3IPTA

Crystal structure of ketosteroid isomerase y16s/d40n from pseudomonas putida with bound equilenin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
127
structure length
124
Chain Sequence
NLPTAQEVQGLMARSIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Dissecting the paradoxical effects of hydrogen bond mutations in the ketosteroid isomerase oxyanion hole.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 37
structure length 124
sequence length 127
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2009-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3iptA00
3T8UA 2R4IA 2HMJB 3F40A 4X2HA 1TUHA 5AIGA 3GRDA 3MG1A 3F7SA 3GZRA 2HMOB 3T8NA 1IDPA 4H3UA 1WQLB 2Z77A 3D9RA 3ECFA 3K0ZA 1TP6A 3GZBA 2CHCA 4HM0B 3EBTA 4N3VA 4RZMA 5AIHA 4K1VA 3GZXB 5IG0A 1Z1SA 1Q40B 5IENA 1O7WB 1NU3A 1GS3A 2QIYA 1Q42A 4MJDA 5BXQA 4KVHA 1OCVA 3A76A 3FZWA 3F8HA 2HMNB 2RGQA 1O7HB 5TGNA 5IG5A 3G16A 1GYBA 3HZPA 4IIAA 4WYKB 1CQSA 1O7MB 3FSDA 3EC9A 1DMQA 3MHEA 4L7KA 4HM2B 3NV0A 3EN1B 3BB9A 3OWUA 3GWRA 1JN5B 2GEXA 4HKVB 4XBYA 1UUWB 4HM1B 2GBXB 5IG3A 5IEPA 2I9WA 2UX0A 2F98A 5JPPA 5IG4A 2RFRA 1A2KA 2OWPA 1OF5B 1W6YA 4ORLA 5STDA 3MG3A 4FCJA 1O7PB 3MSOA 3F7XA 5KP4A 3NHXA 3DM8A 5EVHA 2JQ5A 3ROBA 2Z7AA 1SJWA 4WWUC 2K54A 1Q40A 2BMOB 2HMKB 5AEWB 1NWWA 2CKFB 1O7NB 2BMRB 4Q53A 4XBXA 3JUQA 1OHSA 2XSHB 5KP1A 1HKXA 2B1XB 3SEDA 3LZAA 1DMNA 1S5AA 3UJMA 3B4OA 5AI1A 5IF6A 1JKGB 3EHCA 2F86B 4WYKA 5D81A 3EJVA 2GEYA 1U5OA 3EN8A 1NDOB 4R9LA 3H3HA 3EBYA 1O7GB 3SOYA 1EG9B 3FKAA 3FLJA 1JN5A 1BUQA 4K1UA 3B4PA 3STDA 4HM3B 2A15A 1QMAA 4FCMA 1ISKA 8CHOA 2GBWB 3K7CA 3E99A 3KKGA 3FF0A 3BLZA 3CPOA 3F9SA 1OF5A 3OV4A 3JUOA 2QGUA 4HZBB 5DRVA 4R1KA 2GXFA 2INXA 5HGRA 4J9AA 5D83A 3FF2A 3OX9A 5IERA 1OPYA 4STDA 1E3RA 2B24B 2BMQB 2W2CA 5AEUB 2XSOB 3H51A 6STDA 3DUKA 1W01A 2IMJA 3DXOA 3S5CA 4HM6B 3NXJA 5KP3A 4U13A 4LGQA 2HMMB 3KZTA 3MG2A 5G2GA 1E3VA 1K41A 3DZLA 4HJLB 1OGZA 2HMLB 2Z76A 5CF2A 1STDA 1JKGA 1QJGA 3CNXA 3VGNA 3M8CA 2STDA 1ZO2A 1DMMA 4X2OA 4XM4A 2PZVA 5AIFA 4HVNA 3F8XA 4XBTA 2YFLB 3NBRA 5BVBA 1VZZA 4CDLA 3GZYB 1GY7A 5IEOA 2RCDA 3B7CA 4OVMA 1GY6A 3RGRA 4LEHA 1JB5A 5CLKA 3G8ZA 3NM2A 1W02A 1E97A 1C7HA 3B8LA 2XRXB 3LYGA 5D82A 5CF1A 1W00A 4LMIA 4HM7B 3JUMA 1UUVB 4L8OA 1AR0A 5CK6A 3SOAA 4HZ9B 3I0YA 1JB4A 3KSPA 3HK4A 3ER7A 3JUPA 1ASKA 3NUVA 3VSYA 3OWYA 3OXAA 1ULIB 7STDA 1OH0A 3JUNA 4XDVA 1ULJB 2XR8B 4GB5A 1GY5A 3DMCA 3G0KA 4PEJA 2BNGA 3FGYA 4L8PA 3F14A 3KE7A 4HM4B 1OGXA 3FH1A 1OHOA 4OUQA 5AIIA 3CNMA 3UNLA 3HX8A 4R9KA 1EA2A 2YFJB 4HM8B 1JB2A 4I4KA 3OWSA 4XDWA 4WP5A 1OUNA 3CU3A 3NV0B 5DREA 3RGAA 3EF8A 3MYTA 3IPTA 3Q90A 5FW5A 5JPUA 5CXOA 3WMDA 1ZX2A 4XB5A 4HM5B 2F99A 4J8TA 3EQQB 3MKIA 3EX9A 2YFIB 1OHPA
chains in the Genus database with same CATH superfamily
3T8UA 3V92A 2R4IA 1VQP3 2H0GA 2GU1A 3K9MC 4KT3B 2W04A 2HMJB 1I2FA 3F40A 3KFQC 3WOEB 4JF8A 4X2HA 4MEIA 2KF4A 9RNTA 1RN1A 2FGTA 1TUHA 3WR2A 3LTDA 5A0OB 1RKYA 5AIGA 1JV2B 3GRDA 5EEOA 3MG1A 3F7SA 4H61A 3CCR3 1VQ53 1C54A 3GZRA 4EXRA 2HMOB 1RRHA 4BTXA 3T8NA 1IDPA 1ROAA 4H3UA 1YJN3 1WQLB 2Z77A 3D9RA 1NJI4 3ECFA 1BNJA 2C4BA 3K0ZA 2CG0A 1TP6A 3GZBA 2CHCA 4HM0B 3EBTA 2P0MA 4N3VA 4RZMA 1LQGC 5AIHA 2WO0A 3GZXB 4K1VA 3SLUA 3D4AA 5IG0A 1N9EA 1RGHA 2RSXA 4QWTA 2HOHA 1Z1SA 3LH4A 1BSEA 2CFKA 1Q40B 1BOXA 1UCIA 2KCDA 2KXGA 1NB5I 1QAKA 1RRLA 1G96A 1D6UA 2H0IA 2SBLA 4FMAA 5IENA 1O7WB 1NU3A 3HI7A 1RDSA 4N6OB 1GS3A 1U8CB 2E2TA 2KF3A 2KF5A 1I0VA 3KIIA 1L5GB 2Z6BA 2QIYA 1Q42A 4MJDA 1B2ZA 4KVHA 5BXQA 4N6UA 1SQWA 1OCVA 3A76A 4CPKA 1KSIA 2XF3A 4G1MB 2KAAA 1MWSA 3FZWA 3F8HA 3CPW2 3PGBA 2HMNB 3CCV3 2RGQA 1K734 2UUGC 1O7HB 5TGNA 1IQXA 2KRTA 1GOUA 5IG5A 3I563 3CCU3 2CH9A 3G16A 1UDII 4WHAA 1GYBA 1JBSA 3HZPA 4IIAA 3AGOA 1Q7HA 1N9JA 3L0RA 4GL6A 4WYKB 6RNTA 1CQSA 2ML5A 3I553 3NQZA 3LTAA 1O7MB 2AADA 3FSDA 1X1XA 3EC9A 3FG3A 4HAAA 3CCL3 1DMQA 1NB3I 3UB1A 3D3LA 3MHEA 2Y73A 3SX1A 1N5PA 4L7KA 3X41A 3DH2A 4GHOA 3X3ZA 1VQ73 4HM2B 3NV0A 1FUWA 1GD3A 1SIIA 1T2HA 3BB9A 3EN1B 3TDGA 3BU4A 3OWUA 3Q3FA 4HOHA 3GWRA 4KFFA 1JN5B 3N9HA 4BTWA 1IV9A 2Y74A 3CCS3 1VQO3 2W6JH 2GEXA 1HYFA 4HKVB 1FUTA 4XBYA 3K63A 1UUWB 1FGMA 4HM1B 1TIJA 1UUGB 2RNTA 5EQLA 2GBXB 1BSDA 1LRAA 1G02A 4HBRA 1TRPA 5IG3A 2GSPA 2P05A 3SVAA 5IEPA 2I9WA 2UX0A 2BT3A 2F98A 3LTCA 1DVCA 1G0TA 3X3XA 1I0XA 5JPPA 5IG4A 2RFRA 3EB8A 1RN7A 3LMLA 1IVWA 1BSCA 1GMPA 4OK0A 1A2KA 3CCM3 2OWPA 2CG1A 1OF5B 2GU3A 1I2GA 1SARA 2OQEA 1BANA 1W6YA 2V1LA 4ORLA 4EYCA 2CW9A 3AMOB 3V99A 5STDA 2P09A 3MG3A 5HOHA 1IVUA 2CC3A 2RBIA 4FCJA 1I3FA 2H0HA 1O7PB 3CCE3 1YGWA 3MSOA 1MWUA 2R41A 3F7XA 4AEQA 3PYJA 3HIGA 4KFEA 5KP4A 1JNQA 4FMDA 5AYRB 1B20A 2MC8A 3G713 2CX1A 4CJNA 3K5TA 3FG4A 1AVLA 3NHXA 2CFLA 3DM8A 2W9QA 2F4YA 1RGAA 2W56B 3V98A 5M1AA 3ZFZA 1AQZA 1QALA 5EVHA 1BRJA 2JQ5A 3ROBA 2Z7AA 1SJWA 3LOYA 2QEX3 1UI7A 4WWUC 1FUSA 2K54A 1V58A 1MWTA 1EUIC 1JRQA 1M1XB 1Q40A 1UGIA 2BMOB 1PU4A 1PY3A 3S29A 2HMKB 3KSED 5AEWB 1NWWA 1QAFA 3NQYA 2CKFB 2F56A 1O7NB 2BMRB 4Q53A 4RNYA 2M7OA 4EC6A 4XBXA 2OTL3 3JUQA 1OHSA 2XSHB 1BGSA 1BAOA 3N54B 1HKXA 5KP1A 2B1XB 2BO9B 3SEDA 1VQ43 3DGOA 1BRSA 1FW7A 3LZAA 1DMNA 1LVNA 1S5AA 3UJMA 1BUJA 1TFOA 1K28A 2C10A 3B4OA 3WA2X 4FR9A 5AI1A 5IF6A 3U1WA 2J8XB 1JKGB 1N5HA 3EHCA 1W2B2 1B2XA 1IVVA 1NO3A 1X1YA 4IPBA 1MNLA 2F86B 2OCTA 3S28A 4WYKA 1LOVA 1MGWA 2CWUA 2OQEC 2ZHXB 3D79A 5D81A 3EJVA 1JJ22 1BNRA 2GEYA 1BNIA 1U5OA 2CWVA 3PS8A 2XGLA 3J7Yd 3EN8A 1AV4A 5LC7A 2CFWA 1BIRA 2KF6A 4BIRA 1NDOB 3ZG0A 4R9LA 3H3HA 4N6TA 1M1K4 3EBYA 1O7GB 5RNTA 1TRQA 1ZS7A 3SXXA 3SOYA 1EG9B 3FKAA 4AKZA 3Q2PA 1PFPA 3FLJA 1YI23 1A67A 1W2ZA 3KN4A 1RNTA 1R4CA 2MF7A 1JN5A 1BUQA 1IT8A 1YIT3 1BRHA 1RCLA 3CC23 4K1UA 3B4PA 3O8YA 2LYXA 4O3VA 3STDA 2D42A 1BVIA 3LXUX 5FGOA 4EV5A 3G6E3 1W4NA 4HM3B 3AGNA 1JZOA 4JRFA 1CYVA 1GOYA 3UL5A 2A15A 1RGFA 3NBBA 2W9PA 1QMAA 4FCMA 1ISKA 5JBSA 8CHOA 4BL2A 2ZL8A 1BNEA 1SPUA 1RMSA 2GBWB 3K7CA 4AKYA 3UL6A 3E99A 1W7CA 4N6LA 3CC73 3KKGA 1N8R4 3VF1A 3FF0A 1MOLA 3BLZA 1RGEA 3CPOA 1YJ93 3AHSA 3F9SA 1LNIA 1LOWA 1W5ZA 1OF5A 1IT7A 1RN4A 3S27A 2BU4A 1LOXA 3OV4A 1RGKA 1Q824 3JUOA 3AMOA 3MWZA 5M19A 2WOFA 1A90A 2QGUA 2YX9A 4HZBB 1VQ93 5DRVA 3CXC2 1WTHA 3NBJA 1RGLA 1X1WA 4BU4A 4R1KA 4FMCA 3X42A 1RJOA 5GSPA 1IQ8A 1ROVA 2GXFA 1Q864 2F5WA 3JVCA 2UGIA 2INXA 4MMYB 5HGRA 1S723 2IY2A 3CMA3 4K90B 2W56A 4EV2A 2CFGA 1YVBI 1YJW3 4J9AA 5D83A 3FF2A 1GMRA 3OX9A 1OPYA 5IERA 3EE1A 4STDA 1E3RA 1TJDA 3X3YA 2B24B 2BMQB 2W2CA 1HZ1A 1SIHA 2O3OA 5AEUB 1K8A4 1RNBA 2XSOB 1N8QA 3H51A 3X40A 6STDA 1W6CA 3DUKA 3WODG 1W01A 2IMJA 1D6ZA 2IA7A 1QVG2 1FYSA 1AVKA 4ZM8A 2XFSA 3D5GA 1LOYA 3DXOA 1DETA 3S5CA 4HM6B 1GSPA 1X1UA 1RTUA 3NXJA 3BNBA 4KZ1A 4U13A 4RNZA 5KP3A 4LGQA 2OTJ3 1BNGA 2HMMB 1GMQA 2IUKA 2Q07A 2SARA 3AHWA 1E3VA 3KZTA 3MG2A 1K41A 5G2GA 3DZLA 1I8VA 4HJLB 1OGZA 2HMLB 2Z76A 4HYZA 5CF2A 4EBGA 1STDA 3WHOA 1JKGA 1QJGA 1OACA 1I70A 1WMPA 2FNQA 2ML6A 3CNXA 1B3SA 3PZWA 3VGNA 3FCSB 2LQVA 5IW9A 3M8CA 5ELJA 2STDA 1ZO2A 1FZUA 1DMMA 1WMOA 2P0XA 3ALAA 2CIUA 4N6NB 2WOHA 1K9M4 3Q1CA 4X2OA 4XM4A 1IVXA 1B2SA 1KWIA 2L1SA 2BIRA 2PZVA 5AIFA 2IYJA 1LNHA 4HVNA 1TFKA 3F8XA 2WGOA 3IMAB 4XBTA 4NREA 1B2MA 2K3DA 1LXEA 2YFLB 2OOVA 3NBRA 5BVBA 1VZZA 1A2VA 1FGTA 3CC43 4CDLA 3GZYB 1CH0A 1GY7A 5IEOA 1TTOA 1IQYA 1IV7A 1VQ83 6GSPA 2WGQA 1A2PA 4KFDA 2RCDA 3GAXA 2P38A 1EEJA 7GSPA 1AY7A 3D5IA 2D1WA 4NPBA 3B7CA 4OVMA 1GY6A 4FCZA 3RGRA 3HOHA 2JDIH 4LEHA 3FG1A 1UGHI 4N6MA 1CYUA 4R80A 4O8SA 2O9UX 1F8NA 1JB5A 3IJEB 1Y4KA 4GSPA 5CLKA 5I97A 1I3IA 4RBNA 3DGMA 3G8ZA 1I2EA 1D6YA 3CD63 4NHFA 4R4KA 2E2UA 3SYUA 5ELUA 1VQL3 4EW5A 1R4YA 5AYSC 1JZDA 1RGGA 4J5GA 2XH9A 1BRKA 3NM2A 3DGLA 5M18A 1CEWI 1W02A 1E97A 1V57A 4N6V0 3CCQ3 1YGEA 2FXTA 1Q814 3T0UA 1RCKA 1C7HA 3PCSA 3B8LA 2XRXB 1IK3A 1US1A 1Q9EA 1KC84 1DYUA 1KD14 3LYGA 5D82A 3WDGB 3QK9A 3G4S3 4O02B 1W00A 2ZA4A 4LMIA 4LZIA 4TX4A 5CF1A 4HM7B 3CCJ3 1BRNL 1FGQA 5LC6A 4BL3A 3JUMA 3HIIA 1UUVB 2C11A 4L8OA 1AR0A 2CK3H 2CFDA 1UI8A 2OOVC 7RNTA 3PXMA 3QRDA 4WFOA 4CCVA 8RNTA 5CK6A 3SOAA 1B2UA 4HZ9B 1V74A 1YNVX 5G1LA 2ZDJA 1JBRA 3I0YA 1QVF2 3PCRA 1BNSA 3U97A 1JB4A 3KSPA 1EQKA 1TU5A 3HK4A 3ER7A 1VQM3 2L4VA 1BU4A 4J5KA 3JUPA 1ASKA 1IU7A 1NNVA 1UCJA 2XFTA 3NUVA 3OWYA 3VSYA 1WMNA 1RSNA 1ULIB 1ZGXA 2XEPA 3OXAA 1T3BA 1BRGA 7STDA 1OH0A 3URPA 1BNFA 3JUNA 1RHLA 1RGCA 4XDVA 1M904 1ULJB 2XR8B 5G1KA 2E2VA 1UCKA 4GB5A 1LQMB 3A5EA 4ILFA 3LTBA 1T2IA 1VQQA 1GY5A 1PYLA 3WA3A 2W0QA 3DY5A 2K0MA 3DMCA 3G0KA 4PEJA 5BIRA 1DE3A 2BNGA 3FGYA 2PNCA 2W03A 3GSPA 4MMXB 2QA43 3RNTA 4L8PA 1BRIA 3F14A 3N8BA 3KE7A 4HM4B 1OGXA 3FH1A 3MPHA 1M9GA 3LT9A 1FGOA 1IYYA 1BSAA 1OHOA 4OUQA 3NX0A 3WOFB 5AIIA 1RLSA 2XGNA 4I5QA 2IUJA 5BU4A 3CNMA 1UW1A 4FMBA 3UNLA 4DKIA 1JBTA 1DVDA 3HX8A 3S67A 4R9KA 1YIJ3 4K61A 2CWTA 1YVSA 1MWRA 1EA2A 2YFJB 3BNCA 4IT7A 4LYLB 3RDEA 1KQS2 2CX0A 1B27A 2F5MA 1Q7Y4 4HM8B 1JB2A 3BNDA 4I4KA 3OWSA 1WNHA 1T5YA 2AAEA 4XDWA 1GD4A 3KCHA 4WP5A 1FA3A 1OUNA 1GOVA 3CU3A 3NV0B 3NM7A 5DREA 1VQ63 3RGAA 3EF8A 1W6GA 3MYTA 3IPTA 3ZG5A 3Q90A 1EKMA 5FW5A 5JPUA 1FGRA 1UCLA 5CXOA 1HU9A 3WMDA 3OW22 1ZX2A 3BIRA 4XB5A 1J2BA 3CME3 1VQK3 1YHQ3 4BTYA 4HM5B 3DGYA 1BSBA 2BHMA 2F99A 4J8TA 4RNTA 3EQQB 3MKIA 4O2HA 1MGRA 3EX9A 1B21A 3LT8A 3BNEA 1STFI 3DGNA 4MMZB 2YFIB 1OHPA 4LSOA 1VQN3
chains in the Genus database with same CATH topology
3T8UA 3V92A 2R4IA 1VQP3 2GU1A 3K9MC 2W04A 2HMJB 3KFQC 3F40A 3WOEB 4JF8A 4X2HA 4MEIA 2FGTA 1TUHA 3LTDA 5A0OB 1RKYA 5AIGA 1JV2B 3GRDA 5EEOA 3MG1A 3F7SA 4H61A 3CCR3 1VQ53 3GZRA 4EXRA 2HMOB 1RRHA 4BTXA 3T8NA 1IDPA 1ROAA 4H3UA 1YJN3 1WQLB 2Z77A 3D9RA 1NJI4 3ECFA 3K0ZA 2CG0A 1TP6A 3GZBA 2CHCA 4HM0B 3EBTA 2P0MA 4N3VA 4RZMA 5AIHA 3SLUA 2WO0A 3GZXB 4K1VA 5IG0A 1N9EA 2RSXA 4QWTA 1Z1SA 3LH4A 2CFKA 1Q40B 2KCDA 2KXGA 1NB5I 1QAKA 1RRLA 1G96A 1D6UA 2SBLA 4FMAA 5IENA 1O7WB 1NU3A 3HI7A 4N6OB 1GS3A 1U8CB 2E2TA 1L5GB 3KIIA 2Z6BA 2QIYA 1Q42A 4MJDA 5BXQA 4KVHA 4N6UA 1SQWA 1OCVA 3A76A 1KSIA 2XF3A 4G1MB 3FZWA 3F8HA 3CPW2 3PGBA 2HMNB 3CCV3 2RGQA 1K734 1O7HB 5TGNA 1IQXA 2KRTA 3CCU3 5IG5A 3I563 2CH9A 3G16A 4WHAA 1GYBA 3HZPA 4IIAA 1N9JA 3L0RA 4GL6A 4WYKB 1CQSA 2ML5A 3I553 3NQZA 3LTAA 1O7MB 3FSDA 3FG3A 3EC9A 3CCL3 1DMQA 1NB3I 3UB1A 3D3LA 3MHEA 2Y73A 3SX1A 1N5PA 4L7KA 3X41A 1VQ73 1FUWA 3X3ZA 4HM2B 3NV0A 1GD3A 1SIIA 3EN1B 3BB9A 3TDGA 3OWUA 3GWRA 4KFFA 1JN5B 3N9HA 4BTWA 1IV9A 2Y74A 3CCS3 1VQO3 2W6JH 2GEXA 4HKVB 4XBYA 3K63A 1UUWB 1FGMA 4HM1B 1TIJA 5EQLA 2GBXB 4HBRA 5IG3A 2P05A 3SVAA 5IEPA 2I9WA 2UX0A 2BT3A 2F98A 3LTCA 1DVCA 3X3XA 5JPPA 5IG4A 2RFRA 3EB8A 1RN7A 3LMLA 1IVWA 4OK0A 1A2KA 3CCM3 2OWPA 2CG1A 1OF5B 2GU3A 2OQEA 2V1LA 1W6YA 4ORLA 4EYCA 2CW9A 3AMOB 3V99A 5STDA 2P09A 3MG3A 1IVUA 2CC3A 4FCJA 1O7PB 3CCE3 3MSOA 3F7XA 4AEQA 3PYJA 3HIGA 4KFEA 5KP4A 1JNQA 4FMDA 5AYRB 2MC8A 3G713 3K5TA 3FG4A 1AVLA 3NHXA 2CFLA 3DM8A 2W9QA 2W56B 3V98A 1QALA 5EVHA 2JQ5A 3ROBA 2Z7AA 1SJWA 3LOYA 2QEX3 1UI7A 4WWUC 2K54A 1PU4A 1Q40A 1M1XB 1JRQA 2BMOB 3S29A 2HMKB 3KSED 5AEWB 1NWWA 1QAFA 3NQYA 2CKFB 1O7NB 2BMRB 4Q53A 4RNYA 2M7OA 4EC6A 4XBXA 3JUQA 1OHSA 2XSHB 5KP1A 3N54B 1HKXA 2B1XB 2BO9B 3SEDA 1VQ43 3DGOA 3LZAA 1DMNA 1LVNA 1S5AA 3UJMA 1TFOA 1K28A 2C10A 3B4OA 3WA2X 4FR9A 5AI1A 5IF6A 3U1WA 1JKGB 1N5HA 3EHCA 1W2B2 1IVVA 1NO3A 4IPBA 1MNLA 2F86B 2OCTA 3S28A 4WYKA 2CWUA 5D81A 2OQEC 3EJVA 1JJ22 2GEYA 1U5OA 2CWVA 3PS8A 2XGLA 3J7Yd 3EN8A 1AV4A 5LC7A 2CFWA 1NDOB 4R9LA 3H3HA 4N6TA 1M1K4 3EBYA 1O7GB 3SXXA 3SOYA 1EG9B 3FKAA 4AKZA 3Q2PA 1PFPA 3FLJA 1YI23 1A67A 1W2ZA 3KN4A 1R4CA 2MF7A 1JN5A 1BUQA 1IT8A 1YIT3 3CC23 4K1UA 3B4PA 3O8YA 2LYXA 4O3VA 3STDA 2D42A 3LXUX 5FGOA 4EV5A 3G6E3 1W4NA 4HM3B 4JRFA 1CYVA 3UL5A 2A15A 3NBBA 2W9PA 1QMAA 4FCMA 1ISKA 5JBSA 8CHOA 2ZL8A 1SPUA 2GBWB 3K7CA 4AKYA 3UL6A 3E99A 1W7CA 4N6LA 3CC73 3KKGA 1N8R4 3VF1A 3FF0A 1MOLA 3BLZA 3CPOA 1YJ93 3F9SA 1W5ZA 1OF5A 1IT7A 3S27A 1LOXA 3OV4A 1Q824 3JUOA 3AMOA 3MWZA 2WOFA 1A90A 2QGUA 2YX9A 4HZBB 1VQ93 5DRVA 3CXC2 1WTHA 3NBJA 4R1KA 4FMCA 3X42A 1RJOA 1IQ8A 1ROVA 2GXFA 1Q864 3JVCA 2INXA 4MMYB 5HGRA 1S723 3CMA3 4K90B 2W56A 4EV2A 2CFGA 1YVBI 1YJW3 4J9AA 5D83A 3FF2A 3OX9A 5IERA 1OPYA 3EE1A 4STDA 1E3RA 3X3YA 2B24B 2BMQB 2W2CA 1SIHA 5AEUB 2O3OA 1K8A4 2XSOB 1N8QA 3H51A 3X40A 6STDA 1W6CA 3DUKA 3WODG 1W01A 2IMJA 1D6ZA 2IA7A 1QVG2 1AVKA 4ZM8A 2XFSA 3DXOA 3S5CA 4HM6B 3NXJA 5KP3A 4KZ1A 3BNBA 4U13A 4RNZA 2OTJ3 4LGQA 2HMMB 3KZTA 2IUKA 2Q07A 3MG2A 5G2GA 1E3VA 1K41A 3DZLA 4HJLB 1OGZA 2HMLB 2Z76A 4HYZA 5CF2A 4EBGA 1STDA 1JKGA 1QJGA 1OACA 2ML6A 1WMPA 2FNQA 3CNXA 3PZWA 3VGNA 5IW9A 3FCSB 2LQVA 3M8CA 5ELJA 2STDA 1ZO2A 2P0XA 1DMMA 3ALAA 1WMOA 2CIUA 4N6NB 2WOHA 1K9M4 3Q1CA 4X2OA 4XM4A 1IVXA 1KWIA 2PZVA 5AIFA 1LNHA 4HVNA 1TFKA 3F8XA 2WGOA 3IMAB 4XBTA 4NREA 1LXEA 2YFLB 2OOVA 3NBRA 5BVBA 1VZZA 1A2VA 1FGTA 3CC43 4CDLA 3GZYB 1GY7A 5IEOA 1IQYA 1IV7A 1VQ83 2WGQA 4KFDA 2RCDA 3GAXA 2P38A 2D1WA 3B7CA 4OVMA 1GY6A 4FCZA 3RGRA 2JDIH 4LEHA 3FG1A 4N6MA 1CYUA 4R80A 4O8SA 2O9UX 1F8NA 1JB5A 3IJEB 1Y4KA 5CLKA 5I97A 4RBNA 3DGMA 3G8ZA 3CD63 1D6YA 4NHFA 4R4KA 2E2UA 5ELUA 1VQL3 5AYSC 2XH9A 3NM2A 3DGLA 1CEWI 1W02A 1E97A 4N6V0 3CCQ3 2FXTA 1YGEA 1Q814 3T0UA 1C7HA 3PCSA 3B8LA 2XRXB 1IK3A 1US1A 1KC84 1DYUA 1KD14 3LYGA 5D82A 3WDGB 3QK9A 3G4S3 4O02B 1W00A 4LMIA 4LZIA 4TX4A 5CF1A 4HM7B 3CCJ3 1FGQA 5LC6A 3JUMA 3HIIA 1UUVB 2C11A 4L8OA 1AR0A 2CK3H 2CFDA 1UI8A 2OOVC 3PXMA 3QRDA 4WFOA 4CCVA 5CK6A 3SOAA 4HZ9B 1V74A 2ZDJA 3I0YA 1QVF2 3PCRA 3U97A 1JB4A 3KSPA 1EQKA 1TU5A 3HK4A 3ER7A 1VQM3 2L4VA 3JUPA 1ASKA 1IU7A 3NUVA 2XFTA 3OWYA 3VSYA 1WMNA 3OXAA 1ULIB 2XEPA 7STDA 1OH0A 1M904 3JUNA 4XDVA 1ULJB 2XR8B 2E2VA 4GB5A 3LTBA 1GY5A 3WA3A 2W0QA 3DY5A 2K0MA 3DMCA 3G0KA 4PEJA 2BNGA 3FGYA 2PNCA 2W03A 4MMXB 2QA43 4L8PA 3F14A 3N8BA 3KE7A 4HM4B 1OGXA 3FH1A 3MPHA 1M9GA 3LT9A 1FGOA 1OHOA 4OUQA 3NX0A 3WOFB 5AIIA 2XGNA 2OTL3 2IUJA 3CNMA 1UW1A 4FMBA 3UNLA 1DVDA 3HX8A 3S67A 4R9KA 1YIJ3 4K61A 2CWTA 1KQS2 1EA2A 2YFJB 3BNCA 4IT7A 3RDEA 1Q7Y4 4HM8B 1JB2A 3BNDA 4I4KA 3OWSA 1WNHA 1T5YA 4XDWA 1GD4A 4WP5A 1FA3A 1OUNA 3CU3A 3NV0B 3NM7A 5DREA 1VQ63 3RGAA 3EF8A 1W6GA 3MYTA 3IPTA 3Q90A 1EKMA 5FW5A 5JPUA 1FGRA 5CXOA 1HU9A 3WMDA 3OW22 1ZX2A 4XB5A 1J2BA 3CME3 1VQK3 1YHQ3 4BTYA 4HM5B 2BHMA 2F99A 4J8TA 3EQQB 3MKIA 4O2HA 3EX9A 3LT8A 3BNEA 1STFI 3DGNA 4MMZB 2YFIB 1OHPA 4LSOA 1VQN3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T8U A;  2R4I A;  2HMJ B;  3F40 A;  4X2H A;  1TUH A;  5AIG A;  3GRD A;  3MG1 A;  3F7S A;  3GZR A;  2HMO B;  3T8N A;  1IDP A;  4H3U A;  1WQL B;  2Z77 A;  3D9R A;  3ECF A;  3K0Z A;  1TP6 A;  3GZB A;  2CHC A;  4HM0 B;  3EBT A;  4N3V A;  4RZM A;  5AIH A;  4K1V A;  3GZX B;  5IG0 A;  1Z1S A;  1Q40 B;  5IEN A;  1O7W B;  1NU3 A;  1GS3 A;  2QIY A;  1Q42 A;  4MJD A;  5BXQ A;  4KVH A;  1OCV A;  3A76 A;  3FZW A;  3F8H A;  2HMN B;  2RGQ A;  1O7H B;  5TGN A;  5IG5 A;  3G16 A;  1GYB A;  3HZP A;  4IIA A;  4WYK B;  1CQS A;  1O7M B;  3FSD A;  3EC9 A;  1DMQ A;  3MHE A;  4L7K A;  4HM2 B;  3NV0 A;  3EN1 B;  3BB9 A;  3OWU A;  3GWR A;  1JN5 B;  2GEX A;  4HKV B;  4XBY A;  1UUW B;  4HM1 B;  2GBX B;  5IG3 A;  5IEP A;  2I9W A;  2UX0 A;  2F98 A;  5JPP A;  5IG4 A;  2RFR A;  1A2K A;  2OWP A;  1OF5 B;  1W6Y A;  4ORL A;  5STD A;  3MG3 A;  4FCJ A;  1O7P B;  3MSO A;  3F7X A;  5KP4 A;  3NHX A;  3DM8 A;  5EVH A;  2JQ5 A;  3ROB A;  2Z7A A;  1SJW A;  4WWU C;  2K54 A;  1Q40 A;  2BMO B;  2HMK B;  5AEW B;  1NWW A;  2CKF B;  1O7N B;  2BMR B;  4Q53 A;  4XBX A;  3JUQ A;  1OHS A;  2XSH B;  5KP1 A;  1HKX A;  2B1X B;  3SED A;  3LZA A;  1DMN A;  1S5A A;  3UJM A;  3B4O A;  5AI1 A;  5IF6 A;  1JKG B;  3EHC A;  2F86 B;  4WYK A;  5D81 A;  3EJV A;  2GEY A;  1U5O A;  3EN8 A;  1NDO B;  4R9L A;  3H3H A;  3EBY A;  1O7G B;  3SOY A;  1EG9 B;  3FKA A;  3FLJ A;  1JN5 A;  1BUQ A;  4K1U A;  3B4P A;  3STD A;  4HM3 B;  2A15 A;  1QMA A;  4FCM A;  1ISK A;  8CHO A;  2GBW B;  3K7C A;  3E99 A;  3KKG A;  3FF0 A;  3BLZ A;  3CPO A;  3F9S A;  1OF5 A;  3OV4 A;  3JUO A;  2QGU A;  4HZB B;  5DRV A;  4R1K A;  2GXF A;  2INX A;  5HGR A;  4J9A A;  5D83 A;  3FF2 A;  3OX9 A;  5IER A;  1OPY A;  4STD A;  1E3R A;  2B24 B;  2BMQ B;  2W2C A;  5AEU B;  2XSO B;  3H51 A;  6STD A;  3DUK A;  1W01 A;  2IMJ A;  3DXO A;  3S5C A;  4HM6 B;  3NXJ A;  5KP3 A;  4U13 A;  4LGQ A;  2HMM B;  3KZT A;  3MG2 A;  5G2G A;  1E3V A;  1K41 A;  3DZL A;  4HJL B;  1OGZ A;  2HML B;  2Z76 A;  5CF2 A;  1STD A;  1JKG A;  1QJG A;  3CNX A;  3VGN A;  3M8C A;  2STD A;  1ZO2 A;  1DMM A;  4X2O A;  4XM4 A;  2PZV A;  5AIF A;  4HVN A;  3F8X A;  4XBT A;  2YFL B;  3NBR A;  5BVB A;  1VZZ A;  4CDL A;  3GZY B;  1GY7 A;  5IEO A;  2RCD A;  3B7C A;  4OVM A;  1GY6 A;  3RGR A;  4LEH A;  1JB5 A;  5CLK A;  3G8Z A;  3NM2 A;  1W02 A;  1E97 A;  1C7H A;  3B8L A;  2XRX B;  3LYG A;  5D82 A;  5CF1 A;  1W00 A;  4LMI A;  4HM7 B;  3JUM A;  1UUV B;  4L8O A;  1AR0 A;  5CK6 A;  3SOA A;  4HZ9 B;  3I0Y A;  1JB4 A;  3KSP A;  3HK4 A;  3ER7 A;  3JUP A;  1ASK A;  3NUV A;  3VSY A;  3OWY A;  3OXA A;  1ULI B;  7STD A;  1OH0 A;  3JUN A;  4XDV A;  1ULJ B;  2XR8 B;  4GB5 A;  1GY5 A;  3DMC A;  3G0K A;  4PEJ A;  2BNG A;  3FGY A;  4L8P A;  3F14 A;  3KE7 A;  4HM4 B;  1OGX A;  3FH1 A;  1OHO A;  4OUQ A;  5AII A;  3CNM A;  3UNL A;  3HX8 A;  4R9K A;  1EA2 A;  2YFJ B;  4HM8 B;  1JB2 A;  4I4K A;  3OWS A;  4XDW A;  4WP5 A;  1OUN A;  3CU3 A;  3NV0 B;  5DRE A;  3RGA A;  3EF8 A;  3MYT A;  3IPT A;  3Q90 A;  5FW5 A;  5JPU A;  5CXO A;  3WMD A;  1ZX2 A;  4XB5 A;  4HM5 B;  2F99 A;  4J8T A;  3EQQ B;  3MKI A;  3EX9 A;  2YFI B;  1OHP A; 
#chains in the Genus database with same CATH topology
 3T8U A;  3V92 A;  2R4I A;  1VQP 3;  2H0G A;  2GU1 A;  3K9M C;  4KT3 B;  2W04 A;  2HMJ B;  1I2F A;  3F40 A;  3KFQ C;  3WOE B;  4JF8 A;  4X2H A;  4MEI A;  2KF4 A;  9RNT A;  1RN1 A;  2FGT A;  1TUH A;  3WR2 A;  3LTD A;  5A0O B;  1RKY A;  5AIG A;  1JV2 B;  3GRD A;  5EEO A;  3MG1 A;  3F7S A;  4H61 A;  3CCR 3;  1VQ5 3;  1C54 A;  3GZR A;  4EXR A;  2HMO B;  1RRH A;  4BTX A;  3T8N A;  1IDP A;  1ROA A;  4H3U A;  1YJN 3;  1WQL B;  2Z77 A;  3D9R A;  1NJI 4;  3ECF A;  1BNJ A;  2C4B A;  3K0Z A;  2CG0 A;  1TP6 A;  3GZB A;  2CHC A;  4HM0 B;  3EBT A;  2P0M A;  4N3V A;  4RZM A;  1LQG C;  5AIH A;  2WO0 A;  3GZX B;  4K1V A;  3SLU A;  3D4A A;  5IG0 A;  1N9E A;  1RGH A;  2RSX A;  4QWT A;  2HOH A;  1Z1S A;  3LH4 A;  1BSE A;  2CFK A;  1Q40 B;  1BOX A;  1UCI A;  2KCD A;  2KXG A;  1NB5 I;  1QAK A;  1RRL A;  1G96 A;  1D6U A;  2H0I A;  2SBL A;  4FMA A;  5IEN A;  1O7W B;  1NU3 A;  3HI7 A;  1RDS A;  4N6O B;  1GS3 A;  1U8C B;  2E2T A;  2KF3 A;  2KF5 A;  1I0V A;  3KII A;  1L5G B;  2Z6B A;  2QIY A;  1Q42 A;  4MJD A;  1B2Z A;  4KVH A;  5BXQ A;  4N6U A;  1SQW A;  1OCV A;  3A76 A;  4CPK A;  1KSI A;  2XF3 A;  4G1M B;  2KAA A;  1MWS A;  3FZW A;  3F8H A;  3CPW 2;  3PGB A;  2HMN B;  3CCV 3;  2RGQ A;  1K73 4;  2UUG C;  1O7H B;  5TGN A;  1IQX A;  2KRT A;  1GOU A;  5IG5 A;  3I56 3;  3CCU 3;  2CH9 A;  3G16 A;  1UDI I;  4WHA A;  1GYB A;  1JBS A;  3HZP A;  4IIA A;  3AGO A;  1Q7H A;  1N9J A;  3L0R A;  4GL6 A;  4WYK B;  6RNT A;  1CQS A;  2ML5 A;  3I55 3;  3NQZ A;  3LTA A;  1O7M B;  2AAD A;  3FSD A;  1X1X A;  3EC9 A;  3FG3 A;  4HAA A;  3CCL 3;  1DMQ A;  1NB3 I;  3UB1 A;  3D3L A;  3MHE A;  2Y73 A;  3SX1 A;  1N5P A;  4L7K A;  3X41 A;  3DH2 A;  4GHO A;  3X3Z A;  1VQ7 3;  4HM2 B;  3NV0 A;  1FUW A;  1GD3 A;  1SII A;  1T2H A;  3BB9 A;  3EN1 B;  3TDG A;  3BU4 A;  3OWU A;  3Q3F A;  4HOH A;  3GWR A;  4KFF A;  1JN5 B;  3N9H A;  4BTW A;  1IV9 A;  2Y74 A;  3CCS 3;  1VQO 3;  2W6J H;  2GEX A;  1HYF A;  4HKV B;  1FUT A;  4XBY A;  3K63 A;  1UUW B;  1FGM A;  4HM1 B;  1TIJ A;  1UUG B;  2RNT A;  5EQL A;  2GBX B;  1BSD A;  1LRA A;  1G02 A;  4HBR A;  1TRP A;  5IG3 A;  2GSP A;  2P05 A;  3SVA A;  5IEP A;  2I9W A;  2UX0 A;  2BT3 A;  2F98 A;  3LTC A;  1DVC A;  1G0T A;  3X3X A;  1I0X A;  5JPP A;  5IG4 A;  2RFR A;  3EB8 A;  1RN7 A;  3LML A;  1IVW A;  1BSC A;  1GMP A;  4OK0 A;  1A2K A;  3CCM 3;  2OWP A;  2CG1 A;  1OF5 B;  2GU3 A;  1I2G A;  1SAR A;  2OQE A;  1BAN A;  1W6Y A;  2V1L A;  4ORL A;  4EYC A;  2CW9 A;  3AMO B;  3V99 A;  5STD A;  2P09 A;  3MG3 A;  5HOH A;  1IVU A;  2CC3 A;  2RBI A;  4FCJ A;  1I3F A;  2H0H A;  1O7P B;  3CCE 3;  1YGW A;  3MSO A;  1MWU A;  2R41 A;  3F7X A;  4AEQ A;  3PYJ A;  3HIG A;  4KFE A;  5KP4 A;  1JNQ A;  4FMD A;  5AYR B;  1B20 A;  2MC8 A;  3G71 3;  2CX1 A;  4CJN A;  3K5T A;  3FG4 A;  1AVL A;  3NHX A;  2CFL A;  3DM8 A;  2W9Q A;  2F4Y A;  1RGA A;  2W56 B;  3V98 A;  5M1A A;  3ZFZ A;  1AQZ A;  1QAL A;  5EVH A;  1BRJ A;  2JQ5 A;  3ROB A;  2Z7A A;  1SJW A;  3LOY A;  2QEX 3;  1UI7 A;  4WWU C;  1FUS A;  2K54 A;  1V58 A;  1MWT A;  1EUI C;  1JRQ A;  1M1X B;  1Q40 A;  1UGI A;  2BMO B;  1PU4 A;  1PY3 A;  3S29 A;  2HMK B;  3KSE D;  5AEW B;  1NWW A;  1QAF A;  3NQY A;  2CKF B;  2F56 A;  1O7N B;  2BMR B;  4Q53 A;  4RNY A;  2M7O A;  4EC6 A;  4XBX A;  2OTL 3;  3JUQ A;  1OHS A;  2XSH B;  1BGS A;  1BAO A;  3N54 B;  1HKX A;  5KP1 A;  2B1X B;  2BO9 B;  3SED A;  1VQ4 3;  3DGO A;  1BRS A;  1FW7 A;  3LZA A;  1DMN A;  1LVN A;  1S5A A;  3UJM A;  1BUJ A;  1TFO A;  1K28 A;  2C10 A;  3B4O A;  3WA2 X;  4FR9 A;  5AI1 A;  5IF6 A;  3U1W A;  2J8X B;  1JKG B;  1N5H A;  3EHC A;  1W2B 2;  1B2X A;  1IVV A;  1NO3 A;  1X1Y A;  4IPB A;  1MNL A;  2F86 B;  2OCT A;  3S28 A;  4WYK A;  1LOV A;  1MGW A;  2CWU A;  2OQE C;  2ZHX B;  3D79 A;  5D81 A;  3EJV A;  1JJ2 2;  1BNR A;  2GEY A;  1BNI A;  1U5O A;  2CWV A;  3PS8 A;  2XGL A;  3J7Y d;  3EN8 A;  1AV4 A;  5LC7 A;  2CFW A;  1BIR A;  2KF6 A;  4BIR A;  1NDO B;  3ZG0 A;  4R9L A;  3H3H A;  4N6T A;  1M1K 4;  3EBY A;  1O7G B;  5RNT A;  1TRQ A;  1ZS7 A;  3SXX A;  3SOY A;  1EG9 B;  3FKA A;  4AKZ A;  3Q2P A;  1PFP A;  3FLJ A;  1YI2 3;  1A67 A;  1W2Z A;  3KN4 A;  1RNT A;  1R4C A;  2MF7 A;  1JN5 A;  1BUQ A;  1IT8 A;  1YIT 3;  1BRH A;  1RCL A;  3CC2 3;  4K1U A;  3B4P A;  3O8Y A;  2LYX A;  4O3V A;  3STD A;  2D42 A;  1BVI A;  3LXU X;  5FGO A;  4EV5 A;  3G6E 3;  1W4N A;  4HM3 B;  3AGN A;  1JZO A;  4JRF A;  1CYV A;  1GOY A;  3UL5 A;  2A15 A;  1RGF A;  3NBB A;  2W9P A;  1QMA A;  4FCM A;  1ISK A;  5JBS A;  8CHO A;  4BL2 A;  2ZL8 A;  1BNE A;  1SPU A;  1RMS A;  2GBW B;  3K7C A;  4AKY A;  3UL6 A;  3E99 A;  1W7C A;  4N6L A;  3CC7 3;  3KKG A;  1N8R 4;  3VF1 A;  3FF0 A;  1MOL A;  3BLZ A;  1RGE A;  3CPO A;  1YJ9 3;  3AHS A;  3F9S A;  1LNI A;  1LOW A;  1W5Z A;  1OF5 A;  1IT7 A;  1RN4 A;  3S27 A;  2BU4 A;  1LOX A;  3OV4 A;  1RGK A;  1Q82 4;  3JUO A;  3AMO A;  3MWZ A;  5M19 A;  2WOF A;  1A90 A;  2QGU A;  2YX9 A;  4HZB B;  1VQ9 3;  5DRV A;  3CXC 2;  1WTH A;  3NBJ A;  1RGL A;  1X1W A;  4BU4 A;  4R1K A;  4FMC A;  3X42 A;  1RJO A;  5GSP A;  1IQ8 A;  1ROV A;  2GXF A;  1Q86 4;  2F5W A;  3JVC A;  2UGI A;  2INX A;  4MMY B;  5HGR A;  1S72 3;  2IY2 A;  3CMA 3;  4K90 B;  2W56 A;  4EV2 A;  2CFG A;  1YVB I;  1YJW 3;  4J9A A;  5D83 A;  3FF2 A;  1GMR A;  3OX9 A;  1OPY A;  5IER A;  3EE1 A;  4STD A;  1E3R A;  1TJD A;  3X3Y A;  2B24 B;  2BMQ B;  2W2C A;  1HZ1 A;  1SIH A;  2O3O A;  5AEU B;  1K8A 4;  1RNB A;  2XSO B;  1N8Q A;  3H51 A;  3X40 A;  6STD A;  1W6C A;  3DUK A;  3WOD G;  1W01 A;  2IMJ A;  1D6Z A;  2IA7 A;  1QVG 2;  1FYS A;  1AVK A;  4ZM8 A;  2XFS A;  3D5G A;  1LOY A;  3DXO A;  1DET A;  3S5C A;  4HM6 B;  1GSP A;  1X1U A;  1RTU A;  3NXJ A;  3BNB A;  4KZ1 A;  4U13 A;  4RNZ A;  5KP3 A;  4LGQ A;  2OTJ 3;  1BNG A;  2HMM B;  1GMQ A;  2IUK A;  2Q07 A;  2SAR A;  3AHW A;  1E3V A;  3KZT A;  3MG2 A;  1K41 A;  5G2G A;  3DZL A;  1I8V A;  4HJL B;  1OGZ A;  2HML B;  2Z76 A;  4HYZ A;  5CF2 A;  4EBG A;  1STD A;  3WHO A;  1JKG A;  1QJG A;  1OAC A;  1I70 A;  1WMP A;  2FNQ A;  2ML6 A;  3CNX A;  1B3S A;  3PZW A;  3VGN A;  3FCS B;  2LQV A;  5IW9 A;  3M8C A;  5ELJ A;  2STD A;  1ZO2 A;  1FZU A;  1DMM A;  1WMO A;  2P0X A;  3ALA A;  2CIU A;  4N6N B;  2WOH A;  1K9M 4;  3Q1C A;  4X2O A;  4XM4 A;  1IVX A;  1B2S A;  1KWI A;  2L1S A;  2BIR A;  2PZV A;  5AIF A;  2IYJ A;  1LNH A;  4HVN A;  1TFK A;  3F8X A;  2WGO A;  3IMA B;  4XBT A;  4NRE A;  1B2M A;  2K3D A;  1LXE A;  2YFL B;  2OOV A;  3NBR A;  5BVB A;  1VZZ A;  1A2V A;  1FGT A;  3CC4 3;  4CDL A;  3GZY B;  1CH0 A;  1GY7 A;  5IEO A;  1TTO A;  1IQY A;  1IV7 A;  1VQ8 3;  6GSP A;  2WGQ A;  1A2P A;  4KFD A;  2RCD A;  3GAX A;  2P38 A;  1EEJ A;  7GSP A;  1AY7 A;  3D5I A;  2D1W A;  4NPB A;  3B7C A;  4OVM A;  1GY6 A;  4FCZ A;  3RGR A;  3HOH A;  2JDI H;  4LEH A;  3FG1 A;  1UGH I;  4N6M A;  1CYU A;  4R80 A;  4O8S A;  2O9U X;  1F8N A;  1JB5 A;  3IJE B;  1Y4K A;  4GSP A;  5CLK A;  5I97 A;  1I3I A;  4RBN A;  3DGM A;  3G8Z A;  1I2E A;  1D6Y A;  3CD6 3;  4NHF A;  4R4K A;  2E2U A;  3SYU A;  5ELU A;  1VQL 3;  4EW5 A;  1R4Y A;  5AYS C;  1JZD A;  1RGG A;  4J5G A;  2XH9 A;  1BRK A;  3NM2 A;  3DGL A;  5M18 A;  1CEW I;  1W02 A;  1E97 A;  1V57 A;  4N6V 0;  3CCQ 3;  1YGE A;  2FXT A;  1Q81 4;  3T0U A;  1RCK A;  1C7H A;  3PCS A;  3B8L A;  2XRX B;  1IK3 A;  1US1 A;  1Q9E A;  1KC8 4;  1DYU A;  1KD1 4;  3LYG A;  5D82 A;  3WDG B;  3QK9 A;  3G4S 3;  4O02 B;  1W00 A;  2ZA4 A;  4LMI A;  4LZI A;  4TX4 A;  5CF1 A;  4HM7 B;  3CCJ 3;  1BRN L;  1FGQ A;  5LC6 A;  4BL3 A;  3JUM A;  3HII A;  1UUV B;  2C11 A;  4L8O A;  1AR0 A;  2CK3 H;  2CFD A;  1UI8 A;  2OOV C;  7RNT A;  3PXM A;  3QRD A;  4WFO A;  4CCV A;  8RNT A;  5CK6 A;  3SOA A;  1B2U A;  4HZ9 B;  1V74 A;  1YNV X;  5G1L A;  2ZDJ A;  1JBR A;  3I0Y A;  1QVF 2;  3PCR A;  1BNS A;  3U97 A;  1JB4 A;  3KSP A;  1EQK A;  1TU5 A;  3HK4 A;  3ER7 A;  1VQM 3;  2L4V A;  1BU4 A;  4J5K A;  3JUP A;  1ASK A;  1IU7 A;  1NNV A;  1UCJ A;  2XFT A;  3NUV A;  3OWY A;  3VSY A;  1WMN A;  1RSN A;  1ULI B;  1ZGX A;  2XEP A;  3OXA A;  1T3B A;  1BRG A;  7STD A;  1OH0 A;  3URP A;  1BNF A;  3JUN A;  1RHL A;  1RGC A;  4XDV A;  1M90 4;  1ULJ B;  2XR8 B;  5G1K A;  2E2V A;  1UCK A;  4GB5 A;  1LQM B;  3A5E A;  4ILF A;  3LTB A;  1T2I A;  1VQQ A;  1GY5 A;  1PYL A;  3WA3 A;  2W0Q A;  3DY5 A;  2K0M A;  3DMC A;  3G0K A;  4PEJ A;  5BIR A;  1DE3 A;  2BNG A;  3FGY A;  2PNC A;  2W03 A;  3GSP A;  4MMX B;  2QA4 3;  3RNT A;  4L8P A;  1BRI A;  3F14 A;  3N8B A;  3KE7 A;  4HM4 B;  1OGX A;  3FH1 A;  3MPH A;  1M9G A;  3LT9 A;  1FGO A;  1IYY A;  1BSA A;  1OHO A;  4OUQ A;  3NX0 A;  3WOF B;  5AII A;  1RLS A;  2XGN A;  4I5Q A;  2IUJ A;  5BU4 A;  3CNM A;  1UW1 A;  4FMB A;  3UNL A;  4DKI A;  1JBT A;  1DVD A;  3HX8 A;  3S67 A;  4R9K A;  1YIJ 3;  4K61 A;  2CWT A;  1YVS A;  1MWR A;  1EA2 A;  2YFJ B;  3BNC A;  4IT7 A;  4LYL B;  3RDE A;  1KQS 2;  2CX0 A;  1B27 A;  2F5M A;  1Q7Y 4;  4HM8 B;  1JB2 A;  3BND A;  4I4K A;  3OWS A;  1WNH A;  1T5Y A;  2AAE A;  4XDW A;  1GD4 A;  3KCH A;  4WP5 A;  1FA3 A;  1OUN A;  1GOV A;  3CU3 A;  3NV0 B;  3NM7 A;  5DRE A;  1VQ6 3;  3RGA A;  3EF8 A;  1W6G A;  3MYT A;  3IPT A;  3ZG5 A;  3Q90 A;  1EKM A;  5FW5 A;  5JPU A;  1FGR A;  1UCL A;  5CXO A;  1HU9 A;  3WMD A;  3OW2 2;  1ZX2 A;  3BIR A;  4XB5 A;  1J2B A;  3CME 3;  1VQK 3;  1YHQ 3;  4BTY A;  4HM5 B;  3DGY A;  1BSB A;  2BHM A;  2F99 A;  4J8T A;  4RNT A;  3EQQ B;  3MKI A;  4O2H A;  1MGR A;  3EX9 A;  1B21 A;  3LT8 A;  3BNE A;  1STF I;  3DGN A;  4MMZ B;  2YFI B;  1OHP A;  4LSO A;  1VQN 3; 
#chains in the Genus database with same CATH homology
 3T8U A;  3V92 A;  2R4I A;  1VQP 3;  2GU1 A;  3K9M C;  2W04 A;  2HMJ B;  3KFQ C;  3F40 A;  3WOE B;  4JF8 A;  4X2H A;  4MEI A;  2FGT A;  1TUH A;  3LTD A;  5A0O B;  1RKY A;  5AIG A;  1JV2 B;  3GRD A;  5EEO A;  3MG1 A;  3F7S A;  4H61 A;  3CCR 3;  1VQ5 3;  3GZR A;  4EXR A;  2HMO B;  1RRH A;  4BTX A;  3T8N A;  1IDP A;  1ROA A;  4H3U A;  1YJN 3;  1WQL B;  2Z77 A;  3D9R A;  1NJI 4;  3ECF A;  3K0Z A;  2CG0 A;  1TP6 A;  3GZB A;  2CHC A;  4HM0 B;  3EBT A;  2P0M A;  4N3V A;  4RZM A;  5AIH A;  3SLU A;  2WO0 A;  3GZX B;  4K1V A;  5IG0 A;  1N9E A;  2RSX A;  4QWT A;  1Z1S A;  3LH4 A;  2CFK A;  1Q40 B;  2KCD A;  2KXG A;  1NB5 I;  1QAK A;  1RRL A;  1G96 A;  1D6U A;  2SBL A;  4FMA A;  5IEN A;  1O7W B;  1NU3 A;  3HI7 A;  4N6O B;  1GS3 A;  1U8C B;  2E2T A;  1L5G B;  3KII A;  2Z6B A;  2QIY A;  1Q42 A;  4MJD A;  5BXQ A;  4KVH A;  4N6U A;  1SQW A;  1OCV A;  3A76 A;  1KSI A;  2XF3 A;  4G1M B;  3FZW A;  3F8H A;  3CPW 2;  3PGB A;  2HMN B;  3CCV 3;  2RGQ A;  1K73 4;  1O7H B;  5TGN A;  1IQX A;  2KRT A;  3CCU 3;  5IG5 A;  3I56 3;  2CH9 A;  3G16 A;  4WHA A;  1GYB A;  3HZP A;  4IIA A;  1N9J A;  3L0R A;  4GL6 A;  4WYK B;  1CQS A;  2ML5 A;  3I55 3;  3NQZ A;  3LTA A;  1O7M B;  3FSD A;  3FG3 A;  3EC9 A;  3CCL 3;  1DMQ A;  1NB3 I;  3UB1 A;  3D3L A;  3MHE A;  2Y73 A;  3SX1 A;  1N5P A;  4L7K A;  3X41 A;  1VQ7 3;  1FUW A;  3X3Z A;  4HM2 B;  3NV0 A;  1GD3 A;  1SII A;  3EN1 B;  3BB9 A;  3TDG A;  3OWU A;  3GWR A;  4KFF A;  1JN5 B;  3N9H A;  4BTW A;  1IV9 A;  2Y74 A;  3CCS 3;  1VQO 3;  2W6J H;  2GEX A;  4HKV B;  4XBY A;  3K63 A;  1UUW B;  1FGM A;  4HM1 B;  1TIJ A;  5EQL A;  2GBX B;  4HBR A;  5IG3 A;  2P05 A;  3SVA A;  5IEP A;  2I9W A;  2UX0 A;  2BT3 A;  2F98 A;  3LTC A;  1DVC A;  3X3X A;  5JPP A;  5IG4 A;  2RFR A;  3EB8 A;  1RN7 A;  3LML A;  1IVW A;  4OK0 A;  1A2K A;  3CCM 3;  2OWP A;  2CG1 A;  1OF5 B;  2GU3 A;  2OQE A;  2V1L A;  1W6Y A;  4ORL A;  4EYC A;  2CW9 A;  3AMO B;  3V99 A;  5STD A;  2P09 A;  3MG3 A;  1IVU A;  2CC3 A;  4FCJ A;  1O7P B;  3CCE 3;  3MSO A;  3F7X A;  4AEQ A;  3PYJ A;  3HIG A;  4KFE A;  5KP4 A;  1JNQ A;  4FMD A;  5AYR B;  2MC8 A;  3G71 3;  3K5T A;  3FG4 A;  1AVL A;  3NHX A;  2CFL A;  3DM8 A;  2W9Q A;  2W56 B;  3V98 A;  1QAL A;  5EVH A;  2JQ5 A;  3ROB A;  2Z7A A;  1SJW A;  3LOY A;  2QEX 3;  1UI7 A;  4WWU C;  2K54 A;  1PU4 A;  1Q40 A;  1M1X B;  1JRQ A;  2BMO B;  3S29 A;  2HMK B;  3KSE D;  5AEW B;  1NWW A;  1QAF A;  3NQY A;  2CKF B;  1O7N B;  2BMR B;  4Q53 A;  4RNY A;  2M7O A;  4EC6 A;  4XBX A;  3JUQ A;  1OHS A;  2XSH B;  5KP1 A;  3N54 B;  1HKX A;  2B1X B;  2BO9 B;  3SED A;  1VQ4 3;  3DGO A;  3LZA A;  1DMN A;  1LVN A;  1S5A A;  3UJM A;  1TFO A;  1K28 A;  2C10 A;  3B4O A;  3WA2 X;  4FR9 A;  5AI1 A;  5IF6 A;  3U1W A;  1JKG B;  1N5H A;  3EHC A;  1W2B 2;  1IVV A;  1NO3 A;  4IPB A;  1MNL A;  2F86 B;  2OCT A;  3S28 A;  4WYK A;  2CWU A;  5D81 A;  2OQE C;  3EJV A;  1JJ2 2;  2GEY A;  1U5O A;  2CWV A;  3PS8 A;  2XGL A;  3J7Y d;  3EN8 A;  1AV4 A;  5LC7 A;  2CFW A;  1NDO B;  4R9L A;  3H3H A;  4N6T A;  1M1K 4;  3EBY A;  1O7G B;  3SXX A;  3SOY A;  1EG9 B;  3FKA A;  4AKZ A;  3Q2P A;  1PFP A;  3FLJ A;  1YI2 3;  1A67 A;  1W2Z A;  3KN4 A;  1R4C A;  2MF7 A;  1JN5 A;  1BUQ A;  1IT8 A;  1YIT 3;  3CC2 3;  4K1U A;  3B4P A;  3O8Y A;  2LYX A;  4O3V A;  3STD A;  2D42 A;  3LXU X;  5FGO A;  4EV5 A;  3G6E 3;  1W4N A;  4HM3 B;  4JRF A;  1CYV A;  3UL5 A;  2A15 A;  3NBB A;  2W9P A;  1QMA A;  4FCM A;  1ISK A;  5JBS A;  8CHO A;  2ZL8 A;  1SPU A;  2GBW B;  3K7C A;  4AKY A;  3UL6 A;  3E99 A;  1W7C A;  4N6L A;  3CC7 3;  3KKG A;  1N8R 4;  3VF1 A;  3FF0 A;  1MOL A;  3BLZ A;  3CPO A;  1YJ9 3;  3F9S A;  1W5Z A;  1OF5 A;  1IT7 A;  3S27 A;  1LOX A;  3OV4 A;  1Q82 4;  3JUO A;  3AMO A;  3MWZ A;  2WOF A;  1A90 A;  2QGU A;  2YX9 A;  4HZB B;  1VQ9 3;  5DRV A;  3CXC 2;  1WTH A;  3NBJ A;  4R1K A;  4FMC A;  3X42 A;  1RJO A;  1IQ8 A;  1ROV A;  2GXF A;  1Q86 4;  3JVC A;  2INX A;  4MMY B;  5HGR A;  1S72 3;  3CMA 3;  4K90 B;  2W56 A;  4EV2 A;  2CFG A;  1YVB I;  1YJW 3;  4J9A A;  5D83 A;  3FF2 A;  3OX9 A;  5IER A;  1OPY A;  3EE1 A;  4STD A;  1E3R A;  3X3Y A;  2B24 B;  2BMQ B;  2W2C A;  1SIH A;  5AEU B;  2O3O A;  1K8A 4;  2XSO B;  1N8Q A;  3H51 A;  3X40 A;  6STD A;  1W6C A;  3DUK A;  3WOD G;  1W01 A;  2IMJ A;  1D6Z A;  2IA7 A;  1QVG 2;  1AVK A;  4ZM8 A;  2XFS A;  3DXO A;  3S5C A;  4HM6 B;  3NXJ A;  5KP3 A;  4KZ1 A;  3BNB A;  4U13 A;  4RNZ A;  2OTJ 3;  4LGQ A;  2HMM B;  3KZT A;  2IUK A;  2Q07 A;  3MG2 A;  5G2G A;  1E3V A;  1K41 A;  3DZL A;  4HJL B;  1OGZ A;  2HML B;  2Z76 A;  4HYZ A;  5CF2 A;  4EBG A;  1STD A;  1JKG A;  1QJG A;  1OAC A;  2ML6 A;  1WMP A;  2FNQ A;  3CNX A;  3PZW A;  3VGN A;  5IW9 A;  3FCS B;  2LQV A;  3M8C A;  5ELJ A;  2STD A;  1ZO2 A;  2P0X A;  1DMM A;  3ALA A;  1WMO A;  2CIU A;  4N6N B;  2WOH A;  1K9M 4;  3Q1C A;  4X2O A;  4XM4 A;  1IVX A;  1KWI A;  2PZV A;  5AIF A;  1LNH A;  4HVN A;  1TFK A;  3F8X A;  2WGO A;  3IMA B;  4XBT A;  4NRE A;  1LXE A;  2YFL B;  2OOV A;  3NBR A;  5BVB A;  1VZZ A;  1A2V A;  1FGT A;  3CC4 3;  4CDL A;  3GZY B;  1GY7 A;  5IEO A;  1IQY A;  1IV7 A;  1VQ8 3;  2WGQ A;  4KFD A;  2RCD A;  3GAX A;  2P38 A;  2D1W A;  3B7C A;  4OVM A;  1GY6 A;  4FCZ A;  3RGR A;  2JDI H;  4LEH A;  3FG1 A;  4N6M A;  1CYU A;  4R80 A;  4O8S A;  2O9U X;  1F8N A;  1JB5 A;  3IJE B;  1Y4K A;  5CLK A;  5I97 A;  4RBN A;  3DGM A;  3G8Z A;  3CD6 3;  1D6Y A;  4NHF A;  4R4K A;  2E2U A;  5ELU A;  1VQL 3;  5AYS C;  2XH9 A;  3NM2 A;  3DGL A;  1CEW I;  1W02 A;  1E97 A;  4N6V 0;  3CCQ 3;  2FXT A;  1YGE A;  1Q81 4;  3T0U A;  1C7H A;  3PCS A;  3B8L A;  2XRX B;  1IK3 A;  1US1 A;  1KC8 4;  1DYU A;  1KD1 4;  3LYG A;  5D82 A;  3WDG B;  3QK9 A;  3G4S 3;  4O02 B;  1W00 A;  4LMI A;  4LZI A;  4TX4 A;  5CF1 A;  4HM7 B;  3CCJ 3;  1FGQ A;  5LC6 A;  3JUM A;  3HII A;  1UUV B;  2C11 A;  4L8O A;  1AR0 A;  2CK3 H;  2CFD A;  1UI8 A;  2OOV C;  3PXM A;  3QRD A;  4WFO A;  4CCV A;  5CK6 A;  3SOA A;  4HZ9 B;  1V74 A;  2ZDJ A;  3I0Y A;  1QVF 2;  3PCR A;  3U97 A;  1JB4 A;  3KSP A;  1EQK A;  1TU5 A;  3HK4 A;  3ER7 A;  1VQM 3;  2L4V A;  3JUP A;  1ASK A;  1IU7 A;  3NUV A;  2XFT A;  3OWY A;  3VSY A;  1WMN A;  3OXA A;  1ULI B;  2XEP A;  7STD A;  1OH0 A;  1M90 4;  3JUN A;  4XDV A;  1ULJ B;  2XR8 B;  2E2V A;  4GB5 A;  3LTB A;  1GY5 A;  3WA3 A;  2W0Q A;  3DY5 A;  2K0M A;  3DMC A;  3G0K A;  4PEJ A;  2BNG A;  3FGY A;  2PNC A;  2W03 A;  4MMX B;  2QA4 3;  4L8P A;  3F14 A;  3N8B A;  3KE7 A;  4HM4 B;  1OGX A;  3FH1 A;  3MPH A;  1M9G A;  3LT9 A;  1FGO A;  1OHO A;  4OUQ A;  3NX0 A;  3WOF B;  5AII A;  2XGN A;  2OTL 3;  2IUJ A;  3CNM A;  1UW1 A;  4FMB A;  3UNL A;  1DVD A;  3HX8 A;  3S67 A;  4R9K A;  1YIJ 3;  4K61 A;  2CWT A;  1KQS 2;  1EA2 A;  2YFJ B;  3BNC A;  4IT7 A;  3RDE A;  1Q7Y 4;  4HM8 B;  1JB2 A;  3BND A;  4I4K A;  3OWS A;  1WNH A;  1T5Y A;  4XDW A;  1GD4 A;  4WP5 A;  1FA3 A;  1OUN A;  3CU3 A;  3NV0 B;  3NM7 A;  5DRE A;  1VQ6 3;  3RGA A;  3EF8 A;  1W6G A;  3MYT A;  3IPT A;  3Q90 A;  1EKM A;  5FW5 A;  5JPU A;  1FGR A;  5CXO A;  1HU9 A;  3WMD A;  3OW2 2;  1ZX2 A;  4XB5 A;  1J2B A;  3CME 3;  1VQK 3;  1YHQ 3;  4BTY A;  4HM5 B;  2BHM A;  2F99 A;  4J8T A;  3EQQ B;  3MKI A;  4O2H A;  3EX9 A;  3LT8 A;  3BNE A;  1STF I;  3DGN A;  4MMZ B;  2YFI B;  1OHP A;  4LSO A;  1VQN 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...