1LOYA

X-ray structure of the h40a/e58a mutant of ribonuclease t1 complexed with 3'-guanosine monophosphate
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPAKYNNYEGFDFSVSSPYYAWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease T1
publication title A nucleophile activation dyad in ribonucleases. A combined X-ray crystallographic/ab initio quantum chemical study
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1loyA00
2AAEA 1I2FA 2RBIA 1FUTA 1LNIA 1B2MA 1I0XA 4HAAA 1BANA 2F4YA 1X1UA 1JBTA 1BNGA 1UCIA 1B20A 3KCHA 1Q9EA 4GHOA 3WHOA 1AQZA 1RCLA 1FUSA 1GMQA 1R4YA 5BU4A 2F5MA 1RNTA 1A2PA 1RGHA 3Q3FA 1RGEA 1C54A 1MGRA 1UCJA 2RNTA 1BNRA 1GMRA 3AHSA 1I70A 1CH0A 1BIRA 1YVSA 1LOVA 7RNTA 9RNTA 2BU4A 1RN4A 1RGAA 1YGWA 1BSCA 1G02A 1B2UA 4RNTA 3BIRA 1I8VA 1RGKA 1X1XA 3D5GA 3GSPA 1SARA 5HOHA 1FZUA 2BIRA 1BOXA 3WR2A 1RN1A 3AGNA 1GOVA 1RDSA 1FYSA 1I0VA 1PYLA 2GSPA 1B2ZA 8RNTA 1BRSA 1ZGXA 2ZA4A 1GMPA 1AY7A 2KF4A 4BU4A 1BSBA 1BNEA 1BVIA 5RNTA 1BRIA 1BRHA 1DE3A 1GOYA 1I2GA 1BSAA 2KF5A 7GSPA 3URPA 1RLSA 1RGCA 1UCKA 1RSNA 2C4BA 3D5IA 4GSPA 1RGFA 1I3IA 2KF6A 2SARA 1BNSA 3RNTA 3SYUA 2KF3A 4HOHA 1TRQA 6RNTA 1BRGA 1B3SA 4BIRA 1BUJA 1TRPA 2AADA 1B21A 1LOWA 1BRNL 1RCKA 3BU4A 1LRAA 1BSEA 1IYYA 1BSDA 4J5KA 6GSPA 1X1YA 1I3FA 2KAAA 1BAOA 1LOYA 3D4AA 1YNVX 5BIRA 1B27A 1BNIA 1HYFA 1RNBA 1B2SA 1FW7A 1B2XA 1BU4A 1BRJA 1BNJA 2F5WA 1BNFA 3AGOA 3DGYA 1T2HA 1TTOA 1BGSA 1UCLA 3AHWA 3HOHA 4J5GA 1RHLA 1MGWA 2F56A 3DH2A 2HOHA 3A5EA 1T2IA 1BRKA 1RTUA 1GSPA 1RMSA 1DETA 1I2EA 1HZ1A 1JBSA 1PY3A 1JBRA 1GOUA 5GSPA 1X1WA 1RGGA 1RGLA
chains in the Genus database with same CATH superfamily
2OWPA 1T3BA 2AAEA 1N8QA 2D1WA 5IERA 2GXFA 3EQQB 3DGNA 4LEHA 1YGEA 3NXJA 1W2B2 4L8PA 1A90A 1W4NA 4X2HA 5D83A 3B4PA 3BNDA 3LT8A 5FW5A 3RDEA 5AI1A 3PS8A 4FMCA 4MMZB 1OHSA 3KE7A 5G1LA 3WHOA 5IENA 1N5PA 1K8A4 3ECFA 3DMCA 1RCLA 1R4YA 1J2BA 2F5MA 1R4CA 1M9GA 1YJN3 1LNHA 4EYCA 1EA2A 1ZO2A 5DREA 1C54A 2RNTA 5KP3A 3MWZA 1BUQA 3GWRA 3IMAB 3NBRA 1MWUA 3BB9A 3PCSA 2UX0A 4K1UA 4R4KA 1GD3A 3FG1A 3HX8A 1S723 3V99A 4AEQA 1I8VA 5AEUB 1RRLA 1GY5A 2QIYA 3GSPA 5HOHA 5CK6A 3CMA3 1LQGC 3MYTA 1TJDA 1BOXA 2BIRA 3LT9A 4FR9A 1CEWI 5FGOA 4R1KA 2BT3A 2BMRB 3SEDA 3AGNA 4U13A 1RDSA 4BTXA 3CCL3 4R9KA 1KC84 5AEWB 1ULJB 3EN8A 1ZGXA 2XRXB 1GMPA 1T5YA 2J8XB 3HIGA 1DVCA 3NQYA 2WOHA 2GU3A 1C7HA 1VZZA 2QEX3 4BU4A 1BSBA 4MEIA 3UL6A 1NO3A 1BVIA 3OWSA 3MSOA 2XSOB 1BRIA 3LTCA 2OOVC 1O7MB 2OCTA 4J9AA 1M1K4 2BNGA 1LVNA 1STDA 2F86B 2ML5A 3FH1A 2WGQA 4LZIA 3X40A 3T0UA 5KP4A 1QALA 2LQVA 3K0ZA 1BNSA 4HOHA 2UGIA 2XSHB 6RNTA 3PCRA 4HZ9B 1IT8A 3Q1CA 2XGLA 4L7KA 1VQ63 3D3LA 3LYGA 3FSDA 1LRAA 4RBNA 5CF1A 3JUOA 4O2HA 3CD63 1Z1SA 2KAAA 4I5QA 5TGNA 2P05A 1DMMA 2KRTA 2OQEA 4AKZA 5IG0A 1N9EA 3FG3A 3NUVA 1STFI 1B2SA 1W5ZA 3G8ZA 3JUNA 4FCZA 4MJDA 1EQKA 4NPBA 2C11A 3F8HA 1BRJA 1IVUA 2K3DA 2O3OA 4OUQA 2GEXA 2YFLB 1UUVB 4EV5A 2V1LA 1FA3A 1ROVA 1IQYA 1QAKA 3K9MC 1Q7Y4 1KD14 2CW9A 3KKGA 3PGBA 2JQ5A 4K61A 1FGMA 5EEOA 2STDA 3DH2A 3PYJA 8CHOA 1BRKA 1O7PB 2W0QA 2GBXB 3MPHA 1DETA 2Z7AA 3FF0A 3X42A 1I2EA 1JZOA 1K734 1PY3A 1Q40B 1W6GA 3V98A 5IG4A 2WOFA 1TFOA 3SYUA 3SOYA 1RGLA 4N6MA 3JUQA 3X3XA 5M19A 1W2ZA 3ALAA 1TFKA 1I2FA 1LNIA 7STDA 1B2MA 1JN5B 1I0XA 4HAAA 3T8UA 1MWTA 2ZL8A 4PEJA 1M1XB 1X1UA 2Z76A 1JBTA 1A2VA 2CFDA 2W9PA 3BNBA 3G713 4N6UA 2SBLA 4JRFA 1U8CB 4N3VA 1VQ83 5IEPA 4ZM8A 4IT7A 1GS3A 3LTDA 3CC43 3F40A 1UW1A 1FUSA 4NHFA 1GMQA 3S27A 3OW22 3UL5A 1RNTA 1YJ93 3GZRA 4XBXA 3KN4A 3O8YA 2XH9A 1TIJA 2BHMA 2R4IA 1MGRA 4HVNA 3NHXA 1VQK3 3HI7A 3PXMA 1I70A 1YVSA 5ELUA 3LTAA 5CXOA 1E3VA 5AIFA 7RNTA 2BU4A 1NWWA 1AV4A 3IPTA 1YGWA 3MG1A 3G6E3 1BSCA 1UUWB 1RN7A 2P38A 3EC9A 1YJW3 1QMAA 1RGKA 1X1XA 2H0HA 4HKVB 3E99A 3NV0B 2YFJB 3H51A 3D79A 3GZBA 1FZUA 2CWUA 2IMJA 1W01A 3WOFB 3CCV3 1Y4KA 4HM4B 1RN1A 3CCU3 1DVDA 4CJNA 2OQEC 1B2ZA 2CC3A 5BXQA 1TUHA 1IQ8A 3BLZA 1AY7A 3CNMA 2MC8A 1GY6A 1BNEA 1DMNA 1GYBA 2P09A 2RFRA 4O8SA 3OV4A 4EV2A 5RNTA 3DXOA 1TP6A 2IA7A 3KIIA 1I2GA 1FGTA 1EG9B 2CX0A 4KVHA 7GSPA 2W56B 1UGHI 2F98A 1UCKA 3N9HA 5AIHA 4BL3A 1WTHA 3D5IA 1I3IA 1PFPA 2KF6A 2SARA 3PZWA 4HJLB 4K1VA 3EX9A 2H0IA 2KF3A 2C10A 4FCMA 1RJOA 1BRGA 3K63A 4HM0B 3LTBA 2HMOB 2E2UA 3EBYA 5A0OB 2XR8B 2CFKA 1IK3A 1TRPA 3CPW2 3EB8A 1W00A 5DRVA 1MNLA 1OGXA 1IV9A 1BRNL 2WO0A 1IQXA 1RRHA 3NQZA 4G1MB 4RNYA 3LMLA 3CPOA 3AMOA 3I553 2W04A 1X1YA 1IVXA 3MG3A 1BAOA 1O7WB 3MHEA 1VQ43 2UUGC 3OX9A 1B27A 1BNIA 5AYRB 1HYFA 2RSXA 4EXRA 1US1A 6STDA 3K5TA 1RNBA 1FW7A 3VGNA 5I97A 2HMLB 2OTL3 4KZ1A 5IEOA 3DGYA 3UJMA 1TTOA 1M904 3J7Yd 1E97A 3CCE3 2BMQB 1UCLA 3CC23 2RCDA 4HBRA 3F9SA 3UB1A 1A2KA 1ULIB 1VQL3 5EQLA 1N9JA 2F56A 2A15A 4LMIA 3VF1A 3A5EA 1T2IA 1ASKA 2YFIB 5EVHA 1RMSA 1VQ73 1EKMA 5IG5A 2HMNB 1GOUA 2O9UX 5GSPA 2FXTA 2E2TA 1Q40A 1WQLB 4I4KA 2RBIA 1FGRA 4BTYA 1K9M4 4N6NB 2F4YA 3WR2A 4FMDA 3NBBA 1BNGA 1OHOA 1UCIA 2FGTA 2KCDA 2W6JH 3DGLA 1B20A 2CFLA 3I563 3CU3A 2XFTA 3M8CA 1MWSA 2QA43 4CDLA 1Q9EA 3NM2A 1AQZA 4WHAA 3OWYA 1TU5A 3CCS3 3RGAA 1A2PA 4HM2B 2KXGA 3MG2A 1YIT3 4XDVA 2XEPA 3Q3FA 4EW5A 1KSIA 1RGEA 2B24B 3CCQ3 1UCJA 2IY2A 3AHSA 1LQMB 4KT3B 1DMQA 2ZDJA 3U1WA 4XBYA 1FUWA 1RGAA 1VQN3 2GEYA 1ZX2A 1G02A 1KWIA 1B2UA 1OF5B 1JZDA 3CNXA 3EJVA 2JDIH 4Q53A 4R80A 3DY5A 4RNTA 4O02B 2ML6A 3SVAA 4J8TA 3FG4A 5JPUA 1SARA 1JRQA 1V58A 4WWUC 3NV0A 3F7XA 1PU4A 1FYSA 3H3HA 1PYLA 1Q824 3S28A 3ROBA 1DYUA 3S67A 3ZG5A 1YHQ3 5G1KA 3RGRA 2ZA4A 3CXC2 3FF2A 2D42A 2Z77A 1LXEA 4LYLB 1VQM3 5BVBA 4BTWA 1W7CA 3F8XA 2RGQA 1V74A 3EBTA 1CQSA 3G16A 4KFFA 1V57A 3U97A 2CKFB 3FKAA 1WMPA 1AR0A 2QGUA 3LH4A 1JNQA 5IF6A 4FMAA 2KF5A 3GZYB 3URPA 1RLSA 4EBGA 1RGCA 1Q814 1NJI4 3GRDA 2IUJA 1RSNA 1D6UA 2C4BA 4GSPA 1RGFA 2W56A 3RNTA 2ZHXB 4DKIA 3GZXB 3EHCA 1B3SA 1GD4A 3MKIA 1BUJA 1F8NA 1EUIC 2BMOB 3UNLA 2AADA 3FCSB 4TX4A 1RCKA 1W6CA 1IT7A 1LOXA 2F99A 1BSEA 1NB3I 2K54A 3BNCA 3EN1B 1HKXA 3ER7A 3KSPA 4HM7B 2R41A 4J5KA 3WMDA 2CK3H 1I3FA 2HMKB 3EF8A 4OVMA 1YVBI 2CWVA 3WDGB 1LOYA 1O7GB 3D4AA 1YNVX 3DUKA 4NREA 3VSYA 5ELJA 5BIRA 2CG0A 4OK0A 3HK4A 2W9QA 1BU4A 1A67A 4N6TA 1Q42A 4WYKB 2F5WA 3LZAA 2L1SA 1N8R4 1OCVA 1T2HA 1OPYA 3JUPA 2Y73A 1OACA 4AKYA 1BGSA 2M7OA 2W2CA 1D6YA 4MMXB 1WMOA 1JB2A 3QRDA 1K28A 2Q07A 3B8LA 2Y74A 4WFOA 1W02A 1D6ZA 1JB4A 1QAFA 2E2VA 1RTUA 1IV7A 1QVG2 1GSPA 4KFDA 1JKGB 1NU3A 1JBSA 3JUMA 1OHPA 4HYZA 4O3VA 3F7SA 2CFWA 4XBTA 3WA2X 3KSED 1JB5A 2HMJB 4L8OA 1VQQA 2GBWB 4XB5A 1FUTA 1SIIA 2CH9A 3WOEB 2BO9B 4XDWA 1BANA 3ZFZA 3WA3A 3B4OA 1QVF2 1IVWA 4FCJA 3JVCA 4HM5B 4ILFA 1OH0A 2MF7A 1FGOA 5G2GA 3ZG0A 5M18A 2K0MA 3KCHA 2PNCA 2XF3A 3CME3 1VQ53 5CF2A 1NDOB 4LSOA 4GHOA 3NX0A 2P0XA 5KP1A 3FLJA 3SOAA 2INXA 4QWTA 5BU4A 1JJ22 1FGQA 2W03A 3Q90A 1RGHA 1JV2B 1W6YA 4BL2A 4XM4A 4FMBA 3A76A 1BNRA 4N6V0 1GMRA 2Z6BA 1CH0A 1BIRA 4HM8B 1LOVA 3BNEA 9RNTA 1MOLA 2P0MA 5AIGA 1RN4A 1VQP3 4IIAA 1OGZA 1SQWA 2L4VA 3N54B 1OUNA 5M1AA 1HU9A 3BIRA 3WODG 3D5GA 3KZTA 3X41A 1OF5A 4N6LA 4N6OB 4HZBB 1YI23 3LOYA 1JN5A 5HGRA 2YX9A 2CG1A 1GOVA 1I0VA 3NM7A 1CYVA 1K41A 3EE1A 2GSPA 5CLKA 4CPKA 8RNTA 3AMOB 1ROAA 4MMYB 1BRSA 5D81A 3SLUA 3Q2PA 4LGQA 5JPPA 3LXUX 2CIUA 1G0TA 1UUGB 2KF4A 3TDGA 4EC6A 1NB5I 2XGNA 1AVKA 1UDII 1SPUA 5JBSA 3STDA 1YIJ3 3D9RA 1BRHA 1DE3A 4CCVA 1WNHA 1GOYA 1ISKA 1BSAA 3HIIA 3OXAA 5AYSC 1G96A 2CHCA 3NBJA 2IUKA 1UI7A 1O7NB 5AIIA 2I9WA 3X3ZA 3V92A 3B7CA 1IDPA 1ZS7A 3SX1A 5IW9A 2FNQA 3G4S3 1TRQA 4RNZA 3T8NA 1S5AA 3F14A 3QK9A 2CX1A 1AVLA 4BIRA 3DZLA 3DGMA 4JF8A 1Q7HA 3G0KA 1CYUA 4HM3B 5STDA 3FZWA 1Q864 3DGOA 3S5CA 1B21A 1LOWA 1E3RA 1O7HB 3FGYA 3I0YA 3K7CA 1UI8A 3BU4A 3KFQC 4ORLA 2XFSA 5LC6A 5LC7A 1RKYA 2OTJ3 1IYYA 3S29A 1BSDA 2GU1A 5D82A 6GSPA 1QJGA 3HZPA 3GAXA 2PZVA 5IG3A 4WP5A 4IPBA 1VQO3 3IJEB 1MWRA 1B2XA 2CWTA 2IYJA 1BNJA 1UGIA 3CCM3 1N5HA 1IVVA 3N8BA 1BNFA 1SIHA 2CFGA 4HM6B 1EEJA 2B1XB 3AGOA 3OWUA 4KFEA 4WYKA 1L5GB 4H61A 2OOVA 2LYXA 3AHWA 3HOHA 4J5GA 3X3YA 3CC73 1SJWA 3L0RA 1RHLA 1WMNA 1MGWA 1U5OA 2H0GA 4K90B 2HOHA 2WGOA 4RZMA 3CCR3 1GY7A 1NNVA 1HZ1A 4GL6A 1JBRA 4X2OA 1VQ93 4HM1B 4H3UA 3DM8A 4R9LA 2HMMB 1IU7A 1X1WA 1RGGA 1JKGA 1KQS2 3SXXA 4GB5A 3CCJ3 4STDA
chains in the Genus database with same CATH topology
2AAEA 1I2FA 2RBIA 1FUTA 1LNIA 1B2MA 1I0XA 4HAAA 1BANA 2F4YA 1X1UA 1JBTA 1BNGA 1UCIA 1B20A 3KCHA 1Q9EA 4GHOA 3WHOA 1AQZA 1RCLA 1FUSA 1GMQA 1R4YA 5BU4A 2F5MA 1RNTA 1A2PA 1RGHA 3Q3FA 1RGEA 1C54A 1MGRA 1UCJA 2RNTA 1BNRA 1GMRA 3AHSA 1I70A 1CH0A 1BIRA 1YVSA 1LOVA 7RNTA 9RNTA 2BU4A 1RN4A 1RGAA 1YGWA 1BSCA 1G02A 1B2UA 4RNTA 3BIRA 1I8VA 1RGKA 1X1XA 3D5GA 3GSPA 1SARA 5HOHA 1FZUA 2BIRA 1BOXA 3WR2A 1RN1A 3AGNA 1GOVA 1RDSA 1FYSA 1I0VA 1PYLA 2GSPA 1B2ZA 8RNTA 1BRSA 1ZGXA 2ZA4A 1GMPA 1AY7A 2KF4A 4BU4A 1BSBA 1BNEA 1BVIA 5RNTA 1BRIA 1BRHA 1DE3A 1GOYA 1I2GA 1BSAA 2KF5A 7GSPA 3URPA 1RLSA 1RGCA 1UCKA 1RSNA 2C4BA 3D5IA 4GSPA 1RGFA 1I3IA 2KF6A 2SARA 1BNSA 3RNTA 3SYUA 2KF3A 4HOHA 1TRQA 6RNTA 1BRGA 1B3SA 4BIRA 1BUJA 1TRPA 2AADA 1B21A 1LOWA 1BRNL 1RCKA 3BU4A 1LRAA 1BSEA 1IYYA 1BSDA 4J5KA 6GSPA 1X1YA 1I3FA 2KAAA 1BAOA 1LOYA 3D4AA 1YNVX 5BIRA 1B27A 1BNIA 1HYFA 1RNBA 1B2SA 1FW7A 1B2XA 1BU4A 1BRJA 1BNJA 2F5WA 1BNFA 3AGOA 3DGYA 1T2HA 1TTOA 1BGSA 1UCLA 3AHWA 3HOHA 4J5GA 1RHLA 1MGWA 2F56A 3DH2A 2HOHA 3A5EA 1T2IA 1BRKA 1RTUA 1GSPA 1RMSA 1DETA 1I2EA 1HZ1A 1JBSA 1PY3A 1JBRA 1GOUA 5GSPA 1X1WA 1RGGA 1RGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AAE A;  1I2F A;  2RBI A;  1FUT A;  1LNI A;  1B2M A;  1I0X A;  4HAA A;  1BAN A;  2F4Y A;  1X1U A;  1JBT A;  1BNG A;  1UCI A;  1B20 A;  3KCH A;  1Q9E A;  4GHO A;  3WHO A;  1AQZ A;  1RCL A;  1FUS A;  1GMQ A;  1R4Y A;  5BU4 A;  2F5M A;  1RNT A;  1A2P A;  1RGH A;  3Q3F A;  1RGE A;  1C54 A;  1MGR A;  1UCJ A;  2RNT A;  1BNR A;  1GMR A;  3AHS A;  1I70 A;  1CH0 A;  1BIR A;  1YVS A;  1LOV A;  7RNT A;  9RNT A;  2BU4 A;  1RN4 A;  1RGA A;  1YGW A;  1BSC A;  1G02 A;  1B2U A;  4RNT A;  3BIR A;  1I8V A;  1RGK A;  1X1X A;  3D5G A;  3GSP A;  1SAR A;  5HOH A;  1FZU A;  2BIR A;  1BOX A;  3WR2 A;  1RN1 A;  3AGN A;  1GOV A;  1RDS A;  1FYS A;  1I0V A;  1PYL A;  2GSP A;  1B2Z A;  8RNT A;  1BRS A;  1ZGX A;  2ZA4 A;  1GMP A;  1AY7 A;  2KF4 A;  4BU4 A;  1BSB A;  1BNE A;  1BVI A;  5RNT A;  1BRI A;  1BRH A;  1DE3 A;  1GOY A;  1I2G A;  1BSA A;  2KF5 A;  7GSP A;  3URP A;  1RLS A;  1RGC A;  1UCK A;  1RSN A;  2C4B A;  3D5I A;  4GSP A;  1RGF A;  1I3I A;  2KF6 A;  2SAR A;  1BNS A;  3RNT A;  3SYU A;  2KF3 A;  4HOH A;  1TRQ A;  6RNT A;  1BRG A;  1B3S A;  4BIR A;  1BUJ A;  1TRP A;  2AAD A;  1B21 A;  1LOW A;  1BRN L;  1RCK A;  3BU4 A;  1LRA A;  1BSE A;  1IYY A;  1BSD A;  4J5K A;  6GSP A;  1X1Y A;  1I3F A;  2KAA A;  1BAO A;  1LOY A;  3D4A A;  1YNV X;  5BIR A;  1B27 A;  1BNI A;  1HYF A;  1RNB A;  1B2S A;  1FW7 A;  1B2X A;  1BU4 A;  1BRJ A;  1BNJ A;  2F5W A;  1BNF A;  3AGO A;  3DGY A;  1T2H A;  1TTO A;  1BGS A;  1UCL A;  3AHW A;  3HOH A;  4J5G A;  1RHL A;  1MGW A;  2F56 A;  3DH2 A;  2HOH A;  3A5E A;  1T2I A;  1BRK A;  1RTU A;  1GSP A;  1RMS A;  1DET A;  1I2E A;  1HZ1 A;  1JBS A;  1PY3 A;  1JBR A;  1GOU A;  5GSP A;  1X1W A;  1RGG A;  1RGL A; 
#chains in the Genus database with same CATH topology
 2OWP A;  1T3B A;  2AAE A;  1N8Q A;  2D1W A;  5IER A;  2GXF A;  3EQQ B;  3DGN A;  4LEH A;  1YGE A;  3NXJ A;  1W2B 2;  4L8P A;  1A90 A;  1W4N A;  4X2H A;  5D83 A;  3B4P A;  3BND A;  3LT8 A;  5FW5 A;  3RDE A;  5AI1 A;  3PS8 A;  4FMC A;  4MMZ B;  1OHS A;  3KE7 A;  5G1L A;  3WHO A;  5IEN A;  1N5P A;  1K8A 4;  3ECF A;  3DMC A;  1RCL A;  1R4Y A;  1J2B A;  2F5M A;  1R4C A;  1M9G A;  1YJN 3;  1LNH A;  4EYC A;  1EA2 A;  1ZO2 A;  5DRE A;  1C54 A;  2RNT A;  5KP3 A;  3MWZ A;  1BUQ A;  3GWR A;  3IMA B;  3NBR A;  1MWU A;  3BB9 A;  3PCS A;  2UX0 A;  4K1U A;  4R4K A;  1GD3 A;  3FG1 A;  3HX8 A;  1S72 3;  3V99 A;  4AEQ A;  1I8V A;  5AEU B;  1RRL A;  1GY5 A;  2QIY A;  3GSP A;  5HOH A;  5CK6 A;  3CMA 3;  1LQG C;  3MYT A;  1TJD A;  1BOX A;  2BIR A;  3LT9 A;  4FR9 A;  1CEW I;  5FGO A;  4R1K A;  2BT3 A;  2BMR B;  3SED A;  3AGN A;  4U13 A;  1RDS A;  4BTX A;  3CCL 3;  4R9K A;  1KC8 4;  5AEW B;  1ULJ B;  3EN8 A;  1ZGX A;  2XRX B;  1GMP A;  1T5Y A;  2J8X B;  3HIG A;  1DVC A;  3NQY A;  2WOH A;  2GU3 A;  1C7H A;  1VZZ A;  2QEX 3;  4BU4 A;  1BSB A;  4MEI A;  3UL6 A;  1NO3 A;  1BVI A;  3OWS A;  3MSO A;  2XSO B;  1BRI A;  3LTC A;  2OOV C;  1O7M B;  2OCT A;  4J9A A;  1M1K 4;  2BNG A;  1LVN A;  1STD A;  2F86 B;  2ML5 A;  3FH1 A;  2WGQ A;  4LZI A;  3X40 A;  3T0U A;  5KP4 A;  1QAL A;  2LQV A;  3K0Z A;  1BNS A;  4HOH A;  2UGI A;  2XSH B;  6RNT A;  3PCR A;  4HZ9 B;  1IT8 A;  3Q1C A;  2XGL A;  4L7K A;  1VQ6 3;  3D3L A;  3LYG A;  3FSD A;  1LRA A;  4RBN A;  5CF1 A;  3JUO A;  4O2H A;  3CD6 3;  1Z1S A;  2KAA A;  4I5Q A;  5TGN A;  2P05 A;  1DMM A;  2KRT A;  2OQE A;  4AKZ A;  5IG0 A;  1N9E A;  3FG3 A;  3NUV A;  1STF I;  1B2S A;  1W5Z A;  3G8Z A;  3JUN A;  4FCZ A;  4MJD A;  1EQK A;  4NPB A;  2C11 A;  3F8H A;  1BRJ A;  1IVU A;  2K3D A;  2O3O A;  4OUQ A;  2GEX A;  2YFL B;  1UUV B;  4EV5 A;  2V1L A;  1FA3 A;  1ROV A;  1IQY A;  1QAK A;  3K9M C;  1Q7Y 4;  1KD1 4;  2CW9 A;  3KKG A;  3PGB A;  2JQ5 A;  4K61 A;  1FGM A;  5EEO A;  2STD A;  3DH2 A;  3PYJ A;  8CHO A;  1BRK A;  1O7P B;  2W0Q A;  2GBX B;  3MPH A;  1DET A;  2Z7A A;  3FF0 A;  3X42 A;  1I2E A;  1JZO A;  1K73 4;  1PY3 A;  1Q40 B;  1W6G A;  3V98 A;  5IG4 A;  2WOF A;  1TFO A;  3SYU A;  3SOY A;  1RGL A;  4N6M A;  3JUQ A;  3X3X A;  5M19 A;  1W2Z A;  3ALA A;  1TFK A;  1I2F A;  1LNI A;  7STD A;  1B2M A;  1JN5 B;  1I0X A;  4HAA A;  3T8U A;  1MWT A;  2ZL8 A;  4PEJ A;  1M1X B;  1X1U A;  2Z76 A;  1JBT A;  1A2V A;  2CFD A;  2W9P A;  3BNB A;  3G71 3;  4N6U A;  2SBL A;  4JRF A;  1U8C B;  4N3V A;  1VQ8 3;  5IEP A;  4ZM8 A;  4IT7 A;  1GS3 A;  3LTD A;  3CC4 3;  3F40 A;  1UW1 A;  1FUS A;  4NHF A;  1GMQ A;  3S27 A;  3OW2 2;  3UL5 A;  1RNT A;  1YJ9 3;  3GZR A;  4XBX A;  3KN4 A;  3O8Y A;  2XH9 A;  1TIJ A;  2BHM A;  2R4I A;  1MGR A;  4HVN A;  3NHX A;  1VQK 3;  3HI7 A;  3PXM A;  1I70 A;  1YVS A;  5ELU A;  3LTA A;  5CXO A;  1E3V A;  5AIF A;  7RNT A;  2BU4 A;  1NWW A;  1AV4 A;  3IPT A;  1YGW A;  3MG1 A;  3G6E 3;  1BSC A;  1UUW B;  1RN7 A;  2P38 A;  3EC9 A;  1YJW 3;  1QMA A;  1RGK A;  1X1X A;  2H0H A;  4HKV B;  3E99 A;  3NV0 B;  2YFJ B;  3H51 A;  3D79 A;  3GZB A;  1FZU A;  2CWU A;  2IMJ A;  1W01 A;  3WOF B;  3CCV 3;  1Y4K A;  4HM4 B;  1RN1 A;  3CCU 3;  1DVD A;  4CJN A;  2OQE C;  1B2Z A;  2CC3 A;  5BXQ A;  1TUH A;  1IQ8 A;  3BLZ A;  1AY7 A;  3CNM A;  2MC8 A;  1GY6 A;  1BNE A;  1DMN A;  1GYB A;  2P09 A;  2RFR A;  4O8S A;  3OV4 A;  4EV2 A;  5RNT A;  3DXO A;  1TP6 A;  2IA7 A;  3KII A;  1I2G A;  1FGT A;  1EG9 B;  2CX0 A;  4KVH A;  7GSP A;  2W56 B;  1UGH I;  2F98 A;  1UCK A;  3N9H A;  5AIH A;  4BL3 A;  1WTH A;  3D5I A;  1I3I A;  1PFP A;  2KF6 A;  2SAR A;  3PZW A;  4HJL B;  4K1V A;  3EX9 A;  2H0I A;  2KF3 A;  2C10 A;  4FCM A;  1RJO A;  1BRG A;  3K63 A;  4HM0 B;  3LTB A;  2HMO B;  2E2U A;  3EBY A;  5A0O B;  2XR8 B;  2CFK A;  1IK3 A;  1TRP A;  3CPW 2;  3EB8 A;  1W00 A;  5DRV A;  1MNL A;  1OGX A;  1IV9 A;  1BRN L;  2WO0 A;  1IQX A;  1RRH A;  3NQZ A;  4G1M B;  4RNY A;  3LML A;  3CPO A;  3AMO A;  3I55 3;  2W04 A;  1X1Y A;  1IVX A;  3MG3 A;  1BAO A;  1O7W B;  3MHE A;  1VQ4 3;  2UUG C;  3OX9 A;  1B27 A;  1BNI A;  5AYR B;  1HYF A;  2RSX A;  4EXR A;  1US1 A;  6STD A;  3K5T A;  1RNB A;  1FW7 A;  3VGN A;  5I97 A;  2HML B;  2OTL 3;  4KZ1 A;  5IEO A;  3DGY A;  3UJM A;  1TTO A;  1M90 4;  3J7Y d;  1E97 A;  3CCE 3;  2BMQ B;  1UCL A;  3CC2 3;  2RCD A;  4HBR A;  3F9S A;  3UB1 A;  1A2K A;  1ULI B;  1VQL 3;  5EQL A;  1N9J A;  2F56 A;  2A15 A;  4LMI A;  3VF1 A;  3A5E A;  1T2I A;  1ASK A;  2YFI B;  5EVH A;  1RMS A;  1VQ7 3;  1EKM A;  5IG5 A;  2HMN B;  1GOU A;  2O9U X;  5GSP A;  2FXT A;  2E2T A;  1Q40 A;  1WQL B;  4I4K A;  2RBI A;  1FGR A;  4BTY A;  1K9M 4;  4N6N B;  2F4Y A;  3WR2 A;  4FMD A;  3NBB A;  1BNG A;  1OHO A;  1UCI A;  2FGT A;  2KCD A;  2W6J H;  3DGL A;  1B20 A;  2CFL A;  3I56 3;  3CU3 A;  2XFT A;  3M8C A;  1MWS A;  2QA4 3;  4CDL A;  1Q9E A;  3NM2 A;  1AQZ A;  4WHA A;  3OWY A;  1TU5 A;  3CCS 3;  3RGA A;  1A2P A;  4HM2 B;  2KXG A;  3MG2 A;  1YIT 3;  4XDV A;  2XEP A;  3Q3F A;  4EW5 A;  1KSI A;  1RGE A;  2B24 B;  3CCQ 3;  1UCJ A;  2IY2 A;  3AHS A;  1LQM B;  4KT3 B;  1DMQ A;  2ZDJ A;  3U1W A;  4XBY A;  1FUW A;  1RGA A;  1VQN 3;  2GEY A;  1ZX2 A;  1G02 A;  1KWI A;  1B2U A;  1OF5 B;  1JZD A;  3CNX A;  3EJV A;  2JDI H;  4Q53 A;  4R80 A;  3DY5 A;  4RNT A;  4O02 B;  2ML6 A;  3SVA A;  4J8T A;  3FG4 A;  5JPU A;  1SAR A;  1JRQ A;  1V58 A;  4WWU C;  3NV0 A;  3F7X A;  1PU4 A;  1FYS A;  3H3H A;  1PYL A;  1Q82 4;  3S28 A;  3ROB A;  1DYU A;  3S67 A;  3ZG5 A;  1YHQ 3;  5G1K A;  3RGR A;  2ZA4 A;  3CXC 2;  3FF2 A;  2D42 A;  2Z77 A;  1LXE A;  4LYL B;  1VQM 3;  5BVB A;  4BTW A;  1W7C A;  3F8X A;  2RGQ A;  1V74 A;  3EBT A;  1CQS A;  3G16 A;  4KFF A;  1V57 A;  3U97 A;  2CKF B;  3FKA A;  1WMP A;  1AR0 A;  2QGU A;  3LH4 A;  1JNQ A;  5IF6 A;  4FMA A;  2KF5 A;  3GZY B;  3URP A;  1RLS A;  4EBG A;  1RGC A;  1Q81 4;  1NJI 4;  3GRD A;  2IUJ A;  1RSN A;  1D6U A;  2C4B A;  4GSP A;  1RGF A;  2W56 A;  3RNT A;  2ZHX B;  4DKI A;  3GZX B;  3EHC A;  1B3S A;  1GD4 A;  3MKI A;  1BUJ A;  1F8N A;  1EUI C;  2BMO B;  3UNL A;  2AAD A;  3FCS B;  4TX4 A;  1RCK A;  1W6C A;  1IT7 A;  1LOX A;  2F99 A;  1BSE A;  1NB3 I;  2K54 A;  3BNC A;  3EN1 B;  1HKX A;  3ER7 A;  3KSP A;  4HM7 B;  2R41 A;  4J5K A;  3WMD A;  2CK3 H;  1I3F A;  2HMK B;  3EF8 A;  4OVM A;  1YVB I;  2CWV A;  3WDG B;  1LOY A;  1O7G B;  3D4A A;  1YNV X;  3DUK A;  4NRE A;  3VSY A;  5ELJ A;  5BIR A;  2CG0 A;  4OK0 A;  3HK4 A;  2W9Q A;  1BU4 A;  1A67 A;  4N6T A;  1Q42 A;  4WYK B;  2F5W A;  3LZA A;  2L1S A;  1N8R 4;  1OCV A;  1T2H A;  1OPY A;  3JUP A;  2Y73 A;  1OAC A;  4AKY A;  1BGS A;  2M7O A;  2W2C A;  1D6Y A;  4MMX B;  1WMO A;  1JB2 A;  3QRD A;  1K28 A;  2Q07 A;  3B8L A;  2Y74 A;  4WFO A;  1W02 A;  1D6Z A;  1JB4 A;  1QAF A;  2E2V A;  1RTU A;  1IV7 A;  1QVG 2;  1GSP A;  4KFD A;  1JKG B;  1NU3 A;  1JBS A;  3JUM A;  1OHP A;  4HYZ A;  4O3V A;  3F7S A;  2CFW A;  4XBT A;  3WA2 X;  3KSE D;  1JB5 A;  2HMJ B;  4L8O A;  1VQQ A;  2GBW B;  4XB5 A;  1FUT A;  1SII A;  2CH9 A;  3WOE B;  2BO9 B;  4XDW A;  1BAN A;  3ZFZ A;  3WA3 A;  3B4O A;  1QVF 2;  1IVW A;  4FCJ A;  3JVC A;  4HM5 B;  4ILF A;  1OH0 A;  2MF7 A;  1FGO A;  5G2G A;  3ZG0 A;  5M18 A;  2K0M A;  3KCH A;  2PNC A;  2XF3 A;  3CME 3;  1VQ5 3;  5CF2 A;  1NDO B;  4LSO A;  4GHO A;  3NX0 A;  2P0X A;  5KP1 A;  3FLJ A;  3SOA A;  2INX A;  4QWT A;  5BU4 A;  1JJ2 2;  1FGQ A;  2W03 A;  3Q90 A;  1RGH A;  1JV2 B;  1W6Y A;  4BL2 A;  4XM4 A;  4FMB A;  3A76 A;  1BNR A;  4N6V 0;  1GMR A;  2Z6B A;  1CH0 A;  1BIR A;  4HM8 B;  1LOV A;  3BNE A;  9RNT A;  1MOL A;  2P0M A;  5AIG A;  1RN4 A;  1VQP 3;  4IIA A;  1OGZ A;  1SQW A;  2L4V A;  3N54 B;  1OUN A;  5M1A A;  1HU9 A;  3BIR A;  3WOD G;  3D5G A;  3KZT A;  3X41 A;  1OF5 A;  4N6L A;  4N6O B;  4HZB B;  1YI2 3;  3LOY A;  1JN5 A;  5HGR A;  2YX9 A;  2CG1 A;  1GOV A;  1I0V A;  3NM7 A;  1CYV A;  1K41 A;  3EE1 A;  2GSP A;  5CLK A;  4CPK A;  8RNT A;  3AMO B;  1ROA A;  4MMY B;  1BRS A;  5D81 A;  3SLU A;  3Q2P A;  4LGQ A;  5JPP A;  3LXU X;  2CIU A;  1G0T A;  1UUG B;  2KF4 A;  3TDG A;  4EC6 A;  1NB5 I;  2XGN A;  1AVK A;  1UDI I;  1SPU A;  5JBS A;  3STD A;  1YIJ 3;  3D9R A;  1BRH A;  1DE3 A;  4CCV A;  1WNH A;  1GOY A;  1ISK A;  1BSA A;  3HII A;  3OXA A;  5AYS C;  1G96 A;  2CHC A;  3NBJ A;  2IUK A;  1UI7 A;  1O7N B;  5AII A;  2I9W A;  3X3Z A;  3V92 A;  3B7C A;  1IDP A;  1ZS7 A;  3SX1 A;  5IW9 A;  2FNQ A;  3G4S 3;  1TRQ A;  4RNZ A;  3T8N A;  1S5A A;  3F14 A;  3QK9 A;  2CX1 A;  1AVL A;  4BIR A;  3DZL A;  3DGM A;  4JF8 A;  1Q7H A;  3G0K A;  1CYU A;  4HM3 B;  5STD A;  3FZW A;  1Q86 4;  3DGO A;  3S5C A;  1B21 A;  1LOW A;  1E3R A;  1O7H B;  3FGY A;  3I0Y A;  3K7C A;  1UI8 A;  3BU4 A;  3KFQ C;  4ORL A;  2XFS A;  5LC6 A;  5LC7 A;  1RKY A;  2OTJ 3;  1IYY A;  3S29 A;  1BSD A;  2GU1 A;  5D82 A;  6GSP A;  1QJG A;  3HZP A;  3GAX A;  2PZV A;  5IG3 A;  4WP5 A;  4IPB A;  1VQO 3;  3IJE B;  1MWR A;  1B2X A;  2CWT A;  2IYJ A;  1BNJ A;  1UGI A;  3CCM 3;  1N5H A;  1IVV A;  3N8B A;  1BNF A;  1SIH A;  2CFG A;  4HM6 B;  1EEJ A;  2B1X B;  3AGO A;  3OWU A;  4KFE A;  4WYK A;  1L5G B;  4H61 A;  2OOV A;  2LYX A;  3AHW A;  3HOH A;  4J5G A;  3X3Y A;  3CC7 3;  1SJW A;  3L0R A;  1RHL A;  1WMN A;  1MGW A;  1U5O A;  2H0G A;  4K90 B;  2HOH A;  2WGO A;  4RZM A;  3CCR 3;  1GY7 A;  1NNV A;  1HZ1 A;  4GL6 A;  1JBR A;  4X2O A;  1VQ9 3;  4HM1 B;  4H3U A;  3DM8 A;  4R9L A;  2HMM B;  1IU7 A;  1X1W A;  1RGG A;  1JKG A;  1KQS 2;  3SXX A;  4GB5 A;  3CCJ 3;  4STD A; 
#chains in the Genus database with same CATH homology
 2AAE A;  1I2F A;  2RBI A;  1FUT A;  1LNI A;  1B2M A;  1I0X A;  4HAA A;  1BAN A;  2F4Y A;  1X1U A;  1JBT A;  1BNG A;  1UCI A;  1B20 A;  3KCH A;  1Q9E A;  4GHO A;  3WHO A;  1AQZ A;  1RCL A;  1FUS A;  1GMQ A;  1R4Y A;  5BU4 A;  2F5M A;  1RNT A;  1A2P A;  1RGH A;  3Q3F A;  1RGE A;  1C54 A;  1MGR A;  1UCJ A;  2RNT A;  1BNR A;  1GMR A;  3AHS A;  1I70 A;  1CH0 A;  1BIR A;  1YVS A;  1LOV A;  7RNT A;  9RNT A;  2BU4 A;  1RN4 A;  1RGA A;  1YGW A;  1BSC A;  1G02 A;  1B2U A;  4RNT A;  3BIR A;  1I8V A;  1RGK A;  1X1X A;  3D5G A;  3GSP A;  1SAR A;  5HOH A;  1FZU A;  2BIR A;  1BOX A;  3WR2 A;  1RN1 A;  3AGN A;  1GOV A;  1RDS A;  1FYS A;  1I0V A;  1PYL A;  2GSP A;  1B2Z A;  8RNT A;  1BRS A;  1ZGX A;  2ZA4 A;  1GMP A;  1AY7 A;  2KF4 A;  4BU4 A;  1BSB A;  1BNE A;  1BVI A;  5RNT A;  1BRI A;  1BRH A;  1DE3 A;  1GOY A;  1I2G A;  1BSA A;  2KF5 A;  7GSP A;  3URP A;  1RLS A;  1RGC A;  1UCK A;  1RSN A;  2C4B A;  3D5I A;  4GSP A;  1RGF A;  1I3I A;  2KF6 A;  2SAR A;  1BNS A;  3RNT A;  3SYU A;  2KF3 A;  4HOH A;  1TRQ A;  6RNT A;  1BRG A;  1B3S A;  4BIR A;  1BUJ A;  1TRP A;  2AAD A;  1B21 A;  1LOW A;  1BRN L;  1RCK A;  3BU4 A;  1LRA A;  1BSE A;  1IYY A;  1BSD A;  4J5K A;  6GSP A;  1X1Y A;  1I3F A;  2KAA A;  1BAO A;  1LOY A;  3D4A A;  1YNV X;  5BIR A;  1B27 A;  1BNI A;  1HYF A;  1RNB A;  1B2S A;  1FW7 A;  1B2X A;  1BU4 A;  1BRJ A;  1BNJ A;  2F5W A;  1BNF A;  3AGO A;  3DGY A;  1T2H A;  1TTO A;  1BGS A;  1UCL A;  3AHW A;  3HOH A;  4J5G A;  1RHL A;  1MGW A;  2F56 A;  3DH2 A;  2HOH A;  3A5E A;  1T2I A;  1BRK A;  1RTU A;  1GSP A;  1RMS A;  1DET A;  1I2E A;  1HZ1 A;  1JBS A;  1PY3 A;  1JBR A;  1GOU A;  5GSP A;  1X1W A;  1RGG A;  1RGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...