1LOYA

X-ray structure of the h40a/e58a mutant of ribonuclease t1 complexed with 3'-guanosine monophosphate
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPAKYNNYEGFDFSVSSPYYAWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A nucleophile activation dyad in ribonucleases. A combined X-ray crystallographic/ab initio quantum chemical study
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease T1
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1loyA00
1RGAA 1JBSA 6GSPA 3AGNA 2C4BA 5BIRA 1GMPA 1LOYA 2KF4A 3A5EA 1BANA 2KF5A 1AY7A 1FZUA 1RNTA 1B2SA 1GOVA 1R4YA 3AHWA 1X1UA 2BIRA 4HAAA 1JBTA 1GOYA 1B27A 1UCLA 2AADA 3D4AA 3URPA 3GSPA 1DETA 1BRHA 2RBIA 1PY3A 1AQZA 1BNIA 1I0XA 1B2MA 3RNTA 1BIRA 1GOUA 3WR2A 7GSPA 1RGEA 1TRPA 1I2FA 1I3IA 1BSDA 1RCLA 2F5WA 1G02A 1SARA 1HYFA 1FUTA 1T2HA 3DGYA 2KF3A 1BGSA 1BRKA 1BRJA 1GSPA 3D5IA 5GSPA 5RNTA 1BSEA 1A2PA 1B3SA 1BNGA 2HOHA 2ZA4A 2KAAA 4J5GA 3SYUA 1FW7A 1RCKA 1BUJA 1RN1A 3AHSA 1RGCA 1I3FA 1YNVX 1X1WA 1TRQA 4BIRA 1BRNL 1YVSA 2F56A 1RGGA 1LRAA 1BRSA 8RNTA 1GMRA 1RN4A 1LOWA 1RGHA 1UCJA 4GSPA 1X1YA 2GSPA 1RNBA 1RHLA 1BOXA 1BNEA 1X1XA 2AAEA 4HOHA 1RMSA 2RNTA 1I70A 4RNTA 1RDSA 2KF6A 1BSCA 1CH0A 1TTOA 3WHOA 1GMQA 3BU4A 3KCHA 1BNJA 1BVIA 1RGKA 1HZ1A 3D5GA 1LOVA 7RNTA 1BRIA 3DH2A 3HOHA 9RNTA 1RGLA 1Q9EA 1RLSA 2BU4A 1I8VA 1B21A 1B2XA 1BSAA 1PYLA 1RGFA 1ZGXA 1B2UA 6RNTA 1FYSA 4BU4A 1BU4A 3Q3FA 1LNIA 5HOHA 4GHOA 1I2EA 2F5MA 3BIRA 1RTUA 1BAOA 1DE3A 1B2ZA 1YGWA 4J5KA 1MGRA 1BRGA 2F4YA 1B20A 1BNFA 1I2GA 3AGOA 5BU4A 1UCKA 1FUSA 1RSNA 1T2IA 1C54A 1BNRA 1MGWA 1IYYA 2SARA 1I0VA 1JBRA 1BNSA 1BSBA 1UCIA
chains in the Genus database with same CATH superfamily
1RGAA 2QIYA 3ZFZA 5DREA 5AIGA 1RRHA 2C4BA 5BIRA 1D6ZA 1GMPA 1C7HA 1LOYA 2GBWB 2KF4A 3A5EA 3JUPA 1BANA 1GY5A 1N5HA 3EBTA 3K7CA 3LH4A 3T0UA 5CF1A 2F86B 3AHWA 4HAAA 3AMOA 1K8A4 4N6V0 3UJMA 1O7WB 4O8SA 1UCLA 4IT7A 3FF2A 3S27A 1VQN3 3D4AA 4MEIA 5FW5A 2UGIA 3CCM3 3B8LA 1DETA 1A2VA 2W56A 2PNCA 2RBIA 3NQYA 1AQZA 1BNIA 4HM0B 4O2HA 5EEOA 2IUJA 3LTAA 1YJN3 3WR2A 1QALA 4HM6B 2CFGA 2CFDA 4K1VA 1K9M4 1BSDA 1I3IA 1ROVA 3HIIA 1RCLA 2F5WA 5A0OB 1SARA 2F99A 1FUTA 1T2HA 1M9GA 3DXOA 3LTCA 4HZBB 4BTWA 1BRKA 4AKYA 5EVHA 1ROAA 1WMNA 3MWZA 3EBYA 1QVF2 3CMA3 1N8QA 3HI7A 4GL6A 5HGRA 2GU3A 3HX8A 2INXA 1FGTA 2SBLA 2ZA4A 2W9QA 1GS3A 1NO3A 3Q2PA 4BTYA 1FW7A 1YGEA 1M904 1ZS7A 2XRXB 4J8TA 4BIRA 4LMIA 5D82A 1YVSA 2R41A 2JQ5A 1SIHA 2H0IA 2CWTA 1LRAA 2JDIH 3D3LA 3SOYA 1ASKA 3SX1A 1JRQA 5CF2A 3CC23 1ZX2A 1DMNA 1L5GB 3GRDA 1LOWA 2CFLA 1NNVA 2D42A 2CIUA 1RGHA 2E2VA 4HM7B 2D1WA 1X1YA 1SQWA 2GSPA 3EC9A 3MSOA 4WYKB 4CDLA 1X1XA 2AAEA 1IQ8A 4HJLB 4EW5A 1Q7Y4 2K0MA 4RNTA 3EQQB 1UGHI 3NM7A 2RSXA 1CH0A 4I5QA 5AYRB 4EXRA 3FG4A 3X40A 1IQYA 1UUGB 3BU4A 1LQMB 1V58A 2PZVA 3WOEB 1UGIA 3JVCA 3OX9A 5IW9A 1ULIB 3DY5A 1ULJB 3HIGA 4IPBA 3EHCA 4RBNA 3AMOB 3CCJ3 3EN8A 2V1LA 2KXGA 1W01A 9RNTA 3N8BA 2IMJA 1IV7A 1QAKA 2I9WA 2OCTA 1AVKA 1IT7A 1VQK3 2BMOB 1FA3A 2KRTA 1Q7HA 1U8CB 5IEPA 2Z77A 1LNIA 1YHQ3 2RFRA 3NBJA 5KP3A 3CME3 4XBYA 1I2EA 1PFPA 1BSBA 4MJDA 4TX4A 2F5MA 3EF8A 3FH1A 1KC84 1MGRA 2IUKA 1VQ63 4N6MA 1F8NA 2B24B 1I2GA 2Y74A 5BU4A 4N6NB 3DM8A 4XM4A 1FUSA 1FGMA 1RSNA 2L1SA 2BO9B 1JZDA 1OHOA 2WO0A 3H3HA 4L8OA 5AYSC 3SEDA 4BL3A 3S28A 4R4KA 1C54A 5M19A 1I0VA 1IYYA 1ZO2A 3G8ZA 1Q864 1W2B2 5IG3A 3MG3A 2GBXB 1STFI 2Z7AA 1UUVB 3F7SA 1QJGA 4KT3B 2KF5A 4HM5B 1RNTA 2W9PA 2YFLB 1DVCA 2HMNB 2A15A 1IK3A 1UDII 1EKMA 2W56B 3NV0B 3CNXA 3K9MC 4N3VA 2GXFA 1KSIA 3WODG 1GYBA 1MNLA 1IU7A 4LZIA 1OGZA 2K3DA 1NDOB 5I97A 1IT8A 1TFOA 1TIJA 1I0XA 3FF0A 3D79A 3RNTA 1BIRA 5D81A 3F9SA 4ZM8A 2C11A 1W6GA 2GEYA 3FZWA 4CCVA 1TRPA 1O7NB 1G0TA 1QVG2 2XSOB 1DVDA 3GZBA 3GZXB 2CHCA 1V57A 3BNDA 1IVWA 2P0MA 1CEWI 2RCDA 1O7GB 1BRJA 3IJEB 1M1XB 1CQSA 3U1WA 3NX0A 1YJ93 2XGNA 2FGTA 1BNGA 5IG4A 4HVNA 4XDVA 1OHSA 1CYVA 2OTL3 3UB1A 2M7OA 2ZDJA 1LVNA 1JB5A 2P05A 1FGOA 1OF5B 4MMZB 4XB5A 5JBSA 4EBGA 1YIT3 2F56A 1UI8A 1STDA 2XEPA 1OCVA 3MHEA 2W04A 4G1MB 4PEJA 2ML6A 2YX9A 4X2OA 3T8NA 1T5YA 3U97A 3BNCA 1NWWA 5JPPA 1RKYA 3GAXA 1N5PA 4N6UA 2CFKA 1ISKA 1RNBA 1A67A 1RHLA 3LYGA 1BOXA 5G1LA 1MWUA 4HOHA 3LTBA 3B4OA 1RMSA 3CCQ3 3ZG0A 4LYLB 2WOFA 4BL2A 2HMMB 4RNYA 1A90A 3WMDA 1TTOA 3V92A 4RZMA 4XBXA 3N9HA 2WGOA 3PXMA 4N6LA 3ER7A 1GD4A 1CYUA 1SPUA 4K61A 2BMQB 1S723 4NREA 4NHFA 3DUKA 2XR8B 3RGRA 1BVIA 4K90B 1RGKA 3D5GA 5AEWB 5BVBA 4JF8A 4CJNA 1BRIA 3HOHA 1KQS2 3CPW2 1U5OA 2UUGC 1RGFA 1BSAA 1J2BA 1TP6A 3MKIA 3I563 1B2UA 3KSED 1BU4A 4R9LA 1W2ZA 2OWPA 1M1K4 2P0XA 3CCV3 3STDA 5LC7A 2O9UX 4N6OB 4WHAA 3RDEA 2E2TA 3BIRA 2GEXA 3PS8A 2CG1A 1RTUA 1WTHA 3JUNA 1B2ZA 4WP5A 5LC6A 2YFJB 3CU3A 2XGLA 3Q1CA 5D83A 3WA3A 3IPTA 1EEJA 1LOXA 1D6YA 1W00A 2HMJB 5M1AA 5CK6A 3O8YA 4HYZA 1MGWA 2OOVA 1US1A 2HMOB 2SARA 6STDA 3MG2A 1WMPA 1O7HB 1YI23 1JBRA 1D6UA 1BNSA 1V74A 1GD3A 1YJW3 3A76A 6GSPA 1MWRA 3OWYA 4XBTA 5STDA 3EX9A 2WOHA 4KFFA 1AY7A 1Q824 1B2SA 1GOVA 2K54A 1R4YA 2OTJ3 2BIRA 1GOYA 3UL6A 1W6CA 3KZTA 4K1UA 2OQEC 1EQKA 4FCZA 1NB3I 4O02B 5AIIA 1RRLA 3URPA 4EV2A 5IG5A 1DMQA 2ML5A 1N9EA 4OVMA 1BRHA 3PYJA 5DRVA 3K0ZA 2YFIB 4BTXA 3M8CA 1PU4A 1B2MA 3NXJA 3LXUX 4AEQA 3K63A 3B7CA 1OACA 3DMCA 7GSPA 3OW22 2H0HA 3F14A 1OPYA 1I2FA 2BHMA 1G02A 2ZL8A 5CXOA 3KKGA 4EV5A 2XFSA 3GZRA 3CCL3 4ORLA 3X42A 1IDPA 4J9AA 7STDA 3OWSA 5GSPA 2CFWA 4FMCA 5RNTA 1BSEA 1B3SA 1MWTA 1RJOA 1O7MB 3F8XA 3FCSB 2CH9A 3I0YA 3Q90A 2P09A 1S5AA 2CX0A 2E2UA 2HOHA 2QGUA 2XSHB 4LSOA 2KAAA 4J5GA 5IF6A 5AI1A 1RCKA 1RN1A 2F98A 3AHSA 4HM3B 3DGNA 1LQGC 4STDA 1SIIA 3DGLA 1TRQA 3PGBA 3QK9A 1JB2A 3NBRA 1RGGA 4I4KA 3FG1A 4MMYB 5G2GA 1HKXA 1NU3A 3G16A 1A2KA 2QA43 1BRSA 2CC3A 4R80A 1OH0A 1K734 5KP4A 1JJ22 2BT3A 4X2HA 4GSPA 2OOVC 3ECFA 4U13A 4AKZA 4OK0A 3E99A 3DZLA 2FXTA 3UL5A 1BNEA 1TUHA 5IERA 3UNLA 1E3VA 1Q814 1GY7A 3S67A 1VQ43 3X3XA 1VQL3 1BSCA 2XFTA 1QMAA 3NBBA 1AR0A 4Q53A 3WHOA 1GMQA 1SJWA 1W6YA 1EG9B 1N8R4 4IIAA 3HK4A 1LXEA 2STDA 1UW1A 3KCHA 2P38A 3BLZA 5JPUA 1VQ73 1E3RA 3JUQA 1T3BA 1HZ1A 2ZHXB 3CPOA 1LOVA 3LZAA 3IMAB 1WMOA 3ROBA 4LGQA 1Q9EA 4NPBA 1K41A 2BU4A 3D9RA 1I8VA 1B21A 1QAFA 3NHXA 1OUNA 2CG0A 1VQO3 1TFKA 3G4S3 6RNTA 2HMLB 1FYSA 2RGQA 4BU4A 3Q3FA 1JN5B 2J8XB 1W4NA 4FR9A 3DGOA 2OQEA 4CPKA 1NJI4 1Q40B 2IA7A 3PCRA 1BAOA 1DE3A 1YGWA 1DMMA 2CWUA 4J5KA 1O7PB 2O3OA 1JKGB 5M18A 2WGQA 4HZ9B 1B20A 3CD63 4HM8B 3EE1A 5AEUB 3G713 1BNFA 4KZ1A 1K28A 4O3VA 3ZG5A 1RN7A 5KP1A 1YIJ3 2IY2A 4MMXB 4HM4B 4R9KA 3LT9A 1E97A 1X1WA 1LNHA 1DYUA 1BUQA 2QEX3 1WNHA 1JBSA 4JRFA 1FGQA 3AGNA 1TU5A 3FLJA 2LYXA 2Z76A 3KSPA 4HM2B 4WFOA 3SLUA 1W5ZA 3BB9A 3LOYA 4FCMA 1IVVA 3TDGA 1IQXA 1FZUA 2KCDA 4N6TA 2CW9A 1JBTA 1X1UA 1VQQA 4FMDA 1B27A 2MF7A 3L0RA 3SXXA 3MYTA 3VGNA 2AADA 2CK3H 2L4VA 3SOAA 3LT8A 3GSPA 4ILFA 1VQ83 2XF3A 3V98A 1WQLB 3X41A 1PY3A 3CCR3 3NQZA 3LTDA 3VSYA 1R4CA 1GOUA 3S5CA 1RGEA 1VZZA 1UI7A 2HMKB 3BNEA 8CHOA 3K5TA 3CCU3 3CC43 1HYFA 3X3ZA 2FNQA 1VQ93 1JNQA 3DGYA 2KF3A 4XDWA 2W0QA 1BGSA 5TGNA 1TJDA 4HM1B 1GSPA 3EB8A 2B1XB 3D5IA 3FGYA 3JUOA 1A2PA 3I553 1VQP3 2W6JH 3EJVA 4WYKA 3NM2A 1OGXA 2LQVA 4R1KA 1W02A 3CCE3 3F8HA 3SYUA 3JUMA 3BNBA 4KVHA 4LEHA 1RGCA 4FCJA 1BUJA 1I3FA 1YNVX 1UUWB 1VQM3 4DKIA 1AV4A 1JB4A 1MOLA 1KWIA 3J7Yd 3FG3A 1NB5I 1BRNL 3S29A 3DGMA 3N54B 3MG1A 5IG0A 2H0GA 2IYJA 8RNTA 1JZOA 5ELJA 1GMRA 1RN4A 3RGAA 3CXC2 4HBRA 1UCJA 2BNGA 3NUVA 5AIFA 3WA2X 4RNZA 1FUWA 3VF1A 3WOFB 2Q07A 3PCSA 2RNTA 4EC6A 2GU1A 1I70A 4L8PA 5FGOA 1RDSA 3WDGB 2KF6A 3GZYB 3HZPA 3PZWA 1IVUA 4KFEA 1Y4KA 2Y73A 3KFQC 5ELUA 3X3YA 5IENA 3CCS3 1Q42A 2CKFB 1GY6A 5AIHA 3G6E3 2W03A 1EUIC 2CX1A 1HU9A 1KD14 3OXAA 1BNJA 4WWUC 2XH9A 1Q40A 7RNTA 3DH2A 3KN4A 1FGRA 4OUQA 1RGLA 1IVXA 1RLSA 3F7XA 5G1KA 3SVAA 4HKVB 1JN5A 1B2XA 1PYLA 1JKGA 1OHPA 2Z6BA 1VQ53 1IV9A 1ZGXA 4EYCA 3FSDA 3QRDA 1Z1SA 2MC8A 4QWTA 2W2CA 5IEOA 1YVBI 4GHOA 5HOHA 1MWSA 2R4IA 3CNMA 3LMLA 3OWUA 4KFDA 5CLKA 3CC73 5EQLA 3G0KA 4GB5A 2UX0A 3FKAA 3OV4A 1OF5A 3KE7A 2C10A 3NV0A 1BRGA 2F4YA 1JV2B 4H3UA 4L7KA 3GWRA 1EA2A 3ALAA 3AGOA 1UCKA 1W7CA 3B4PA 4FMAA 4H61A 3MPHA 3EN1B 3T8UA 1T2IA 3V99A 1N9JA 1BNRA 3H51A 2BMRB 4FMBA 3KIIA 1AVLA 5BXQA 1G96A 1UCIA 2CWVA 3F40A
chains in the Genus database with same CATH topology
1RGAA 1JBSA 6GSPA 3AGNA 2C4BA 5BIRA 1GMPA 1LOYA 2KF4A 3A5EA 1BANA 2KF5A 1AY7A 1FZUA 1RNTA 1B2SA 1GOVA 1R4YA 3AHWA 1X1UA 2BIRA 4HAAA 1JBTA 1GOYA 1B27A 1UCLA 2AADA 3D4AA 3URPA 3GSPA 1DETA 1BRHA 2RBIA 1PY3A 1AQZA 1BNIA 1I0XA 1B2MA 3RNTA 1BIRA 1GOUA 3WR2A 7GSPA 1RGEA 1TRPA 1I2FA 1I3IA 1BSDA 1RCLA 2F5WA 1G02A 1SARA 1HYFA 1FUTA 1T2HA 3DGYA 2KF3A 1BGSA 1BRKA 1BRJA 1GSPA 3D5IA 5GSPA 5RNTA 1BSEA 1A2PA 1B3SA 1BNGA 2HOHA 2ZA4A 2KAAA 4J5GA 3SYUA 1FW7A 1RCKA 1BUJA 1RN1A 3AHSA 1RGCA 1I3FA 1YNVX 1X1WA 1TRQA 4BIRA 1BRNL 1YVSA 2F56A 1RGGA 1LRAA 1BRSA 8RNTA 1GMRA 1RN4A 1LOWA 1RGHA 1UCJA 4GSPA 1X1YA 2GSPA 1RNBA 1RHLA 1BOXA 1BNEA 1X1XA 2AAEA 4HOHA 1RMSA 2RNTA 1I70A 4RNTA 1RDSA 2KF6A 1BSCA 1CH0A 1TTOA 3WHOA 1GMQA 3BU4A 3KCHA 1BNJA 1BVIA 1RGKA 1HZ1A 3D5GA 1LOVA 7RNTA 1BRIA 3DH2A 3HOHA 9RNTA 1RGLA 1Q9EA 1RLSA 2BU4A 1I8VA 1B21A 1B2XA 1BSAA 1PYLA 1RGFA 1ZGXA 1B2UA 6RNTA 1FYSA 4BU4A 1BU4A 3Q3FA 1LNIA 5HOHA 4GHOA 1I2EA 2F5MA 3BIRA 1RTUA 1BAOA 1DE3A 1B2ZA 1YGWA 4J5KA 1MGRA 1BRGA 2F4YA 1B20A 1BNFA 1I2GA 3AGOA 5BU4A 1UCKA 1FUSA 1RSNA 1T2IA 1C54A 1BNRA 1MGWA 1IYYA 2SARA 1I0VA 1JBRA 1BNSA 1BSBA 1UCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGA A;  1JBS A;  6GSP A;  3AGN A;  2C4B A;  5BIR A;  1GMP A;  1LOY A;  2KF4 A;  3A5E A;  1BAN A;  2KF5 A;  1AY7 A;  1FZU A;  1RNT A;  1B2S A;  1GOV A;  1R4Y A;  3AHW A;  1X1U A;  2BIR A;  4HAA A;  1JBT A;  1GOY A;  1B27 A;  1UCL A;  2AAD A;  3D4A A;  3URP A;  3GSP A;  1DET A;  1BRH A;  2RBI A;  1PY3 A;  1AQZ A;  1BNI A;  1I0X A;  1B2M A;  3RNT A;  1BIR A;  1GOU A;  3WR2 A;  7GSP A;  1RGE A;  1TRP A;  1I2F A;  1I3I A;  1BSD A;  1RCL A;  2F5W A;  1G02 A;  1SAR A;  1HYF A;  1FUT A;  1T2H A;  3DGY A;  2KF3 A;  1BGS A;  1BRK A;  1BRJ A;  1GSP A;  3D5I A;  5GSP A;  5RNT A;  1BSE A;  1A2P A;  1B3S A;  1BNG A;  2HOH A;  2ZA4 A;  2KAA A;  4J5G A;  3SYU A;  1FW7 A;  1RCK A;  1BUJ A;  1RN1 A;  3AHS A;  1RGC A;  1I3F A;  1YNV X;  1X1W A;  1TRQ A;  4BIR A;  1BRN L;  1YVS A;  2F56 A;  1RGG A;  1LRA A;  1BRS A;  8RNT A;  1GMR A;  1RN4 A;  1LOW A;  1RGH A;  1UCJ A;  4GSP A;  1X1Y A;  2GSP A;  1RNB A;  1RHL A;  1BOX A;  1BNE A;  1X1X A;  2AAE A;  4HOH A;  1RMS A;  2RNT A;  1I70 A;  4RNT A;  1RDS A;  2KF6 A;  1BSC A;  1CH0 A;  1TTO A;  3WHO A;  1GMQ A;  3BU4 A;  3KCH A;  1BNJ A;  1BVI A;  1RGK A;  1HZ1 A;  3D5G A;  1LOV A;  7RNT A;  1BRI A;  3DH2 A;  3HOH A;  9RNT A;  1RGL A;  1Q9E A;  1RLS A;  2BU4 A;  1I8V A;  1B21 A;  1B2X A;  1BSA A;  1PYL A;  1RGF A;  1ZGX A;  1B2U A;  6RNT A;  1FYS A;  4BU4 A;  1BU4 A;  3Q3F A;  1LNI A;  5HOH A;  4GHO A;  1I2E A;  2F5M A;  3BIR A;  1RTU A;  1BAO A;  1DE3 A;  1B2Z A;  1YGW A;  4J5K A;  1MGR A;  1BRG A;  2F4Y A;  1B20 A;  1BNF A;  1I2G A;  3AGO A;  5BU4 A;  1UCK A;  1FUS A;  1RSN A;  1T2I A;  1C54 A;  1BNR A;  1MGW A;  1IYY A;  2SAR A;  1I0V A;  1JBR A;  1BNS A;  1BSB A;  1UCI A; 
#chains in the Genus database with same CATH topology
 1RGA A;  2QIY A;  3ZFZ A;  5DRE A;  5AIG A;  1RRH A;  2C4B A;  5BIR A;  1D6Z A;  1GMP A;  1C7H A;  1LOY A;  2GBW B;  2KF4 A;  3A5E A;  3JUP A;  1BAN A;  1GY5 A;  1N5H A;  3EBT A;  3K7C A;  3LH4 A;  3T0U A;  5CF1 A;  2F86 B;  3AHW A;  4HAA A;  3AMO A;  1K8A 4;  4N6V 0;  3UJM A;  1O7W B;  4O8S A;  1UCL A;  4IT7 A;  3FF2 A;  3S27 A;  1VQN 3;  3D4A A;  4MEI A;  5FW5 A;  2UGI A;  3CCM 3;  3B8L A;  1DET A;  1A2V A;  2W56 A;  2PNC A;  2RBI A;  3NQY A;  1AQZ A;  1BNI A;  4HM0 B;  4O2H A;  5EEO A;  2IUJ A;  3LTA A;  1YJN 3;  3WR2 A;  1QAL A;  4HM6 B;  2CFG A;  2CFD A;  4K1V A;  1K9M 4;  1BSD A;  1I3I A;  1ROV A;  3HII A;  1RCL A;  2F5W A;  5A0O B;  1SAR A;  2F99 A;  1FUT A;  1T2H A;  1M9G A;  3DXO A;  3LTC A;  4HZB B;  4BTW A;  1BRK A;  4AKY A;  5EVH A;  1ROA A;  1WMN A;  3MWZ A;  3EBY A;  1QVF 2;  3CMA 3;  1N8Q A;  3HI7 A;  4GL6 A;  5HGR A;  2GU3 A;  3HX8 A;  2INX A;  1FGT A;  2SBL A;  2ZA4 A;  2W9Q A;  1GS3 A;  1NO3 A;  3Q2P A;  4BTY A;  1FW7 A;  1YGE A;  1M90 4;  1ZS7 A;  2XRX B;  4J8T A;  4BIR A;  4LMI A;  5D82 A;  1YVS A;  2R41 A;  2JQ5 A;  1SIH A;  2H0I A;  2CWT A;  1LRA A;  2JDI H;  3D3L A;  3SOY A;  1ASK A;  3SX1 A;  1JRQ A;  5CF2 A;  3CC2 3;  1ZX2 A;  1DMN A;  1L5G B;  3GRD A;  1LOW A;  2CFL A;  1NNV A;  2D42 A;  2CIU A;  1RGH A;  2E2V A;  4HM7 B;  2D1W A;  1X1Y A;  1SQW A;  2GSP A;  3EC9 A;  3MSO A;  4WYK B;  4CDL A;  1X1X A;  2AAE A;  1IQ8 A;  4HJL B;  4EW5 A;  1Q7Y 4;  2K0M A;  4RNT A;  3EQQ B;  1UGH I;  3NM7 A;  2RSX A;  1CH0 A;  4I5Q A;  5AYR B;  4EXR A;  3FG4 A;  3X40 A;  1IQY A;  1UUG B;  3BU4 A;  1LQM B;  1V58 A;  2PZV A;  3WOE B;  1UGI A;  3JVC A;  3OX9 A;  5IW9 A;  1ULI B;  3DY5 A;  1ULJ B;  3HIG A;  4IPB A;  3EHC A;  4RBN A;  3AMO B;  3CCJ 3;  3EN8 A;  2V1L A;  2KXG A;  1W01 A;  9RNT A;  3N8B A;  2IMJ A;  1IV7 A;  1QAK A;  2I9W A;  2OCT A;  1AVK A;  1IT7 A;  1VQK 3;  2BMO B;  1FA3 A;  2KRT A;  1Q7H A;  1U8C B;  5IEP A;  2Z77 A;  1LNI A;  1YHQ 3;  2RFR A;  3NBJ A;  5KP3 A;  3CME 3;  4XBY A;  1I2E A;  1PFP A;  1BSB A;  4MJD A;  4TX4 A;  2F5M A;  3EF8 A;  3FH1 A;  1KC8 4;  1MGR A;  2IUK A;  1VQ6 3;  4N6M A;  1F8N A;  2B24 B;  1I2G A;  2Y74 A;  5BU4 A;  4N6N B;  3DM8 A;  4XM4 A;  1FUS A;  1FGM A;  1RSN A;  2L1S A;  2BO9 B;  1JZD A;  1OHO A;  2WO0 A;  3H3H A;  4L8O A;  5AYS C;  3SED A;  4BL3 A;  3S28 A;  4R4K A;  1C54 A;  5M19 A;  1I0V A;  1IYY A;  1ZO2 A;  3G8Z A;  1Q86 4;  1W2B 2;  5IG3 A;  3MG3 A;  2GBX B;  1STF I;  2Z7A A;  1UUV B;  3F7S A;  1QJG A;  4KT3 B;  2KF5 A;  4HM5 B;  1RNT A;  2W9P A;  2YFL B;  1DVC A;  2HMN B;  2A15 A;  1IK3 A;  1UDI I;  1EKM A;  2W56 B;  3NV0 B;  3CNX A;  3K9M C;  4N3V A;  2GXF A;  1KSI A;  3WOD G;  1GYB A;  1MNL A;  1IU7 A;  4LZI A;  1OGZ A;  2K3D A;  1NDO B;  5I97 A;  1IT8 A;  1TFO A;  1TIJ A;  1I0X A;  3FF0 A;  3D79 A;  3RNT A;  1BIR A;  5D81 A;  3F9S A;  4ZM8 A;  2C11 A;  1W6G A;  2GEY A;  3FZW A;  4CCV A;  1TRP A;  1O7N B;  1G0T A;  1QVG 2;  2XSO B;  1DVD A;  3GZB A;  3GZX B;  2CHC A;  1V57 A;  3BND A;  1IVW A;  2P0M A;  1CEW I;  2RCD A;  1O7G B;  1BRJ A;  3IJE B;  1M1X B;  1CQS A;  3U1W A;  3NX0 A;  1YJ9 3;  2XGN A;  2FGT A;  1BNG A;  5IG4 A;  4HVN A;  4XDV A;  1OHS A;  1CYV A;  2OTL 3;  3UB1 A;  2M7O A;  2ZDJ A;  1LVN A;  1JB5 A;  2P05 A;  1FGO A;  1OF5 B;  4MMZ B;  4XB5 A;  5JBS A;  4EBG A;  1YIT 3;  2F56 A;  1UI8 A;  1STD A;  2XEP A;  1OCV A;  3MHE A;  2W04 A;  4G1M B;  4PEJ A;  2ML6 A;  2YX9 A;  4X2O A;  3T8N A;  1T5Y A;  3U97 A;  3BNC A;  1NWW A;  5JPP A;  1RKY A;  3GAX A;  1N5P A;  4N6U A;  2CFK A;  1ISK A;  1RNB A;  1A67 A;  1RHL A;  3LYG A;  1BOX A;  5G1L A;  1MWU A;  4HOH A;  3LTB A;  3B4O A;  1RMS A;  3CCQ 3;  3ZG0 A;  4LYL B;  2WOF A;  4BL2 A;  2HMM B;  4RNY A;  1A90 A;  3WMD A;  1TTO A;  3V92 A;  4RZM A;  4XBX A;  3N9H A;  2WGO A;  3PXM A;  4N6L A;  3ER7 A;  1GD4 A;  1CYU A;  1SPU A;  4K61 A;  2BMQ B;  1S72 3;  4NRE A;  4NHF A;  3DUK A;  2XR8 B;  3RGR A;  1BVI A;  4K90 B;  1RGK A;  3D5G A;  5AEW B;  5BVB A;  4JF8 A;  4CJN A;  1BRI A;  3HOH A;  1KQS 2;  3CPW 2;  1U5O A;  2UUG C;  1RGF A;  1BSA A;  1J2B A;  1TP6 A;  3MKI A;  3I56 3;  1B2U A;  3KSE D;  1BU4 A;  4R9L A;  1W2Z A;  2OWP A;  1M1K 4;  2P0X A;  3CCV 3;  3STD A;  5LC7 A;  2O9U X;  4N6O B;  4WHA A;  3RDE A;  2E2T A;  3BIR A;  2GEX A;  3PS8 A;  2CG1 A;  1RTU A;  1WTH A;  3JUN A;  1B2Z A;  4WP5 A;  5LC6 A;  2YFJ B;  3CU3 A;  2XGL A;  3Q1C A;  5D83 A;  3WA3 A;  3IPT A;  1EEJ A;  1LOX A;  1D6Y A;  1W00 A;  2HMJ B;  5M1A A;  5CK6 A;  3O8Y A;  4HYZ A;  1MGW A;  2OOV A;  1US1 A;  2HMO B;  2SAR A;  6STD A;  3MG2 A;  1WMP A;  1O7H B;  1YI2 3;  1JBR A;  1D6U A;  1BNS A;  1V74 A;  1GD3 A;  1YJW 3;  3A76 A;  6GSP A;  1MWR A;  3OWY A;  4XBT A;  5STD A;  3EX9 A;  2WOH A;  4KFF A;  1AY7 A;  1Q82 4;  1B2S A;  1GOV A;  2K54 A;  1R4Y A;  2OTJ 3;  2BIR A;  1GOY A;  3UL6 A;  1W6C A;  3KZT A;  4K1U A;  2OQE C;  1EQK A;  4FCZ A;  1NB3 I;  4O02 B;  5AII A;  1RRL A;  3URP A;  4EV2 A;  5IG5 A;  1DMQ A;  2ML5 A;  1N9E A;  4OVM A;  1BRH A;  3PYJ A;  5DRV A;  3K0Z A;  2YFI B;  4BTX A;  3M8C A;  1PU4 A;  1B2M A;  3NXJ A;  3LXU X;  4AEQ A;  3K63 A;  3B7C A;  1OAC A;  3DMC A;  7GSP A;  3OW2 2;  2H0H A;  3F14 A;  1OPY A;  1I2F A;  2BHM A;  1G02 A;  2ZL8 A;  5CXO A;  3KKG A;  4EV5 A;  2XFS A;  3GZR A;  3CCL 3;  4ORL A;  3X42 A;  1IDP A;  4J9A A;  7STD A;  3OWS A;  5GSP A;  2CFW A;  4FMC A;  5RNT A;  1BSE A;  1B3S A;  1MWT A;  1RJO A;  1O7M B;  3F8X A;  3FCS B;  2CH9 A;  3I0Y A;  3Q90 A;  2P09 A;  1S5A A;  2CX0 A;  2E2U A;  2HOH A;  2QGU A;  2XSH B;  4LSO A;  2KAA A;  4J5G A;  5IF6 A;  5AI1 A;  1RCK A;  1RN1 A;  2F98 A;  3AHS A;  4HM3 B;  3DGN A;  1LQG C;  4STD A;  1SII A;  3DGL A;  1TRQ A;  3PGB A;  3QK9 A;  1JB2 A;  3NBR A;  1RGG A;  4I4K A;  3FG1 A;  4MMY B;  5G2G A;  1HKX A;  1NU3 A;  3G16 A;  1A2K A;  2QA4 3;  1BRS A;  2CC3 A;  4R80 A;  1OH0 A;  1K73 4;  5KP4 A;  1JJ2 2;  2BT3 A;  4X2H A;  4GSP A;  2OOV C;  3ECF A;  4U13 A;  4AKZ A;  4OK0 A;  3E99 A;  3DZL A;  2FXT A;  3UL5 A;  1BNE A;  1TUH A;  5IER A;  3UNL A;  1E3V A;  1Q81 4;  1GY7 A;  3S67 A;  1VQ4 3;  3X3X A;  1VQL 3;  1BSC A;  2XFT A;  1QMA A;  3NBB A;  1AR0 A;  4Q53 A;  3WHO A;  1GMQ A;  1SJW A;  1W6Y A;  1EG9 B;  1N8R 4;  4IIA A;  3HK4 A;  1LXE A;  2STD A;  1UW1 A;  3KCH A;  2P38 A;  3BLZ A;  5JPU A;  1VQ7 3;  1E3R A;  3JUQ A;  1T3B A;  1HZ1 A;  2ZHX B;  3CPO A;  1LOV A;  3LZA A;  3IMA B;  1WMO A;  3ROB A;  4LGQ A;  1Q9E A;  4NPB A;  1K41 A;  2BU4 A;  3D9R A;  1I8V A;  1B21 A;  1QAF A;  3NHX A;  1OUN A;  2CG0 A;  1VQO 3;  1TFK A;  3G4S 3;  6RNT A;  2HML B;  1FYS A;  2RGQ A;  4BU4 A;  3Q3F A;  1JN5 B;  2J8X B;  1W4N A;  4FR9 A;  3DGO A;  2OQE A;  4CPK A;  1NJI 4;  1Q40 B;  2IA7 A;  3PCR A;  1BAO A;  1DE3 A;  1YGW A;  1DMM A;  2CWU A;  4J5K A;  1O7P B;  2O3O A;  1JKG B;  5M18 A;  2WGQ A;  4HZ9 B;  1B20 A;  3CD6 3;  4HM8 B;  3EE1 A;  5AEU B;  3G71 3;  1BNF A;  4KZ1 A;  1K28 A;  4O3V A;  3ZG5 A;  1RN7 A;  5KP1 A;  1YIJ 3;  2IY2 A;  4MMX B;  4HM4 B;  4R9K A;  3LT9 A;  1E97 A;  1X1W A;  1LNH A;  1DYU A;  1BUQ A;  2QEX 3;  1WNH A;  1JBS A;  4JRF A;  1FGQ A;  3AGN A;  1TU5 A;  3FLJ A;  2LYX A;  2Z76 A;  3KSP A;  4HM2 B;  4WFO A;  3SLU A;  1W5Z A;  3BB9 A;  3LOY A;  4FCM A;  1IVV A;  3TDG A;  1IQX A;  1FZU A;  2KCD A;  4N6T A;  2CW9 A;  1JBT A;  1X1U A;  1VQQ A;  4FMD A;  1B27 A;  2MF7 A;  3L0R A;  3SXX A;  3MYT A;  3VGN A;  2AAD A;  2CK3 H;  2L4V A;  3SOA A;  3LT8 A;  3GSP A;  4ILF A;  1VQ8 3;  2XF3 A;  3V98 A;  1WQL B;  3X41 A;  1PY3 A;  3CCR 3;  3NQZ A;  3LTD A;  3VSY A;  1R4C A;  1GOU A;  3S5C A;  1RGE A;  1VZZ A;  1UI7 A;  2HMK B;  3BNE A;  8CHO A;  3K5T A;  3CCU 3;  3CC4 3;  1HYF A;  3X3Z A;  2FNQ A;  1VQ9 3;  1JNQ A;  3DGY A;  2KF3 A;  4XDW A;  2W0Q A;  1BGS A;  5TGN A;  1TJD A;  4HM1 B;  1GSP A;  3EB8 A;  2B1X B;  3D5I A;  3FGY A;  3JUO A;  1A2P A;  3I55 3;  1VQP 3;  2W6J H;  3EJV A;  4WYK A;  3NM2 A;  1OGX A;  2LQV A;  4R1K A;  1W02 A;  3CCE 3;  3F8H A;  3SYU A;  3JUM A;  3BNB A;  4KVH A;  4LEH A;  1RGC A;  4FCJ A;  1BUJ A;  1I3F A;  1YNV X;  1UUW B;  1VQM 3;  4DKI A;  1AV4 A;  1JB4 A;  1MOL A;  1KWI A;  3J7Y d;  3FG3 A;  1NB5 I;  1BRN L;  3S29 A;  3DGM A;  3N54 B;  3MG1 A;  5IG0 A;  2H0G A;  2IYJ A;  8RNT A;  1JZO A;  5ELJ A;  1GMR A;  1RN4 A;  3RGA A;  3CXC 2;  4HBR A;  1UCJ A;  2BNG A;  3NUV A;  5AIF A;  3WA2 X;  4RNZ A;  1FUW A;  3VF1 A;  3WOF B;  2Q07 A;  3PCS A;  2RNT A;  4EC6 A;  2GU1 A;  1I70 A;  4L8P A;  5FGO A;  1RDS A;  3WDG B;  2KF6 A;  3GZY B;  3HZP A;  3PZW A;  1IVU A;  4KFE A;  1Y4K A;  2Y73 A;  3KFQ C;  5ELU A;  3X3Y A;  5IEN A;  3CCS 3;  1Q42 A;  2CKF B;  1GY6 A;  5AIH A;  3G6E 3;  2W03 A;  1EUI C;  2CX1 A;  1HU9 A;  1KD1 4;  3OXA A;  1BNJ A;  4WWU C;  2XH9 A;  1Q40 A;  7RNT A;  3DH2 A;  3KN4 A;  1FGR A;  4OUQ A;  1RGL A;  1IVX A;  1RLS A;  3F7X A;  5G1K A;  3SVA A;  4HKV B;  1JN5 A;  1B2X A;  1PYL A;  1JKG A;  1OHP A;  2Z6B A;  1VQ5 3;  1IV9 A;  1ZGX A;  4EYC A;  3FSD A;  3QRD A;  1Z1S A;  2MC8 A;  4QWT A;  2W2C A;  5IEO A;  1YVB I;  4GHO A;  5HOH A;  1MWS A;  2R4I A;  3CNM A;  3LML A;  3OWU A;  4KFD A;  5CLK A;  3CC7 3;  5EQL A;  3G0K A;  4GB5 A;  2UX0 A;  3FKA A;  3OV4 A;  1OF5 A;  3KE7 A;  2C10 A;  3NV0 A;  1BRG A;  2F4Y A;  1JV2 B;  4H3U A;  4L7K A;  3GWR A;  1EA2 A;  3ALA A;  3AGO A;  1UCK A;  1W7C A;  3B4P A;  4FMA A;  4H61 A;  3MPH A;  3EN1 B;  3T8U A;  1T2I A;  3V99 A;  1N9J A;  1BNR A;  3H51 A;  2BMR B;  4FMB A;  3KII A;  1AVL A;  5BXQ A;  1G96 A;  1UCI A;  2CWV A;  3F40 A; 
#chains in the Genus database with same CATH homology
 1RGA A;  1JBS A;  6GSP A;  3AGN A;  2C4B A;  5BIR A;  1GMP A;  1LOY A;  2KF4 A;  3A5E A;  1BAN A;  2KF5 A;  1AY7 A;  1FZU A;  1RNT A;  1B2S A;  1GOV A;  1R4Y A;  3AHW A;  1X1U A;  2BIR A;  4HAA A;  1JBT A;  1GOY A;  1B27 A;  1UCL A;  2AAD A;  3D4A A;  3URP A;  3GSP A;  1DET A;  1BRH A;  2RBI A;  1PY3 A;  1AQZ A;  1BNI A;  1I0X A;  1B2M A;  3RNT A;  1BIR A;  1GOU A;  3WR2 A;  7GSP A;  1RGE A;  1TRP A;  1I2F A;  1I3I A;  1BSD A;  1RCL A;  2F5W A;  1G02 A;  1SAR A;  1HYF A;  1FUT A;  1T2H A;  3DGY A;  2KF3 A;  1BGS A;  1BRK A;  1BRJ A;  1GSP A;  3D5I A;  5GSP A;  5RNT A;  1BSE A;  1A2P A;  1B3S A;  1BNG A;  2HOH A;  2ZA4 A;  2KAA A;  4J5G A;  3SYU A;  1FW7 A;  1RCK A;  1BUJ A;  1RN1 A;  3AHS A;  1RGC A;  1I3F A;  1YNV X;  1X1W A;  1TRQ A;  4BIR A;  1BRN L;  1YVS A;  2F56 A;  1RGG A;  1LRA A;  1BRS A;  8RNT A;  1GMR A;  1RN4 A;  1LOW A;  1RGH A;  1UCJ A;  4GSP A;  1X1Y A;  2GSP A;  1RNB A;  1RHL A;  1BOX A;  1BNE A;  1X1X A;  2AAE A;  4HOH A;  1RMS A;  2RNT A;  1I70 A;  4RNT A;  1RDS A;  2KF6 A;  1BSC A;  1CH0 A;  1TTO A;  3WHO A;  1GMQ A;  3BU4 A;  3KCH A;  1BNJ A;  1BVI A;  1RGK A;  1HZ1 A;  3D5G A;  1LOV A;  7RNT A;  1BRI A;  3DH2 A;  3HOH A;  9RNT A;  1RGL A;  1Q9E A;  1RLS A;  2BU4 A;  1I8V A;  1B21 A;  1B2X A;  1BSA A;  1PYL A;  1RGF A;  1ZGX A;  1B2U A;  6RNT A;  1FYS A;  4BU4 A;  1BU4 A;  3Q3F A;  1LNI A;  5HOH A;  4GHO A;  1I2E A;  2F5M A;  3BIR A;  1RTU A;  1BAO A;  1DE3 A;  1B2Z A;  1YGW A;  4J5K A;  1MGR A;  1BRG A;  2F4Y A;  1B20 A;  1BNF A;  1I2G A;  3AGO A;  5BU4 A;  1UCK A;  1FUS A;  1RSN A;  1T2I A;  1C54 A;  1BNR A;  1MGW A;  1IYY A;  2SAR A;  1I0V A;  1JBR A;  1BNS A;  1BSB A;  1UCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...