVX A;  4HM5 B;  3A76 A;  1LXE A;  4K61 A;  3CU3 A;  2CFK A;  2D1W A;  2XGL A;  3D9R A;  3K63 A;  1RRH A;  2GU1 A;  3OV4 A;  1L5G B;  1OF5 A;  1VQO 3;  4KFD A;  1U5O A;  1VQ5 3;  4K1U A;  1NB3 I;  1ZX2 A;  3NHX A;  2W0Q A;  1ZO2 A;  3QK9 A;  1Q40 A;  1IV7 A;  1TUH A;  3GWR A;  1N9J A;  4R4K A;  5D83 A;  3HII A;  3ALA A;  4BTX A;  5CLK A;  2KCD A;  5IG3 A;  3LTA A;  4WWU C;  3DGN A;  2XEP A;  3JUM A;  1RJO A;  1QVG 2;  3JUN A;  4R1K A;  3IMA B;  2CWU A;  2RGQ A;  1KSI A;  2P05 A;  8CHO A;  1R4C A;  1M9G A;  4HYZ A;  5AEU B;  3EN1 B;  3HX8 A;  1VQK 3;  5KP1 A;  1Y4K A;  3F40 A;  3M8C A;  3OX9 A;  3RGR A;  4N6T A;  4MJD A;  1FGR A;  1YI2 3;  5AIF A;  3FLJ A;  4WP5 A;  2HMM B;  4LEH A;  1KD1 4;  5LC7 A;  1Q81 4;  2BNG A;  1WTH A;  1TU5 A;  4FMD A;  3LH4 A;  1LNH A;  1IT8 A;  5AYR B;  1VZZ A;  3IPT A;  1NU3 A;  2P38 A;  3LYG A;  1E3V A;  3EF8 A;  3EBT A;  1QAK A;  1NDO B;  1OHO A;  4FCZ A;  1RN7 A;  4HM0 B;  2RCD A;  3AMO A;  2B1X B;  1QMA A;  3LTB A;  3HI7 A;  1S72 3;  1JRQ A;  3G71 3;  1SPU A;  4R80 A;  1IVW A;  2WO0 A;  3CCV 3;  1PU4 A;  5KP4 A;  3O8Y A;  3UL6 A;  1YIJ 3;  4NRE A;  3S29 A;  2QA4 3;  1M1K 4;  3D3L A;  1YJN 3;  2KXG A;  1W6C A;  3DGO A;  1W00 A;  2FXT A;  1G96 A;  4OVM A;  3WA3 A;  2XFT A;  5IEN A;  3U1W A;  1D6Z A;  1Q42 A;  1YHQ 3;  1OGX A;  2CFL A;  1UW1 A;  5EVH A;  1SJW A;  1W5Z A;  1OUN A;  1MNL A;  3EQQ B;  3U97 A;  2GBX B;  4O2H A;  4HM8 B;  4JRF A;  1ROV A;  3NX0 A;  3OWU A;  3G4S 3;  1STF I;  4HM3 B;  3X3X A;  5FGO A;  2W56 A;  2SBL A;  5AIH A;  4XDV A;  3N8B A;  3DM8 A;  1E3R A;  2OWP A;  3GZX B;  4L8O A;  3EX9 A;  3EJV A;  3K9M C;  3F8H A;  2Z76 A;  3JUO A;  4KFE A;  2F86 B;  4XDW A;  2V1L A;  2O9U X;  3B7C A;  4MMX B;  3RGA A;  3F7X A;  3FGY A;  3CC2 3;  2W56 B;  4TX4 A;  3CD6 3;  4IT7 A;  1M1X B;  4WYK B;  4MEI A;  3CCM 3;  1DMM A;  1J2B A;  2IUK A;  2INX A;  3KZT A;  2ZDJ A;  4CDL A;  4G1M B;  2RFR A;  3T8U A;  3WOD G;  3SXX A;  1ULI B;  3CCJ 3;  2W03 A;  2GXF A;  2W6J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...