1W2B2

Trigger factor ribosome binding domain in complex with 50s
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
total genus 12
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1w2b200
1YJN3 1KD14 3CCL3 1VQK3 3CCV3 3CCM3 1VQ73 3CC73 1N8R4 1KC84 1VQO3 1VQ43 1VQN3 3CC23 1VQ83 1VQL3 3G4S3 3CXC2 1YIT3 1YHQ3 3CME3 1VQ93 1M1K4 2QEX3 2OTL3 1M904 1YJW3 1Q824 3CPW2 1QVG2 1K8A4 3CCU3 3I553 1KQS2 3CCE3 3CCR3 1S723 1K734 1QVF2 2OTJ3 3CC43 1YI23 1W2B2 3I563 3G6E3 1Q814 3CMA3 1YIJ3 3CCJ3 1Q7Y4 2QA43 3OW22 1JJ22 3CCS3 1VQP3 1VQ53 3CD63 1K9M4 1VQ63 1Q864 3G713 3CCQ3 1YJ93 1NJI4 1VQM3
chains in the Genus database with same CATH superfamily
3K5TA 3MKIA 5IF6A 4HKVB 1ZGXA 4N6LA 1T3BA 1E3RA 4FCZA 2HMJB 4XDVA 1FGRA 3HX8A 1JN5A 2L1SA 3NV0B 4K61A 1Q7HA 1RGAA 3X3XA 1A67A 1QJGA 6RNTA 2HMKB 1JBTA 1N5HA 4KFEA 2H0GA 1LNIA 2R4IA 2INXA 2CWVA 3DMCA 5RNTA 1SARA 3FG4A 4L8PA 1JKGA 2IY2A 3GSPA 3N8BA 1JBSA 1RGGA 3QRDA 1VQQA 4OVMA 3KE7A 1YGWA 3MG1A 3OWUA 3Q90A 4MEIA 5HOHA 2STDA 1WMOA 1O7WB 1RN4A 3URPA 5IG3A 3MG3A 1WMNA 1MWSA 3GZRA 1ZO2A 2XRXB 3DGMA 2KF6A 5TGNA 1IT8A 3AHWA 3CC73 3CCV3 2OOVA 4HM5B 2K0MA 5M18A 1EUIC 3LMLA 2GEYA 2OWPA 5BIRA 1NO3A 1SPUA 4HJLB 3FCSB 2BNGA 4GB5A 1IU7A 2OTL3 1IV7A 4N6TA 1IVUA 1K8A4 3NXJA 3GAXA 1OGXA 3JUMA 1BANA 4BTWA 5A0OB 1B2ZA 1BIRA 1VQ53 3HK4A 2FNQA 1T2IA 2XSHB 1K9M4 1YNVX 2SBLA 4AKYA 3LH4A 4LEHA 3FKAA 3SLUA 1B20A 1GMQA 1QALA 4IT7A 5LC7A 1TUHA 3WOFB 3AMOA 1DE3A 2P38A 1ROVA 1BVIA 3PZWA 3WODG 1AVLA 4AKZA 2W04A 3SOYA 2YFJB 4CDLA 3EN1B 1N8QA 1MNLA 1OHSA 2F56A 3V99A 3JVCA 2HMOB 2XF3A 1I2FA 4HOHA 1QVG2 4HM4B 1ZS7A 1N5PA 1BNRA 3PYJA 3CCE3 1W2ZA 2CFDA 1I70A 1KSIA 3PCSA 3EC9A 4EV2A 2XGNA 3CCJ3 4HM3B 1EQKA 3JUQA 2OQEA 3DUKA 4RZMA 3NBBA 3B7CA 1UI8A 4ZM8A 3GZBA 1VQ93 1M1XB 1MOLA 3EF8A 1KD14 2YFLB 5G2GA 2ML5A 4IIAA 4HM2B 1A2KA 3D79A 3EHCA 3ECFA 2ML6A 5JBSA 3GRDA 3KKGA 3EE1A 4LSOA 2BT3A 3PGBA 3NV0A 3B4OA 4IPBA 1UW1A 2ZHXB 1PYLA 5D83A 1RNTA 3K0ZA 2A15A 1M1K4 1TFKA 3IPTA 1M904 1O7NB 2SARA 1LXEA 1YVSA 4CJNA 1TFOA 2JQ5A 3EN8A 3I563 1W00A 3G6E3 1LQMB 3CMA3 1B2UA 2E2VA 2QA43 1YGEA 1A90A 1HZ1A 4G1MB 3CD63 6GSPA 2BO9B 2BMRB 5DRVA 5IEOA 1US1A 3DGLA 1GSPA 2Z7AA 3BB9A 3CNMA 7RNTA 1VQ83 3NM2A 1MWTA 1OH0A 2MF7A 1CYVA 2XGLA 3O8YA 5CK6A 3ZFZA 1OUNA 3OX9A 3KIIA 1W6GA 3WA3A 3J7Yd 2F99A 3AGOA 1I2EA 1GY7A 2IUKA 1BUJA 5CF1A 1RN1A 2KAAA 1GS3A 2CWTA 3QK9A 3RNTA 1VQL3 4J5KA 2CX1A 1RCLA 1A2VA 1SQWA 2YX9A 4EXRA 1FA3A 5JPPA 3H51A 2B24B 2W03A 1C7HA 1QMAA 3N54B 1U5OA 3D5IA 2O9UX 1LOXA 1BOXA 2P0MA 1RTUA 5JPUA 1UUVB 2KF3A 4H61A 2K54A 4LMIA 3X42A 3FGYA 1UGIA 1UI7A 2O3OA 1TP6A 1VQM3 4EC6A 5IERA 2CFKA 4CCVA 4TX4A 2GU3A 3MHEA 3F14A 4R1KA 1AVKA 1HKXA 3D3LA 1BNSA 3LTBA 3DM8A 4L7KA 1VQ43 4O2HA 1SIIA 2W0QA 2ZA4A 5G1LA 5DREA 1R4CA 4I4KA 2C4BA 1OGZA 2Z6BA 3KN4A 1ULIB 3X41A 3NM7A 3LT9A 5BVBA 2XFSA 4WYKB 5IEPA 3CPW2 1RGCA 1BNEA 4HZ9B 2Y73A 3WR2A 2IYJA 3HZPA 1RJOA 4XB5A 1I2GA 1IT7A 2CH9A 1N9EA 3B4PA 1ROAA 3GZXB 1Q9EA 1RGLA 2CK3H 3CCQ3 3UL6A 4HVNA 1BUQA 1WQLB 2OOVC 3MWZA 3VSYA 5BU4A 1R4YA 3IMAB 1X1UA 2CKFB 3F7XA 3S29A 4HM7B 5IW9A 1MGWA 3NBJA 1LVNA 1FUTA 2K3DA 4FCJA 4FCMA 1G0TA 5EVHA 5HGRA 1L5GB 3UB1A 1DVCA 1KC84 3KSED 1LRAA 2GBWB 2F4YA 1EA2A 1SJWA 3NBRA 4ILFA 3G4S3 4WP5A 2FGTA 5AIGA 4XBTA 4FMAA 3K9MC 3BNBA 4MMZB 1Q824 2H0HA 4J5GA 3I553 3D9RA 2WGQA 1FGTA 1STFI 3GZYB 2BMOB 1WTHA 1JNQA 5IG5A 3HI7A 3V92A 1FGQA 3DXOA 3Q3FA 4BIRA 2CHCA 4BU4A 2P0XA 1B2MA 2XSOB 3H3HA 1UCLA 1OCVA 2HOHA 2RFRA 1FGOA 2CG1A 2F5WA 5KP4A 3IJEB 4R9KA 3BIRA 1RGEA 3OXAA 1BRIA 2XR8B 4STDA 1V74A 3SVAA 3VGNA 1V58A 3EBYA 2IMJA 1I3FA 8CHOA 2Z77A 2KF4A 3CC23 1UUGB 5IG0A 1IV9A 1S5AA 1BNFA 1BRKA 1GD4A 2CFGA 1UCKA 4N6MA 2W9QA 3CXC2 1RSNA 3F8XA 1FW7A 4U13A 3G8ZA 1RGFA 3DH2A 4N6UA 1IVVA 5FGOA 3UNLA 4EYCA 3F9SA 3N9HA 1OF5B 1GOYA 3FZWA 1UDII 4O3VA 1K734 4RNYA 1GY6A 2ZDJA 1B27A 4XBXA 1X1WA 1FUSA 2OQEC 1CYUA 1Q7Y4 4JRFA 1DMNA 2C11A 1MWUA 3DGNA 4LYLB 1BRJA 1BSBA 4K1VA 3LTCA 3LZAA 2PZVA 2QIYA 1G02A 1FZUA 3EQQB 5CF2A 3S27A 5AYRB 3NQZA 2R41A 1WNHA 2CX0A 1FYSA 5GSPA 3CME3 1JB4A 1B2XA 4I5QA 1W5ZA 3K7CA 3S5CA 1DMMA 2LQVA 4X2OA 3RGRA 3WHOA 1BRGA 1QAFA 4WYKA 3T8UA 2RCDA 1JBRA 4L8OA 1GY5A 1RDSA 4MMYB 1PY3A 5AIFA 1YI23 2HMMB 2ZL8A 4KFFA 3F8HA 3E99A 4KZ1A 3FF0A 4GHOA 4NREA 3Q2PA 1JB2A 1W4NA 3D4AA 2W56B 5STDA 1X1XA 1VQ63 3ZG5A 3WMDA 3I0YA 1YJ93 4BL2A 3FH1A 1VQO3 2JDIH 1GMRA 1RRLA 3OV4A 3WA2X 2GSPA 2BIRA 4J8TA 1BRHA 1ISKA 4WWUC 3F7SA 1WMPA 1K41A 2AADA 3K63A 1BRSA 3ALAA 4K1UA 3RDEA 3HIGA 3JUPA 3LT8A 4BL3A 2QEX3 5AIHA 3SX1A 2OCTA 1RGKA 1GOVA 4FMCA 3S28A 3T8NA 3CC43 3U1WA 1JB5A 4HYZA 1IYYA 1MGRA 3FF2A 3PXMA 1IQ8A 1B3SA 4H3UA 3RGAA 3S67A 3UL5A 1BNIA 2RGQA 3BNCA 1VQP3 1LOWA 3NUVA 4AEQA 5M19A 7GSPA 1PU4A 3PCRA 4HM0B 3AMOB 2XEPA 3EJVA 5EEOA 1T2HA 1CEWI 5CXOA 4R80A 1NB3I 2AAEA 3CPOA 4FR9A 1N8R4 6STDA 5FW5A 1B21A 4XM4A 3SOAA 5D82A 1FUWA 3HIIA 1B2SA 3G16A 3STDA 1BGSA 2GEXA 3OWYA 4HAAA 3M8CA 3MPHA 1Q42A 2CC3A 1DVDA 3WDGB 4N6V0 1RGHA 2GBXB 4N6OB 3V98A 1OF5A 1QVF2 3UJMA 3LXUX 3U97A 1Y4KA 5LC6A 5M1AA 1RCKA 4HM6B 2C10A 4QWTA 7STDA 2BMQB 2B1XB 1IQXA 1JZDA 4NHFA 1BU4A 4RNTA 1OACA 1NDOB 1N9JA 1OHOA 1RLSA 1GYBA 3LYGA 2CIUA 3CNXA 4KT3B 1F8NA 1BNJA 2W2CA 1VQN3 1PFPA 2YFIB 2MC8A 1RRHA 1QAKA 2WGOA 2LYXA 1W6CA 3F40A 3SEDA 1TJDA 1S723 1MWRA 3BNEA 2WOFA 1DYUA 1W01A 2WOHA 3A5EA 3L0RA 1JV2B 4R9LA 1CQSA 2KXGA 3VF1A 1ULJB 2E2UA 2BU4A 4N6NB 4BTXA 2KCDA 1O7HB 1Z1SA 2W56A 4BTYA 4JF8A 1D6ZA 1G96A 1TTOA 5IENA 1W7CA 3CCM3 4GSPA 4XDWA 1VZZA 1BSAA 8RNTA 1I0XA 3ZG0A 1TRPA 1E97A 2D1WA 4XBYA 1DMQA 1BRNL 5AI1A 5EQLA 1BSDA 1STDA 3GWRA 1LQGC 2CG0A 4O02B 3BU4A 1BSEA 3X3YA 5KP1A 5ELJA 4RBNA 3KFQC 1E3VA 2I9WA 1KQS2 3MG2A 1Q40B 2GXFA 2Y74A 4PEJA 1ASKA 4K90B 2RBIA 4X2HA 1IDPA 3ROBA 1W2B2 2BHMA 1LNHA 1T5YA 4N3VA 5BXQA 1D6UA 2RNTA 2UUGC 1NB5I 1D6YA 2HMLB 2KRTA 2P09A 4KVHA 1LOVA 4MMXB 3FLJA 1RKYA 3G713 2Z76A 3AGNA 4NPBA 4LZIA 2XFTA 3Q1CA 4HM1B 1VQ73 1JN5B 1FGMA 2CWUA 2CFWA 2UX0A 3EX9A 1BAOA 2D42A 3T0UA 4R4KA 2M7OA 3B8LA 1JKGB 3BNDA 1V57A 2H0IA 3LTAA 4CPKA 3DY5A 3LOYA 4EW5A 1ZX2A 3OWSA 2F5MA 2IA7A 4DKIA 2KF5A 2W6JH 3PS8A 3A76A 1K28A 1NWWA 3KZTA 3X3ZA 1Q864 1YVBI 1BNGA 4RNZA 1YJN3 5I97A 1IQYA 3CCL3 1KWIA 4EV5A 1VQK3 2UGIA 3CU3A 4J9AA 4GL6A 3EB8A 1U8CB 1O7MB 1OHPA 3SYUA 2PNCA 3MSOA 4MJDA 4WHAA 1I8VA 4Q53A 2E2TA 2RSXA 3G0KA 5G1KA 2QGUA 5CLKA 5AYSC 1SIHA 3EBTA 4OUQA 1I0VA 5ELUA 2IUJA 1IK3A 1JZOA 1YIT3 1O7GB 3FG1A 1GMPA 1AQZA 4OK0A 1C54A 2XH9A 3CCU3 1IVXA 4FMBA 1TU5A 1RNBA 2HMNB 9RNTA 1EEJA 2F86B 3TDGA 1HU9A 2GU1A 1AY7A 1JRQA 1TIJA 1Q814 1JJ22 3WOEB 1A2PA 1YIJ3 3NQYA 3D5GA 1OPYA 3CCS3 3KCHA 3JUOA 4FMDA 2FXTA 1CH0A 1W6YA 3FG3A 2CW9A 4ORLA 3DZLA 1RMSA 4KFDA 3AHSA 3HOHA 4LGQA 2J8XB 1AV4A 1DETA 4HM8B 3BLZA 1NJI4 1J2BA 1LOYA 3MYTA 2V1LA 3NHXA 1TRQA 3JUNA 1EKMA 5D81A 1W02A 1UUWB 4HBRA 1M9GA 5AIIA 1GOUA 5AEUB 3X40A 1YHQ3 3KSPA 2WO0A 4HZBB 4EBGA 2Q07A 1YJW3 1EG9B 1I3IA 3ER7A 3SXXA 1GD3A 1RHLA 1NNVA 1UCJA 3NX0A 1UGHI 1AR0A 4WFOA 3CCR3 2OTJ3 1O7PB 1Q40A 1UCIA 2W9PA 2P05A 3DGOA 1HYFA 1RN7A 2F98A 2CFLA 1BSCA 3OW22 1X1YA 4O8SA 5KP3A 5IG4A 3LTDA 1IVWA 3FSDA 5AEWB 1NU3A 3DGYA 2L4VA
chains in the Genus database with same CATH topology
3K5TA 3MKIA 5IF6A 4HKVB 4N6LA 1E3RA 4FCZA 2HMJB 4XDVA 1FGRA 3HX8A 1JN5A 3NV0B 4K61A 3X3XA 1A67A 1QJGA 2HMKB 1N5HA 4KFEA 2R4IA 2INXA 2CWVA 3DMCA 3FG4A 4L8PA 1JKGA 3N8BA 3QRDA 4OVMA 3KE7A 3OWUA 3MG1A 3Q90A 4MEIA 2STDA 1WMOA 1O7WB 5IG3A 3MG3A 1WMNA 3GZRA 1ZO2A 2XRXB 3DGMA 5TGNA 1IT8A 3CCV3 2OOVA 4HM5B 2K0MA 3LMLA 2GEYA 2OWPA 1NO3A 1SPUA 4HJLB 3FCSB 2BNGA 4GB5A 1IU7A 2OTL3 1IV7A 4N6TA 1IVUA 1K8A4 3NXJA 3GAXA 1OGXA 3JUMA 4BTWA 5A0OB 1VQ53 3HK4A 2FNQA 2XSHB 1K9M4 2SBLA 4AKYA 3LH4A 4LEHA 3FKAA 3SLUA 1QALA 4IT7A 5LC7A 1TUHA 3WOFB 3AMOA 2P38A 1ROVA 3PZWA 3WODG 1AVLA 4AKZA 2W04A 3SOYA 2YFJB 4CDLA 3EN1B 1N8QA 1MNLA 1OHSA 3V99A 3JVCA 2HMOB 2XF3A 1QVG2 4HM4B 1N5PA 3PYJA 3CCE3 1W2ZA 2CFDA 1KSIA 3PCSA 3EC9A 4EV2A 2XGNA 3CCJ3 4HM3B 1EQKA 3JUQA 2OQEA 3DUKA 4RZMA 3NBBA 3B7CA 1UI8A 4ZM8A 3GZBA 1VQ93 1M1XB 1MOLA 3EF8A 1KD14 2YFLB 5G2GA 2ML5A 4IIAA 4HM2B 1A2KA 3EHCA 3ECFA 2ML6A 5JBSA 3GRDA 3KKGA 3EE1A 4LSOA 2BT3A 3PGBA 3NV0A 3B4OA 4IPBA 1UW1A 5D83A 3K0ZA 2A15A 1M1K4 1TFKA 3IPTA 1M904 1O7NB 1LXEA 1TFOA 2JQ5A 3EN8A 3I563 1W00A 3G6E3 3CMA3 2E2VA 2QA43 1YGEA 1A90A 4G1MB 3CD63 2BO9B 2BMRB 5DRVA 5IEOA 1US1A 3DGLA 2Z7AA 3BB9A 3CNMA 1VQ83 3NM2A 1OH0A 2MF7A 1CYVA 2XGLA 3O8YA 5CK6A 1OUNA 3OX9A 3KIIA 1W6GA 3WA3A 3J7Yd 2F99A 1GY7A 2IUKA 5CF1A 1GS3A 2CWTA 3QK9A 1VQL3 1A2VA 1SQWA 2YX9A 4EXRA 1FA3A 5JPPA 3H51A 2B24B 2W03A 1C7HA 1QMAA 3N54B 1U5OA 2O9UX 1LOXA 2P0MA 5JPUA 1UUVB 4H61A 2K54A 4LMIA 3X42A 3FGYA 1UI7A 2O3OA 1TP6A 1VQM3 4EC6A 5IERA 2CFKA 4CCVA 4TX4A 2GU3A 3MHEA 3F14A 4R1KA 1AVKA 1HKXA 3D3LA 3LTBA 4L7KA 3DM8A 1VQ43 4O2HA 1SIIA 2W0QA 5DREA 1R4CA 4I4KA 2Z6BA 1OGZA 3X41A 3KN4A 1ULIB 3NM7A 3LT9A 5BVBA 2XFSA 4WYKB 5IEPA 3CPW2 4HZ9B 2Y73A 3HZPA 1RJOA 4XB5A 1IT7A 2CH9A 1N9EA 3B4PA 1ROAA 3GZXB 2CK3H 3CCQ3 3UL6A 4HVNA 1BUQA 1WQLB 2OOVC 3MWZA 3VSYA 3IMAB 2CKFB 3S29A 3F7XA 4HM7B 5IW9A 3NBJA 1LVNA 4FCJA 1L5GB 4FCMA 1KC84 5HGRA 5EVHA 3UB1A 1DVCA 3KSED 2GBWB 1EA2A 1SJWA 3NBRA 3G4S3 4WP5A 2FGTA 5AIGA 4XBTA 4FMAA 3K9MC 3BNBA 4MMZB 1Q824 3I553 3D9RA 2WGQA 1FGTA 1STFI 3GZYB 2BMOB 1WTHA 1JNQA 5IG5A 3HI7A 3V92A 1FGQA 3DXOA 2CHCA 2P0XA 2XSOB 3H3HA 1OCVA 2RFRA 1FGOA 2CG1A 5KP4A 3IJEB 4R9KA 3OXAA 2XR8B 4STDA 1V74A 3SVAA 3VGNA 3EBYA 2IMJA 8CHOA 2Z77A 3CC23 5IG0A 1IV9A 1S5AA 1GD4A 2CFGA 4N6MA 2W9QA 3CXC2 3F8XA 4U13A 3G8ZA 4N6UA 1IVVA 5FGOA 3UNLA 4EYCA 3F9SA 3N9HA 1OF5B 3FZWA 4O3VA 1K734 4RNYA 1GY6A 2ZDJA 4XBXA 2OQEC 1CYUA 1Q7Y4 4JRFA 1DMNA 2C11A 3DGNA 4K1VA 3LTCA 3LZAA 2PZVA 2QIYA 3EQQB 5CF2A 3CC73 3S27A 5AYRB 3NQZA 1WNHA 3CME3 1JB4A 1W5ZA 3K7CA 3S5CA 1DMMA 2LQVA 4X2OA 3RGRA 1QAFA 4WYKA 3T8UA 2RCDA 4L8OA 1GY5A 4MMYB 5AIFA 1YI23 2HMMB 2ZL8A 4KFFA 3F8HA 3E99A 4KZ1A 3FF0A 4NREA 3Q2PA 1JB2A 1W4NA 5STDA 2W56B 1VQ63 3WMDA 3I0YA 1YJ93 3FH1A 1VQO3 2JDIH 1RRLA 3OV4A 3WA2X 4J8TA 1ISKA 4WWUC 3F7SA 1WMPA 1K41A 3K63A 3ALAA 4K1UA 3RDEA 3HIGA 3JUPA 3LT8A 2QEX3 5AIHA 3SX1A 2OCTA 4FMCA 3S28A 3T8NA 3CC43 3U1WA 1JB5A 4HYZA 3FF2A 3PXMA 1IQ8A 4H3UA 3RGAA 3S67A 1VQP3 3UL5A 2RGQA 3BNCA 1JJ22 3NUVA 4AEQA 1PU4A 3PCRA 4HM0B 3AMOB 2XEPA 3EJVA 5EEOA 5CXOA 1CEWI 4R80A 1NB3I 3CPOA 4FR9A 1N8R4 6STDA 5FW5A 3SOAA 4XM4A 1FUWA 5D82A 3HIIA 3G16A 3STDA 2GEXA 3OWYA 3M8CA 3MPHA 1Q42A 2CC3A 1DVDA 3WDGB 4N6V0 4N6OB 2GBXB 3V98A 1OF5A 1QVF2 3UJMA 3LXUX 3U97A 1Y4KA 5LC6A 4HM6B 2C10A 4QWTA 7STDA 2BMQB 2B1XB 1IQXA 4NHFA 1OACA 1NDOB 1N9JA 1OHOA 1GYBA 3LYGA 2CIUA 3CNXA 1F8NA 1VQN3 2W2CA 1PFPA 2YFIB 2MC8A 1RRHA 1QAKA 2WGOA 2LYXA 1W6CA 3F40A 3SEDA 1S723 3BNEA 2WOFA 1DYUA 1W01A 2WOHA 3L0RA 1JV2B 4R9LA 1CQSA 2KXGA 3VF1A 1ULJB 2E2UA 4BTXA 4N6NB 2W56A 2KCDA 1O7HB 1Z1SA 4BTYA 4JF8A 1D6ZA 1G96A 5IENA 1W7CA 3CCM3 4XDWA 1VZZA 1E97A 2D1WA 4XBYA 1DMQA 5AI1A 5EQLA 1STDA 3GWRA 2CG0A 4O02B 3X3YA 5KP1A 5ELJA 4RBNA 3KFQC 1E3VA 2I9WA 1KQS2 3MG2A 1Q40B 2GXFA 2Y74A 4PEJA 1ASKA 4K90B 4X2HA 3ROBA 1IDPA 1W2B2 2BHMA 1LNHA 1T5YA 4N3VA 5BXQA 1D6UA 1NB5I 1D6YA 2HMLB 2KRTA 2P09A 4KVHA 4MMXB 1RKYA 3FLJA 3G713 2Z76A 4LZIA 2XFTA 3Q1CA 4HM1B 1VQ73 1JN5B 1FGMA 2CWUA 2CFWA 2UX0A 3EX9A 2D42A 3T0UA 4R4KA 2M7OA 3B8LA 1JKGB 3BNDA 3LTAA 3DY5A 3LOYA 1ZX2A 3OWSA 2IA7A 2W6JH 3PS8A 3A76A 1K28A 1NWWA 3KZTA 3X3ZA 1Q864 1YVBI 4RNZA 1YJN3 5I97A 1IQYA 3CCL3 1KWIA 4EV5A 1VQK3 3CU3A 4J9AA 4GL6A 3EB8A 1U8CB 1O7MB 1OHPA 2PNCA 3MSOA 4MJDA 4WHAA 5AYSC 4Q53A 2E2TA 2RSXA 3G0KA 2QGUA 5CLKA 1SIHA 3EBTA 4OUQA 5ELUA 1IK3A 2IUJA 1YIT3 1O7GB 3FG1A 4OK0A 2XH9A 3CCU3 1IVXA 4FMBA 1TU5A 2HMNB 2F86B 3TDGA 1HU9A 2GU1A 1JRQA 1TIJA 1Q814 3WOEB 1YIJ3 3NQYA 1OPYA 3CCS3 3JUOA 4FMDA 2FXTA 1W6YA 3FG3A 2CW9A 4ORLA 3DZLA 4KFDA 1NJI4 4LGQA 1AV4A 4HM8B 3BLZA 1J2BA 3MYTA 2V1LA 3NHXA 3JUNA 1EKMA 5D81A 1W02A 1UUWB 4HBRA 1M9GA 5AIIA 5AEUB 3X40A 1YHQ3 3KSPA 2WO0A 4HZBB 4EBGA 2Q07A 1YJW3 1EG9B 3ER7A 3SXXA 1GD3A 3NX0A 4WFOA 1AR0A 3CCR3 2OTJ3 1O7PB 1Q40A 2W9PA 2P05A 3DGOA 2F98A 1RN7A 2CFLA 3OW22 4O8SA 5KP3A 5IG4A 3LTDA 1IVWA 3FSDA 5AEWB 1NU3A 2L4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN 3;  1KD1 4;  3CCL 3;  1VQK 3;  3CCV 3;  3CCM 3;  1VQ7 3;  3CC7 3;  1N8R 4;  1KC8 4;  1VQO 3;  1VQ4 3;  1VQN 3;  3CC2 3;  1VQ8 3;  1VQL 3;  3G4S 3;  3CXC 2;  1YIT 3;  1YHQ 3;  3CME 3;  1VQ9 3;  1M1K 4;  2QEX 3;  2OTL 3;  1M90 4;  1YJW 3;  1Q82 4;  3CPW 2;  1QVG 2;  1K8A 4;  3CCU 3;  3I55 3;  1KQS 2;  3CCE 3;  3CCR 3;  1S72 3;  1K73 4;  1QVF 2;  2OTJ 3;  3CC4 3;  1YI2 3;  1W2B 2;  3I56 3;  3G6E 3;  1Q81 4;  3CMA 3;  1YIJ 3;  3CCJ 3;  1Q7Y 4;  2QA4 3;  3OW2 2;  1JJ2 2;  3CCS 3;  1VQP 3;  1VQ5 3;  3CD6 3;  1K9M 4;  1VQ6 3;  1Q86 4;  3G71 3;  3CCQ 3;  1YJ9 3;  1NJI 4;  1VQM 3; 
#chains in the Genus database with same CATH topology
 3K5T A;  3MKI A;  5IF6 A;  4HKV B;  1ZGX A;  4N6L A;  1T3B A;  1E3R A;  4FCZ A;  2HMJ B;  4XDV A;  1FGR A;  3HX8 A;  1JN5 A;  2L1S A;  3NV0 B;  4K61 A;  1Q7H A;  1RGA A;  3X3X A;  1A67 A;  1QJG A;  6RNT A;  2HMK B;  1JBT A;  1N5H A;  4KFE A;  2H0G A;  1LNI A;  2R4I A;  2INX A;  2CWV A;  3DMC A;  5RNT A;  1SAR A;  3FG4 A;  4L8P A;  1JKG A;  2IY2 A;  3GSP A;  3N8B A;  1JBS A;  1RGG A;  3QRD A;  1VQQ A;  4OVM A;  3KE7 A;  1YGW A;  3MG1 A;  3OWU A;  3Q90 A;  4MEI A;  5HOH A;  2STD A;  1WMO A;  1O7W B;  1RN4 A;  3URP A;  5IG3 A;  3MG3 A;  1WMN A;  1MWS A;  3GZR A;  1ZO2 A;  2XRX B;  3DGM A;  2KF6 A;  5TGN A;  1IT8 A;  3AHW A;  3CC7 3;  3CCV 3;  2OOV A;  4HM5 B;  2K0M A;  5M18 A;  1EUI C;  3LML A;  2GEY A;  2OWP A;  5BIR A;  1NO3 A;  1SPU A;  4HJL B;  3FCS B;  2BNG A;  4GB5 A;  1IU7 A;  2OTL 3;  1IV7 A;  4N6T A;  1IVU A;  1K8A 4;  3NXJ A;  3GAX A;  1OGX A;  3JUM A;  1BAN A;  4BTW A;  5A0O B;  1B2Z A;  1BIR A;  1VQ5 3;  3HK4 A;  2FNQ A;  1T2I A;  2XSH B;  1K9M 4;  1YNV X;  2SBL A;  4AKY A;  3LH4 A;  4LEH A;  3FKA A;  3SLU A;  1B20 A;  1GMQ A;  1QAL A;  4IT7 A;  5LC7 A;  1TUH A;  3WOF B;  3AMO A;  1DE3 A;  2P38 A;  1ROV A;  1BVI A;  3PZW A;  3WOD G;  1AVL A;  4AKZ A;  2W04 A;  3SOY A;  2YFJ B;  4CDL A;  3EN1 B;  1N8Q A;  1MNL A;  1OHS A;  2F56 A;  3V99 A;  3JVC A;  2HMO B;  2XF3 A;  1I2F A;  4HOH A;  1QVG 2;  4HM4 B;  1ZS7 A;  1N5P A;  1BNR A;  3PYJ A;  3CCE 3;  1W2Z A;  2CFD A;  1I70 A;  1KSI A;  3PCS A;  3EC9 A;  4EV2 A;  2XGN A;  3CCJ 3;  4HM3 B;  1EQK A;  3JUQ A;  2OQE A;  3DUK A;  4RZM A;  3NBB A;  3B7C A;  1UI8 A;  4ZM8 A;  3GZB A;  1VQ9 3;  1M1X B;  1MOL A;  3EF8 A;  1KD1 4;  2YFL B;  5G2G A;  2ML5 A;  4IIA A;  4HM2 B;  1A2K A;  3D79 A;  3EHC A;  3ECF A;  2ML6 A;  5JBS A;  3GRD A;  3KKG A;  3EE1 A;  4LSO A;  2BT3 A;  3PGB A;  3NV0 A;  3B4O A;  4IPB A;  1UW1 A;  2ZHX B;  1PYL A;  5D83 A;  1RNT A;  3K0Z A;  2A15 A;  1M1K 4;  1TFK A;  3IPT A;  1M90 4;  1O7N B;  2SAR A;  1LXE A;  1YVS A;  4CJN A;  1TFO A;  2JQ5 A;  3EN8 A;  3I56 3;  1W00 A;  3G6E 3;  1LQM B;  3CMA 3;  1B2U A;  2E2V A;  2QA4 3;  1YGE A;  1A90 A;  1HZ1 A;  4G1M B;  3CD6 3;  6GSP A;  2BO9 B;  2BMR B;  5DRV A;  5IEO A;  1US1 A;  3DGL A;  1GSP A;  2Z7A A;  3BB9 A;  3CNM A;  7RNT A;  1VQ8 3;  3NM2 A;  1MWT A;  1OH0 A;  2MF7 A;  1CYV A;  2XGL A;  3O8Y A;  5CK6 A;  3ZFZ A;  1OUN A;  3OX9 A;  3KII A;  1W6G A;  3WA3 A;  3J7Y d;  2F99 A;  3AGO A;  1I2E A;  1GY7 A;  2IUK A;  1BUJ A;  5CF1 A;  1RN1 A;  2KAA A;  1GS3 A;  2CWT A;  3QK9 A;  3RNT A;  1VQL 3;  4J5K A;  2CX1 A;  1RCL A;  1A2V A;  1SQW A;  2YX9 A;  4EXR A;  1FA3 A;  5JPP A;  3H51 A;  2B24 B;  2W03 A;  1C7H A;  1QMA A;  3N54 B;  1U5O A;  3D5I A;  2O9U X;  1LOX A;  1BOX A;  2P0M A;  1RTU A;  5JPU A;  1UUV B;  2KF3 A;  4H61 A;  2K54 A;  4LMI A;  3X42 A;  3FGY A;  1UGI A;  1UI7 A;  2O3O A;  1TP6 A;  1VQM 3;  4EC6 A;  5IER A;  2CFK A;  4CCV A;  4TX4 A;  2GU3 A;  3MHE A;  3F14 A;  4R1K A;  1AVK A;  1HKX A;  3D3L A;  1BNS A;  3LTB A;  3DM8 A;  4L7K A;  1VQ4 3;  4O2H A;  1SII A;  2W0Q A;  2ZA4 A;  5G1L A;  5DRE A;  1R4C A;  4I4K A;  2C4B A;  1OGZ A;  2Z6B A;  3KN4 A;  1ULI B;  3X41 A;  3NM7 A;  3LT9 A;  5BVB A;  2XFS A;  4WYK B;  5IEP A;  3CPW 2;  1RGC A;  1BNE A;  4HZ9 B;  2Y73 A;  3WR2 A;  2IYJ A;  3HZP A;  1RJO A;  4XB5 A;  1I2G A;  1IT7 A;  2CH9 A;  1N9E A;  3B4P A;  1ROA A;  3GZX B;  1Q9E A;  1RGL A;  2CK3 H;  3CCQ 3;  3UL6 A;  4HVN A;  1BUQ A;  1WQL B;  2OOV C;  3MWZ A;  3VSY A;  5BU4 A;  1R4Y A;  3IMA B;  1X1U A;  2CKF B;  3F7X A;  3S29 A;  4HM7 B;  5IW9 A;  1MGW A;  3NBJ A;  1LVN A;  1FUT A;  2K3D A;  4FCJ A;  4FCM A;  1G0T A;  5EVH A;  5HGR A;  1L5G B;  3UB1 A;  1DVC A;  1KC8 4;  3KSE D;  1LRA A;  2GBW B;  2F4Y A;  1EA2 A;  1SJW A;  3NBR A;  4ILF A;  3G4S 3;  4WP5 A;  2FGT A;  5AIG A;  4XBT A;  4FMA A;  3K9M C;  3BNB A;  4MMZ B;  1Q82 4;  2H0H A;  4J5G A;  3I55 3;  3D9R A;  2WGQ A;  1FGT A;  1STF I;  3GZY B;  2BMO B;  1WTH A;  1JNQ A;  5IG5 A;  3HI7 A;  3V92 A;  1FGQ A;  3DXO A;  3Q3F A;  4BIR A;  2CHC A;  4BU4 A;  2P0X A;  1B2M A;  2XSO B;  3H3H A;  1UCL A;  1OCV A;  2HOH A;  2RFR A;  1FGO A;  2CG1 A;  2F5W A;  5KP4 A;  3IJE B;  4R9K A;  3BIR A;  1RGE A;  3OXA A;  1BRI A;  2XR8 B;  4STD A;  1V74 A;  3SVA A;  3VGN A;  1V58 A;  3EBY A;  2IMJ A;  1I3F A;  8CHO A;  2Z77 A;  2KF4 A;  3CC2 3;  1UUG B;  5IG0 A;  1IV9 A;  1S5A A;  1BNF A;  1BRK A;  1GD4 A;  2CFG A;  1UCK A;  4N6M A;  2W9Q A;  3CXC 2;  1RSN A;  3F8X A;  1FW7 A;  4U13 A;  3G8Z A;  1RGF A;  3DH2 A;  4N6U A;  1IVV A;  5FGO A;  3UNL A;  4EYC A;  3F9S A;  3N9H A;  1OF5 B;  1GOY A;  3FZW A;  1UDI I;  4O3V A;  1K73 4;  4RNY A;  1GY6 A;  2ZDJ A;  1B27 A;  4XBX A;  1X1W A;  1FUS A;  2OQE C;  1CYU A;  1Q7Y 4;  4JRF A;  1DMN A;  2C11 A;  1MWU A;  3DGN A;  4LYL B;  1BRJ A;  1BSB A;  4K1V A;  3LTC A;  3LZA A;  2PZV A;  2QIY A;  1G02 A;  1FZU A;  3EQQ B;  5CF2 A;  3S27 A;  5AYR B;  3NQZ A;  2R41 A;  1WNH A;  2CX0 A;  1FYS A;  5GSP A;  3CME 3;  1JB4 A;  1B2X A;  4I5Q A;  1W5Z A;  3K7C A;  3S5C A;  1DMM A;  2LQV A;  4X2O A;  3RGR A;  3WHO A;  1BRG A;  1QAF A;  4WYK A;  3T8U A;  2RCD A;  1JBR A;  4L8O A;  1GY5 A;  1RDS A;  4MMY B;  1PY3 A;  5AIF A;  1YI2 3;  2HMM B;  2ZL8 A;  4KFF A;  3F8H A;  3E99 A;  4KZ1 A;  3FF0 A;  4GHO A;  4NRE A;  3Q2P A;  1JB2 A;  1W4N A;  3D4A A;  2W56 B;  5STD A;  1X1X A;  1VQ6 3;  3ZG5 A;  3WMD A;  3I0Y A;  1YJ9 3;  4BL2 A;  3FH1 A;  1VQO 3;  2JDI H;  1GMR A;  1RRL A;  3OV4 A;  3WA2 X;  2GSP A;  2BIR A;  4J8T A;  1BRH A;  1ISK A;  4WWU C;  3F7S A;  1WMP A;  1K41 A;  2AAD A;  3K63 A;  1BRS A;  3ALA A;  4K1U A;  3RDE A;  3HIG A;  3JUP A;  3LT8 A;  4BL3 A;  2QEX 3;  5AIH A;  3SX1 A;  2OCT A;  1RGK A;  1GOV A;  4FMC A;  3S28 A;  3T8N A;  3CC4 3;  3U1W A;  1JB5 A;  4HYZ A;  1IYY A;  1MGR A;  3FF2 A;  3PXM A;  1IQ8 A;  1B3S A;  4H3U A;  3RGA A;  3S67 A;  3UL5 A;  1BNI A;  2RGQ A;  3BNC A;  1VQP 3;  1LOW A;  3NUV A;  4AEQ A;  5M19 A;  7GSP A;  1PU4 A;  3PCR A;  4HM0 B;  3AMO B;  2XEP A;  3EJV A;  5EEO A;  1T2H A;  1CEW I;  5CXO A;  4R80 A;  1NB3 I;  2AAE A;  3CPO A;  4FR9 A;  1N8R 4;  6STD A;  5FW5 A;  1B21 A;  4XM4 A;  3SOA A;  5D82 A;  1FUW A;  3HII A;  1B2S A;  3G16 A;  3STD A;  1BGS A;  2GEX A;  3OWY A;  4HAA A;  3M8C A;  3MPH A;  1Q42 A;  2CC3 A;  1DVD A;  3WDG B;  4N6V 0;  1RGH A;  2GBX B;  4N6O B;  3V98 A;  1OF5 A;  1QVF 2;  3UJM A;  3LXU X;  3U97 A;  1Y4K A;  5LC6 A;  5M1A A;  1RCK A;  4HM6 B;  2C10 A;  4QWT A;  7STD A;  2BMQ B;  2B1X B;  1IQX A;  1JZD A;  4NHF A;  1BU4 A;  4RNT A;  1OAC A;  1NDO B;  1N9J A;  1OHO A;  1RLS A;  1GYB A;  3LYG A;  2CIU A;  3CNX A;  4KT3 B;  1F8N A;  1BNJ A;  2W2C A;  1VQN 3;  1PFP A;  2YFI B;  2MC8 A;  1RRH A;  1QAK A;  2WGO A;  2LYX A;  1W6C A;  3F40 A;  3SED A;  1TJD A;  1S72 3;  1MWR A;  3BNE A;  2WOF A;  1DYU A;  1W01 A;  2WOH A;  3A5E A;  3L0R A;  1JV2 B;  4R9L A;  1CQS A;  2KXG A;  3VF1 A;  1ULJ B;  2E2U A;  2BU4 A;  4N6N B;  4BTX A;  2KCD A;  1O7H B;  1Z1S A;  2W56 A;  4BTY A;  4JF8 A;  1D6Z A;  1G96 A;  1TTO A;  5IEN A;  1W7C A;  3CCM 3;  4GSP A;  4XDW A;  1VZZ A;  1BSA A;  8RNT A;  1I0X A;  3ZG0 A;  1TRP A;  1E97 A;  2D1W A;  4XBY A;  1DMQ A;  1BRN L;  5AI1 A;  5EQL A;  1BSD A;  1STD A;  3GWR A;  1LQG C;  2CG0 A;  4O02 B;  3BU4 A;  1BSE A;  3X3Y A;  5KP1 A;  5ELJ A;  4RBN A;  3KFQ C;  1E3V A;  2I9W A;  1KQS 2;  3MG2 A;  1Q40 B;  2GXF A;  2Y74 A;  4PEJ A;  1ASK A;  4K90 B;  2RBI A;  4X2H A;  1IDP A;  3ROB A;  1W2B 2;  2BHM A;  1LNH A;  1T5Y A;  4N3V A;  5BXQ A;  1D6U A;  2RNT A;  2UUG C;  1NB5 I;  1D6Y A;  2HML B;  2KRT A;  2P09 A;  4KVH A;  1LOV A;  4MMX B;  3FLJ A;  1RKY A;  3G71 3;  2Z76 A;  3AGN A;  4NPB A;  4LZI A;  2XFT A;  3Q1C A;  4HM1 B;  1VQ7 3;  1JN5 B;  1FGM A;  2CWU A;  2CFW A;  2UX0 A;  3EX9 A;  1BAO A;  2D42 A;  3T0U A;  4R4K A;  2M7O A;  3B8L A;  1JKG B;  3BND A;  1V57 A;  2H0I A;  3LTA A;  4CPK A;  3DY5 A;  3LOY A;  4EW5 A;  1ZX2 A;  3OWS A;  2F5M A;  2IA7 A;  4DKI A;  2KF5 A;  2W6J H;  3PS8 A;  3A76 A;  1K28 A;  1NWW A;  3KZT A;  3X3Z A;  1Q86 4;  1YVB I;  1BNG A;  4RNZ A;  1YJN 3;  5I97 A;  1IQY A;  3CCL 3;  1KWI A;  4EV5 A;  1VQK 3;  2UGI A;  3CU3 A;  4J9A A;  4GL6 A;  3EB8 A;  1U8C B;  1O7M B;  1OHP A;  3SYU A;  2PNC A;  3MSO A;  4MJD A;  4WHA A;  1I8V A;  4Q53 A;  2E2T A;  2RSX A;  3G0K A;  5G1K A;  2QGU A;  5CLK A;  5AYS C;  1SIH A;  3EBT A;  4OUQ A;  1I0V A;  5ELU A;  2IUJ A;  1IK3 A;  1JZO A;  1YIT 3;  1O7G B;  3FG1 A;  1GMP A;  1AQZ A;  4OK0 A;  1C54 A;  2XH9 A;  3CCU 3;  1IVX A;  4FMB A;  1TU5 A;  1RNB A;  2HMN B;  9RNT A;  1EEJ A;  2F86 B;  3TDG A;  1HU9 A;  2GU1 A;  1AY7 A;  1JRQ A;  1TIJ A;  1Q81 4;  1JJ2 2;  3WOE B;  1A2P A;  1YIJ 3;  3NQY A;  3D5G A;  1OPY A;  3CCS 3;  3KCH A;  3JUO A;  4FMD A;  2FXT A;  1CH0 A;  1W6Y A;  3FG3 A;  2CW9 A;  4ORL A;  3DZL A;  1RMS A;  4KFD A;  3AHS A;  3HOH A;  4LGQ A;  2J8X B;  1AV4 A;  1DET A;  4HM8 B;  3BLZ A;  1NJI 4;  1J2B A;  1LOY A;  3MYT A;  2V1L A;  3NHX A;  1TRQ A;  3JUN A;  1EKM A;  5D81 A;  1W02 A;  1UUW B;  4HBR A;  1M9G A;  5AII A;  1GOU A;  5AEU B;  3X40 A;  1YHQ 3;  3KSP A;  2WO0 A;  4HZB B;  4EBG A;  2Q07 A;  1YJW 3;  1EG9 B;  1I3I A;  3ER7 A;  3SXX A;  1GD3 A;  1RHL A;  1NNV A;  1UCJ A;  3NX0 A;  1UGH I;  1AR0 A;  4WFO A;  3CCR 3;  2OTJ 3;  1O7P B;  1Q40 A;  1UCI A;  2W9P A;  2P05 A;  3DGO A;  1HYF A;  1RN7 A;  2F98 A;  2CFL A;  1BSC A;  3OW2 2;  1X1Y A;  4O8S A;  5KP3 A;  5IG4 A;  3LTD A;  1IVW A;  3FSD A;  5AEW B;  1NU3 A;  3DGY A;  2L4V A; 
#chains in the Genus database with same CATH homology
 3K5T A;  3MKI A;  5IF6 A;  4HKV B;  4N6L A;  1E3R A;  4FCZ A;  2HMJ B;  4XDV A;  1FGR A;  3HX8 A;  1JN5 A;  3NV0 B;  4K61 A;  3X3X A;  1A67 A;  1QJG A;  2HMK B;  1N5H A;  4KFE A;  2R4I A;  2INX A;  2CWV A;  3DMC A;  3FG4 A;  4L8P A;  1JKG A;  3N8B A;  3QRD A;  4OVM A;  3KE7 A;  3OWU A;  3MG1 A;  3Q90 A;  4MEI A;  2STD A;  1WMO A;  1O7W B;  5IG3 A;  3MG3 A;  1WMN A;  3GZR A;  1ZO2 A;  2XRX B;  3DGM A;  5TGN A;  1IT8 A;  3CCV 3;  2OOV A;  4HM5 B;  2K0M A;  3LML A;  2GEY A;  2OWP A;  1NO3 A;  1SPU A;  4HJL B;  3FCS B;  2BNG A;  4GB5 A;  1IU7 A;  2OTL 3;  1IV7 A;  4N6T A;  1IVU A;  1K8A 4;  3NXJ A;  3GAX A;  1OGX A;  3JUM A;  4BTW A;  5A0O B;  1VQ5 3;  3HK4 A;  2FNQ A;  2XSH B;  1K9M 4;  2SBL A;  4AKY A;  3LH4 A;  4LEH A;  3FKA A;  3SLU A;  1QAL A;  4IT7 A;  5LC7 A;  1TUH A;  3WOF B;  3AMO A;  2P38 A;  1ROV A;  3PZW A;  3WOD G;  1AVL A;  4AKZ A;  2W04 A;  3SOY A;  2YFJ B;  4CDL A;  3EN1 B;  1N8Q A;  1MNL A;  1OHS A;  3V99 A;  3JVC A;  2HMO B;  2XF3 A;  1QVG 2;  4HM4 B;  1N5P A;  3PYJ A;  3CCE 3;  1W2Z A;  2CFD A;  1KSI A;  3PCS A;  3EC9 A;  4EV2 A;  2XGN A;  3CCJ 3;  4HM3 B;  1EQK A;  3JUQ A;  2OQE A;  3DUK A;  4RZM A;  3NBB A;  3B7C A;  1UI8 A;  4ZM8 A;  3GZB A;  1VQ9 3;  1M1X B;  1MOL A;  3EF8 A;  1KD1 4;  2YFL B;  5G2G A;  2ML5 A;  4IIA A;  4HM2 B;  1A2K A;  3EHC A;  3ECF A;  2ML6 A;  5JBS A;  3GRD A;  3KKG A;  3EE1 A;  4LSO A;  2BT3 A;  3PGB A;  3NV0 A;  3B4O A;  4IPB A;  1UW1 A;  5D83 A;  3K0Z A;  2A15 A;  1M1K 4;  1TFK A;  3IPT A;  1M90 4;  1O7N B;  1LXE A;  1TFO A;  2JQ5 A;  3EN8 A;  3I56 3;  1W00 A;  3G6E 3;  3CMA 3;  2E2V A;  2QA4 3;  1YGE A;  1A90 A;  4G1M B;  3CD6 3;  2BO9 B;  2BMR B;  5DRV A;  5IEO A;  1US1 A;  3DGL A;  2Z7A A;  3BB9 A;  3CNM A;  1VQ8 3;  3NM2 A;  1OH0 A;  2MF7 A;  1CYV A;  2XGL A;  3O8Y A;  5CK6 A;  1OUN A;  3OX9 A;  3KII A;  1W6G A;  3WA3 A;  3J7Y d;  2F99 A;  1GY7 A;  2IUK A;  5CF1 A;  1GS3 A;  2CWT A;  3QK9 A;  1VQL 3;  1A2V A;  1SQW A;  2YX9 A;  4EXR A;  1FA3 A;  5JPP A;  3H51 A;  2B24 B;  2W03 A;  1C7H A;  1QMA A;  3N54 B;  1U5O A;  2O9U X;  1LOX A;  2P0M A;  5JPU A;  1UUV B;  4H61 A;  2K54 A;  4LMI A;  3X42 A;  3FGY A;  1UI7 A;  2O3O A;  1TP6 A;  1VQM 3;  4EC6 A;  5IER A;  2CFK A;  4CCV A;  4TX4 A;  2GU3 A;  3MHE A;  3F14 A;  4R1K A;  1AVK A;  1HKX A;  3D3L A;  3LTB A;  4L7K A;  3DM8 A;  1VQ4 3;  4O2H A;  1SII A;  2W0Q A;  5DRE A;  1R4C A;  4I4K A;  2Z6B A;  1OGZ A;  3X41 A;  3KN4 A;  1ULI B;  3NM7 A;  3LT9 A;  5BVB A;  2XFS A;  4WYK B;  5IEP A;  3CPW 2;  4HZ9 B;  2Y73 A;  3HZP A;  1RJO A;  4XB5 A;  1IT7 A;  2CH9 A;  1N9E A;  3B4P A;  1ROA A;  3GZX B;  2CK3 H;  3CCQ 3;  3UL6 A;  4HVN A;  1BUQ A;  1WQL B;  2OOV C;  3MWZ A;  3VSY A;  3IMA B;  2CKF B;  3S29 A;  3F7X A;  4HM7 B;  5IW9 A;  3NBJ A;  1LVN A;  4FCJ A;  1L5G B;  4FCM A;  1KC8 4;  5HGR A;  5EVH A;  3UB1 A;  1DVC A;  3KSE D;  2GBW B;  1EA2 A;  1SJW A;  3NBR A;  3G4S 3;  4WP5 A;  2FGT A;  5AIG A;  4XBT A;  4FMA A;  3K9M C;  3BNB A;  4MMZ B;  1Q82 4;  3I55 3;  3D9R A;  2WGQ A;  1FGT A;  1STF I;  3GZY B;  2BMO B;  1WTH A;  1JNQ A;  5IG5 A;  3HI7 A;  3V92 A;  1FGQ A;  3DXO A;  2CHC A;  2P0X A;  2XSO B;  3H3H A;  1OCV A;  2RFR A;  1FGO A;  2CG1 A;  5KP4 A;  3IJE B;  4R9K A;  3OXA A;  2XR8 B;  4STD A;  1V74 A;  3SVA A;  3VGN A;  3EBY A;  2IMJ A;  8CHO A;  2Z77 A;  3CC2 3;  5IG0 A;  1IV9 A;  1S5A A;  1GD4 A;  2CFG A;  4N6M A;  2W9Q A;  3CXC 2;  3F8X A;  4U13 A;  3G8Z A;  4N6U A;  1IVV A;  5FGO A;  3UNL A;  4EYC A;  3F9S A;  3N9H A;  1OF5 B;  3FZW A;  4O3V A;  1K73 4;  4RNY A;  1GY6 A;  2ZDJ A;  4XBX A;  2OQE C;  1CYU A;  1Q7Y 4;  4JRF A;  1DMN A;  2C11 A;  3DGN A;  4K1V A;  3LTC A;  3LZA A;  2PZV A;  2QIY A;  3EQQ B;  5CF2 A;  3CC7 3;  3S27 A;  5AYR B;  3NQZ A;  1WNH A;  3CME 3;  1JB4 A;  1W5Z A;  3K7C A;  3S5C A;  1DMM A;  2LQV A;  4X2O A;  3RGR A;  1QAF A;  4WYK A;  3T8U A;  2RCD A;  4L8O A;  1GY5 A;  4MMY B;  5AIF A;  1YI2 3;  2HMM B;  2ZL8 A;  4KFF A;  3F8H A;  3E99 A;  4KZ1 A;  3FF0 A;  4NRE A;  3Q2P A;  1JB2 A;  1W4N A;  5STD A;  2W56 B;  1VQ6 3;  3WMD A;  3I0Y A;  1YJ9 3;  3FH1 A;  1VQO 3;  2JDI H;  1RRL A;  3OV4 A;  3WA2 X;  4J8T A;  1ISK A;  4WWU C;  3F7S A;  1WMP A;  1K41 A;  3K63 A;  3ALA A;  4K1U A;  3RDE A;  3HIG A;  3JUP A;  3LT8 A;  2QEX 3;  5AIH A;  3SX1 A;  2OCT A;  4FMC A;  3S28 A;  3T8N A;  3CC4 3;  3U1W A;  1JB5 A;  4HYZ A;  3FF2 A;  3PXM A;  1IQ8 A;  4H3U A;  3RGA A;  3S67 A;  1VQP 3;  3UL5 A;  2RGQ A;  3BNC A;  1JJ2 2;  3NUV A;  4AEQ A;  1PU4 A;  3PCR A;  4HM0 B;  3AMO B;  2XEP A;  3EJV A;  5EEO A;  5CXO A;  1CEW I;  4R80 A;  1NB3 I;  3CPO A;  4FR9 A;  1N8R 4;  6STD A;  5FW5 A;  3SOA A;  4XM4 A;  1FUW A;  5D82 A;  3HII A;  3G16 A;  3STD A;  2GEX A;  3OWY A;  3M8C A;  3MPH A;  1Q42 A;  2CC3 A;  1DVD A;  3WDG B;  4N6V 0;  4N6O B;  2GBX B;  3V98 A;  1OF5 A;  1QVF 2;  3UJM A;  3LXU X;  3U97 A;  1Y4K A;  5LC6 A;  4HM6 B;  2C10 A;  4QWT A;  7STD A;  2BMQ B;  2B1X B;  1IQX A;  4NHF A;  1OAC A;  1NDO B;  1N9J A;  1OHO A;  1GYB A;  3LYG A;  2CIU A;  3CNX A;  1F8N A;  1VQN 3;  2W2C A;  1PFP A;  2YFI B;  2MC8 A;  1RRH A;  1QAK A;  2WGO A;  2LYX A;  1W6C A;  3F40 A;  3SED A;  1S72 3;  3BNE A;  2WOF A;  1DYU A;  1W01 A;  2WOH A;  3L0R A;  1JV2 B;  4R9L A;  1CQS A;  2KXG A;  3VF1 A;  1ULJ B;  2E2U A;  4BTX A;  4N6N B;  2W56 A;  2KCD A;  1O7H B;  1Z1S A;  4BTY A;  4JF8 A;  1D6Z A;  1G96 A;  5IEN A;  1W7C A;  3CCM 3;  4XDW A;  1VZZ A;  1E97 A;  2D1W A;  4XBY A;  1DMQ A;  5AI1 A;  5EQL A;  1STD A;  3GWR A;  2CG0 A;  4O02 B;  3X3Y A;  5KP1 A;  5ELJ A;  4RBN A;  3KFQ C;  1E3V A;  2I9W A;  1KQS 2;  3MG2 A;  1Q40 B;  2GXF A;  2Y74 A;  4PEJ A;  1ASK A;  4K90 B;  4X2H A;  3ROB A;  1IDP A;  1W2B 2;  2BHM A;  1LNH A;  1T5Y A;  4N3V A;  5BXQ A;  1D6U A;  1NB5 I;  1D6Y A;  2HML B;  2KRT A;  2P09 A;  4KVH A;  4MMX B;  1RKY A;  3FLJ A;  3G71 3;  2Z76 A;  4LZI A;  2XFT A;  3Q1C A;  4HM1 B;  1VQ7 3;  1JN5 B;  1FGM A;  2CWU A;  2CFW A;  2UX0 A;  3EX9 A;  2D42 A;  3T0U A;  4R4K A;  2M7O A;  3B8L A;  1JKG B;  3BND A;  3LTA A;  3DY5 A;  3LOY A;  1ZX2 A;  3OWS A;  2IA7 A;  2W6J H;  3PS8 A;  3A76 A;  1K28 A;  1NWW A;  3KZT A;  3X3Z A;  1Q86 4;  1YVB I;  4RNZ A;  1YJN 3;  5I97 A;  1IQY A;  3CCL 3;  1KWI A;  4EV5 A;  1VQK 3;  3CU3 A;  4J9A A;  4GL6 A;  3EB8 A;  1U8C B;  1O7M B;  1OHP A;  2PNC A;  3MSO A;  4MJD A;  4WHA A;  5AYS C;  4Q53 A;  2E2T A;  2RSX A;  3G0K A;  2QGU A;  5CLK A;  1SIH A;  3EBT A;  4OUQ A;  5ELU A;  1IK3 A;  2IUJ A;  1YIT 3;  1O7G B;  3FG1 A;  4OK0 A;  2XH9 A;  3CCU 3;  1IVX A;  4FMB A;  1TU5 A;  2HMN B;  2F86 B;  3TDG A;  1HU9 A;  2GU1 A;  1JRQ A;  1TIJ A;  1Q81 4;  3WOE B;  1YIJ 3;  3NQY A;  1OPY A;  3CCS 3;  3JUO A;  4FMD A;  2FXT A;  1W6Y A;  3FG3 A;  2CW9 A;  4ORL A;  3DZL A;  4KFD A;  1NJI 4;  4LGQ A;  1AV4 A;  4HM8 B;  3BLZ A;  1J2B A;  3MYT A;  2V1L A;  3NHX A;  3JUN A;  1EKM A;  5D81 A;  1W02 A;  1UUW B;  4HBR A;  1M9G A;  5AII A;  5AEU B;  3X40 A;  1YHQ 3;  3KSP A;  2WO0 A;  4HZB B;  4EBG A;  2Q07 A;  1YJW 3;  1EG9 B;  3ER7 A;  3SXX A;  1GD3 A;  3NX0 A;  4WFO A;  1AR0 A;  3CCR 3;  2OTJ 3;  1O7P B;  1Q40 A;  2W9P A;  2P05 A;  3DGO A;  2F98 A;  1RN7 A;  2CFL A;  3OW2 2;  4O8S A;  5KP3 A;  5IG4 A;  3LTD A;  1IVW A;  3FSD A;  5AEW B;  1NU3 A;  2L4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...