1W2B2

Trigger factor ribosome binding domain in complex with 50s
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 12
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1w2b200
3CCE3 2QA43 1YI23 1JJ22 1VQ63 3CD63 3CCV3 1W2B2 1M904 2OTJ3 1VQ43 1S723 3CPW2 3I553 1Q814 3CMA3 1VQO3 3CXC2 3CCJ3 1YJN3 3CCU3 1VQP3 1YHQ3 1VQK3 1QVG2 3CCM3 1KC84 1VQ93 2OTL3 3CME3 2QEX3 1VQ53 1YJ93 1K9M4 3G713 1VQL3 1VQN3 1N8R4 1K734 3OW22 1VQ83 1M1K4 3CC23 1K8A4 3CC73 1YIJ3 3I563 3CCS3 1Q7Y4 3CCQ3 1QVF2 1YIT3 3CC43 3G6E3 1KD14 1KQS2 1Q824 3G4S3 3CCL3 3CCR3 1VQ73 1VQM3 1NJI4 1YJW3 1Q864
chains in the Genus database with same CATH superfamily
2IUJA 1YI23 3G8ZA 2CFGA 1STDA 4GL6A 2OTJ3 1RGLA 3F8HA 1WNHA 2HMMB 4O3VA 3X3YA 4J9AA 3WA2X 4HKVB 3HIGA 3FF2A 3LT8A 3CXC2 1VQP3 3DM8A 3F8XA 3AGOA 2OOVC 3AHWA 3SOYA 1VQL3 1RGEA 1RRHA 1YIJ3 3NBBA 2Q07A 2SBLA 1KWIA 1QAFA 3PXMA 3WODG 3BLZA 4G1MB 1IQYA 5STDA 1L5GB 2OCTA 3UB1A 3K0ZA 2WOHA 3MYTA 5D82A 5BU4A 3CCE3 2XGLA 1BNRA 4GHOA 2WGQA 5IEPA 3LZAA 2K0MA 1N5PA 4KZ1A 3QRDA 1PU4A 3CPW2 2ZHXB 1AR0A 1B21A 5IW9A 1IQXA 3S29A 3KKGA 1X1UA 5IENA 1UUWB 4KFDA 1VQK3 1EG9B 2CX0A 3UL5A 1UUVB 1ZGXA 1GSPA 3F9SA 3WHOA 1TRQA 1LNHA 1RMSA 5CF2A 1YGEA 1W01A 1IT7A 1JN5B 1OHPA 1RGHA 1I3FA 1SARA 3MHEA 3Q2PA 8RNTA 2BMRB 1BRKA 1DYUA 4N6LA 3CCS3 1QVF2 3CC43 1UCJA 1US1A 4N3VA 3WMDA 1RGFA 2KXGA 2ZDJA 3V98A 2RBIA 1BRJA 1OGXA 4LEHA 3N8BA 3FSDA 2CX1A 1VQN3 1MWUA 1WMOA 2CWTA 1JKGB 2BNGA 1N8QA 4KFFA 4FR9A 3RGAA 3NQZA 4J5GA 1TUHA 1T2IA 1I2GA 3DGNA 5LC7A 1RSNA 1STFI 3LXUX 3EN1B 4CDLA 4RNYA 2RCDA 3CNMA 2OOVA 3G16A 4QWTA 5IF6A 1HU9A 1FGRA 2H0IA 3X3ZA 1RHLA 3UNLA 1R4YA 2B1XB 3HI7A 2W9PA 4HAAA 1FGTA 3UJMA 4HOHA 1OHSA 1E3VA 1SIIA 2CFLA 4LGQA 4WFOA 5IG0A 1O7PB 4O2HA 3BNBA 1JV2B 3GSPA 4BL2A 2R41A 1FUWA 4EBGA 4BTWA 1M1XB 4K61A 3EN8A 1QMAA 3KE7A 1W4NA 4HM2B 1JNQA 1TIJA 1UDII 1GS3A 2HMLB 1IT8A 3GWRA 1X1XA 4H61A 1PFPA 1VQO3 6GSPA 4XBYA 1K28A 4GB5A 4N6V0 1I0VA 3M8CA 5KP4A 3EBYA 1IYYA 2OTL3 5AEWB 1D6YA 2A15A 3PGBA 1UGHI 4TX4A 1VQ53 1MWRA 2WGOA 3X3XA 4RNZA 1FGQA 1M1K4 1C54A 1V57A 1S5AA 3E99A 1QJGA 4HYZA 4XDWA 3SEDA 3AHSA 1BGSA 2RSXA 3GAXA 1RCKA 5CLKA 3RNTA 4XM4A 2C11A 2K54A 1FW7A 1LOVA 1BRGA 5CF1A 3IMAB 1A67A 1BRIA 2F4YA 4FMAA 2XF3A 4XDVA 5DREA 1SQWA 1GMPA 2W6JH 1BNJA 3CC73 2MC8A 3B7CA 1JZOA 3Q90A 1K41A 1BRNL 3KN4A 4OVMA 2B24B 3CMA3 4FCJA 4PEJA 1DVCA 1ZO2A 4IT7A 2IYJA 5AYSC 3OX9A 1CYUA 4MMXB 5BXQA 5HGRA 3G713 1VQ83 5CXOA 5BIRA 1BSEA 2CH9A 3NM7A 1BNFA 3G0KA 2OQEA 3S27A 4BTXA 2LYXA 4EV2A 1IV9A 1Q9EA 1JRQA 4STDA 1ULIB 3IPTA 5M19A 1FZUA 1GY7A 1B2SA 1F8NA 1UCKA 2P0MA 1BNGA 1GMQA 3KFQC 5IG4A 1VQ43 3T0UA 1DE3A 1RGKA 3EC9A 2M7OA 2YFLB 3HOHA 4K90B 4XBTA 4CCVA 1W2ZA 1YJN3 1QVG2 1G96A 3B4OA 1ZS7A 3PCSA 5EEOA 2QEX3 5I97A 3WOEB 1NB3I 3DGYA 4HM5B 3U1WA 2XR8B 1R4CA 3DXOA 5ELUA 3S5CA 1U8CB 5D81A 2CG1A 2CK3H 4ORLA 5IG3A 2KCDA 1AY7A 4HVNA 1IU7A 1MOLA 2IA7A 4XB5A 1NWWA 5G1KA 6RNTA 1LNIA 1BRSA 1DETA 1WQLB 4GSPA 4ZM8A 4I5QA 2IY2A 2KF6A 1OACA 1RNTA 2PNCA 3HX8A 5GSPA 5JBSA 7STDA 1Q40B 7GSPA 1UGIA 1T3BA 2XGNA 1A2VA 1AVLA 2RFRA 5AIIA 3I0YA 1RN1A 1OHOA 2BU4A 2F86B 1WTHA 2YX9A 4DKIA 3WR2A 3FG4A 1ROVA 4HM4B 4OUQA 1T2HA 2BMQB 3LMLA 1V58A 3DUKA 2CWVA 3GZBA 3LTBA 4OK0A 3V92A 1W6CA 1FUTA 3ROBA 3SOAA 1OPYA 3PZWA 3GZXB 3LTAA 1ULJB 1W5ZA 3OWUA 1I70A 3H3HA 1VQ73 4NHFA 1O7HB 3X41A 4BU4A 3T8NA 3OV4A 1TJDA 4Q53A 4HZ9B 1JJ22 1PY3A 5G1LA 4JRFA 3NQYA 3CCV3 3F7SA 2ML6A 1QAKA 3KZTA 2ML5A 1BSDA 1RLSA 1YVSA 1O7GB 3SLUA 4R80A 1O7WB 3WOFB 3F7XA 1TFOA 1MGRA 4HM1B 4KT3B 1BUQA 1KC84 1BANA 5HOHA 1CYVA 2F99A 3WA3A 4IPBA 4LYLB 1BOXA 3EX9A 3EB8A 1N8R4 1DMNA 3DGOA 3D9RA 4KVHA 4U13A 3MSOA 3RDEA 3NV0A 1K8A4 2W04A 2BMOB 1Q7Y4 4LZIA 3VF1A 1A2KA 3K7CA 1AV4A 1Q824 1D6ZA 2CKFB 4MJDA 1RCLA 1W6GA 2E2VA 2QGUA 2GBXB 2KF4A 4WYKA 1VQM3 3MKIA 2OQEC 3S28A 1I2FA 2FXTA 2GEXA 3KCHA 7RNTA 4R1KA 1M904 3FGYA 3JUOA 4N6TA 2XH9A 3VSYA 3MWZA 4FMBA 4HZBB 1HYFA 2O9UX 2OWPA 3X40A 2IMJA 5IERA 1BNIA 4RZMA 1VQ93 3VGNA 1E97A 1W6YA 3ZG0A 1I0XA 3OW22 4BIRA 1CQSA 3JUPA 1FA3A 3JUNA 4HM3B 2WOFA 1AVKA 1E3RA 2HMNB 2HMJB 2W0QA 2R4IA 3STDA 1B2ZA 2Z77A 3F14A 1RGCA 3EQQB 2GSPA 2STDA 1T5YA 1I2EA 2IUKA 3CD63 2Z7AA 1RTUA 2WO0A 2CFDA 1W2B2 5BVBA 3WDGB 2KF3A 3K63A 4RNTA 3I553 1PYLA 2CHCA 5A0OB 5G2GA 4O8SA 4NREA 4R9LA 1I8VA 3X42A 4HJLB 5AI1A 4H3UA 5EQLA 1UI7A 5DRVA 3BU4A 1BU4A 1K734 3N9HA 1UW1A 3IJEB 2RGQA 5M18A 3D4AA 1RJOA 4FMCA 3CCQ3 1D6UA 1Z1SA 1YIT3 1IVVA 1NU3A 1JB4A 1BSBA 3FH1A 1MWSA 1GOYA 1TTOA 2JQ5A 1JB5A 2W56A 4R4KA 5AIHA 2AADA 3JUMA 1I3IA 2F5MA 2BO9B 4KFEA 3CCR3 1HZ1A 1O7MB 2GU1A 1NB5I 1UUGB 2L4VA 3BNEA 5D83A 1S723 1YNVX 3SVAA 2J8XB 3T8UA 5AIGA 1JBRA 2FGTA 3JVCA 3URPA 3LOYA 1BUJA 1MGWA 5M1AA 1JB2A 1RN7A 3PS8A 4CJNA 1U5OA 2YFIB 2GBWB 4K1UA 1A90A 1FUSA 2GU3A 2GEYA 1KSIA 1K9M4 2PZVA 5LC6A 2L1SA 4MEIA 3MG2A 2KF5A 1WMPA 4N6UA 2CWUA 2CG0A 2HOHA 1BRHA 1M9GA 2HMKB 2XFSA 3FLJA 3RGRA 4EV5A 1KQS2 2QIYA 4IIAA 4HM6B 3H51A 1BSAA 2KAAA 3AMOA 4BTYA 3LTDA 3Q3FA 2AAEA 3B8LA 1B20A 4N6OB 1X1WA 3U97A 2Y73A 1Q814 2BIRA 1TP6A 1GYBA 1LOWA 2D1WA 3GZRA 4O02B 1V74A 1G0TA 1BAOA 2CIUA 4J8TA 1Q42A 1ZX2A 4J5KA 4L8OA 3CCU3 3Q1CA 4ILFA 5CK6A 3ZG5A 3CU3A 3MPHA 1N5HA 1X1YA 3ZFZA 4HM7B 4JF8A 3DGLA 1LXEA 3SX1A 3A76A 3EHCA 3SXXA 3O8YA 4FMDA 3KSPA 1OF5A 3NUVA 1ISKA 2H0HA 2W03A 1SIHA 1OH0A 4HM0B 2HMOB 3KSED 3NV0B 4L7KA 5KP3A 1EQKA 4WHAA 1B2MA 2H0GA 4FCZA 1LQMB 1RKYA 4X2HA 3NX0A 3ER7A 2XFTA 1UCIA 1NJI4 3B4PA 2QA43 4WYKB 1IV7A 1IDPA 2I9WA 5TGNA 3EBTA 1FGOA 1LRAA 1MNLA 1NDOB 4HM8B 3A5EA 1WMNA 1O7NB 1RRLA 1G02A 1YHQ3 5AIFA 2P0XA 1MWTA 2F56A 1EKMA 4BL3A 3CCM3 4FCMA 3CME3 1RGAA 2FNQA 2Z76A 1OCVA 3GZYB 1GOVA 3F40A 5FGOA 1B3SA 2XEPA 3TDGA 3I563 3G6E3 1QALA 4LMIA 4MMYB 3DY5A 3V99A 3G4S3 2V1LA 4K1VA 1DVDA 2P05A 2ZA4A 5ELJA 2O3OA 1LOYA 2LQVA 4I4KA 5JPPA 1YJW3 1Q40A 1NO3A 3GRDA 2UGIA 3FZWA 2F98A 1YGWA 3NHXA 3NM2A 1UCLA 3K9MC 3D5IA 4R9KA 3DMCA 1OUNA 1BSCA 2E2UA 1SJWA 4EC6A 1RN4A 3DGMA 1JN5A 1N9JA 2P09A 1GY6A 3FG1A 1BNEA 1EA2A 3DZLA 3FG3A 2P38A 1JZDA 2BT3A 2C10A 3J7Yd 3L0RA 2XRXB 3OWYA 1SPUA 5AEUB 1RDSA 2D42A 2CC3A 2YFJB 5JPUA 2CFKA 3EJVA 4WP5A 1GOUA 1Y4KA 3LT9A 5FW5A 3CCL3 1EEJA 2C4BA 1GD4A 1W7CA 1JKGA 3D3LA 3DH2A 3FF0A 3HK4A 3KIIA 5EVHA 2W56B 3CNXA 1JBSA 1VQQA 1AQZA 3ECFA 2KRTA 3EF8A 4AKZA 4EW5A 1YVBI 1IK3A 3HIIA 1GY5A 2INXA 2Y74A 5IEOA 1VZZA 1DMQA 4NPBA 1LQGC 3OWSA 8CHOA 1TU5A 3N54B 3PCRA 3D79A 3MG1A 2RNTA 1RGGA 1J2BA 4XBXA 5KP1A 1BVIA 1GMRA 1CH0A 1YJ93 4HBRA 1UI8A 4N6NB 5RNTA 2W9QA 3JUQA 2UX0A 4LSOA 1JBTA 1IVWA 1BIRA 1TFKA 4N6MA 1IVXA 4RBNA 6STDA 3S67A 3LH4A 1DMMA 3NBRA 5AYRB 4WWUC 2F5WA 2GXFA 1NNVA 4AKYA 1LVNA 1B27A 1GD3A 3SYUA 2XSOB 1ASKA 2BHMA 1Q864 1FYSA 5IG5A 1VQ63 4CPKA 3QK9A 1RNBA 2K3DA 3CPOA 3UL6A 2JDIH 3AMOB 2CFWA 2E2TA 1LOXA 3LTCA 4AEQA 1OGZA 3LYGA 1B2UA 3CCJ3 1Q7HA 2SARA 1HKXA 3BIRA 3ALAA 4EYCA 4L8PA 1IQ8A 3NBJA 2UUGC 1BNSA 1C7HA 1FGMA 2ZL8A 3K5TA 1B2XA 3NXJA 3BNDA 3CC23 1ROAA 1N9EA 1EUIC 1IVUA 2CW9A 1W00A 1TRPA 2W2CA 3BB9A 3FCSB 3D5GA 3HZPA 3BNCA 4MMZB 3OXAA 1KD14 1OF5B 1W02A 2XSHB 9RNTA 1A2PA 1CEWI 3PYJA 4X2OA 3EE1A 3MG3A 3FKAA 3AGNA 2MF7A 4EXRA 2Z6BA
chains in the Genus database with same CATH topology
2IUJA 1YI23 3G8ZA 2CFGA 1STDA 4GL6A 2OTJ3 3F8HA 1WNHA 2HMMB 4O3VA 3X3YA 4J9AA 3WA2X 4HKVB 3HIGA 3FF2A 3LT8A 3CXC2 1VQP3 3DM8A 3F8XA 2OOVC 3SOYA 1VQL3 1RRHA 1YIJ3 3NBBA 2Q07A 2SBLA 1KWIA 1QAFA 3PXMA 3WODG 3BLZA 4G1MB 1IQYA 5STDA 1L5GB 2OCTA 3UB1A 3K0ZA 2WOHA 5D82A 3CCE3 2XGLA 5IEPA 2WGQA 3LZAA 2K0MA 1N5PA 4KZ1A 3QRDA 1PU4A 3CPW2 1AR0A 5IW9A 1IQXA 3S29A 3KKGA 5IENA 1UUWB 4KFDA 1VQK3 1EG9B 3UL5A 1UUVB 3F9SA 1LNHA 1YGEA 1W01A 1IT7A 1JN5B 1OHPA 3MHEA 3Q2PA 2BMRB 1DYUA 4N6LA 3CCS3 1QVF2 3CC43 1US1A 4N3VA 3WMDA 2ZDJA 2KXGA 3V98A 1OGXA 4LEHA 3N8BA 3FSDA 1VQN3 1WMOA 2CWTA 1JKGB 2BNGA 1N8QA 4KFFA 4FR9A 3RGAA 3NQZA 1TUHA 3DGNA 5LC7A 1STFI 3LXUX 3EN1B 4CDLA 4RNYA 2RCDA 3CNMA 2OOVA 3G16A 4QWTA 5IF6A 1HU9A 1FGRA 3X3ZA 3UNLA 2B1XB 3HI7A 2W9PA 1FGTA 3UJMA 1OHSA 1E3VA 1SIIA 2CFLA 4LGQA 4WFOA 5IG0A 1O7PB 4O2HA 3BNBA 1JV2B 1FUWA 4EBGA 4BTWA 1M1XB 4K61A 3EN8A 1QMAA 3KE7A 1W4NA 4HM2B 1JNQA 1TIJA 1GS3A 2HMLB 1IT8A 3GWRA 4H61A 1PFPA 1VQO3 4XBYA 1K28A 4GB5A 4N6V0 3M8CA 5KP4A 3EBYA 2OTL3 5AEWB 1D6YA 2A15A 3PGBA 4TX4A 1VQ53 2WGOA 3X3XA 4RNZA 1FGQA 1M1K4 1S5AA 3E99A 1QJGA 4HYZA 4XDWA 3SEDA 2RSXA 3GAXA 5CLKA 4XM4A 2C11A 2K54A 5CF1A 3IMAB 1A67A 4FMAA 2XF3A 4XDVA 5DREA 1SQWA 2W6JH 2MC8A 3B7CA 3Q90A 1K41A 3KN4A 4OVMA 2B24B 3CMA3 4FCJA 4PEJA 1DVCA 1ZO2A 4IT7A 5AYSC 1CYUA 3OX9A 4MMXB 5BXQA 5HGRA 3G713 1VQ83 5CXOA 2CH9A 3NM7A 3S27A 3G0KA 2OQEA 4BTXA 2LYXA 4EV2A 1IV9A 1JRQA 4STDA 1ULIB 3IPTA 1GY7A 2P0MA 1F8NA 5IG4A 3KFQC 1VQ43 3T0UA 3EC9A 2M7OA 2YFLB 4K90B 4XBTA 4CCVA 1W2ZA 1YJN3 1QVG2 1G96A 3B4OA 5EEOA 3PCSA 2QEX3 5I97A 3WOEB 1NB3I 4HM5B 3U1WA 2XR8B 1R4CA 3DXOA 5ELUA 3S5CA 1U8CB 5D81A 2CG1A 2CK3H 4ORLA 2KCDA 4HVNA 1IU7A 1MOLA 2IA7A 4XB5A 1NWWA 1WQLB 4ZM8A 2PNCA 1OACA 5JBSA 3HX8A 7STDA 1Q40B 2XGNA 1A2VA 1AVLA 2RFRA 5AIIA 3I0YA 1OHOA 2F86B 2YX9A 1WTHA 5IG3A 3FG4A 1ROVA 4HM4B 4OUQA 2BMQB 3LMLA 3GZBA 3DUKA 2CWVA 3LTBA 4OK0A 3V92A 1W6CA 3ROBA 3SOAA 1OPYA 3PZWA 3GZXB 3LTAA 1ULJB 1W5ZA 3OWUA 3H3HA 1VQ73 4NHFA 1O7HB 3X41A 3T8NA 3OV4A 4Q53A 4HZ9B 1JJ22 4JRFA 3NQYA 3CCV3 3F7SA 2ML6A 1QAKA 3KZTA 2ML5A 1O7GB 3SLUA 4R80A 1O7WB 3WOFB 3F7XA 1TFOA 4HM1B 1BUQA 1KC84 1CYVA 2F99A 3WA3A 4IPBA 3EX9A 3EB8A 1N8R4 1DMNA 3DGOA 3D9RA 4KVHA 4U13A 3MSOA 3RDEA 3NV0A 1K8A4 2W04A 2BMOB 1Q7Y4 4LZIA 3VF1A 1A2KA 3K7CA 1AV4A 1Q824 1D6ZA 2CKFB 4MJDA 2E2VA 1W6GA 2QGUA 4WYKA 2GBXB 1VQM3 3MKIA 2OQEC 3S28A 2FXTA 2GEXA 1M904 4R1KA 3FGYA 3JUOA 4N6TA 2XH9A 3VSYA 3MWZA 4FMBA 4HZBB 3X40A 2O9UX 2OWPA 5IERA 2IMJA 4RZMA 1VQ93 3VGNA 1E97A 1W6YA 3OW22 1CQSA 3JUPA 1FA3A 3JUNA 4HM3B 2WOFA 1AVKA 1E3RA 2HMNB 2HMJB 2W0QA 2R4IA 3STDA 2Z77A 3F14A 3EQQB 2STDA 1T5YA 2IUKA 3CD63 2Z7AA 1W2B2 2WO0A 2CFDA 5BVBA 3WDGB 3K63A 3I553 5A0OB 2CHCA 5G2GA 4O8SA 4NREA 4R9LA 3X42A 4HJLB 5AI1A 4H3UA 5EQLA 1UI7A 5DRVA 1K734 3N9HA 1UW1A 3IJEB 2RGQA 4FMCA 1RJOA 3CCQ3 1D6UA 1Z1SA 1YIT3 1IVVA 1NU3A 1JB4A 3FH1A 2JQ5A 2W56A 1JB5A 4R4KA 5AIHA 3JUMA 3CCR3 2BO9B 4KFEA 1O7MB 2GU1A 1NB5I 2L4VA 3BNEA 5D83A 1S723 3SVAA 3T8UA 5AIGA 2FGTA 3JVCA 3LOYA 1JB2A 1RN7A 3PS8A 1U5OA 2YFIB 2GBWB 4K1UA 1A90A 2GU3A 2GEYA 1KSIA 1K9M4 2PZVA 5LC6A 4MEIA 3MG2A 1WMPA 4N6UA 2CWUA 2CG0A 2XFSA 1M9GA 2HMKB 3RGRA 3FLJA 4EV5A 1KQS2 2QIYA 4IIAA 4HM6B 3H51A 3AMOA 4BTYA 3LTDA 3B8LA 4N6OB 3U97A 1Q814 2Y73A 1TP6A 1GYBA 2D1WA 3GZRA 4O02B 1V74A 2CIUA 4J8TA 1Q42A 1ZX2A 4L8OA 3CCU3 3Q1CA 5CK6A 3CU3A 3MPHA 1N5HA 4HM7B 4JF8A 3DGLA 1LXEA 3SX1A 3A76A 3EHCA 3SXXA 3O8YA 4FMDA 3KSPA 1OF5A 3NUVA 1ISKA 2W03A 1SIHA 1OH0A 4HM0B 2HMOB 3KSED 3NV0B 4L7KA 5KP3A 1EQKA 4WHAA 4FCZA 1RKYA 4X2HA 3NX0A 3ER7A 2XFTA 1NJI4 3B4PA 2QA43 4WYKB 1IV7A 1IDPA 2I9WA 5TGNA 3EBTA 1FGOA 1MNLA 1NDOB 4HM8B 1WMNA 1O7NB 1RRLA 1YHQ3 5AIFA 2P0XA 3CCM3 1EKMA 4FCMA 3CME3 2FNQA 2Z76A 1OCVA 3GZYB 3F40A 5FGOA 2XEPA 3TDGA 3I563 3G6E3 1QALA 4LMIA 4MMYB 3DY5A 3V99A 3G4S3 2V1LA 4K1VA 1DVDA 2P05A 5ELJA 2O3OA 4I4KA 2LQVA 5JPPA 1YJW3 1Q40A 1NO3A 3GRDA 3FZWA 2F98A 3NM2A 3NHXA 3K9MC 4R9KA 3DMCA 1OUNA 2E2UA 1SJWA 4EC6A 3DGMA 1JN5A 1N9JA 2P09A 1GY6A 3FG1A 1EA2A 3DZLA 3FG3A 2P38A 2BT3A 2C10A 3J7Yd 3L0RA 2XRXB 3OWYA 1SPUA 5AEUB 2D42A 2CC3A 2YFJB 5JPUA 2CFKA 3EJVA 4WP5A 5FW5A 1Y4KA 3LT9A 3CCL3 1GD4A 1W7CA 1JKGA 3D3LA 3FF0A 3HK4A 3KIIA 5EVHA 2W56B 3CNXA 3ECFA 2KRTA 3EF8A 4AKZA 1YVBI 1IK3A 3HIIA 1GY5A 2INXA 2Y74A 5IEOA 1VZZA 1DMQA 3OWSA 8CHOA 1TU5A 3N54B 3PCRA 3MG1A 1J2BA 4XBXA 5KP1A 1YJ93 4HBRA 1UI8A 4N6NB 2W9QA 3JUQA 2UX0A 4LSOA 1IVWA 1TFKA 4N6MA 1IVXA 4RBNA 6STDA 3S67A 3LH4A 1DMMA 3NBRA 5AYRB 4WWUC 2GXFA 4AKYA 1LVNA 1GD3A 2XSOB 1ASKA 2BHMA 1Q864 5IG5A 1VQ63 3QK9A 3CPOA 3UL6A 2JDIH 3AMOB 2CFWA 2E2TA 1LOXA 3LTCA 4AEQA 1OGZA 3LYGA 3CCJ3 1HKXA 3ALAA 4EYCA 4L8PA 1IQ8A 3NBJA 1C7HA 1FGMA 2ZL8A 3K5TA 3NXJA 3BNDA 3CC23 1ROAA 1N9EA 2W2CA 1IVUA 2CW9A 1W00A 3BB9A 3FCSB 3HZPA 3MYTA 5CF2A 3CC73 3BNCA 4MMZB 3OXAA 1KD14 1OF5B 1W02A 2XSHB 1CEWI 3PYJA 4X2OA 3EE1A 3MG3A 3FKAA 4EXRA 2MF7A 2Z6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE 3;  2QA4 3;  1YI2 3;  1JJ2 2;  1VQ6 3;  3CD6 3;  3CCV 3;  1W2B 2;  1M90 4;  2OTJ 3;  1VQ4 3;  1S72 3;  3CPW 2;  3I55 3;  1Q81 4;  3CMA 3;  1VQO 3;  3CXC 2;  3CCJ 3;  1YJN 3;  3CCU 3;  1VQP 3;  1YHQ 3;  1VQK 3;  1QVG 2;  3CCM 3;  1KC8 4;  1VQ9 3;  2OTL 3;  3CME 3;  2QEX 3;  1VQ5 3;  1YJ9 3;  1K9M 4;  3G71 3;  1VQL 3;  1VQN 3;  1N8R 4;  1K73 4;  3OW2 2;  1VQ8 3;  1M1K 4;  3CC2 3;  1K8A 4;  3CC7 3;  1YIJ 3;  3I56 3;  3CCS 3;  1Q7Y 4;  3CCQ 3;  1QVF 2;  1YIT 3;  3CC4 3;  3G6E 3;  1KD1 4;  1KQS 2;  1Q82 4;  3G4S 3;  3CCL 3;  3CCR 3;  1VQ7 3;  1VQM 3;  1NJI 4;  1YJW 3;  1Q86 4; 
#chains in the Genus database with same CATH topology
 2IUJ A;  1YI2 3;  3G8Z A;  2CFG A;  1STD A;  4GL6 A;  2OTJ 3;  1RGL A;  3F8H A;  1WNH A;  2HMM B;  4O3V A;  3X3Y A;  4J9A A;  3WA2 X;  4HKV B;  3HIG A;  3FF2 A;  3LT8 A;  3CXC 2;  1VQP 3;  3DM8 A;  3F8X A;  3AGO A;  2OOV C;  3AHW A;  3SOY A;  1VQL 3;  1RGE A;  1RRH A;  1YIJ 3;  3NBB A;  2Q07 A;  2SBL A;  1KWI A;  1QAF A;  3PXM A;  3WOD G;  3BLZ A;  4G1M B;  1IQY A;  5STD A;  1L5G B;  2OCT A;  3UB1 A;  3K0Z A;  2WOH A;  3MYT A;  5D82 A;  5BU4 A;  3CCE 3;  2XGL A;  1BNR A;  4GHO A;  2WGQ A;  5IEP A;  3LZA A;  2K0M A;  1N5P A;  4KZ1 A;  3QRD A;  1PU4 A;  3CPW 2;  2ZHX B;  1AR0 A;  1B21 A;  5IW9 A;  1IQX A;  3S29 A;  3KKG A;  1X1U A;  5IEN A;  1UUW B;  4KFD A;  1VQK 3;  1EG9 B;  2CX0 A;  3UL5 A;  1UUV B;  1ZGX A;  1GSP A;  3F9S A;  3WHO A;  1TRQ A;  1LNH A;  1RMS A;  5CF2 A;  1YGE A;  1W01 A;  1IT7 A;  1JN5 B;  1OHP A;  1RGH A;  1I3F A;  1SAR A;  3MHE A;  3Q2P A;  8RNT A;  2BMR B;  1BRK A;  1DYU A;  4N6L A;  3CCS 3;  1QVF 2;  3CC4 3;  1UCJ A;  1US1 A;  4N3V A;  3WMD A;  1RGF A;  2KXG A;  2ZDJ A;  3V98 A;  2RBI A;  1BRJ A;  1OGX A;  4LEH A;  3N8B A;  3FSD A;  2CX1 A;  1VQN 3;  1MWU A;  1WMO A;  2CWT A;  1JKG B;  2BNG A;  1N8Q A;  4KFF A;  4FR9 A;  3RGA A;  3NQZ A;  4J5G A;  1TUH A;  1T2I A;  1I2G A;  3DGN A;  5LC7 A;  1RSN A;  1STF I;  3LXU X;  3EN1 B;  4CDL A;  4RNY A;  2RCD A;  3CNM A;  2OOV A;  3G16 A;  4QWT A;  5IF6 A;  1HU9 A;  1FGR A;  2H0I A;  3X3Z A;  1RHL A;  3UNL A;  1R4Y A;  2B1X B;  3HI7 A;  2W9P A;  4HAA A;  1FGT A;  3UJM A;  4HOH A;  1OHS A;  1E3V A;  1SII A;  2CFL A;  4LGQ A;  4WFO A;  5IG0 A;  1O7P B;  4O2H A;  3BNB A;  1JV2 B;  3GSP A;  4BL2 A;  2R41 A;  1FUW A;  4EBG A;  4BTW A;  1M1X B;  4K61 A;  3EN8 A;  1QMA A;  3KE7 A;  1W4N A;  4HM2 B;  1JNQ A;  1TIJ A;  1UDI I;  1GS3 A;  2HML B;  1IT8 A;  3GWR A;  1X1X A;  4H61 A;  1PFP A;  1VQO 3;  6GSP A;  4XBY A;  1K28 A;  4GB5 A;  4N6V 0;  1I0V A;  3M8C A;  5KP4 A;  3EBY A;  1IYY A;  2OTL 3;  5AEW B;  1D6Y A;  2A15 A;  3PGB A;  1UGH I;  4TX4 A;  1VQ5 3;  1MWR A;  2WGO A;  3X3X A;  4RNZ A;  1FGQ A;  1M1K 4;  1C54 A;  1V57 A;  1S5A A;  3E99 A;  1QJG A;  4HYZ A;  4XDW A;  3SED A;  3AHS A;  1BGS A;  2RSX A;  3GAX A;  1RCK A;  5CLK A;  3RNT A;  4XM4 A;  2C11 A;  2K54 A;  1FW7 A;  1LOV A;  1BRG A;  5CF1 A;  3IMA B;  1A67 A;  1BRI A;  2F4Y A;  4FMA A;  2XF3 A;  4XDV A;  5DRE A;  1SQW A;  1GMP A;  2W6J H;  1BNJ A;  3CC7 3;  2MC8 A;  3B7C A;  1JZO A;  3Q90 A;  1K41 A;  1BRN L;  3KN4 A;  4OVM A;  2B24 B;  3CMA 3;  4FCJ A;  4PEJ A;  1DVC A;  1ZO2 A;  4IT7 A;  2IYJ A;  5AYS C;  3OX9 A;  1CYU A;  4MMX B;  5BXQ A;  5HGR A;  3G71 3;  1VQ8 3;  5CXO A;  5BIR A;  1BSE A;  2CH9 A;  3NM7 A;  1BNF A;  3G0K A;  2OQE A;  3S27 A;  4BTX A;  2LYX A;  4EV2 A;  1IV9 A;  1Q9E A;  1JRQ A;  4STD A;  1ULI B;  3IPT A;  5M19 A;  1FZU A;  1GY7 A;  1B2S A;  1F8N A;  1UCK A;  2P0M A;  1BNG A;  1GMQ A;  3KFQ C;  5IG4 A;  1VQ4 3;  3T0U A;  1DE3 A;  1RGK A;  3EC9 A;  2M7O A;  2YFL B;  3HOH A;  4K90 B;  4XBT A;  4CCV A;  1W2Z A;  1YJN 3;  1QVG 2;  1G96 A;  3B4O A;  1ZS7 A;  3PCS A;  5EEO A;  2QEX 3;  5I97 A;  3WOE B;  1NB3 I;  3DGY A;  4HM5 B;  3U1W A;  2XR8 B;  1R4C A;  3DXO A;  5ELU A;  3S5C A;  1U8C B;  5D81 A;  2CG1 A;  2CK3 H;  4ORL A;  5IG3 A;  2KCD A;  1AY7 A;  4HVN A;  1IU7 A;  1MOL A;  2IA7 A;  4XB5 A;  1NWW A;  5G1K A;  6RNT A;  1LNI A;  1BRS A;  1DET A;  1WQL B;  4GSP A;  4ZM8 A;  4I5Q A;  2IY2 A;  2KF6 A;  1OAC A;  1RNT A;  2PNC A;  3HX8 A;  5GSP A;  5JBS A;  7STD A;  1Q40 B;  7GSP A;  1UGI A;  1T3B A;  2XGN A;  1A2V A;  1AVL A;  2RFR A;  5AII A;  3I0Y A;  1RN1 A;  1OHO A;  2BU4 A;  2F86 B;  1WTH A;  2YX9 A;  4DKI A;  3WR2 A;  3FG4 A;  1ROV A;  4HM4 B;  4OUQ A;  1T2H A;  2BMQ B;  3LML A;  1V58 A;  3DUK A;  2CWV A;  3GZB A;  3LTB A;  4OK0 A;  3V92 A;  1W6C A;  1FUT A;  3ROB A;  3SOA A;  1OPY A;  3PZW A;  3GZX B;  3LTA A;  1ULJ B;  1W5Z A;  3OWU A;  1I70 A;  3H3H A;  1VQ7 3;  4NHF A;  1O7H B;  3X41 A;  4BU4 A;  3T8N A;  3OV4 A;  1TJD A;  4Q53 A;  4HZ9 B;  1JJ2 2;  1PY3 A;  5G1L A;  4JRF A;  3NQY A;  3CCV 3;  3F7S A;  2ML6 A;  1QAK A;  3KZT A;  2ML5 A;  1BSD A;  1RLS A;  1YVS A;  1O7G B;  3SLU A;  4R80 A;  1O7W B;  3WOF B;  3F7X A;  1TFO A;  1MGR A;  4HM1 B;  4KT3 B;  1BUQ A;  1KC8 4;  1BAN A;  5HOH A;  1CYV A;  2F99 A;  3WA3 A;  4IPB A;  4LYL B;  1BOX A;  3EX9 A;  3EB8 A;  1N8R 4;  1DMN A;  3DGO A;  3D9R A;  4KVH A;  4U13 A;  3MSO A;  3RDE A;  3NV0 A;  1K8A 4;  2W04 A;  2BMO B;  1Q7Y 4;  4LZI A;  3VF1 A;  1A2K A;  3K7C A;  1AV4 A;  1Q82 4;  1D6Z A;  2CKF B;  4MJD A;  1RCL A;  1W6G A;  2E2V A;  2QGU A;  2GBX B;  2KF4 A;  4WYK A;  1VQM 3;  3MKI A;  2OQE C;  3S28 A;  1I2F A;  2FXT A;  2GEX A;  3KCH A;  7RNT A;  4R1K A;  1M90 4;  3FGY A;  3JUO A;  4N6T A;  2XH9 A;  3VSY A;  3MWZ A;  4FMB A;  4HZB B;  1HYF A;  2O9U X;  2OWP A;  3X40 A;  2IMJ A;  5IER A;  1BNI A;  4RZM A;  1VQ9 3;  3VGN A;  1E97 A;  1W6Y A;  3ZG0 A;  1I0X A;  3OW2 2;  4BIR A;  1CQS A;  3JUP A;  1FA3 A;  3JUN A;  4HM3 B;  2WOF A;  1AVK A;  1E3R A;  2HMN B;  2HMJ B;  2W0Q A;  2R4I A;  3STD A;  1B2Z A;  2Z77 A;  3F14 A;  1RGC A;  3EQQ B;  2GSP A;  2STD A;  1T5Y A;  1I2E A;  2IUK A;  3CD6 3;  2Z7A A;  1RTU A;  2WO0 A;  2CFD A;  1W2B 2;  5BVB A;  3WDG B;  2KF3 A;  3K63 A;  4RNT A;  3I55 3;  1PYL A;  2CHC A;  5A0O B;  5G2G A;  4O8S A;  4NRE A;  4R9L A;  1I8V A;  3X42 A;  4HJL B;  5AI1 A;  4H3U A;  5EQL A;  1UI7 A;  5DRV A;  3BU4 A;  1BU4 A;  1K73 4;  3N9H A;  1UW1 A;  3IJE B;  2RGQ A;  5M18 A;  3D4A A;  1RJO A;  4FMC A;  3CCQ 3;  1D6U A;  1Z1S A;  1YIT 3;  1IVV A;  1NU3 A;  1JB4 A;  1BSB A;  3FH1 A;  1MWS A;  1GOY A;  1TTO A;  2JQ5 A;  1JB5 A;  2W56 A;  4R4K A;  5AIH A;  2AAD A;  3JUM A;  1I3I A;  2F5M A;  2BO9 B;  4KFE A;  3CCR 3;  1HZ1 A;  1O7M B;  2GU1 A;  1NB5 I;  1UUG B;  2L4V A;  3BNE A;  5D83 A;  1S72 3;  1YNV X;  3SVA A;  2J8X B;  3T8U A;  5AIG A;  1JBR A;  2FGT A;  3JVC A;  3URP A;  3LOY A;  1BUJ A;  1MGW A;  5M1A A;  1JB2 A;  1RN7 A;  3PS8 A;  4CJN A;  1U5O A;  2YFI B;  2GBW B;  4K1U A;  1A90 A;  1FUS A;  2GU3 A;  2GEY A;  1KSI A;  1K9M 4;  2PZV A;  5LC6 A;  2L1S A;  4MEI A;  3MG2 A;  2KF5 A;  1WMP A;  4N6U A;  2CWU A;  2CG0 A;  2HOH A;  1BRH A;  1M9G A;  2HMK B;  2XFS A;  3FLJ A;  3RGR A;  4EV5 A;  1KQS 2;  2QIY A;  4IIA A;  4HM6 B;  3H51 A;  1BSA A;  2KAA A;  3AMO A;  4BTY A;  3LTD A;  3Q3F A;  2AAE A;  3B8L A;  1B20 A;  4N6O B;  1X1W A;  3U97 A;  2Y73 A;  1Q81 4;  2BIR A;  1TP6 A;  1GYB A;  1LOW A;  2D1W A;  3GZR A;  4O02 B;  1V74 A;  1G0T A;  1BAO A;  2CIU A;  4J8T A;  1Q42 A;  1ZX2 A;  4J5K A;  4L8O A;  3CCU 3;  3Q1C A;  4ILF A;  5CK6 A;  3ZG5 A;  3CU3 A;  3MPH A;  1N5H A;  1X1Y A;  3ZFZ A;  4HM7 B;  4JF8 A;  3DGL A;  1LXE A;  3SX1 A;  3A76 A;  3EHC A;  3SXX A;  3O8Y A;  4FMD A;  3KSP A;  1OF5 A;  3NUV A;  1ISK A;  2H0H A;  2W03 A;  1SIH A;  1OH0 A;  4HM0 B;  2HMO B;  3KSE D;  3NV0 B;  4L7K A;  5KP3 A;  1EQK A;  4WHA A;  1B2M A;  2H0G A;  4FCZ A;  1LQM B;  1RKY A;  4X2H A;  3NX0 A;  3ER7 A;  2XFT A;  1UCI A;  1NJI 4;  3B4P A;  2QA4 3;  4WYK B;  1IV7 A;  1IDP A;  2I9W A;  5TGN A;  3EBT A;  1FGO A;  1LRA A;  1MNL A;  1NDO B;  4HM8 B;  3A5E A;  1WMN A;  1O7N B;  1RRL A;  1G02 A;  1YHQ 3;  5AIF A;  2P0X A;  1MWT A;  2F56 A;  1EKM A;  4BL3 A;  3CCM 3;  4FCM A;  3CME 3;  1RGA A;  2FNQ A;  2Z76 A;  1OCV A;  3GZY B;  1GOV A;  3F40 A;  5FGO A;  1B3S A;  2XEP A;  3TDG A;  3I56 3;  3G6E 3;  1QAL A;  4LMI A;  4MMY B;  3DY5 A;  3V99 A;  3G4S 3;  2V1L A;  4K1V A;  1DVD A;  2P05 A;  2ZA4 A;  5ELJ A;  2O3O A;  1LOY A;  2LQV A;  4I4K A;  5JPP A;  1YJW 3;  1Q40 A;  1NO3 A;  3GRD A;  2UGI A;  3FZW A;  2F98 A;  1YGW A;  3NHX A;  3NM2 A;  1UCL A;  3K9M C;  3D5I A;  4R9K A;  3DMC A;  1OUN A;  1BSC A;  2E2U A;  1SJW A;  4EC6 A;  1RN4 A;  3DGM A;  1JN5 A;  1N9J A;  2P09 A;  1GY6 A;  3FG1 A;  1BNE A;  1EA2 A;  3DZL A;  3FG3 A;  2P38 A;  1JZD A;  2BT3 A;  2C10 A;  3J7Y d;  3L0R A;  2XRX B;  3OWY A;  1SPU A;  5AEU B;  1RDS A;  2D42 A;  2CC3 A;  2YFJ B;  5JPU A;  2CFK A;  3EJV A;  4WP5 A;  1GOU A;  1Y4K A;  3LT9 A;  5FW5 A;  3CCL 3;  1EEJ A;  2C4B A;  1GD4 A;  1W7C A;  1JKG A;  3D3L A;  3DH2 A;  3FF0 A;  3HK4 A;  3KII A;  5EVH A;  2W56 B;  3CNX A;  1JBS A;  1VQQ A;  1AQZ A;  3ECF A;  2KRT A;  3EF8 A;  4AKZ A;  4EW5 A;  1YVB I;  1IK3 A;  3HII A;  1GY5 A;  2INX A;  2Y74 A;  5IEO A;  1VZZ A;  1DMQ A;  4NPB A;  1LQG C;  3OWS A;  8CHO A;  1TU5 A;  3N54 B;  3PCR A;  3D79 A;  3MG1 A;  2RNT A;  1RGG A;  1J2B A;  4XBX A;  5KP1 A;  1BVI A;  1GMR A;  1CH0 A;  1YJ9 3;  4HBR A;  1UI8 A;  4N6N B;  5RNT A;  2W9Q A;  3JUQ A;  2UX0 A;  4LSO A;  1JBT A;  1IVW A;  1BIR A;  1TFK A;  4N6M A;  1IVX A;  4RBN A;  6STD A;  3S67 A;  3LH4 A;  1DMM A;  3NBR A;  5AYR B;  4WWU C;  2F5W A;  2GXF A;  1NNV A;  4AKY A;  1LVN A;  1B27 A;  1GD3 A;  3SYU A;  2XSO B;  1ASK A;  2BHM A;  1Q86 4;  1FYS A;  5IG5 A;  1VQ6 3;  4CPK A;  3QK9 A;  1RNB A;  2K3D A;  3CPO A;  3UL6 A;  2JDI H;  3AMO B;  2CFW A;  2E2T A;  1LOX A;  3LTC A;  4AEQ A;  1OGZ A;  3LYG A;  1B2U A;  3CCJ 3;  1Q7H A;  2SAR A;  1HKX A;  3BIR A;  3ALA A;  4EYC A;  4L8P A;  1IQ8 A;  3NBJ A;  2UUG C;  1BNS A;  1C7H A;  1FGM A;  2ZL8 A;  3K5T A;  1B2X A;  3NXJ A;  3BND A;  3CC2 3;  1ROA A;  1N9E A;  1EUI C;  1IVU A;  2CW9 A;  1W00 A;  1TRP A;  2W2C A;  3BB9 A;  3FCS B;  3D5G A;  3HZP A;  3BNC A;  4MMZ B;  3OXA A;  1KD1 4;  1OF5 B;  1W02 A;  2XSH B;  9RNT A;  1A2P A;  1CEW I;  3PYJ A;  4X2O A;  3EE1 A;  3MG3 A;  3FKA A;  3AGN A;  2MF7 A;  4EXR A;  2Z6B A; 
#chains in the Genus database with same CATH homology
 2IUJ A;  1YI2 3;  3G8Z A;  2CFG A;  1STD A;  4GL6 A;  2OTJ 3;  3F8H A;  1WNH A;  2HMM B;  4O3V A;  3X3Y A;  4J9A A;  3WA2 X;  4HKV B;  3HIG A;  3FF2 A;  3LT8 A;  3CXC 2;  1VQP 3;  3DM8 A;  3F8X A;  2OOV C;  3SOY A;  1VQL 3;  1RRH A;  1YIJ 3;  3NBB A;  2Q07 A;  2SBL A;  1KWI A;  1QAF A;  3PXM A;  3WOD G;  3BLZ A;  4G1M B;  1IQY A;  5STD A;  1L5G B;  2OCT A;  3UB1 A;  3K0Z A;  2WOH A;  5D82 A;  3CCE 3;  2XGL A;  5IEP A;  2WGQ A;  3LZA A;  2K0M A;  1N5P A;  4KZ1 A;  3QRD A;  1PU4 A;  3CPW 2;  1AR0 A;  5IW9 A;  1IQX A;  3S29 A;  3KKG A;  5IEN A;  1UUW B;  4KFD A;  1VQK 3;  1EG9 B;  3UL5 A;  1UUV B;  3F9S A;  1LNH A;  1YGE A;  1W01 A;  1IT7 A;  1JN5 B;  1OHP A;  3MHE A;  3Q2P A;  2BMR B;  1DYU A;  4N6L A;  3CCS 3;  1QVF 2;  3CC4 3;  1US1 A;  4N3V A;  3WMD A;  2ZDJ A;  2KXG A;  3V98 A;  1OGX A;  4LEH A;  3N8B A;  3FSD A;  1VQN 3;  1WMO A;  2CWT A;  1JKG B;  2BNG A;  1N8Q A;  4KFF A;  4FR9 A;  3RGA A;  3NQZ A;  1TUH A;  3DGN A;  5LC7 A;  1STF I;  3LXU X;  3EN1 B;  4CDL A;  4RNY A;  2RCD A;  3CNM A;  2OOV A;  3G16 A;  4QWT A;  5IF6 A;  1HU9 A;  1FGR A;  3X3Z A;  3UNL A;  2B1X B;  3HI7 A;  2W9P A;  1FGT A;  3UJM A;  1OHS A;  1E3V A;  1SII A;  2CFL A;  4LGQ A;  4WFO A;  5IG0 A;  1O7P B;  4O2H A;  3BNB A;  1JV2 B;  1FUW A;  4EBG A;  4BTW A;  1M1X B;  4K61 A;  3EN8 A;  1QMA A;  3KE7 A;  1W4N A;  4HM2 B;  1JNQ A;  1TIJ A;  1GS3 A;  2HML B;  1IT8 A;  3GWR A;  4H61 A;  1PFP A;  1VQO 3;  4XBY A;  1K28 A;  4GB5 A;  4N6V 0;  3M8C A;  5KP4 A;  3EBY A;  2OTL 3;  5AEW B;  1D6Y A;  2A15 A;  3PGB A;  4TX4 A;  1VQ5 3;  2WGO A;  3X3X A;  4RNZ A;  1FGQ A;  1M1K 4;  1S5A A;  3E99 A;  1QJG A;  4HYZ A;  4XDW A;  3SED A;  2RSX A;  3GAX A;  5CLK A;  4XM4 A;  2C11 A;  2K54 A;  5CF1 A;  3IMA B;  1A67 A;  4FMA A;  2XF3 A;  4XDV A;  5DRE A;  1SQW A;  2W6J H;  2MC8 A;  3B7C A;  3Q90 A;  1K41 A;  3KN4 A;  4OVM A;  2B24 B;  3CMA 3;  4FCJ A;  4PEJ A;  1DVC A;  1ZO2 A;  4IT7 A;  5AYS C;  1CYU A;  3OX9 A;  4MMX B;  5BXQ A;  5HGR A;  3G71 3;  1VQ8 3;  5CXO A;  2CH9 A;  3NM7 A;  3S27 A;  3G0K A;  2OQE A;  4BTX A;  2LYX A;  4EV2 A;  1IV9 A;  1JRQ A;  4STD A;  1ULI B;  3IPT A;  1GY7 A;  2P0M A;  1F8N A;  5IG4 A;  3KFQ C;  1VQ4 3;  3T0U A;  3EC9 A;  2M7O A;  2YFL B;  4K90 B;  4XBT A;  4CCV A;  1W2Z A;  1YJN 3;  1QVG 2;  1G96 A;  3B4O A;  5EEO A;  3PCS A;  2QEX 3;  5I97 A;  3WOE B;  1NB3 I;  4HM5 B;  3U1W A;  2XR8 B;  1R4C A;  3DXO A;  5ELU A;  3S5C A;  1U8C B;  5D81 A;  2CG1 A;  2CK3 H;  4ORL A;  2KCD A;  4HVN A;  1IU7 A;  1MOL A;  2IA7 A;  4XB5 A;  1NWW A;  1WQL B;  4ZM8 A;  2PNC A;  1OAC A;  5JBS A;  3HX8 A;  7STD A;  1Q40 B;  2XGN A;  1A2V A;  1AVL A;  2RFR A;  5AII A;  3I0Y A;  1OHO A;  2F86 B;  2YX9 A;  1WTH A;  5IG3 A;  3FG4 A;  1ROV A;  4HM4 B;  4OUQ A;  2BMQ B;  3LML A;  3GZB A;  3DUK A;  2CWV A;  3LTB A;  4OK0 A;  3V92 A;  1W6C A;  3ROB A;  3SOA A;  1OPY A;  3PZW A;  3GZX B;  3LTA A;  1ULJ B;  1W5Z A;  3OWU A;  3H3H A;  1VQ7 3;  4NHF A;  1O7H B;  3X41 A;  3T8N A;  3OV4 A;  4Q53 A;  4HZ9 B;  1JJ2 2;  4JRF A;  3NQY A;  3CCV 3;  3F7S A;  2ML6 A;  1QAK A;  3KZT A;  2ML5 A;  1O7G B;  3SLU A;  4R80 A;  1O7W B;  3WOF B;  3F7X A;  1TFO A;  4HM1 B;  1BUQ A;  1KC8 4;  1CYV A;  2F99 A;  3WA3 A;  4IPB A;  3EX9 A;  3EB8 A;  1N8R 4;  1DMN A;  3DGO A;  3D9R A;  4KVH A;  4U13 A;  3MSO A;  3RDE A;  3NV0 A;  1K8A 4;  2W04 A;  2BMO B;  1Q7Y 4;  4LZI A;  3VF1 A;  1A2K A;  3K7C A;  1AV4 A;  1Q82 4;  1D6Z A;  2CKF B;  4MJD A;  2E2V A;  1W6G A;  2QGU A;  4WYK A;  2GBX B;  1VQM 3;  3MKI A;  2OQE C;  3S28 A;  2FXT A;  2GEX A;  1M90 4;  4R1K A;  3FGY A;  3JUO A;  4N6T A;  2XH9 A;  3VSY A;  3MWZ A;  4FMB A;  4HZB B;  3X40 A;  2O9U X;  2OWP A;  5IER A;  2IMJ A;  4RZM A;  1VQ9 3;  3VGN A;  1E97 A;  1W6Y A;  3OW2 2;  1CQS A;  3JUP A;  1FA3 A;  3JUN A;  4HM3 B;  2WOF A;  1AVK A;  1E3R A;  2HMN B;  2HMJ B;  2W0Q A;  2R4I A;  3STD A;  2Z77 A;  3F14 A;  3EQQ B;  2STD A;  1T5Y A;  2IUK A;  3CD6 3;  2Z7A A;  1W2B 2;  2WO0 A;  2CFD A;  5BVB A;  3WDG B;  3K63 A;  3I55 3;  5A0O B;  2CHC A;  5G2G A;  4O8S A;  4NRE A;  4R9L A;  3X42 A;  4HJL B;  5AI1 A;  4H3U A;  5EQL A;  1UI7 A;  5DRV A;  1K73 4;  3N9H A;  1UW1 A;  3IJE B;  2RGQ A;  4FMC A;  1RJO A;  3CCQ 3;  1D6U A;  1Z1S A;  1YIT 3;  1IVV A;  1NU3 A;  1JB4 A;  3FH1 A;  2JQ5 A;  2W56 A;  1JB5 A;  4R4K A;  5AIH A;  3JUM A;  3CCR 3;  2BO9 B;  4KFE A;  1O7M B;  2GU1 A;  1NB5 I;  2L4V A;  3BNE A;  5D83 A;  1S72 3;  3SVA A;  3T8U A;  5AIG A;  2FGT A;  3JVC A;  3LOY A;  1JB2 A;  1RN7 A;  3PS8 A;  1U5O A;  2YFI B;  2GBW B;  4K1U A;  1A90 A;  2GU3 A;  2GEY A;  1KSI A;  1K9M 4;  2PZV A;  5LC6 A;  4MEI A;  3MG2 A;  1WMP A;  4N6U A;  2CWU A;  2CG0 A;  2XFS A;  1M9G A;  2HMK B;  3RGR A;  3FLJ A;  4EV5 A;  1KQS 2;  2QIY A;  4IIA A;  4HM6 B;  3H51 A;  3AMO A;  4BTY A;  3LTD A;  3B8L A;  4N6O B;  3U97 A;  1Q81 4;  2Y73 A;  1TP6 A;  1GYB A;  2D1W A;  3GZR A;  4O02 B;  1V74 A;  2CIU A;  4J8T A;  1Q42 A;  1ZX2 A;  4L8O A;  3CCU 3;  3Q1C A;  5CK6 A;  3CU3 A;  3MPH A;  1N5H A;  4HM7 B;  4JF8 A;  3DGL A;  1LXE A;  3SX1 A;  3A76 A;  3EHC A;  3SXX A;  3O8Y A;  4FMD A;  3KSP A;  1OF5 A;  3NUV A;  1ISK A;  2W03 A;  1SIH A;  1OH0 A;  4HM0 B;  2HMO B;  3KSE D;  3NV0 B;  4L7K A;  5KP3 A;  1EQK A;  4WHA A;  4FCZ A;  1RKY A;  4X2H A;  3NX0 A;  3ER7 A;  2XFT A;  1NJI 4;  3B4P A;  2QA4 3;  4WYK B;  1IV7 A;  1IDP A;  2I9W A;  5TGN A;  3EBT A;  1FGO A;  1MNL A;  1NDO B;  4HM8 B;  1WMN A;  1O7N B;  1RRL A;  1YHQ 3;  5AIF A;  2P0X A;  3CCM 3;  1EKM A;  4FCM A;  3CME 3;  2FNQ A;  2Z76 A;  1OCV A;  3GZY B;  3F40 A;  5FGO A;  2XEP A;  3TDG A;  3I56 3;  3G6E 3;  1QAL A;  4LMI A;  4MMY B;  3DY5 A;  3V99 A;  3G4S 3;  2V1L A;  4K1V A;  1DVD A;  2P05 A;  5ELJ A;  2O3O A;  4I4K A;  2LQV A;  5JPP A;  1YJW 3;  1Q40 A;  1NO3 A;  3GRD A;  3FZW A;  2F98 A;  3NM2 A;  3NHX A;  3K9M C;  4R9K A;  3DMC A;  1OUN A;  2E2U A;  1SJW A;  4EC6 A;  3DGM A;  1JN5 A;  1N9J A;  2P09 A;  1GY6 A;  3FG1 A;  1EA2 A;  3DZL A;  3FG3 A;  2P38 A;  2BT3 A;  2C10 A;  3J7Y d;  3L0R A;  2XRX B;  3OWY A;  1SPU A;  5AEU B;  2D42 A;  2CC3 A;  2YFJ B;  5JPU A;  2CFK A;  3EJV A;  4WP5 A;  5FW5 A;  1Y4K A;  3LT9 A;  3CCL 3;  1GD4 A;  1W7C A;  1JKG A;  3D3L A;  3FF0 A;  3HK4 A;  3KII A;  5EVH A;  2W56 B;  3CNX A;  3ECF A;  2KRT A;  3EF8 A;  4AKZ A;  1YVB I;  1IK3 A;  3HII A;  1GY5 A;  2INX A;  2Y74 A;  5IEO A;  1VZZ A;  1DMQ A;  3OWS A;  8CHO A;  1TU5 A;  3N54 B;  3PCR A;  3MG1 A;  1J2B A;  4XBX A;  5KP1 A;  1YJ9 3;  4HBR A;  1UI8 A;  4N6N B;  2W9Q A;  3JUQ A;  2UX0 A;  4LSO A;  1IVW A;  1TFK A;  4N6M A;  1IVX A;  4RBN A;  6STD A;  3S67 A;  3LH4 A;  1DMM A;  3NBR A;  5AYR B;  4WWU C;  2GXF A;  4AKY A;  1LVN A;  1GD3 A;  2XSO B;  1ASK A;  2BHM A;  1Q86 4;  5IG5 A;  1VQ6 3;  3QK9 A;  3CPO A;  3UL6 A;  2JDI H;  3AMO B;  2CFW A;  2E2T A;  1LOX A;  3LTC A;  4AEQ A;  1OGZ A;  3LYG A;  3CCJ 3;  1HKX A;  3ALA A;  4EYC A;  4L8P A;  1IQ8 A;  3NBJ A;  1C7H A;  1FGM A;  2ZL8 A;  3K5T A;  3NXJ A;  3BND A;  3CC2 3;  1ROA A;  1N9E A;  2W2C A;  1IVU A;  2CW9 A;  1W00 A;  3BB9 A;  3FCS B;  3HZP A;  3MYT A;  5CF2 A;  3CC7 3;  3BNC A;  4MMZ B;  3OXA A;  1KD1 4;  1OF5 B;  1W02 A;  2XSH B;  1CEW I;  3PYJ A;  4X2O A;  3EE1 A;  3MG3 A;  3FKA A;  4EXR A;  2MF7 A;  2Z6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...