1LOYA

X-ray structure of the h40a/e58a mutant of ribonuclease t1 complexed with 3'-guanosine monophosphate
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPAKYNNYEGFDFSVSSPYYAWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease T1
publication title A nucleophile activation dyad in ribonucleases. A combined X-ray crystallographic/ab initio quantum chemical study
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1loyA00
2KF3A 1RNTA 2BIRA 2KF6A 1FUSA 1B2MA 1X1YA 1LRAA 3WR2A 1RSNA 1B20A 1RDSA 1YGWA 1BNFA 1B2XA 1GOYA 1ZGXA 1X1UA 2ZA4A 3DH2A 1BNJA 1I3IA 2F5WA 3D5IA 1BRNL 1JBRA 6GSPA 1FZUA 4GSPA 1I0VA 1JBSA 2AADA 1T2IA 1FUTA 1UCLA 1TRPA 1RGKA 1BIRA 1BRHA 1R4YA 1RGHA 1UCJA 1I3FA 2F4YA 2RNTA 1X1WA 3AGNA 1RCLA 1PY3A 1A2PA 6RNTA 1GOVA 8RNTA 1BRSA 1G02A 5RNTA 7RNTA 1RGCA 5BU4A 1BNSA 1FYSA 1RTUA 3AGOA 1BSDA 3URPA 1RCKA 3RNTA 1B2ZA 1BNGA 1BNIA 1FW7A 1CH0A 1B27A 4HAAA 5HOHA 1BUJA 1RLSA 1AQZA 1UCKA 4GHOA 1RHLA 1GMQA 1Q9EA 1RNBA 4BIRA 3AHWA 1GMPA 2AAEA 2GSPA 1GOUA 1RGGA 2SARA 3Q3FA 4RNTA 1BRGA 1TTOA 1I2FA 3SYUA 1I2EA 1B2UA 1BGSA 1YVSA 1YNVX 3DGYA 1B2SA 1RN1A 1RN4A 1T2HA 1RGAA 1X1XA 1B21A 3D4AA 1I0XA 1LOWA 1BRJA 2KF4A 3AHSA 3KCHA 3BU4A 3BIRA 1I2GA 2KF5A 1BANA 2C4BA 1AY7A 4J5GA 4HOHA 5GSPA 1BVIA 2HOHA 3GSPA 1RGEA 2F56A 1GSPA 1JBTA 1LOVA 1BU4A 1DETA 1BSBA 1BAOA 1SARA 4BU4A 1BNRA 1BRIA 1RGLA 1PYLA 1I70A 1B3SA 1BNEA 1BSEA 1BOXA 9RNTA 2F5MA 1RGFA 1BSAA 1LOYA 1RMSA 1GMRA 1MGRA 1UCIA 1TRQA 3D5GA 4J5KA 2KAAA 1C54A 1IYYA 3A5EA 1DE3A 1BRKA 1HZ1A 1HYFA 2BU4A 5BIRA 3HOHA 2RBIA 1I8VA 1BSCA 1LNIA 1MGWA 3WHOA 7GSPA
chains in the Genus database with same CATH superfamily
1RJOA 1LQMB 1W01A 2W6JH 2BIRA 4EXRA 3EE1A 2QGUA 1L5GB 1ASKA 1UUWB 2CFLA 1STDA 5CK6A 3B8LA 3WDGB 1X1YA 2A15A 3K63A 1LRAA 5AEWB 1W2B2 1M9GA 5AIIA 1RDSA 1ZGXA 4R80A 5KP4A 2F99A 3IMAB 1NB5I 1I3IA 3D5IA 3FCSB 3JUQA 4WHAA 3EHCA 3NBRA 1QVF2 3RGRA 1I0VA 1JBSA 3NV0B 2AADA 2XFSA 3ER7A 1ULJB 2GEYA 1Q7Y4 3DGNA 1TRPA 2FNQA 3IJEB 1JKGB 1RGKA 3FSDA 3NM7A 2GBXB 4CCVA 4FMAA 3G0KA 1W4NA 3A76A 1PY3A 2R4IA 3MG1A 1UW1A 4FMBA 4QWTA 5RNTA 2QEX3 3OXAA 3DY5A 7RNTA 3CXC2 1MWUA 5KP3A 4HM8B 3TDGA 3CNXA 2IY2A 1E3RA 3HX8A 1RCKA 1N9JA 2K54A 3RNTA 1BNGA 3UL5A 1BNIA 3QK9A 1FW7A 2WOFA 2B24B 4MMXB 1YJ93 1Q814 3NM2A 4GB5A 1YVBI 2ML6A 3G6E3 5AEUB 3U1WA 4U13A 1A2KA 1JKGA 3EC9A 4GHOA 2FGTA 1YGEA 1GMQA 1N5HA 1VQ43 3S27A 3MWZA 1Q9EA 2BNGA 4KZ1A 3I553 1WMNA 4I5QA 1VQ93 3CCQ3 1E97A 3LTDA 1JB4A 3D79A 3FF2A 3SVAA 5FW5A 1IVWA 3ZFZA 2GBWB 4RNTA 4HM6B 3PS8A 1TTOA 3FH1A 2HMKB 1B2UA 1VQK3 1GY6A 1YNVX 3H51A 2YFLB 1B2SA 2CFDA 1RN1A 1RN4A 1QJGA 4HBRA 5AIFA 2WGQA 3E99A 1B21A 2ZDJA 4J8TA 3SOAA 1RRHA 3SX1A 1GY5A 3N9HA 1DMMA 1D6ZA 1OF5B 3S5CA 3GRDA 3MG2A 3JUMA 2KF5A 1EUIC 5GSPA 2CWTA 2CG0A 1QAKA 3MKIA 4G1MB 2CFKA 3GZBA 3DGLA 1RGEA 1YI23 2SBLA 1IV7A 1MNLA 3CD63 4JRFA 1IDPA 5D82A 1BAOA 4BU4A 3CCR3 3CCS3 2CK3H 3KSED 1NU3A 2CX1A 5AI1A 1NB3I 3MG3A 2STDA 1BSEA 3FG1A 3B4OA 3CME3 5STDA 1FGRA 1OF5A 9RNTA 1NWWA 2CFGA 1BUQA 3CC43 1RN7A 5D83A 4OUQA 1VQL3 2W9PA 2H0IA 5M1AA 1UCIA 4J9AA 1WNHA 4BTXA 2MF7A 4H3UA 1EQKA 4J5KA 2E2UA 2KAAA 1JB5A 1GD3A 1QALA 1U5OA 4IPBA 1NNVA 2Y73A 5CF2A 2CWVA 2OQEA 1JZDA 2BU4A 2H0HA 3N54B 2F86B 3ZG5A 4WP5A 1GYBA 2CFWA 4RNYA 4LMIA 3WHOA 1MGWA 2V1LA 3LXUX 1RNTA 4N6OB 4EBGA 4HM3B 3ZG0A 4JF8A 1DMQA 2OCTA 2KCDA 3K9MC 3GWRA 5BXQA 1G96A 5DRVA 3K7CA 5IG3A 4N6LA 2K3DA 3KIIA 1FGOA 4K1UA 1B2XA 1GOYA 1MOLA 1X1UA 2BMRB 3HI7A 5ELJA 4AKZA 1VQ73 4LZIA 1BRNL 6GSPA 1OUNA 3F8XA 1FZUA 1Q42A 3D3LA 2R41A 2E2TA 1MWRA 2GU1A 3Q2PA 1N8QA 4RNZA 1CQSA 1RRLA 3EJVA 4X2OA 1DVCA 4MEIA 3ROBA 3V98A 1BRHA 1R4YA 1RGHA 2F4YA 2P0MA 4HM4B 1WMPA 3AGNA 1B2MA 3MHEA 1JV2B 1G02A 1R4CA 2BO9B 3F14A 1NDOB 3PGBA 2XF3A 5BU4A 3F7SA 2ZL8A 1RTUA 3F9SA 3KSPA 2UX0A 4KT3B 5KP1A 1UI8A 3G4S3 2XFTA 3CNMA 1WQLB 1OH0A 4O3VA 4L8PA 1B27A 3FG3A 3F40A 1LNHA 1CYVA 2K0MA 2ML5A 5HGRA 7STDA 1AQZA 3U97A 4EV2A 4EV5A 4ILFA 3K5TA 1EA2A 5LC6A 1NO3A 3T0UA 2QA43 1CYUA 3OWSA 3LH4A 1SIIA 5AIGA 1IVUA 3WOEB 1RNBA 3KN4A 4CJNA 5FGOA 1JRQA 2W03A 3WA2X 4EC6A 1GMPA 2UGIA 2GSPA 1GOUA 3SLUA 1S5AA 4HM2B 1I2EA 1RKYA 1KSIA 4BTYA 3L0RA 1T2HA 1TFOA 2INXA 2P38A 3CCE3 1X1XA 2W2CA 3FLJA 3CCJ3 2GXFA 2IYJA 4NHFA 3NV0A 3S67A 1K734 2KF4A 2L4VA 4MMZB 3FZWA 3BIRA 3X3XA 1DYUA 2OOVA 1BANA 3NQZA 5JBSA 2C4BA 1J2BA 5G1LA 1O7MB 1BVIA 1SPUA 3FF0A 1GSPA 3IPTA 4HVNA 1IQ8A 1PFPA 4KFFA 4LYLB 3H3HA 3X40A 3KE7A 5IEOA 1RGLA 3HZPA 3J7Yd 1PYLA 3MYTA 1I70A 1B3SA 1W7CA 1D6UA 1O7PB 3N8BA 4FCZA 3PZWA 4FMDA 3SXXA 1KWIA 2Z6BA 4OK0A 4XDWA 1JZOA 2RSXA 1KQS2 1LQGC 2F5MA 3CPOA 1SQWA 4BL3A 3HIGA 1VQM3 4KFDA 1IT8A 4R9LA 4FMCA 1C54A 2IA7A 3F7XA 4O8SA 3G16A 3PCRA 2XR8B 2HMMB 2XGLA 2Z76A 5G1KA 4STDA 5BIRA 2XSHB 1YHQ3 3NHXA 1G0TA 1IV9A 1I8VA 2C11A 3JVCA 1IVXA 2OQEC 4KFEA 1U8CB 1EKMA 1UGIA 3G8ZA 1FUSA 1OGZA 4HZBB 2HMOB 1A2VA 3KFQC 4NPBA 1E3VA 2JQ5A 3WR2A 1AV4A 1RSNA 4RZMA 1BNFA 4IIAA 1KC84 4HKVB 3DH2A 4R4KA 1BNJA 2LQVA 5TGNA 2IUJA 2I9WA 3EX9A 3VGNA 3CMA3 2XGNA 4HM5B 5JPPA 3BNEA 2RGQA 4AKYA 1DVDA 1FA3A 4IT7A 4XBYA 1Y4KA 1PU4A 4OVMA 4TX4A 1ROVA 1T2IA 4HM7B 1FUTA 2CX0A 1UCLA 1STFI 1IVVA 1AR0A 2RNTA 2D1WA 3EB8A 3BNDA 4HYZA 1V58A 2P05A 4FR9A 1X1WA 4N6MA 5ELUA 1K8A4 3LZAA 2M7OA 4N3VA 4K1VA 2GEXA 6RNTA 1GOVA 1ROAA 3OWYA 1BRSA 3GZXB 8RNTA 1RGCA 1FGTA 1UI7A 2CC3A 1W2ZA 1BNSA 3AGOA 4WFOA 3LTCA 3OV4A 4LGQA 1BSDA 1HKXA 2W9QA 3URPA 3S29A 1B2ZA 1W5ZA 5CLKA 1CH0A 2C10A 1T5YA 1YJN3 1VQ53 3F8HA 1TP6A 1RLSA 4FCJA 3CCL3 3VF1A 4CDLA 4XM4A 1BUJA 2MC8A 1UCKA 4LEHA 2OWPA 2BT3A 1CEWI 1RHLA 2IUKA 3O8YA 5EEOA 1VQQA 2D42A 4BIRA 3AHWA 3PXMA 4FCMA 1FGQA 1K41A 1WTHA 2IMJA 8CHOA 4HM1B 2AAEA 3Q3FA 1FGMA 3I0YA 5AYRB 1A90A 1BRGA 2F98A 3UB1A 1VZZA 1ZS7A 3GZYB 4XDVA 5CF1A 5JPUA 3NBJA 4MMYB 1Q864 3X3ZA 3CCM3 3MPHA 1K9M4 3LT8A 2CW9A 1VQN3 1T3BA 3D4AA 1MWTA 3BB9A 3WOFB 1OACA 4MJDA 1BRJA 1JB2A 1S723 3KCHA 3I563 1YIJ3 5EQLA 1VQO3 1QAFA 5I97A 5M18A 1KD14 4XBTA 3EQQB 4PEJA 2Z77A 1AY7A 3QRDA 4J5GA 5DREA 4O02B 2P09A 3NXJA 3GSPA 4AEQA 5IEPA 4X2HA 2OOVC 1BU4A 3CC73 1DETA 1W02A 1Q40B 3LTAA 1BRIA 1QVG2 4L7KA 1LVNA 2UUGC 1UDII 5IW9A 3LTBA 4CPKA 2HMLB 1BOXA 4BTWA 1RGFA 4GL6A 3LOYA 2KXGA 1OHOA 1RMSA 3JUOA 1GMRA 2O3OA 3M8CA 3ALAA 5EVHA 2H0GA 1TRQA 3D5GA 3JUPA 3RDEA 3Q90A 3WA3A 1DE3A 3UNLA 1TIJA 1HZ1A 2Z7AA 3NQYA 1FUWA 1IQXA 1YJW3 1K28A 1DMNA 1Q40A 2ZHXB 3HOHA 3SEDA 2RBIA 2CHCA 2XRXB 2GU3A 2W04A 2YX9A 2CH9A 3OWUA 3T8UA 1LOXA 2XSOB 3FKAA 5G2GA 2WOHA 3OX9A 2OTJ3 2KF3A 1IQYA 2KF6A 3DUKA 4L8OA 3EF8A 4N6NB 5IG0A 1UGHI 2PNCA 3K0ZA 2YFJB 5LC7A 3V99A 3CU3A 1GY7A 3RGAA 1N5PA 1B20A 3NX0A 1ZX2A 3JUNA 1YGWA 3MSOA 4I4KA 2ZA4A 2F5WA 4HZ9B 1JBRA 3LT9A 1GS3A 1M1XB 3DZLA 4K90B 1HU9A 4GSPA 3PCSA 4XBXA 1OHSA 2KRTA 1W6CA 1Z1SA 2J8XB 1W00A 3ECFA 4DKIA 3NUVA 1SIHA 5M19A 2XH9A 1BIRA 1UCJA 1OPYA 1I3FA 2PZVA 1RCLA 1QMAA 1A2PA 2L1SA 1W6GA 3KKGA 2YFIB 5IERA 1UUVB 3DMCA 1N8R4 2OTL3 1O7NB 1OCVA 1GD4A 1FYSA 3V92A 3VSYA 2LYXA 1OGXA 4K61A 4KVHA 1O7WB 4LSOA 3T8NA 1A67A 1YIT3 3WODG 5A0OB 3CCU3 4HAAA 1Q7HA 3EN8A 5HOHA 2RCDA 1JNQA 3AMOB 2B1XB 3EBTA 2QIYA 1V57A 3DGMA 4EW5A 3S28A 3HK4A 2BHMA 2CKFB 3GZRA 5IF6A 4BL2A 1VQP3 2WO0A 2Y74A 3DXOA 2O9UX 1F8NA 2BMQB 1O7GB 4ZM8A 3PYJA 4O2HA 1W6YA 1AVLA 2SARA 1RGGA 3FGYA 5D81A 4EYCA 1I2FA 3SYUA 1YVSA 1BGSA 4ORLA 1OHPA 3DGOA 3DGYA 3AMOA 4XB5A 1IT7A 1JJ22 2W0QA 2P0XA 4RBNA 5IG4A 1RGAA 1UUGB 1VQ83 2XEPA 3EBYA 4HJLB 1I0XA 3BLZA 1LOWA 3STDA 3DM8A 4N6TA 3AHSA 5AIHA 2CG1A 3BU4A 5IENA 1I2GA 2FXTA 2WGOA 2W56B 2JDIH 1VQ63 1ULIB 3Q1CA 4HOHA 1IU7A 2HOHA 3CC23 1M904 1US1A 1LXEA 3LYGA 3B4PA 1C7HA 2F56A 2HMJB 1JBTA 3X42A 1LOVA 5IG5A 1BSBA 1SARA 3HIIA 5CXOA 1N9EA 4N6UA 4WYKB 5AYSC 3UJMA 3X41A 1BNRA 3LMLA 2CWUA 4WWUC 1TJDA 1NJI4 2RFRA 4H61A 3BNBA 4R1KA 1TU5A 1D6YA 5BVBA 1BNEA 1JN5B 4N6V0 2Q07A 3KZTA 1SJWA 3FG4A 3B7CA 2BMOB 1BSAA 1LOYA 2CIUA 2W56A 3NBBA 4R9KA 1EEJA 1V74A 4Q53A 3SOYA 1MGRA 3OW22 1TFKA 3CPW2 4NREA 1O7HB 1IYYA 3BNCA 3A5EA 2HMNB 1BRKA 1TUHA 1HYFA 1MWSA 1M1K4 1ZO2A 3EN1B 1IK3A 1Q824 4WYKA 3CCV3 3G713 1EG9B 2E2VA 3UL6A 3GAXA 4HM0B 6STDA 3X3YA 1AVKA 1BSCA 1WMOA 1LNIA 3D9RA 1JN5A 3WMDA 7GSPA 1ISKA
chains in the Genus database with same CATH topology
2KF3A 1RNTA 2BIRA 2KF6A 1FUSA 1B2MA 1X1YA 1LRAA 3WR2A 1RSNA 1B20A 1RDSA 1YGWA 1BNFA 1B2XA 1GOYA 1ZGXA 1X1UA 2ZA4A 3DH2A 1BNJA 1I3IA 2F5WA 3D5IA 1BRNL 1JBRA 6GSPA 1FZUA 4GSPA 1I0VA 1JBSA 2AADA 1T2IA 1FUTA 1UCLA 1TRPA 1RGKA 1BIRA 1BRHA 1R4YA 1RGHA 1UCJA 1I3FA 2F4YA 2RNTA 1X1WA 3AGNA 1RCLA 1PY3A 1A2PA 6RNTA 1GOVA 8RNTA 1BRSA 1G02A 5RNTA 7RNTA 1RGCA 5BU4A 1BNSA 1FYSA 1RTUA 3AGOA 1BSDA 3URPA 1RCKA 3RNTA 1B2ZA 1BNGA 1BNIA 1FW7A 1CH0A 1B27A 4HAAA 5HOHA 1BUJA 1RLSA 1AQZA 1UCKA 4GHOA 1RHLA 1GMQA 1Q9EA 1RNBA 4BIRA 3AHWA 1GMPA 2AAEA 2GSPA 1GOUA 1RGGA 2SARA 3Q3FA 4RNTA 1BRGA 1TTOA 1I2FA 3SYUA 1I2EA 1B2UA 1BGSA 1YVSA 1YNVX 3DGYA 1B2SA 1RN1A 1RN4A 1T2HA 1RGAA 1X1XA 1B21A 3D4AA 1I0XA 1LOWA 1BRJA 2KF4A 3AHSA 3KCHA 3BU4A 3BIRA 1I2GA 2KF5A 1BANA 2C4BA 1AY7A 4J5GA 4HOHA 5GSPA 1BVIA 2HOHA 3GSPA 1RGEA 2F56A 1GSPA 1JBTA 1LOVA 1BU4A 1DETA 1BSBA 1BAOA 1SARA 4BU4A 1BNRA 1BRIA 1RGLA 1PYLA 1I70A 1B3SA 1BNEA 1BSEA 1BOXA 9RNTA 2F5MA 1RGFA 1BSAA 1LOYA 1RMSA 1GMRA 1MGRA 1UCIA 1TRQA 3D5GA 4J5KA 2KAAA 1C54A 1IYYA 3A5EA 1DE3A 1BRKA 1HZ1A 1HYFA 2BU4A 5BIRA 3HOHA 2RBIA 1I8VA 1BSCA 1LNIA 1MGWA 3WHOA 7GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KF3 A;  1RNT A;  2BIR A;  2KF6 A;  1FUS A;  1B2M A;  1X1Y A;  1LRA A;  3WR2 A;  1RSN A;  1B20 A;  1RDS A;  1YGW A;  1BNF A;  1B2X A;  1GOY A;  1ZGX A;  1X1U A;  2ZA4 A;  3DH2 A;  1BNJ A;  1I3I A;  2F5W A;  3D5I A;  1BRN L;  1JBR A;  6GSP A;  1FZU A;  4GSP A;  1I0V A;  1JBS A;  2AAD A;  1T2I A;  1FUT A;  1UCL A;  1TRP A;  1RGK A;  1BIR A;  1BRH A;  1R4Y A;  1RGH A;  1UCJ A;  1I3F A;  2F4Y A;  2RNT A;  1X1W A;  3AGN A;  1RCL A;  1PY3 A;  1A2P A;  6RNT A;  1GOV A;  8RNT A;  1BRS A;  1G02 A;  5RNT A;  7RNT A;  1RGC A;  5BU4 A;  1BNS A;  1FYS A;  1RTU A;  3AGO A;  1BSD A;  3URP A;  1RCK A;  3RNT A;  1B2Z A;  1BNG A;  1BNI A;  1FW7 A;  1CH0 A;  1B27 A;  4HAA A;  5HOH A;  1BUJ A;  1RLS A;  1AQZ A;  1UCK A;  4GHO A;  1RHL A;  1GMQ A;  1Q9E A;  1RNB A;  4BIR A;  3AHW A;  1GMP A;  2AAE A;  2GSP A;  1GOU A;  1RGG A;  2SAR A;  3Q3F A;  4RNT A;  1BRG A;  1TTO A;  1I2F A;  3SYU A;  1I2E A;  1B2U A;  1BGS A;  1YVS A;  1YNV X;  3DGY A;  1B2S A;  1RN1 A;  1RN4 A;  1T2H A;  1RGA A;  1X1X A;  1B21 A;  3D4A A;  1I0X A;  1LOW A;  1BRJ A;  2KF4 A;  3AHS A;  3KCH A;  3BU4 A;  3BIR A;  1I2G A;  2KF5 A;  1BAN A;  2C4B A;  1AY7 A;  4J5G A;  4HOH A;  5GSP A;  1BVI A;  2HOH A;  3GSP A;  1RGE A;  2F56 A;  1GSP A;  1JBT A;  1LOV A;  1BU4 A;  1DET A;  1BSB A;  1BAO A;  1SAR A;  4BU4 A;  1BNR A;  1BRI A;  1RGL A;  1PYL A;  1I70 A;  1B3S A;  1BNE A;  1BSE A;  1BOX A;  9RNT A;  2F5M A;  1RGF A;  1BSA A;  1LOY A;  1RMS A;  1GMR A;  1MGR A;  1UCI A;  1TRQ A;  3D5G A;  4J5K A;  2KAA A;  1C54 A;  1IYY A;  3A5E A;  1DE3 A;  1BRK A;  1HZ1 A;  1HYF A;  2BU4 A;  5BIR A;  3HOH A;  2RBI A;  1I8V A;  1BSC A;  1LNI A;  1MGW A;  3WHO A;  7GSP A; 
#chains in the Genus database with same CATH topology
 1RJO A;  1LQM B;  1W01 A;  2W6J H;  2BIR A;  4EXR A;  3EE1 A;  2QGU A;  1L5G B;  1ASK A;  1UUW B;  2CFL A;  1STD A;  5CK6 A;  3B8L A;  3WDG B;  1X1Y A;  2A15 A;  3K63 A;  1LRA A;  5AEW B;  1W2B 2;  1M9G A;  5AII A;  1RDS A;  1ZGX A;  4R80 A;  5KP4 A;  2F99 A;  3IMA B;  1NB5 I;  1I3I A;  3D5I A;  3FCS B;  3JUQ A;  4WHA A;  3EHC A;  3NBR A;  1QVF 2;  3RGR A;  1I0V A;  1JBS A;  3NV0 B;  2AAD A;  2XFS A;  3ER7 A;  1ULJ B;  2GEY A;  1Q7Y 4;  3DGN A;  1TRP A;  2FNQ A;  3IJE B;  1JKG B;  1RGK A;  3FSD A;  3NM7 A;  2GBX B;  4CCV A;  4FMA A;  3G0K A;  1W4N A;  3A76 A;  1PY3 A;  2R4I A;  3MG1 A;  1UW1 A;  4FMB A;  4QWT A;  5RNT A;  2QEX 3;  3OXA A;  3DY5 A;  7RNT A;  3CXC 2;  1MWU A;  5KP3 A;  4HM8 B;  3TDG A;  3CNX A;  2IY2 A;  1E3R A;  3HX8 A;  1RCK A;  1N9J A;  2K54 A;  3RNT A;  1BNG A;  3UL5 A;  1BNI A;  3QK9 A;  1FW7 A;  2WOF A;  2B24 B;  4MMX B;  1YJ9 3;  1Q81 4;  3NM2 A;  4GB5 A;  1YVB I;  2ML6 A;  3G6E 3;  5AEU B;  3U1W A;  4U13 A;  1A2K A;  1JKG A;  3EC9 A;  4GHO A;  2FGT A;  1YGE A;  1GMQ A;  1N5H A;  1VQ4 3;  3S27 A;  3MWZ A;  1Q9E A;  2BNG A;  4KZ1 A;  3I55 3;  1WMN A;  4I5Q A;  1VQ9 3;  3CCQ 3;  1E97 A;  3LTD A;  1JB4 A;  3D79 A;  3FF2 A;  3SVA A;  5FW5 A;  1IVW A;  3ZFZ A;  2GBW B;  4RNT A;  4HM6 B;  3PS8 A;  1TTO A;  3FH1 A;  2HMK B;  1B2U A;  1VQK 3;  1GY6 A;  1YNV X;  3H51 A;  2YFL B;  1B2S A;  2CFD A;  1RN1 A;  1RN4 A;  1QJG A;  4HBR A;  5AIF A;  2WGQ A;  3E99 A;  1B21 A;  2ZDJ A;  4J8T A;  3SOA A;  1RRH A;  3SX1 A;  1GY5 A;  3N9H A;  1DMM A;  1D6Z A;  1OF5 B;  3S5C A;  3GRD A;  3MG2 A;  3JUM A;  2KF5 A;  1EUI C;  5GSP A;  2CWT A;  2CG0 A;  1QAK A;  3MKI A;  4G1M B;  2CFK A;  3GZB A;  3DGL A;  1RGE A;  1YI2 3;  2SBL A;  1IV7 A;  1MNL A;  3CD6 3;  4JRF A;  1IDP A;  5D82 A;  1BAO A;  4BU4 A;  3CCR 3;  3CCS 3;  2CK3 H;  3KSE D;  1NU3 A;  2CX1 A;  5AI1 A;  1NB3 I;  3MG3 A;  2STD A;  1BSE A;  3FG1 A;  3B4O A;  3CME 3;  5STD A;  1FGR A;  1OF5 A;  9RNT A;  1NWW A;  2CFG A;  1BUQ A;  3CC4 3;  1RN7 A;  5D83 A;  4OUQ A;  1VQL 3;  2W9P A;  2H0I A;  5M1A A;  1UCI A;  4J9A A;  1WNH A;  4BTX A;  2MF7 A;  4H3U A;  1EQK A;  4J5K A;  2E2U A;  2KAA A;  1JB5 A;  1GD3 A;  1QAL A;  1U5O A;  4IPB A;  1NNV A;  2Y73 A;  5CF2 A;  2CWV A;  2OQE A;  1JZD A;  2BU4 A;  2H0H A;  3N54 B;  2F86 B;  3ZG5 A;  4WP5 A;  1GYB A;  2CFW A;  4RNY A;  4LMI A;  3WHO A;  1MGW A;  2V1L A;  3LXU X;  1RNT A;  4N6O B;  4EBG A;  4HM3 B;  3ZG0 A;  4JF8 A;  1DMQ A;  2OCT A;  2KCD A;  3K9M C;  3GWR A;  5BXQ A;  1G96 A;  5DRV A;  3K7C A;  5IG3 A;  4N6L A;  2K3D A;  3KII A;  1FGO A;  4K1U A;  1B2X A;  1GOY A;  1MOL A;  1X1U A;  2BMR B;  3HI7 A;  5ELJ A;  4AKZ A;  1VQ7 3;  4LZI A;  1BRN L;  6GSP A;  1OUN A;  3F8X A;  1FZU A;  1Q42 A;  3D3L A;  2R41 A;  2E2T A;  1MWR A;  2GU1 A;  3Q2P A;  1N8Q A;  4RNZ A;  1CQS A;  1RRL A;  3EJV A;  4X2O A;  1DVC A;  4MEI A;  3ROB A;  3V98 A;  1BRH A;  1R4Y A;  1RGH A;  2F4Y A;  2P0M A;  4HM4 B;  1WMP A;  3AGN A;  1B2M A;  3MHE A;  1JV2 B;  1G02 A;  1R4C A;  2BO9 B;  3F14 A;  1NDO B;  3PGB A;  2XF3 A;  5BU4 A;  3F7S A;  2ZL8 A;  1RTU A;  3F9S A;  3KSP A;  2UX0 A;  4KT3 B;  5KP1 A;  1UI8 A;  3G4S 3;  2XFT A;  3CNM A;  1WQL B;  1OH0 A;  4O3V A;  4L8P A;  1B27 A;  3FG3 A;  3F40 A;  1LNH A;  1CYV A;  2K0M A;  2ML5 A;  5HGR A;  7STD A;  1AQZ A;  3U97 A;  4EV2 A;  4EV5 A;  4ILF A;  3K5T A;  1EA2 A;  5LC6 A;  1NO3 A;  3T0U A;  2QA4 3;  1CYU A;  3OWS A;  3LH4 A;  1SII A;  5AIG A;  1IVU A;  3WOE B;  1RNB A;  3KN4 A;  4CJN A;  5FGO A;  1JRQ A;  2W03 A;  3WA2 X;  4EC6 A;  1GMP A;  2UGI A;  2GSP A;  1GOU A;  3SLU A;  1S5A A;  4HM2 B;  1I2E A;  1RKY A;  1KSI A;  4BTY A;  3L0R A;  1T2H A;  1TFO A;  2INX A;  2P38 A;  3CCE 3;  1X1X A;  2W2C A;  3FLJ A;  3CCJ 3;  2GXF A;  2IYJ A;  4NHF A;  3NV0 A;  3S67 A;  1K73 4;  2KF4 A;  2L4V A;  4MMZ B;  3FZW A;  3BIR A;  3X3X A;  1DYU A;  2OOV A;  1BAN A;  3NQZ A;  5JBS A;  2C4B A;  1J2B A;  5G1L A;  1O7M B;  1BVI A;  1SPU A;  3FF0 A;  1GSP A;  3IPT A;  4HVN A;  1IQ8 A;  1PFP A;  4KFF A;  4LYL B;  3H3H A;  3X40 A;  3KE7 A;  5IEO A;  1RGL A;  3HZP A;  3J7Y d;  1PYL A;  3MYT A;  1I70 A;  1B3S A;  1W7C A;  1D6U A;  1O7P B;  3N8B A;  4FCZ A;  3PZW A;  4FMD A;  3SXX A;  1KWI A;  2Z6B A;  4OK0 A;  4XDW A;  1JZO A;  2RSX A;  1KQS 2;  1LQG C;  2F5M A;  3CPO A;  1SQW A;  4BL3 A;  3HIG A;  1VQM 3;  4KFD A;  1IT8 A;  4R9L A;  4FMC A;  1C54 A;  2IA7 A;  3F7X A;  4O8S A;  3G16 A;  3PCR A;  2XR8 B;  2HMM B;  2XGL A;  2Z76 A;  5G1K A;  4STD A;  5BIR A;  2XSH B;  1YHQ 3;  3NHX A;  1G0T A;  1IV9 A;  1I8V A;  2C11 A;  3JVC A;  1IVX A;  2OQE C;  4KFE A;  1U8C B;  1EKM A;  1UGI A;  3G8Z A;  1FUS A;  1OGZ A;  4HZB B;  2HMO B;  1A2V A;  3KFQ C;  4NPB A;  1E3V A;  2JQ5 A;  3WR2 A;  1AV4 A;  1RSN A;  4RZM A;  1BNF A;  4IIA A;  1KC8 4;  4HKV B;  3DH2 A;  4R4K A;  1BNJ A;  2LQV A;  5TGN A;  2IUJ A;  2I9W A;  3EX9 A;  3VGN A;  3CMA 3;  2XGN A;  4HM5 B;  5JPP A;  3BNE A;  2RGQ A;  4AKY A;  1DVD A;  1FA3 A;  4IT7 A;  4XBY A;  1Y4K A;  1PU4 A;  4OVM A;  4TX4 A;  1ROV A;  1T2I A;  4HM7 B;  1FUT A;  2CX0 A;  1UCL A;  1STF I;  1IVV A;  1AR0 A;  2RNT A;  2D1W A;  3EB8 A;  3BND A;  4HYZ A;  1V58 A;  2P05 A;  4FR9 A;  1X1W A;  4N6M A;  5ELU A;  1K8A 4;  3LZA A;  2M7O A;  4N3V A;  4K1V A;  2GEX A;  6RNT A;  1GOV A;  1ROA A;  3OWY A;  1BRS A;  3GZX B;  8RNT A;  1RGC A;  1FGT A;  1UI7 A;  2CC3 A;  1W2Z A;  1BNS A;  3AGO A;  4WFO A;  3LTC A;  3OV4 A;  4LGQ A;  1BSD A;  1HKX A;  2W9Q A;  3URP A;  3S29 A;  1B2Z A;  1W5Z A;  5CLK A;  1CH0 A;  2C10 A;  1T5Y A;  1YJN 3;  1VQ5 3;  3F8H A;  1TP6 A;  1RLS A;  4FCJ A;  3CCL 3;  3VF1 A;  4CDL A;  4XM4 A;  1BUJ A;  2MC8 A;  1UCK A;  4LEH A;  2OWP A;  2BT3 A;  1CEW I;  1RHL A;  2IUK A;  3O8Y A;  5EEO A;  1VQQ A;  2D42 A;  4BIR A;  3AHW A;  3PXM A;  4FCM A;  1FGQ A;  1K41 A;  1WTH A;  2IMJ A;  8CHO A;  4HM1 B;  2AAE A;  3Q3F A;  1FGM A;  3I0Y A;  5AYR B;  1A90 A;  1BRG A;  2F98 A;  3UB1 A;  1VZZ A;  1ZS7 A;  3GZY B;  4XDV A;  5CF1 A;  5JPU A;  3NBJ A;  4MMY B;  1Q86 4;  3X3Z A;  3CCM 3;  3MPH A;  1K9M 4;  3LT8 A;  2CW9 A;  1VQN 3;  1T3B A;  3D4A A;  1MWT A;  3BB9 A;  3WOF B;  1OAC A;  4MJD A;  1BRJ A;  1JB2 A;  1S72 3;  3KCH A;  3I56 3;  1YIJ 3;  5EQL A;  1VQO 3;  1QAF A;  5I97 A;  5M18 A;  1KD1 4;  4XBT A;  3EQQ B;  4PEJ A;  2Z77 A;  1AY7 A;  3QRD A;  4J5G A;  5DRE A;  4O02 B;  2P09 A;  3NXJ A;  3GSP A;  4AEQ A;  5IEP A;  4X2H A;  2OOV C;  1BU4 A;  3CC7 3;  1DET A;  1W02 A;  1Q40 B;  3LTA A;  1BRI A;  1QVG 2;  4L7K A;  1LVN A;  2UUG C;  1UDI I;  5IW9 A;  3LTB A;  4CPK A;  2HML B;  1BOX A;  4BTW A;  1RGF A;  4GL6 A;  3LOY A;  2KXG A;  1OHO A;  1RMS A;  3JUO A;  1GMR A;  2O3O A;  3M8C A;  3ALA A;  5EVH A;  2H0G A;  1TRQ A;  3D5G A;  3JUP A;  3RDE A;  3Q90 A;  3WA3 A;  1DE3 A;  3UNL A;  1TIJ A;  1HZ1 A;  2Z7A A;  3NQY A;  1FUW A;  1IQX A;  1YJW 3;  1K28 A;  1DMN A;  1Q40 A;  2ZHX B;  3HOH A;  3SED A;  2RBI A;  2CHC A;  2XRX B;  2GU3 A;  2W04 A;  2YX9 A;  2CH9 A;  3OWU A;  3T8U A;  1LOX A;  2XSO B;  3FKA A;  5G2G A;  2WOH A;  3OX9 A;  2OTJ 3;  2KF3 A;  1IQY A;  2KF6 A;  3DUK A;  4L8O A;  3EF8 A;  4N6N B;  5IG0 A;  1UGH I;  2PNC A;  3K0Z A;  2YFJ B;  5LC7 A;  3V99 A;  3CU3 A;  1GY7 A;  3RGA A;  1N5P A;  1B20 A;  3NX0 A;  1ZX2 A;  3JUN A;  1YGW A;  3MSO A;  4I4K A;  2ZA4 A;  2F5W A;  4HZ9 B;  1JBR A;  3LT9 A;  1GS3 A;  1M1X B;  3DZL A;  4K90 B;  1HU9 A;  4GSP A;  3PCS A;  4XBX A;  1OHS A;  2KRT A;  1W6C A;  1Z1S A;  2J8X B;  1W00 A;  3ECF A;  4DKI A;  3NUV A;  1SIH A;  5M19 A;  2XH9 A;  1BIR A;  1UCJ A;  1OPY A;  1I3F A;  2PZV A;  1RCL A;  1QMA A;  1A2P A;  2L1S A;  1W6G A;  3KKG A;  2YFI B;  5IER A;  1UUV B;  3DMC A;  1N8R 4;  2OTL 3;  1O7N B;  1OCV A;  1GD4 A;  1FYS A;  3V92 A;  3VSY A;  2LYX A;  1OGX A;  4K61 A;  4KVH A;  1O7W B;  4LSO A;  3T8N A;  1A67 A;  1YIT 3;  3WOD G;  5A0O B;  3CCU 3;  4HAA A;  1Q7H A;  3EN8 A;  5HOH A;  2RCD A;  1JNQ A;  3AMO B;  2B1X B;  3EBT A;  2QIY A;  1V57 A;  3DGM A;  4EW5 A;  3S28 A;  3HK4 A;  2BHM A;  2CKF B;  3GZR A;  5IF6 A;  4BL2 A;  1VQP 3;  2WO0 A;  2Y74 A;  3DXO A;  2O9U X;  1F8N A;  2BMQ B;  1O7G B;  4ZM8 A;  3PYJ A;  4O2H A;  1W6Y A;  1AVL A;  2SAR A;  1RGG A;  3FGY A;  5D81 A;  4EYC A;  1I2F A;  3SYU A;  1YVS A;  1BGS A;  4ORL A;  1OHP A;  3DGO A;  3DGY A;  3AMO A;  4XB5 A;  1IT7 A;  1JJ2 2;  2W0Q A;  2P0X A;  4RBN A;  5IG4 A;  1RGA A;  1UUG B;  1VQ8 3;  2XEP A;  3EBY A;  4HJL B;  1I0X A;  3BLZ A;  1LOW A;  3STD A;  3DM8 A;  4N6T A;  3AHS A;  5AIH A;  2CG1 A;  3BU4 A;  5IEN A;  1I2G A;  2FXT A;  2WGO A;  2W56 B;  2JDI H;  1VQ6 3;  1ULI B;  3Q1C A;  4HOH A;  1IU7 A;  2HOH A;  3CC2 3;  1M90 4;  1US1 A;  1LXE A;  3LYG A;  3B4P A;  1C7H A;  2F56 A;  2HMJ B;  1JBT A;  3X42 A;  1LOV A;  5IG5 A;  1BSB A;  1SAR A;  3HII A;  5CXO A;  1N9E A;  4N6U A;  4WYK B;  5AYS C;  3UJM A;  3X41 A;  1BNR A;  3LML A;  2CWU A;  4WWU C;  1TJD A;  1NJI 4;  2RFR A;  4H61 A;  3BNB A;  4R1K A;  1TU5 A;  1D6Y A;  5BVB A;  1BNE A;  1JN5 B;  4N6V 0;  2Q07 A;  3KZT A;  1SJW A;  3FG4 A;  3B7C A;  2BMO B;  1BSA A;  1LOY A;  2CIU A;  2W56 A;  3NBB A;  4R9K A;  1EEJ A;  1V74 A;  4Q53 A;  3SOY A;  1MGR A;  3OW2 2;  1TFK A;  3CPW 2;  4NRE A;  1O7H B;  1IYY A;  3BNC A;  3A5E A;  2HMN B;  1BRK A;  1TUH A;  1HYF A;  1MWS A;  1M1K 4;  1ZO2 A;  3EN1 B;  1IK3 A;  1Q82 4;  4WYK A;  3CCV 3;  3G71 3;  1EG9 B;  2E2V A;  3UL6 A;  3GAX A;  4HM0 B;  6STD A;  3X3Y A;  1AVK A;  1BSC A;  1WMO A;  1LNI A;  3D9R A;  1JN5 A;  3WMD A;  7GSP A;  1ISK A; 
#chains in the Genus database with same CATH homology
 2KF3 A;  1RNT A;  2BIR A;  2KF6 A;  1FUS A;  1B2M A;  1X1Y A;  1LRA A;  3WR2 A;  1RSN A;  1B20 A;  1RDS A;  1YGW A;  1BNF A;  1B2X A;  1GOY A;  1ZGX A;  1X1U A;  2ZA4 A;  3DH2 A;  1BNJ A;  1I3I A;  2F5W A;  3D5I A;  1BRN L;  1JBR A;  6GSP A;  1FZU A;  4GSP A;  1I0V A;  1JBS A;  2AAD A;  1T2I A;  1FUT A;  1UCL A;  1TRP A;  1RGK A;  1BIR A;  1BRH A;  1R4Y A;  1RGH A;  1UCJ A;  1I3F A;  2F4Y A;  2RNT A;  1X1W A;  3AGN A;  1RCL A;  1PY3 A;  1A2P A;  6RNT A;  1GOV A;  8RNT A;  1BRS A;  1G02 A;  5RNT A;  7RNT A;  1RGC A;  5BU4 A;  1BNS A;  1FYS A;  1RTU A;  3AGO A;  1BSD A;  3URP A;  1RCK A;  3RNT A;  1B2Z A;  1BNG A;  1BNI A;  1FW7 A;  1CH0 A;  1B27 A;  4HAA A;  5HOH A;  1BUJ A;  1RLS A;  1AQZ A;  1UCK A;  4GHO A;  1RHL A;  1GMQ A;  1Q9E A;  1RNB A;  4BIR A;  3AHW A;  1GMP A;  2AAE A;  2GSP A;  1GOU A;  1RGG A;  2SAR A;  3Q3F A;  4RNT A;  1BRG A;  1TTO A;  1I2F A;  3SYU A;  1I2E A;  1B2U A;  1BGS A;  1YVS A;  1YNV X;  3DGY A;  1B2S A;  1RN1 A;  1RN4 A;  1T2H A;  1RGA A;  1X1X A;  1B21 A;  3D4A A;  1I0X A;  1LOW A;  1BRJ A;  2KF4 A;  3AHS A;  3KCH A;  3BU4 A;  3BIR A;  1I2G A;  2KF5 A;  1BAN A;  2C4B A;  1AY7 A;  4J5G A;  4HOH A;  5GSP A;  1BVI A;  2HOH A;  3GSP A;  1RGE A;  2F56 A;  1GSP A;  1JBT A;  1LOV A;  1BU4 A;  1DET A;  1BSB A;  1BAO A;  1SAR A;  4BU4 A;  1BNR A;  1BRI A;  1RGL A;  1PYL A;  1I70 A;  1B3S A;  1BNE A;  1BSE A;  1BOX A;  9RNT A;  2F5M A;  1RGF A;  1BSA A;  1LOY A;  1RMS A;  1GMR A;  1MGR A;  1UCI A;  1TRQ A;  3D5G A;  4J5K A;  2KAA A;  1C54 A;  1IYY A;  3A5E A;  1DE3 A;  1BRK A;  1HZ1 A;  1HYF A;  2BU4 A;  5BIR A;  3HOH A;  2RBI A;  1I8V A;  1BSC A;  1LNI A;  1MGW A;  3WHO A;  7GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...