1T3BA

X-ray structure of dsbc from haemophilus influenzae
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
209
structure length
209
Chain Sequence
DAAIKRKLQSFNISNIVIKSSPISGIKTAVTDQGILYVSEDGKYLFEGKLYELTNNGPVDVAGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDITCHYCHLLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTAKDPVFALNEAEKGNLPKEVKTPNIVKKHYELGIQFGVRGTPSIVTSTGELIGGYLKPADLLRALEETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbC
publication title Structure of DsbC from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 53
structure length 209
sequence length 209
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2004-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1t3bA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1t3bA02
5F06A 14GSA 2IL3A 1ERVA 3QFAC 2VOCA 1GULA 2C4JA 5E59A 2L4CA 1GH2A 19GSA 3H1NA 4PURA 4DSSB 4WR4A 5IIZA 1V58A 2CX4A 4ZL9A 4N0VA 1U88A 4XTSA 2LS5A 1PRXA 4N0ZA 3ZRDA 4ZXGA 3KJYA 3ZIVA 4HJMA 4KA0A 4FYBA 4I8BA 4KGIA 1K0NA 3KP8A 22GSA 3GX8A 2HT9A 2V32A 3TKRA 3F0IA 2VCTA 1X5DA 3ZYWA 5KN3A 4K7IA 4HOJA 1FO5A 2DBCA 2O89A 4MH3A 1PL1A 1FB0A 4EC0A 2OE0A 4K8MA 2YJHA 2DC5A 1O85A 2NPBA 4O32A 1ON4A 2OA7A 4TR3A 1SL2B 2LQQA 3FW2A 3QAWA 5J4UA 10GSA 2VUPA 1SK1A 1GLQA 1GUMA 1LJRA 4MH2A 2G2QA 1SYXA 3PH9A 4HQSA 2H75A 2LNTA 1B4PA 2JADA 4WETA 1GUHA 4JR6A 3HJOA 3ZFLA 3LJRA 3L4NA 3CTFA 4Q5RA 4L5OA 4F03A 1JZWA 1FW1A 1GSSA 3TOUA 2LEGA 2I4AA 2EIQA 1EWXA 4KB3A 5IQYA 4MJAA 2FUG2 1TXXA 5G1KA 3I69A 1OC9A 1GNWA 2OJLA 2VL3A 1F2EA 1S3CA 2HSHA 3LSZA 4G10A 2WS2A 5EVOA 1H75A 2VLTA 4V2NA 3RBTA 3LYKA 1GWCA 3GUSA 3RPPA 5JWRB 3HVVA 5FHIA 1HQOA 2OE3A 2GT6A 4YQUA 2H1GA 3TB2A 3VPTA 1A2LA 4FYCA 1SL0B 2LJAA 4WXTA 4MPGA 4E8EA 4KNDA 2CVBA 2YWIA 2MYGA 1Y6EA 5DBQA 1SKWB 2RM5A 7GSSA 5EPFA 2VCQA 3KZQA 4ECCA 5B6MA 1VF4A 1T4ZA 1V2AA 1Q98A 2CVDA 3QR6A 3QAGA 5IMFA 1AAZA 3MAKA 4OFTA 1FOVA 4K0GA 5DQSA 4HUAA 1J0FA 4O92A 1SK0A 2IJYA 4V1Ap 3W6GA 1AW9A 3PGTA 1GP1A 4TR1A 4XRAA 3A2VA 2C0EA 1T1VA 1Z6NA 2Z9SA 3IC4A 2JZTA 5ECSA 1B8XA 1O8WA 4EKZA 2DJ0A 1QK8A 1O81A 2VIMA 1M7TA 1VF3A 3WGXA 1FG4A 2PWJA 3EMPA 4IBPA 4KX4A 4NV5A 4PUAA 3DRNA 3G9BA 5KN2A 3KGKA 4MF6A 1R5AA 2HFDA 1WJKA 1AQXA 4MMMA 3PR8A 4EO3A 1A23A 18GSA 2PERA 1G6YA 2O85A 3HKRA 4ZBBA 5KN1A 1XVQA 2K9FA 4MJBA 4KDXA 3QOUA 2JSYA 5GAPD 3WT2A 2DLXA 3GKXA 1ILOA 5DJLA 3P7XA 1OKTA 3L9SA 5L71A 2VLUA 3IA1A 4PUFC 2H6XA 2IY2A 3TRPA 1ZMAA 3DIEA 5JWQB 2H70A 2RUEA 5ECLB 2GDRA 4QL9A 12GSA 20GSA 3D6IA 1YY7A 1I5GA 1WRYA 1ZGNA 2QGVA 1KNGA 1XCCA 4J2FA 1UC7A 2GSRA 2V2GA 2CX3A 3VWXA 4GXZA 1TI1A 3J7Yk 1NM3A 2VD1A 2RUFA 2JU5A 2K8SA 1U3AA 3SWLA 4XRDA 2I81A 1NW2A 1T7PB 4I97A 1OC3A 4P3YB 2DJ1A 3GV1A 5G5FA 4BWQA 4K7OA 4ID0A 3VI7A 4IVFA 3VWWA 3FR3A 4EDZA 2YWNA 5H5RA 1ERTA 3NIVA 4AF2A 4HZ4A 4O5RA 5AN1A 2H1DA 1NHOA 1YDKA 5CREA 4G19A 1OE8A 4DSQA 1X5CA 3DD3A 4ZL8A 2L6DA 4KCEA 2FLSA 3KH7A 4GSNA 2P5QA 5ABRA 4HU9A 3S9FA 2YJ7A 3BCIA 5IOXA 5ID2B 3ZVJD 2DSAA 5F0GA 3HXSA 2KP2A 3E3EA 1TRSA 2M46A 5ELAA 3CTGA 2FY6A 2YZHA 2R37A 1F9MA 1B48A 2VL2C 1SD9A 2LJRA 3C71A 4F9ZA 4PXOA 4G9HA 2K18A 4MF5A 2YPMA 1SJ6A 4JEDA 2VM2A 4H86A 2B7KA 2I3YA 5ID2A 5J3RA 2F8FA 3QFBC 4EDYA 4GQCA 2GGTA 1AUCA 1ST9A 1T8EB 4ZILA 2B6MA 4KSOA 1XBSA 1THXA 4CHSA 3GKKA 3KIJA 1PL2A 3DVWA 5CRGA 2RLIA 3D4TA 5DAKB 3EU3A 3UAPA 1KTEA 5AIVA 5HR2A 4JBBA 3DXBA 1PD21 5AISA 2P31A 3VK9A 4KSMA 3WT1A 1U3IA 2A2RA 4IQ1A 2H8LA 4D73B 5G2ZA 3SBCA 1HNCA 1W4VA 2MBTA 1J9BA 4XS4B 1R5PA 4BWSA 4LL4B 3VWVA 3FY7A 1IYHA 1G7OA 4NMUA 2HSYA 3I9V2 1M2AA 3GKNA 2IMEA 4MABA 3TKQA 4PX1A 2LKUA 4BPYA 2NBSA 4J56E 4FO5A 2H0HA 1HYUA 3FYGA 4DVCA 3HVXA 2KHPA 1WIKA 2H73A 5D9TA 5IOWA 5ECMB 2AUVA 1VF1A 3KMNA 4TXVA 4EUYA 3ZMKA 1DSBA 1K0AA 3TKSE 1TDIA 4IKHA 1H4OA 2CZ2A 2YANA 3ME8A 5GSSA 4IP1A 4ILFA 5CRDA 1XPVA 1X9SB 2X8HA 4TXOA 1A24A 3KMOA 3HA9A 1FAAA 1ZOFA 3RPNA 4V2MA 1M99A 2L4QA 3KP9A 4I5QA 3IAM2 2PPTA 1K0BA 5IPHA 3P8WA 1TRWA 2AYTA 1N2AA 1GTIA 2YWOA 5G30A 4BVXA 2GQMA 3F9UA 5F05A 4KAEA 2C3TA 1F3AA 1SD8A 3F4TA 3Q6OA 3DKSA 4NPBA 2BMXA 1QMVA 2R5GA 3RAZA 5LNKe 2KLXA 4O7HA 2E0QA 3Q19A 3HD5A 5DJMA 2TRCP 2EIRA 2H76A 2G0FA 4K0NA 2FHEA 1ABAA 2B7JA 3KCMA 2N5BA 3G7JA 3ZMLA 5C04A 3EYTA 2C3NA 13GSA 5CRHA 3C1RA 2LRNA 3RHCA 5B7CA 2MMAA 4ISDA 4GQFA 3I43A 2F9SA 2ON7A 2IMDA 2OACA 2C1YA 5D9VA 1FHEA 3GA4A 5J5NA 2H72A 1K0CA 3FR9A 2MBSA 4N11A 1XWKA 4F0BA 2JSZA 5H5SA 4TOPA 1XVWA 3IOSA 4J57E 5A4WA 4ECBA 1SYRA 2O87A 3APSA 3GNJA 2LRTA 1UN2A 3NOFA 1BYEA 4WF5A 2C8UA 2WB9A 4IJIA 2K6VA 3CSIA 5G31A 1XOAA 2M80A 2J9HA 1M9AA 4ECIA 4K9ZA 4MZCA 1OC9B 1GSDA 3DGQA 3IR4A 1TK0B 3TJGA 4F0CA 5B8AA 1E2YA 2LV3A 3IK9A 1YJ6A 2JZRA 3C7MA 3M8NA 4KUNA 4JU5A 1EP7A 1PQNA 2H19A 2AAWA 2XBIA 3QMXA 3IBHA 4JRRA 1FVKA 3TKSA 4ZB9A 4MLYA 4KDUA 2GVPA 5HFGA 1V40A 1SK2A 1TK5B 3HDCA 1OAZA 5DCHA 2R6KA 1K3YA 1DE2A 4I2UA 1XOBA 2VD0A 3HZ8A 3CSHA 1U6TA 5JCGA 3IHQA 2DIZA 4TR1B 1CQGA 3CMIA 1GSYA 1JFUA 2IFQA 2TRXA 1TU8A 1GSEA 1PA3A 2HRNA 2YOIA 4MP4A 4OMVA 3LWAA 1OE7A 4L0WA 2IMFA 2PBJA 1TU7A 3TJKA 3FZ9A 2IMIA 2VO4A 3OR5A 1FVJA 1PKWA 1R4WA 4HS1A 3RHBA 1SKRB 1DUGA 4POKA 3IRAA 1QXHA 2LSTA 3D22A 2YZUA 2D2ZA 3GN3A 1TK8B 2C3QA 1Z6MA 3I6AA 3BBYA 2OE1A 5ECIB 3H93A 1CQHA 3M9KA 1GRXA 3VURA 1K0MA 1LU4A 3WGEA 2FWFA 1XIYA 4XCSA 1QUWA 4XS6A 3EC3A 3LFLA 2IYJA 3V1WA 3MWHA 4BL7A 4HI7A 1V57A 2FA8A 3LYPA 2DJJA 5DDLA 4IS0A 3LXZA 4IGJA 3GSSA 4YAVA 1M2DA 2KUCA 4KE3A 2PGTA 2QC7A 5IMZA 4MJCA 3M3MA 3UMAA 5G5EA 2NTOA 1ZL9A 5FT3A 3TGZA 2A4VA 1IYIA 3IE3A 1UA5A 4WBRD 3FK8A 3O3TA 3D0ZA 4HU7A 2PVOC 2E7PA 1PKZA 4V2LA 4AGSA 4DSRA 1O73A 2B1KA 1W89A 2CVKA 2B5YA 5IO0A 2X64A 1AXDA 3LGCA 1G6WA 2OBIA 1A8LA 5DALA 1AQWA 1LBKA 2FGXA 4WEYA 1F3BA 2F3MA 3GX0A 3ERGA 3LG6A 3HY2A 2WZ9A 3U5RE 5IO2A 4KDYA 1GTUA 2H1BA 1GLPA 5HQPA 1EGRA 3L78A 1F6MC 4RI6A 4EVMA 3FEUA 2DIYA 1RK4A 1R26A 1OC8A 2FD3A 1TTZA 1XW5A 2XHFA 1GTBA 2HXKA 2E2MA 2QSIA 3UJ1A 2VM1A 1XWBA 4LMVA 2F8AA 5IMAA 3GH6A 5D96A 1XWAA 5CYYA 2YV9A 1GSFA 1XXUA 2LRCA 1TI3A 3TKPA 3GKMA 2HYXA 2DMMA 1TKDB 4MCUA 3ED3A 1TJDA 2IN3A 4IJ3A 3GL5A 3F4RA 1E6BA 3J7Yb 5CRWA 4X43A 6GSTA 3Q74A 4PNGA 5ECNB 3DEXA 3VI5A 3IPZA 1WE0A 2IIYA 2V41A 2PUKC 1MDKA 6GSXA 1YKCA 1HD2A 3IXRA 4TW5A 2H71A 4MZBA 3DMLA 3HYPA 5G1LA 6GSVA 4AJ6A 2H6YA 1Z3EA 4PNFA 2AV4A 1BAYA 4F2IA 4Q5FA 4POBA 5J9CA 3TJBA 4TKYA 2JL4A 2GTUA 1X0RA 3UIWA 2WJUA 5GSTA 3W8SA 2A2SA 3GHAA 2GSTA 2DJ3A 1EGOA 1QFNA 5JCUA 2JZSA 3E0UA 4HDEA 1A2MA 3JCML 1K0DA 1YF0A 4EXJA 2EC4A 1A0RP 1YF1A 1B9YC 1GSQA 1UVZA 4PGTA 3D5JA 3BJ5A 4L5LA 1SL1B 4NHWA 16GSA 4TR4A 3ZLPA 3EURA 5KN0A 5J9BA 1B4QA 1A8YA 1M0UA 2JACA 3NZNA 3CXGA 1TOFA 5A4VA 4JR4A 5IM9A 3US3A 2HE3A 3UVHA 1TRVA 3ZITA 2LNSA 2AHEA 1I9DA 3QCPA 3IDVA 4ZB8A 1XWGA 3LXTA 1MDJA 5A5KA 17GSA 3G7YA 3A3TA 3CRTA 4KW6A 3LORA 2R4VA 2CQ9A 3ME7A 1QGVA 4TXOB 4XS1A 2O8VB 1PN9A 4BA7A 2IPAA 4K6XA 3WD6A 1J08A 3KM6A 3UOMA 3HJPA 2B5EA 4MJEA 2GQKA 3G7IA 3VLNA 1RW1A 1DBYA 2H6ZA 1M9BA 3HCZA 1EZKA 1X5EA 2ON5A 5CNWA 4CDOA 3UVTA 3ZFBA 3F3QA 3ZL5A 2PU9C 4RUVA 5DVBA 2VCZA 5ECQB 5CAXA 1EEMA 3F3RA 5LCZA 3EE2A 3TRQA 3PINA 1PX6A 5GAND 3TUEA 6GSSA 3QDNA 4RQXA 1Z7PA 5D8IA 3A2WA 5F8BA 1EOHA 1S3AA 3ZREA 5JWOB 5JCWA 3GFKA 2FWEA 4WBJA 3FZAA 3U6VA 5A4UA 1O7UA 2FNOA 3HZ4A 3ZIJA 3KXOA 4GSTA 2HLSA 3L0HA 1A2JA 2WDUA 1JLVA 2GS3A 4X1UA 3TCOA 5HFIA 2HI7A 1OVNA 5AIXA 3EWLA 4JE1A 1GUKA 4TRXA 3APQA 2GZPA 4BVYA 4QQ7A 5IMVA 1K3LA 2XPDA 4IN0A 3F6DA 4L8EA 1V98A 1T4YA 1AIUA 1ERWA 2DMLA 3GH9A 4HQZA 5J41A 3EINA 2XPEA 3UARA 1JHBA 1USBA 2FWGA 4GRFA 3MDKA 3QPMA 3RDWA 3GTUB 3M0FA 3H8QA 1PMTA 4IELA 4JZQA 1WWJA 4MK3A 2VAFA 2OBKA 2OADA 3H4KA 4DSSA 4IHUA 2V6KA 4ULXA 3F4SA 3EU4A 2PN8A 2CA8A 5FWGA 4OD7A 4OCEA 3QAVA 4FH8A 3IV4A 5CP1A 3EVIA 3BCKA 5ECKB 4ECJA 1Z9HA 1GTAA 3GL3A 1PX7A 5D73A 4GSSA 2MMOA 4ZBAA 4MPFA 3CRUA 3ZVJA 3GTUA 2TIRA 1JZRA 4KH7A 1ERUA 3CYNA 4HZ2A 2FWHA 3APOA 1PSQA 1RQMA 2VCVA 3N5OA 2NVLA 1R7HA 4TR0A 1GNEA 4OWYA 3FZ4A 4QL7A 3EMXA 4RQRA 1XZOA 2CAQA 3DVXA 5HR3A 4IW9A 4GCIA 2VL9A 5ELGA 1MTCA 3KTBA 2QKEA 4YQVA 1SJZA 1Y25A 4WR5A 2IFQB 3KTLA 2XC2A 5F07A 1YEPA 4WKWA 4HJ2A 1YZXA 4RI7A 2L6CA 3D4MA 2YNXA 2DJKA 3TKSC 5D9XA 5D93A 5IPGA 1Q4JA 2M72A 3C8EA 1BQ7A 1AC1A 3P90A 11GSA 6GSYA 2LQOA 2WFCA 2GZYA 1FB6A 4GWRA 3IAS2 4TVEA 3AY8A 2BJXA 3C1SA 4PQ1A 5IMCA 2GT5A 3ERWA 1SENA 1NHYA 2H0IA 1KBNA 5D9WA 3FHKA 1WOUA 1BJXA 1NSWA 2MZCA 2CT6A 2WULA 2H01A 4NAXA 2R3XA 2RM6A 3TOTA 3A2XA 2V6OA 1ZZYA 5ECPB 5GZZB 2KP1A 3TJJA 1DE1A 3FZ5A 4POMA 3HVSA 1URMA 5HR1A 2RIIA 2CZ3A 3FRCA 2B1LA 3QD9A 3W8JA 2VCWA 1SU9A 1X9WB 2P0GA 2CV4A 1EV4A 3Q18A 2XBQA 3F63A 2F51A 1A0FA 1HNBA 2L5LA 2C80A 3VPQA 3MSZA 1T3BA 1EV9A 3GSTA 4ML6A 5EY6A 4HEA2 2L59A 4K2DA 4V1Ag 3O76A 3UBKA 2H0GA 2I1UA 1BX9A 3VWUA 1T00A 4POLA 3KH9A 4Q5NA 4YH2A 3ISOA 5DALB 2ZCTA 4OO4A 4E8HA 3VFIA 1XFLA 2L5OA 2VCXA 3O6TA 3F6FA 4CW9A 1XW6A 2MMZA 3GYKA 4NWYA 3WGDA 1MEKA 1TP9A 5KEJA 1WP0A 4OFMA 3K8NA 3TRXA 4AJ8A 2X8GA 5HFKA 5DCGA 8GSSA 4GF0A 4EL1A 1KEBA 4L0UA 2YWMA 3UL3A 3GMFA 4I2TA 1N8JA 2PMTA 2C0GA 3TJFA 2X99A 3GRXA 2BTOT 3FKFA 1G0TA 2HNLA 3UBLA 5EL8A 4ML1A 1VF2A 2IWTA 4KCAA 1OKDA 3GURA 2AB6A 2B5XA 1G7EA 3D21A 5AGYA 1TRUA 3P2AA 1SJIA 3IK7A 4N10A 4DEJA 2LJKA 2HZFA 1ZYEA 2WGRA 2OKAA 2O7KA 3HHVA 4XHMA 3CBUA 3DWVA 2GQLA 2E2GA 2P5RA 3F8UA 1AQVA 2YCDA 3HJMA 3M9JA 2N5FA 1XW9A 3M1GA 2H1AA 5HR0A 1JZOA 4TN8A 4N30A 2KOKA 5DQYA 1Z5YE 1MD4A 2N5AA 1K0OA 4EF0A 3H79A 5H5QA 3WYWA 6GSUA 1GL8A 2B3SA 2HRFA 2X8CA 5B8BA 2YP6A 4YQMA 2VL2A 1ZYQB 2K8VA 3BD2A 2ZNMA 3C73A 5ECHB 1K3OA 3ZTLA 1B9XC 2NDOA 2YN1A 4G2EA 1O8XA 4NXIA 2I9HA 1BG5A 4K7NA 4MZWA 2LTKA 4F82A 4OFNA 3LEFA 4PQIA 3KEBA 2GSQA 2H30A 2ALBA 2MMNA 1GSUA 3CSJA 3GIXA 2FA4A 1EOGA 4NHZA 2ES7A 4AJ7A 1O6JA 4ZBDA 2FCHA 1XWCA 1X9MB 2GLRA 6GSWA 4Z7XA 4YAPA 4IP6A 4ZL7A 5ECOB 2V1MA 2L57A 1S3DA 1MD3A 4OO5A 2IMKA 1Z7RA 4EE0A 2PVQA 1WPIA 3LQ7A 4ZB6A 3UEMA 3BOAA 2R2JA 4WF4A 1EEJA 1F37A 5LD0A 3KD0A 1EP8A 3DYRA 4Q5QA 2H66A 4LLRA 4I6XA 5ENUA 3ZZXA 4LMWA 1C72A 4PQHA 1HNAA 1YKAA 2DJ2A 4IQAA 2LUSA 2HZEB 4XIHA 2C0DA 1ML6A 4GLTA 2AJQB 5IMDA 3L9UA 4GTUA 5CO3A 4LA1A 2WRTA 1WMJA 1YEXA 1JZDA 2ZUPA 4MA9A 3L9VA 4MDCA 3MNGA 1ZCPA 5DAKA 2CAIA 3E9JB 3TDGA 1ACVA 4ACSA 3N9JA 1QQ2A 1JLWA 4OCFA 5COHA 1OYJA 5ECRB 4MF7A 2C0FA 2H74A 2VLVA 5B6NA 4X0XA 4LL1B 4ZIJA 4D73A 1VGLA 2J23A 4XS4A 2HZEA 2EIOA 3R2QA 1PGTA 1TW9A 2REMA 1SKSB 1BEDA 1M2BA 4FIWA 1YQ1A 1V9WA 5C00A 4K1FA 3ERFA 2GSSA 2YV7A 2GZZA 2WCIA 5INYA 1THOA 4FYUA 1U87A 9GSSA 3A5WA 1VRSD 1MDIA 3FR6A 5E4WA 4NV2A
chains in the Genus database with same CATH superfamily
5F06A 3EBTA 3S5CA 4EC6A 2V1LA 14GSA 5IEPA 1TFOA 2IL3A 4KFFA 1ERVA 3QFAC 2HMLB 1KD14 2VOCA 1GULA 2C4JA 5E59A 4CPKA 2L4CA 1GH2A 3FF0A 1MGWA 19GSA 3H1NA 4PURA 4DSSB 4WR4A 5IIZA 1V58A 1TTOA 1IV9A 3K5TA 1VQO3 2CX4A 4ZL9A 4N0VA 5BXQA 3NBRA 3WDGB 1U88A 4XTSA 2LS5A 3LT8A 1PRXA 4N0ZA 3ZRDA 4ZXGA 3KJYA 3ZIVA 1SIIA 3K7CA 3FG3A 1I0XA 5IENA 3H51A 1K8A4 4HJMA 2JDIH 3MHEA 1QVG2 2OCTA 4KA0A 1FUTA 2K54A 5HOHA 4FYBA 4I8BA 4KGIA 1D6UA 1K0NA 3KP8A 3EF8A 22GSA 1YIJ3 3GX8A 3D5IA 4MEIA 1OGXA 1FGRA 2HT9A 2V32A 3TKRA 3F0IA 2VCTA 1X5DA 3ZYWA 5KN3A 4K7IA 1DVCA 4HOJA 1FO5A 2DBCA 2O89A 4BU4A 1YNVX 4BIKA 1JN5B 1UUGB 4MH3A 2CWTA 1PL1A 1TUHA 1FB0A 4EC0A 1C54A 2OE0A 4FMBA 4K8MA 2YJHA 2DC5A 1O85A 2NPBA 1X1WA 1TFKA 1ON4A 1PFPA 1YI23 2OA7A 4O32A 4TR3A 1BNFA 3UNLA 3X3YA 1SL2B 1N5PA 2LQQA 3FW2A 3LW9A 3QAWA 5J4UA 10GSA 2VUPA 1SK1A 3CQFA 1GLQA 3CPW2 1GUMA 1KSIA 1LJRA 3IC8A 4MH2A 4WYKB 2G2QA 1SYXA 4QWTA 3PH9A 1B2SA 4HQSA 1BOXA 2H75A 1JN5A 2LNTA 1B4PA 3WA2X 2JADA 1BNRA 1GUHA 4WETA 4JR6A 3HJOA 1LNHA 3DGOA 3ZFLA 5BVBA 3LJRA 5STDA 3U97A 3F9SA 2XGNA 3L4NA 2XFSA 3CTFA 2WOHA 3T8UA 2CK3H 1ROAA 4Q5RA 4L5OA 4F03A 2CC3A 2W2CA 1JZWA 1FW1A 1GSSA 3TOUA 2LEGA 2I4AA 2P0XA 2EIQA 2P05A 1Q824 3F40A 1EWXA 4KB3A 5IQYA 5M1AA 4MJAA 2FUG2 1F8NA 3BNCA 4WYKA 4K2XA 1TXXA 5G1KA 4L8OA 2E2TA 1BRHA 3I69A 1OC9A 1GNWA 2FXTA 4FCMA 1BAOA 3F7SA 3F7XA 3KSED 5AEWB 2OJLA 2VL3A 1F2EA 1S3CA 2HSHA 3LSZA 4G10A 4HM0B 2WS2A 5EVOA 2CKFB 1H75A 2VLTA 4V2NA 3RBTA 3NBJA 3LYKA 1GWCA 3GUSA 3CPOA 3RPPA 1UGHI 2MC8A 5JWRB 5KP1A 4XBTA 3HVVA 5FHIA 1HQOA 4KZ1A 1S3RA 2OE3A 2GT6A 4Q53A 2H1GA 4YQUA 3TB2A 4X4JA 2HSMA 3VPTA 1A2LA 4FYCA 3HX8A 1SL0B 2LJAA 4WXTA 4MPGA 4E8EA 1HKXA 2I9WA 4KNDA 2CVBA 2YWIA 1I0VA 4HAAA 2W6JH 2MYGA 1Y6EA 5DBQA 2BU4A 1SKWB 3GZRA 2RM5A 7GSSA 5TGNA 5EPFA 2E2VA 2XSHB 2VCQA 3KZQA 1IVXA 4ECCA 5B6MA 1VF4A 1T4ZA 1V2AA 1Q98A 1TP6A 3JUPA 1ZYNA 2CVDA 3QR6A 3QAGA 5IMFA 1US1A 1AAZA 3MAKA 4OFTA 1FOVA 1VQ83 4K0GA 5DQSA 4HUAA 1J0FA 2K0MA 4O92A 1SK0A 2IJYA 3AGOA 4V1Ap 3W6GA 1AW9A 3PGTA 1GP1A 3HI7A 4TR1A 4XRAA 3A2VA 2C0EA 1T1VA 2QA2A 1Z6NA 2Z9SA 3IC4A 2JZTA 1BRNL 3LTDA 5ECSA 2F56A 1B8XA 6RNTA 1O8WA 4EKZA 2DJ0A 1QK8A 3S67A 1O81A 3PYJA 4HZ9B 2VIMA 1M7TA 1VF3A 3WGXA 4R9KA 3JUOA 3T0UA 1FG4A 1VQM3 1BSEA 2KF3A 2PWJA 4EXRA 1LQMB 2CFGA 1ISKA 3EMPA 4IBPA 4KX4A 4NV5A 4PUAA 1MWUA 1RCLA 1CQSA 2W9PA 3DRNA 4LMIA 3G9BA 5KN2A 2Y73A 3KGKA 4XDWA 4MF6A 1R5AA 2HFDA 4A5PA 2KF4A 3OW22 2IA7A 1WJKA 1AQXA 1ZYPA 4MMMA 4AEQA 3PR8A 4EO3A 1DE3A 1A23A 18GSA 2PERA 1G6YA 2O85A 3HKRA 4ZBBA 5KN1A 1OF5A 1XVQA 2K9FA 4MJBA 4KDXA 4HM3B 1EQKA 3QOUA 2JSYA 5GAPD 4HM6B 1IDPA 3WT2A 2DLXA 3K9MC 1I2EA 1UCLA 3GKXA 3Q3FA 5DJLA 1ILOA 3P7XA 1OKTA 3L9SA 5L71A 2VLUA 3X41A 3IA1A 4PUFC 2H6XA 2IY2A 3TRPA 2ML6A 1ZMAA 3DIEA 5JWQB 3FKAA 2H70A 2RUEA 5ECLB 2OTJ3 2GDRA 4QL9A 12GSA 20GSA 3D6IA 1YY7A 1I5GA 2QIYA 1WRYA 4L8PA 1ZGNA 1SQWA 4CJNA 2QGVA 1KNGA 1XCCA 4J2FA 4WP5A 1UC7A 2GSRA 2BMRB 4EV2A 2V2GA 2CX3A 1RN7A 3VWXA 5KP3A 4GXZA 1TI1A 4N6NB 1RNBA 1BIRA 4KFEA 5CXOA 3J7Yk 1NM3A 2VD1A 4HM8B 1J2BA 2RUFA 2JU5A 3IMAB 2K8SA 1U3AA 1AR0A 2RNTA 3SWLA 4XRDA 5AYRB 2I81A 3UB1A 5AEUB 1NW2A 1T7PB 3GZBA 3Q1CA 4I97A 4LGQA 1OC3A 3WA3A 4P3YB 2YFLB 3RGRA 2DJ1A 3GV1A 5G5FA 4BWQA 4K7OA 4ID0A 3VI7A 1A90A 1SPUA 4IVFA 3VWWA 3ALAA 2HMOB 4O02B 3FR3A 3PCSA 4EDZA 3UL5A 2YWNA 5H5RA 1ERTA 3NIVA 2QEX3 4AF2A 4HZ4A 1WQLB 4O5RA 1NWWA 5AN1A 1W2ZA 2H1DA 2KXGA 1NHOA 1N8QA 1YDKA 5CREA 4G19A 1OE8A 4DSQA 1X5CA 3DY5A 3DD3A 4ZL8A 2L6DA 4KCEA 1KC84 2FLSA 3KH7A 4GSNA 2P5QA 5JPPA 4HU9A 5ABRA 3S9FA 1RSNA 3EBYA 2YJ7A 9RNTA 1VQ53 1NDOB 2GXFA 3BCIA 3T8NA 5IOXA 5M18A 5ID2B 3PPUA 3ZVJD 2DSAA 1JNQA 5F0GA 3HXSA 2KP2A 3E3EA 1TRSA 2M46A 1ROVA 5ELAA 3DGYA 3CTGA 1RGCA 3ROBA 2FY6A 2YZHA 1G02A 3GWRA 2R37A 1F9MA 2XGLA 5AIGA 2LQVA 1B48A 1IQ8A 2VL2C 1LOVA 1SJWA 1BANA 1SD9A 2LJRA 3C71A 4F9ZA 4PXOA 4G9HA 2CX1A 1E3VA 2K18A 4MF5A 1AVKA 1VQK3 4Z2RA 3FG4A 1FGMA 3CC43 1SJ6A 2YPMA 4JEDA 1MWRA 4WHAA 3D3LA 8CHOA 2VM2A 4H86A 2CIUA 2RGQA 2B7KA 2I3YA 5ID2A 5J3RA 3RDEA 4HSCX 2F8FA 2RSXA 3QFBC 4EDYA 4GQCA 1UCKA 3HZPA 2GGTA 5CLKA 3G6E3 1AUCA 1ST9A 1CYUA 3QRDA 1T8EB 4ZILA 3CD63 2HMNB 2B6MA 4KSOA 3Q2PA 1N5HA 1THXA 1XBSA 4CHSA 1VZZA 3GKKA 3HOHA 3KIJA 1PL2A 3DVWA 5CRGA 2W56A 2RLIA 1A2VA 3D4TA 1I3IA 5DAKB 3EU3A 3UAPA 2OTL3 2AAEA 1KTEA 3NXJA 5AIVA 5HR2A 4JBBA 1UW1A 4RNYA 3DXBA 1PD21 5AISA 2P31A 1FGQA 3VK9A 2R0GA 4K5SA 4KSMA 3WT1A 1U3IA 1S5AA 2A2RA 4IQ1A 2H8LA 4D73B 5G2ZA 3SBCA 1HNCA 1W4VA 2MBTA 1I70A 4N6V0 1J9BA 4XS4B 1IV7A 1R5PA 4AKYA 4BWSA 4LL4B 2C10A 3VWVA 5IEOA 3FY7A 1IYHA 2CH9A 1G7OA 4NMUA 1RNTA 2AADA 2HSYA 4Z2TA 3I9V2 4LYLB 1M2AA 3GKNA 3MIXA 1GMRA 2HOHA 2IMEA 4MABA 3TKQA 4RNTA 4PX1A 3GSPA 2LKUA 1BNIA 4BPYA 4EV5A 2UX0A 2NBSA 1BGSA 1FUSA 1WMPA 4J56E 1W01A 4XM4A 4FO5A 2H0HA 1HYUA 1VQP3 2RCDA 3FYGA 4DVCA 3HVXA 4BL2A 1U5OA 2KHPA 1WIKA 2H73A 3DGMA 5D9TA 5IOWA 4EBGA 3RNTA 1UI7A 5ECMB 2AUVA 2CW9A 4G0KA 1VF1A 3KMNA 4TXVA 5FGOA 2P0MA 3ZMKA 4EUYA 4BVXB 1RLSA 1CH0A 1AVLA 4L7KA 1DSBA 1K0AA 1W2B2 3TKSE 1TDIA 4IKHA 1H4OA 1UCJA 2CZ2A 2YANA 3ME8A 4YKGA 5GSSA 4IP1A 3LH4A 4ILFA 3SOYA 1XPVA 5CRDA 1X9SB 2X8HA 4TXOA 1A24A 3CU3A 2OQEC 3KMOA 3HA9A 3BIRA 1FAAA 1ZOFA 3RPNA 1N9EA 4V2MA 1SARA 2BIRA 1M99A 2Z77A 2L4QA 2QGUA 3KP9A 4K61A 4I5QA 3IAM2 1YJN3 1RGKA 2PPTA 1K0BA 5IPHA 1LQGC 3P8WA 1TRWA 2AYTA 4IIAA 3VF1A 3S29A 1N2AA 3JUQA 1GTIA 2YWOA 5G30A 4BVXA 1Q42A 2GQMA 3F9UA 5F05A 4KAEA 2B1XB 2C3TA 5RNTA 1F3AA 1SD8A 3F4TA 3Q6OA 1YGEA 3DKSA 4NPBA 3D79A 4J9AA 2BMXA 1O7GB 1QMVA 2R5GA 3RAZA 5LNKe 2KLXA 4O7HA 2E0QA 3Q19A 3HD5A 5DJMA 4GL6A 2TRCP 1HYFA 2EIRA 2H76A 2G0FA 3CXC2 3NM7A 1RGHA 4K0NA 1AQZA 2BHMA 2FHEA 1ABAA 1Q9EA 5ELJA 4HJLB 1RN4A 2B7JA 3B7CA 1YVBI 3IJEB 4HYZA 3KCMA 2N5BA 3G7JA 3ZMLA 1M904 1GMPA 5C04A 1Q40A 4GB5A 3EYTA 1BSAA 2C3NA 3OWUA 13GSA 5CRHA 4HVNA 3C1RA 1Q7Y4 2LRNA 3RHCA 1MOLA 5B7CA 2MMAA 4ISDA 4GQFA 1NB5I 2YFJB 2UZ8A 3I43A 5D81A 3LZAA 2F9SA 2XH9A 4GSPA 1Q814 2ZHXB 1N8R4 1OH0A 2ON7A 1NNVA 2IMDA 2OACA 1WTHA 2CFDA 1FHEA 2C1YA 1W7CA 1OGZA 3GA4A 5D9VA 1DYUA 3KN4A 5J5NA 2H72A 1K0CA 4O2HA 3FR9A 1JRQA 1RRHA 2IUKA 2MBSA 4N11A 1XWKA 1JJ22 3DMCA 4F0BA 2JSZA 5H5SA 4TOPA 3DH2A 1XVWA 3IOSA 4J57E 5A4WA 4ECBA 4HM2B 1PY3A 1SYRA 2O87A 2UGIA 4H3UA 3APSA 1LRAA 3GNJA 3G16A 1W6CA 3CCQ3 3FLJA 4CCVA 2LRTA 1STDA 3CME3 2F86B 1UN2A 1BYEA 3NOFA 4WF5A 2C8UA 1B2UA 2PZVA 1T2IA 2WB9A 4IJIA 2K6VA 3FH1A 3CSIA 5G31A 1XOAA 1K28A 2M80A 2J9HA 1M9AA 4ECIA 3ZFZA 4K9ZA 4MZCA 1OC9B 2F5MA 1STFI 3AMOA 1GSDA 3DGQA 1PFOA 3IR4A 1TK0B 3TJGA 4F0CA 4R9LA 5B8AA 1E2YA 1B27A 1YJW3 3WODG 2CHCA 1BSBA 3MSOA 2LV3A 1CEWI 3IK9A 1YJ6A 2JZRA 3C7MA 4JRFA 1W5ZA 3M8NA 4KUNA 4JU5A 1EP7A 1PQNA 2H19A 3D9RA 2AAWA 2XBIA 1B20A 3MG2A 3QMXA 3EN1B 3IBHA 4JRRA 1FVKA 3TKSA 3AHWA 3LYGA 4ZB9A 4MLYA 4KDUA 2GVPA 5HFGA 5HGRA 1V40A 1SK2A 3EN8A 3AGNA 4GHOA 1TK5B 3CCV3 2Z76A 3HDCA 1S723 1OAZA 2XFTA 4FMAA 1Q864 1RGLA 1ZX2A 3SVAA 2R6KA 3UL6A 5DCHA 1BNJA 1NO3A 1K3YA 1DE2A 4I2UA 1XOBA 2QA43 2VD0A 4O8SA 3HZ8A 3CSHA 1BRGA 1U6TA 5JCGA 1FGOA 3IHQA 2DIZA 4TR1B 1CQGA 2BMQB 3CMIA 4ORLA 1GSYA 1JFUA 2IFQA 2TRXA 3CCS3 4PTSA 3CCU3 5AIHA 1TU8A 1GSEA 1PA3A 1G96A 2HRNA 4XBYA 2C4BA 2YOIA 2HMKB 1A2KA 4MP4A 4OMVA 3LWAA 1OE7A 4L0WA 1D6YA 2IMFA 1TU7A 2PBJA 3FZ9A 3TJKA 2IMIA 1M3IA 2VO4A 3I563 3OR5A 1FVJA 1PKWA 1R4WA 3FZWA 4BL7B 4HS1A 3RHBA 1SKRB 3V92A 1DUGA 3BB9A 2O9UX 1FOHA 4POKA 3IRAA 1QXHA 2LSTA 1RJOA 1K9M4 3D22A 2YZUA 2D2ZA 3GN3A 1TK8B 1OF5B 2C3QA 1Z6MA 3I6AA 3BBYA 2OE1A 3PXMA 5ECIB 4G0IA 5BU4A 3H93A 1M9GA 1CQHA 3M9KA 5IG5A 3CCJ3 3CC73 1GRXA 4J5KA 3VURA 1K0MA 1LU4A 1GSPA 3WGEA 2YX9A 1GMQA 1OHOA 3MYTA 2FWFA 1XIYA 4XCSA 1QUWA 4XS6A 1BVIA 3EC3A 3LFLA 2IYJA 3V1WA 2F5WA 3MWHA 4BL7A 4HI7A 2GU3A 3LOYA 1V57A 2FA8A 1FYSA 4HM1B 4FCZA 3LYPA 2DJJA 5DDLA 1GY6A 4IS0A 1RHLA 3LXZA 1BRSA 4O3VA 3DGLA 2GEYA 4MJDA 4IGJA 3GSSA 1UUVB 4YAVA 1M2DA 2KUCA 4KE3A 2PGTA 2IUJA 2QC7A 5IMZA 4MJCA 1K41A 3M3MA 3UMAA 5G5EA 2NTOA 1ZL9A 4JF8A 5FT3A 3TGZA 2A4VA 1WNHA 2Z7AA 2F98A 1IYIA 3IE3A 1UA5A 3HVNA 4WBRD 1X1XA 3NM2A 3FK8A 3O3TA 1NU3A 3D0ZA 4HU7A 2PVOC 2E7PA 1PKZA 3BNDA 4V2LA 4AGSA 4DSRA 1SIHA 1O73A 3CNMA 2B1KA 1W89A 2CVKA 2B5YA 5IO0A 2X64A 2JQ5A 1AXDA 1LOWA 2XSOB 3LGCA 4HM4B 1G6WA 2OBIA 1A8LA 3LMLA 5DALA 1AQWA 1LBKA 2FGXA 4WEYA 1JBSA 1F3BA 2F3MA 3GX0A 1VQL3 3ERGA 3LG6A 1C7HA 3HY2A 2WZ9A 2R4IA 3U5RE 2Y74A 5IO2A 1GY5A 6GSPA 5IG0A 4KDYA 4WWUC 1GTUA 3CCM3 2H1BA 1GLPA 5HQPA 3QK9A 5AIIA 1EGRA 1WMNA 3L78A 4U13A 5BIRA 1F6MC 4RI6A 4EVMA 1OACA 2SBLA 3FEUA 2DIYA 1EA2A 1RK4A 3FF2A 1R26A 1OC8A 2FD3A 3FG1A 4EYCA 1TTZA 3KFQC 1XW5A 1IT7A 2XHFA 1GTBA 2HXKA 2E2MA 2QSIA 3UJ1A 2VM1A 2XEPA 1XWBA 4LMVA 2F8AA 4AKZA 5IMAA 3GH6A 5BRTA 5D96A 2BNGA 5AI1A 4NHFA 1XWAA 5CYYA 1ZS7A 2GBXB 2YV9A 1GSFA 1XXUA 2LRCA 1O7PB 1W02A 2KF6A 3EB8A 1TI3A 3TKPA 3GKMA 2HYXA 2OOVA 2DMMA 1RN1A 1TKDB 1GOVA 4MCUA 3ED3A 1TJDA 2IN3A 4X2OA 4IJ3A 1RGEA 3GL5A 3NV0A 2XRXB 3F4RA 1E6BA 3NQZA 3J7Yb 5CRWA 4X43A 6GSTA 3Q74A 4PNGA 3KSPA 7STDA 5ECNB 3DEXA 1LOYA 3VI5A 3IPZA 1WE0A 2IIYA 3WR2A 2V41A 2PUKC 4MMYB 1MDKA 3F14A 1I2GA 2MF7A 1YKCA 2BT3A 6GSXA 1XG8A 1HD2A 3IXRA 4TW5A 2H71A 4MZBA 3DMLA 3HYPA 5G1LA 5EEOA 5ELUA 4ICYA 6GSVA 4KVHA 2L1SA 4AJ6A 4FMCA 3PZWA 2H6YA 1Z3EA 4PNFA 3O8YA 2W56B 1BUJA 2AV4A 1BAYA 1BRIA 3N8BA 2ML5A 4J8TA 4F2IA 5KOXA 5GSPA 4Q5FA 4POBA 5J9CA 3TJBA 4CY6A 4TKYA 4G0LA 1DMNA 1U8CB 3M8CA 2JL4A 3MG1A 1NJI4 2GTUA 1X0RA 1W6YA 3E99A 2WO0A 3UIWA 2WJUA 5GSTA 2ZA4A 1IVWA 3W8SA 4BL3A 2A2SA 3GHAA 2GSTA 2BO9B 2DJ3A 3SX1A 1EGOA 2SARA 1QFNA 5JCUA 2GEXA 2JZSA 3E0UA 1UDII 4HDEA 1A2MA 3JCML 1K0DA 5D83A 1YF0A 4EXJA 1K734 4MNNA 2EC4A 2FNQA 3V99A 1A0RP 1OUNA 1YF1A 1B9YC 1GSQA 1UVZA 4PGTA 3D5JA 3BJ5A 4L5LA 3A76A 1PYLA 1DVDA 3LXUX 1SL1B 1TU5A 4STDA 4G1MB 4NHWA 16GSA 4TR4A 3ZLPA 3PCRA 3EURA 1UCIA 5J9BA 5KN0A 1B4QA 1A8YA 1M0UA 5KOWA 2JACA 1FGTA 3NZNA 3CXGA 1TOFA 4HM7B 5A4VA 3N54B 4JR4A 5IM9A 3KKGA 3NHXA 4R80A 4OUQA 3OXAA 2R0CA 3MWZA 3US3A 1JV2B 2HE3A 1IU7A 1QAFA 5D82A 3UVHA 1TRVA 3WOFB 3ZITA 1UI8A 2W9QA 2LNSA 2AHEA 1I9DA 3QCPA 3IDVA 4ZB8A 3G0KA 3SXXA 3KZTA 1GY7A 1XWGA 3LXTA 1MDJA 5A5KA 2Z6BA 1PN0A 2A2PA 3LTAA 17GSA 3R3EA 3G7YA 3A3TA 3CRTA 5IW9A 4TX4A 4KW6A 2HMJB 3LORA 2R4VA 2CQ9A 3ME7A 1QGVA 4TXOB 4XS1A 2O8VB 2P09A 1PN9A 4BA7A 3DUKA 2IPAA 1KWIA 4K6XA 3LTBA 3WD6A 1J08A 3I553 2ZDJA 3KM6A 3MYDA 3UOMA 2KCDA 3HJPA 2B5EA 4EW5A 4MJEA 2GQKA 3G7IA 3VLNA 3ZG0A 1RW1A 1IVVA 1DBYA 2H6ZA 4KF9A 3OWYA 1M9BA 3HCZA 1EZKA 3X3ZA 2R41A 3OWSA 2GSPA 3CCR3 1X5EA 2ON5A 5CNWA 4CDOA 3UVTA 3ZFBA 3F3QA 3ZL5A 2PU9C 4RUVA 5DVBA 2VCZA 4N6MA 5ECQB 5CAXA 1EEMA 1EUIC 3F3RA 5LCZA 3EE2A 1E3RA 4BIRA 3TRQA 3PINA 4OK0A 1PX6A 5GAND 3TUEA 6GSSA 3EX9A 3RGAA 3QDNA 4RQXA 1Z7PA 5D8IA 3A2WA 5F8BA 3JVCA 5AIFA 1EOHA 3VSYA 1S3AA 3ZREA 7RNTA 2L4VA 5A0OB 1VQ43 3SLUA 3J7Yd 1GOUA 1VQN3 5JWOB 1Q40B 1D6ZA 5JCWA 5EQLA 1FW7A 3GFKA 2FWEA 4WBJA 1ZO2A 3FZAA 1L5GB 3U6VA 4BTXA 5A4UA 3PS8A 1O7WB 3DZLA 3BLZA 1O7UA 4XBXA 2X4AA 2D1WA 4EIPA 1BRKA 2FNOA 1OHPA 3HZ4A 1BSCA 3G4S3 3ZIJA 3KXOA 2HLSA 3L0HA 4GSTA 1A2JA 2P38A 1YIT3 1GOYA 2WDUA 4HZBB 1OCVA 4WFOA 4ZM8A 1JLVA 2GS3A 4X1UA 3TCOA 5HFIA 3NUVA 2HI7A 1OVNA 5AIXA 1ASKA 3EWLA 4JE1A 3KE7A 1GUKA 3D4AA 4TRXA 3APQA 2GZPA 2CFKA 4BVYA 4QQ7A 5IMVA 4HOHA 1K3LA 2XPDA 4IN0A 2HRKA 3F6DA 3ZG5A 3WHOA 5JBSA 4L8EA 1V98A 5IG3A 2WGOA 1T4YA 1AIUA 1ERWA 2DMLA 1DETA 3GH9A 1JB4A 4HQZA 4K1VA 5J41A 5KP4A 3EINA 2XPEA 3EJVA 3UARA 1JHBA 1ZGXA 1USBA 3FSDA 3AMOB 2FWGA 2M7OA 4GRFA 3MDKA 3QPMA 3RDWA 1B21A 4BTWA 3GTUB 1QAKA 3H8QA 3M0FA 1FUWA 1PMTA 3DM8A 4IELA 4JZQA 1WWJA 3X42A 4MK3A 2VAFA 2OBKA 2OADA 2XF3A 3H4KA 4DSSA 4IHUA 2V6KA 4ULXA 3X40A 3F4SA 3EU4A 2PN8A 2CA8A 5FWGA 4I4KA 5CF1A 4OD7A 4OCEA 3QAVA 2CWUA 4R4KA 4FH8A 3IV4A 5CP1A 4OVMA 2J8XB 3EVIA 1I3FA 3BCKA 5ECKB 4ECJA 2KAAA 1UGIA 2OWPA 3SEDA 1Z9HA 1GTAA 3GL3A 1MNLA 1PX7A 5D73A 4GSSA 1RGGA 5M19A 4LSOA 4R1KA 2MMOA 4ZBAA 2RBIA 4MPFA 3MPHA 4K1UA 3NQYA 4J5GA 3CRUA 3ZVJA 3GTUA 1AV4A 4XB5A 2HMMB 7GSPA 2TIRA 1BU4A 1JZRA 5BMUA 4IPBA 1BSDA 4KH7A 2STDA 1ERUA 3CYNA 4HZ2A 2FWHA 1HU9A 3APOA 1PSQA 1RQMA 2VCVA 3N5OA 2NVLA 1R7HA 4TR0A 1GNEA 4OWYA 4KT3B 3X3XA 3FZ4A 4QL7A 3EMXA 4RQRA 1B2XA 1XZOA 2CAQA 3DVXA 3GRDA 5HR3A 4IW9A 4GCIA 2VL9A 5ELGA 1IYYA 5G2GA 1MTCA 3KTBA 2GU1A 2QKEA 4YQVA 1SJZA 1Y25A 4WR5A 2IFQB 3KTLA 2XC2A 1KQS2 1M1K4 5F07A 1YEPA 1B2ZA 4WKWA 2PNCA 4HJ2A 5IERA 1BUQA 1YZXA 3Q90A 5DRVA 4RI7A 2L6CA 3LT9A 3D4MA 2YNXA 2DJKA 3TKSC 2KF5A 5D9XA 2CFWA 5D93A 5IPGA 1Q4JA 2M72A 4K5RA 3C8EA 1RKYA 1BQ7A 1AC1A 3P90A 11GSA 6GSYA 3EC9A 6STDA 2LQOA 2WFCA 2GZYA 1LOXA 1MWSA 1FB6A 1E97A 4GWRA 1IQYA 3IAS2 3DXOA 4TVEA 1RTUA 3AY8A 3OX9A 2BJXA 1TIJA 3C1SA 1IVUA 4PQ1A 4CY8A 1O7MB 1W4NA 2C11A 2GT5A 3EPTA 5IMCA 1I2FA 3ERWA 3L0RA 3S27A 2R0PA 1SENA 1NHYA 2H0IA 2IMJA 1KBNA 5D9WA 3FHKA 1WOUA 1BJXA 1NSWA 2MZCA 3HIIA 2CT6A 2WULA 1LXEA 2H01A 3NBBA 4NAXA 2R3XA 2RM6A 3TOTA 3A2XA 2V6OA 1ZZYA 5ECPB 1TRQA 5GZZB 5IF6A 2KP1A 4N6OB 3TJJA 3U1WA 3CC23 1DE1A 3FZ5A 4POMA 1Q7HA 3F8HA 3HVSA 1URMA 5HR1A 2RIIA 3BNBA 2CZ3A 3FRCA 3JUMA 4CDLA 5AYSC 2B1LA 3QD9A 3W8JA 2VCWA 2DKIA 1SU9A 1I8VA 3GZXB 3STDA 2P0GA 1X9WB 2QA1A 1QJGA 2CV4A 1EV4A 3Q18A 2XBQA 3F63A 8RNTA 2F51A 1A0FA 3PGBA 3FMWA 1HNBA 2L5LA 1OPYA 2C80A 3VPQA 3MSZA 1T3BA 4MMXB 1EV9A 3GSTA 4ML6A 1RCKA 1GS3A 3IPTA 5EY6A 1T5YA 4HEA2 2L59A 4HM5B 4K2DA 4V1Ag 3O76A 3UBKA 2H0GA 3BNEA 2I1UA 1BX9A 4O5UA 3VWUA 1T00A 1UUWB 3S28A 4K90B 4POLA 2D42A 3KH9A 3HK4A 4LZIA 1GYBA 3K0ZA 4Q5NA 4YH2A 1FZUA 5CK6A 3ISOA 1BNSA 5DALB 2ZCTA 1N9JA 3KIIA 4OO4A 4E8HA 3VFIA 1HZ1A 1M1XB 3A5IA 3NX0A 1XFLA 1QMAA 2L5OA 2VCXA 3O6TA 3F6FA 4HKVB 4CW9A 1XW6A 4EIQA 2CWVA 2A4HA 2MMZA 2BMOB 3GYKA 4NWYA 1ULJB 3WGDA 2WGQA 1VQ73 1MEKA 3FGYA 1TP9A 5KEJA 4O5QA 5LC6A 1WP0A 3G8ZA 2CFLA 4KFDA 4OFMA 3EQQB 3K8NA 3TRXA 1GD3A 5LC7A 2CG0A 1VQ63 4AJ8A 3VGNA 2X8GA 3LTCA 5HFKA 1JB5A 2O3OA 5DCGA 8GSSA 4GF0A 4EL1A 1KEBA 4L0UA 2YWMA 1IT8A 3UL3A 3GMFA 4I2TA 3DGNA 1N8JA 1EG9B 2PMTA 2Q07A 3H3HA 1RGAA 2C0GA 3TJFA 1X1UA 2X99A 3GRXA 3NV0B 3A5EA 2BTOT 3FKFA 1G0TA 4HBRA 2HNLA 3UBLA 2RFRA 5EL8A 4ML1A 1VF2A 2IWTA 4KCAA 1OKDA 3GURA 3MG3A 1A67A 2AB6A 2B5XA 3B8LA 1G7EA 3D21A 5AGYA 1TRUA 3P2AA 1SJIA 3IK7A 1MGRA 4N10A 1DMQA 1BNEA 4DEJA 2LJKA 2HZFA 1ZYEA 3B4OA 4DKIA 2WGRA 1AY7A 2OKAA 3HIGA 2CX0A 5JPUA 1EKMA 2O7KA 3HHVA 4XHMA 2YFIB 1BNGA 3CBUA 4MMZB 3DWVA 3K63A 2GQLA 2E2GA 1R4YA 2P5RA 2DKHA 3EE1A 4N6TA 3F8UA 1AQVA 2YCDA 3HJMA 3M9JA 1T2HA 1XW9A 2N5FA 4N3VA 3M1GA 4FMDA 2OOVC 2H1AA 1W00A 5HR0A 1BRJA 1Z1SA 1JZOA 1NB3I 4TN8A 4N30A 4NREA 5CF2A 1JB2A 2KOKA 5DQYA 1Z5YE 1MD4A 1Y4KA 2N5AA 3WOEB 1K0OA 3CCL3 4EF0A 3H79A 1V74A 2GBWB 1B2MA 5H5QA 3WYWA 6GSUA 1GL8A 2B3SA 1QVF2 2HRFA 2X8CA 3FCSB 1B3SA 5B8BA 2YP6A 1VQQA 4YQMA 2VL2A 1ZYQB 1YGWA 5FW5A 2K8VA 3BD2A 2ZNMA 3C73A 5ECHB 1K3OA 3ZTLA 1B9XC 3G713 2NDOA 2YN1A 1MWTA 4G2EA 2INXA 4X2HA 4H61A 4N6LA 1OHSA 3KCHA 1O8XA 2K3DA 2W03A 3CMA3 1R4CA 4NXIA 2I9HA 2A15A 1BG5A 4K7NA 1JKGB 4MZWA 2E2UA 1O7HB 1YVSA 2LTKA 1RMSA 4F82A 3URPA 1LVNA 4OFNA 3LEFA 3KEBA 1X1YA 2GSQA 2H30A 2ALBA 2MMNA 4PQIA 1GSUA 1W6GA 3ER7A 3CSJA 3GIXA 2FA4A 1EOGA 4NHZA 4PEJA 2ES7A 2X49A 4AJ7A 1O6JA 4ZBDA 2FCHA 1XWCA 1X9MB 2F4YA 2GLRA 6GSWA 4Z7XA 4YAPA 1GD4A 4IP6A 4ZL7A 4RBNA 4FQUA 5ECOB 2V1MA 2L57A 5IG4A 1S3DA 2LYXA 1MD3A 1IK3A 5DREA 3GAXA 4IT7A 4OO5A 2B24B 2IMKA 1Z7RA 4EE0A 2PVQA 4LEHA 1WPIA 3LQ7A 4ZB6A 3V98A 1JKGA 3UEMA 3BOAA 2R2JA 3D5GA 4WF4A 3F8XA 1EEJA 2HRAA 1VQ93 1F37A 5LD0A 3KD0A 4XDVA 1EP8A 3MKIA 3UJMA 3DYRA 5I97A 4Q5QA 2KRTA 2H66A 4RZMA 4I6XA 4LLRA 5ENUA 1CYVA 3ZZXA 4N6UA 3SOAA 4LMWA 1C72A 4PQHA 4BTYA 1YJ93 1HNAA 1YKAA 2DJ2A 4IQAA 4Z2UA 2LUSA 2HZEB 1O7NB 1YHQ3 4XIHA 2C0DA 1ML6A 1PU4A 4GLTA 4FCJA 3AHSA 3CCE3 2AJQB 5IMDA 3L9UA 1ULIB 4GTUA 5CO3A 4LA1A 2WRTA 1WMJA 1YEXA 1JZDA 2ZUPA 3WMDA 4MA9A 3L9VA 4MDCA 3MNGA 4USSA 1ZCPA 5DAKA 1JBRA 2CAIA 2F99A 3E9JB 1WMOA 3N9HA 3GZYB 3TDGA 5EVHA 1ACVA 4ACSA 1A2PA 2UUGC 1QQ2A 1IQXA 3N9JA 1JLWA 1RRLA 4RNZA 4OCFA 5COHA 2W04A 3EHCA 1OYJA 5ECRB 1RGFA 4MF7A 2C0FA 2H74A 2VLVA 1QALA 2W0QA 3BU4A 5B6NA 1TRPA 4LL1B 4X0XA 4ZIJA 3OV4A 2WOFA 4D73A 1VGLA 2J23A 4XS4A 4FR9A 2HZEA 1DMMA 1JBTA 2EIOA 3R2QA 2CG1A 1LNIA 1PGTA 3IHGA 1TW9A 2REMA 1SKSB 1BEDA 3B4PA 1M2BA 4FIWA 1YQ1A 1V9WA 2ZL8A 5C00A 4K1FA 2OQEA 3ERFA 2GSSA 1RDSA 2YV7A 2GZZA 2WCIA 5INYA 1THOA 4YKFA 3ECFA 2FGTA 4BVYB 3SYUA 3JUNA 4FYUA 1U87A 9GSSA 3A5WA 1M3JA 1VRSD 2XR8B 1MDIA 3I0YA 3FR6A 1FA3A 5E4WA 3CNXA 4NV2A
chains in the Genus database with same CATH topology
5F06A 14GSA 2IL3A 1ERVA 3QFAC 2VOCA 1GULA 2C4JA 5E59A 2L4CA 1GH2A 19GSA 3H1NA 4PURA 4DSSB 4WR4A 5IIZA 1V58A 2CX4A 4ZL9A 4N0VA 1U88A 4XTSA 2LS5A 1PRXA 4N0ZA 3ZRDA 4ZXGA 3KJYA 3ZIVA 4HJMA 4KA0A 4FYBA 4I8BA 4KGIA 1K0NA 3KP8A 22GSA 3GX8A 2HT9A 2V32A 3TKRA 3F0IA 2VCTA 1X5DA 3ZYWA 5KN3A 4K7IA 4HOJA 1FO5A 2DBCA 2O89A 4MH3A 1PL1A 1FB0A 4EC0A 2OE0A 4K8MA 2YJHA 2DC5A 1O85A 2NPBA 4O32A 1ON4A 2OA7A 4TR3A 1SL2B 2LQQA 3FW2A 3LW9A 3QAWA 5J4UA 10GSA 2VUPA 1SK1A 1GLQA 1GUMA 1LJRA 3IC8A 4MH2A 2G2QA 1SYXA 3PH9A 4HQSA 2H75A 2LNTA 1B4PA 2JADA 4WETA 1GUHA 4JR6A 3HJOA 3ZFLA 3LJRA 3L4NA 3CTFA 4Q5RA 4L5OA 4F03A 1JZWA 1FW1A 1GSSA 3TOUA 2LEGA 2I4AA 2EIQA 1EWXA 4KB3A 5IQYA 4MJAA 2FUG2 4K2XA 1TXXA 5G1KA 3I69A 1OC9A 1GNWA 2OJLA 2VL3A 1F2EA 1S3CA 2HSHA 3LSZA 4G10A 2WS2A 5EVOA 1H75A 2VLTA 4V2NA 3RBTA 3LYKA 1GWCA 3GUSA 3RPPA 5JWRB 3HVVA 5FHIA 1HQOA 2OE3A 2GT6A 4YQUA 2H1GA 3TB2A 4X4JA 2HSMA 3VPTA 1A2LA 4FYCA 1SL0B 2LJAA 4WXTA 4MPGA 4E8EA 4KNDA 2CVBA 2YWIA 2MYGA 1Y6EA 5DBQA 1SKWB 2RM5A 7GSSA 5EPFA 2VCQA 3KZQA 4ECCA 5B6MA 1VF4A 1T4ZA 1V2AA 1Q98A 1ZYNA 2CVDA 3QR6A 3QAGA 5IMFA 1AAZA 3MAKA 4OFTA 1FOVA 4K0GA 5DQSA 4HUAA 1J0FA 4O92A 1SK0A 2IJYA 4V1Ap 3W6GA 1AW9A 3PGTA 1GP1A 4TR1A 4XRAA 3A2VA 2C0EA 1T1VA 2QA2A 1Z6NA 2Z9SA 3IC4A 2JZTA 5ECSA 1B8XA 1O8WA 4EKZA 2DJ0A 1QK8A 1O81A 2VIMA 1M7TA 1VF3A 3WGXA 1FG4A 2PWJA 3EMPA 4IBPA 4KX4A 4NV5A 4PUAA 3DRNA 3G9BA 5KN2A 3KGKA 4MF6A 1R5AA 2HFDA 4A5PA 1WJKA 1ZYPA 1AQXA 4MMMA 3PR8A 4EO3A 1A23A 18GSA 2PERA 1G6YA 2O85A 3HKRA 4ZBBA 5KN1A 1XVQA 2K9FA 4MJBA 4KDXA 3QOUA 2JSYA 5GAPD 3WT2A 2DLXA 3GKXA 1ILOA 5DJLA 3P7XA 1OKTA 3L9SA 5L71A 2VLUA 3IA1A 4PUFC 2H6XA 2IY2A 3TRPA 1ZMAA 3DIEA 5JWQB 2H70A 2RUEA 5ECLB 2GDRA 4QL9A 12GSA 20GSA 3D6IA 1YY7A 1I5GA 1WRYA 1ZGNA 2QGVA 1KNGA 1XCCA 4J2FA 1UC7A 2GSRA 2V2GA 2CX3A 3VWXA 4GXZA 1TI1A 3J7Yk 1NM3A 2VD1A 2RUFA 2JU5A 2K8SA 1U3AA 3SWLA 4XRDA 2I81A 1NW2A 1T7PB 4I97A 1OC3A 4P3YB 2DJ1A 3GV1A 5G5FA 4BWQA 4K7OA 4ID0A 3VI7A 4IVFA 3VWWA 3FR3A 4EDZA 2YWNA 5H5RA 1ERTA 3NIVA 4AF2A 4HZ4A 4O5RA 5AN1A 2H1DA 1NHOA 1YDKA 5CREA 4G19A 1OE8A 4DSQA 1X5CA 3DD3A 4ZL8A 2L6DA 4KCEA 2FLSA 3KH7A 4GSNA 2P5QA 5ABRA 4HU9A 3S9FA 2YJ7A 3BCIA 5IOXA 5ID2B 3PPUA 3ZVJD 2DSAA 5F0GA 3HXSA 2KP2A 3E3EA 1TRSA 2M46A 5ELAA 3CTGA 2FY6A 2YZHA 2R37A 1F9MA 1B48A 2VL2C 1SD9A 2LJRA 3C71A 4F9ZA 4PXOA 4G9HA 2K18A 4MF5A 4Z2RA 2YPMA 1SJ6A 4JEDA 2VM2A 4H86A 2B7KA 2I3YA 5ID2A 5J3RA 2F8FA 3QFBC 4EDYA 4GQCA 2GGTA 1AUCA 1ST9A 1T8EB 4ZILA 2B6MA 4KSOA 1XBSA 1THXA 4CHSA 3GKKA 3KIJA 1PL2A 3DVWA 5CRGA 2RLIA 3D4TA 5DAKB 3EU3A 3UAPA 1KTEA 5AIVA 5HR2A 4JBBA 3DXBA 1PD21 5AISA 2P31A 3VK9A 2R0GA 4K5SA 4KSMA 3WT1A 1U3IA 2A2RA 4IQ1A 2H8LA 4D73B 5G2ZA 3SBCA 1HNCA 1W4VA 2MBTA 1J9BA 4XS4B 1R5PA 4BWSA 4LL4B 3VWVA 3FY7A 1IYHA 1G7OA 4NMUA 2HSYA 4Z2TA 3I9V2 1M2AA 3GKNA 3MIXA 2IMEA 4MABA 3TKQA 4PX1A 2LKUA 4BPYA 2NBSA 4J56E 4FO5A 2H0HA 1HYUA 3FYGA 4DVCA 3HVXA 2KHPA 1WIKA 2H73A 5D9TA 5IOWA 5ECMB 2AUVA 4G0KA 1VF1A 3KMNA 4TXVA 4EUYA 3ZMKA 4BVXB 1DSBA 1K0AA 3TKSE 1TDIA 4IKHA 1H4OA 2CZ2A 2YANA 3ME8A 4YKGA 5GSSA 4IP1A 4ILFA 5CRDA 1XPVA 1X9SB 2X8HA 4TXOA 1A24A 3KMOA 3HA9A 1FAAA 1ZOFA 3RPNA 4V2MA 1M99A 2L4QA 3KP9A 4I5QA 3IAM2 2PPTA 1K0BA 5IPHA 3P8WA 1TRWA 2AYTA 1N2AA 1GTIA 2YWOA 5G30A 4BVXA 2GQMA 3F9UA 5F05A 4KAEA 2C3TA 1F3AA 1SD8A 3F4TA 3Q6OA 3DKSA 4NPBA 2BMXA 1QMVA 2R5GA 3RAZA 5LNKe 2KLXA 4O7HA 2E0QA 3Q19A 3HD5A 5DJMA 2TRCP 2EIRA 2H76A 2G0FA 4K0NA 2FHEA 1ABAA 2B7JA 3KCMA 2N5BA 3G7JA 3ZMLA 5C04A 3EYTA 2C3NA 13GSA 5CRHA 3C1RA 2LRNA 3RHCA 5B7CA 2MMAA 4ISDA 4GQFA 2UZ8A 3I43A 2F9SA 2ON7A 2IMDA 2OACA 2C1YA 5D9VA 1FHEA 3GA4A 5J5NA 2H72A 1K0CA 3FR9A 2MBSA 4N11A 1XWKA 4F0BA 2JSZA 5H5SA 4TOPA 1XVWA 3IOSA 4J57E 5A4WA 4ECBA 1SYRA 2O87A 3APSA 3GNJA 2LRTA 1UN2A 3NOFA 1BYEA 4WF5A 2C8UA 2WB9A 4IJIA 2K6VA 3CSIA 5G31A 1XOAA 2M80A 2J9HA 1M9AA 4ECIA 4K9ZA 4MZCA 1OC9B 1GSDA 3DGQA 3IR4A 1TK0B 3TJGA 4F0CA 5B8AA 1E2YA 2LV3A 3IK9A 1YJ6A 2JZRA 3C7MA 3M8NA 4KUNA 4JU5A 1EP7A 1PQNA 2H19A 2AAWA 2XBIA 3QMXA 3IBHA 4JRRA 1FVKA 3TKSA 4ZB9A 4MLYA 4KDUA 2GVPA 5HFGA 1V40A 1SK2A 1TK5B 3HDCA 1OAZA 5DCHA 2R6KA 1K3YA 1DE2A 4I2UA 1XOBA 2VD0A 3HZ8A 3CSHA 1U6TA 5JCGA 3IHQA 2DIZA 4TR1B 1CQGA 3CMIA 1GSYA 1JFUA 2IFQA 2TRXA 4PTSA 1TU8A 1GSEA 1PA3A 2HRNA 2YOIA 4MP4A 4OMVA 3LWAA 1OE7A 4L0WA 2IMFA 2PBJA 1TU7A 3TJKA 3FZ9A 2IMIA 2VO4A 3OR5A 1FVJA 1PKWA 1R4WA 4BL7B 4HS1A 3RHBA 1SKRB 1DUGA 1FOHA 4POKA 3IRAA 1QXHA 2LSTA 3D22A 2YZUA 2D2ZA 3GN3A 1TK8B 2C3QA 1Z6MA 3I6AA 3BBYA 2OE1A 5ECIB 4G0IA 3H93A 1CQHA 3M9KA 1GRXA 3VURA 1K0MA 1LU4A 3WGEA 2FWFA 1XIYA 4XCSA 1QUWA 4XS6A 3EC3A 3LFLA 2IYJA 3V1WA 3MWHA 4BL7A 4HI7A 1V57A 2FA8A 3LYPA 2DJJA 5DDLA 4IS0A 3LXZA 4IGJA 3GSSA 4YAVA 1M2DA 2KUCA 4KE3A 2PGTA 2QC7A 5IMZA 4MJCA 3M3MA 3UMAA 5G5EA 2NTOA 1ZL9A 5FT3A 3TGZA 2A4VA 1IYIA 3IE3A 1UA5A 4WBRD 3FK8A 3O3TA 3D0ZA 4HU7A 2PVOC 2E7PA 1PKZA 4V2LA 4AGSA 4DSRA 1O73A 2B1KA 1W89A 2CVKA 2B5YA 5IO0A 2X64A 1AXDA 3LGCA 1G6WA 2OBIA 1A8LA 5DALA 1AQWA 1LBKA 2FGXA 4WEYA 1F3BA 2F3MA 3GX0A 3ERGA 3LG6A 3HY2A 2WZ9A 3U5RE 5IO2A 4KDYA 1GTUA 2H1BA 1GLPA 5HQPA 1EGRA 3L78A 1F6MC 4RI6A 4EVMA 3FEUA 2DIYA 1RK4A 1R26A 1OC8A 2FD3A 1TTZA 1XW5A 2XHFA 1GTBA 2HXKA 2E2MA 2QSIA 3UJ1A 2VM1A 1XWBA 4LMVA 2F8AA 5IMAA 3GH6A 5BRTA 5D96A 1XWAA 5CYYA 2YV9A 1GSFA 1XXUA 2LRCA 1TI3A 3TKPA 3GKMA 2HYXA 2DMMA 1TKDB 4MCUA 3ED3A 1TJDA 2IN3A 4IJ3A 3GL5A 3F4RA 1E6BA 3J7Yb 5CRWA 4X43A 6GSTA 3Q74A 4PNGA 5ECNB 3DEXA 3VI5A 3IPZA 1WE0A 2IIYA 2V41A 2PUKC 1MDKA 6GSXA 1YKCA 1HD2A 3IXRA 4TW5A 2H71A 4MZBA 3DMLA 3HYPA 5G1LA 4ICYA 6GSVA 4AJ6A 2H6YA 1Z3EA 4PNFA 2AV4A 1BAYA 4F2IA 5KOXA 4Q5FA 4POBA 5J9CA 3TJBA 4CY6A 4TKYA 4G0LA 2JL4A 2GTUA 1X0RA 3UIWA 2WJUA 5GSTA 3W8SA 2A2SA 3GHAA 2GSTA 2DJ3A 1EGOA 1QFNA 5JCUA 2JZSA 3E0UA 4HDEA 1A2MA 3JCML 1K0DA 1YF0A 4EXJA 4MNNA 2EC4A 1A0RP 1YF1A 1B9YC 1GSQA 1UVZA 4PGTA 3D5JA 3BJ5A 4L5LA 1SL1B 4NHWA 16GSA 4TR4A 3ZLPA 3EURA 5KN0A 5J9BA 1B4QA 1A8YA 1M0UA 5KOWA 2JACA 3NZNA 3CXGA 1TOFA 5A4VA 4JR4A 5IM9A 2R0CA 3US3A 2HE3A 3UVHA 1TRVA 3ZITA 2LNSA 2AHEA 1I9DA 3QCPA 3IDVA 4ZB8A 1XWGA 3LXTA 1MDJA 5A5KA 1PN0A 2A2PA 17GSA 3R3EA 3G7YA 3A3TA 3CRTA 4KW6A 3LORA 2R4VA 2CQ9A 3ME7A 1QGVA 4TXOB 4XS1A 2O8VB 1PN9A 4BA7A 2IPAA 4K6XA 3WD6A 1J08A 3KM6A 3MYDA 3UOMA 3HJPA 2B5EA 4MJEA 2GQKA 3G7IA 3VLNA 1RW1A 1DBYA 2H6ZA 4KF9A 1M9BA 3HCZA 1EZKA 1X5EA 2ON5A 5CNWA 4CDOA 3UVTA 3ZFBA 3F3QA 3ZL5A 2PU9C 4RUVA 5DVBA 2VCZA 5ECQB 5CAXA 1EEMA 3F3RA 5LCZA 3EE2A 3TRQA 3PINA 1PX6A 5GAND 3TUEA 6GSSA 3QDNA 4RQXA 1Z7PA 5D8IA 3A2WA 5F8BA 1EOHA 1S3AA 3ZREA 5JWOB 5JCWA 3GFKA 2FWEA 4WBJA 3FZAA 3U6VA 5A4UA 1O7UA 2X4AA 4EIPA 2FNOA 3HZ4A 3ZIJA 3KXOA 4GSTA 2HLSA 3L0HA 1A2JA 2WDUA 1JLVA 2GS3A 4X1UA 3TCOA 5HFIA 2HI7A 1OVNA 5AIXA 3EWLA 4JE1A 1GUKA 4TRXA 3APQA 2GZPA 4BVYA 4QQ7A 5IMVA 1K3LA 2XPDA 4IN0A 2HRKA 3F6DA 4L8EA 1V98A 1T4YA 1AIUA 1ERWA 2DMLA 3GH9A 4HQZA 5J41A 3EINA 2XPEA 3UARA 1JHBA 1USBA 2FWGA 4GRFA 3MDKA 3QPMA 3RDWA 3GTUB 3M0FA 3H8QA 1PMTA 4IELA 4JZQA 1WWJA 4MK3A 2VAFA 2OBKA 2OADA 3H4KA 4DSSA 4IHUA 2V6KA 4ULXA 3F4SA 3EU4A 2PN8A 2CA8A 5FWGA 4OD7A 4OCEA 3QAVA 4FH8A 3IV4A 5CP1A 3EVIA 3BCKA 5ECKB 4ECJA 1Z9HA 1GTAA 3GL3A 1PX7A 5D73A 4GSSA 2MMOA 4ZBAA 4MPFA 3CRUA 3ZVJA 3GTUA 2TIRA 1JZRA 5BMUA 4KH7A 1ERUA 3CYNA 4HZ2A 2FWHA 3APOA 1PSQA 1RQMA 2VCVA 3N5OA 2NVLA 1R7HA 4TR0A 1GNEA 4OWYA 3FZ4A 4QL7A 3EMXA 4RQRA 1XZOA 2CAQA 3DVXA 5HR3A 4IW9A 4GCIA 2VL9A 5ELGA 1MTCA 3KTBA 2QKEA 4YQVA 1SJZA 1Y25A 4WR5A 2IFQB 3KTLA 2XC2A 5F07A 1YEPA 4WKWA 4HJ2A 1YZXA 4RI7A 2L6CA 3D4MA 2YNXA 2DJKA 3TKSC 5D9XA 5D93A 5IPGA 1Q4JA 2M72A 4K5RA 3C8EA 1BQ7A 1AC1A 3P90A 11GSA 6GSYA 2LQOA 2WFCA 2GZYA 1FB6A 4GWRA 3IAS2 4TVEA 3AY8A 2BJXA 3C1SA 4PQ1A 4CY8A 5IMCA 2GT5A 3EPTA 3ERWA 2R0PA 1SENA 1NHYA 2H0IA 1KBNA 5D9WA 3FHKA 1WOUA 1BJXA 1NSWA 2MZCA 2CT6A 2WULA 2H01A 4NAXA 2R3XA 2RM6A 3TOTA 3A2XA 2V6OA 1ZZYA 5ECPB 5GZZB 2KP1A 3TJJA 1DE1A 3FZ5A 4POMA 3HVSA 1URMA 5HR1A 2RIIA 2CZ3A 3FRCA 2B1LA 3QD9A 3W8JA 2VCWA 2DKIA 1SU9A 1X9WB 2P0GA 2QA1A 2CV4A 1EV4A 3Q18A 2XBQA 3F63A 2F51A 1A0FA 3FMWA 1HNBA 2L5LA 2C80A 3VPQA 3MSZA 1T3BA 1EV9A 3GSTA 4ML6A 5EY6A 4HEA2 2L59A 4K2DA 4V1Ag 3O76A 3UBKA 2H0GA 2I1UA 1BX9A 4O5UA 3VWUA 1T00A 4POLA 3KH9A 4Q5NA 4YH2A 3ISOA 5DALB 2ZCTA 4OO4A 4E8HA 3VFIA 3A5IA 1XFLA 2L5OA 2VCXA 3O6TA 3F6FA 4CW9A 1XW6A 4EIQA 2A4HA 2MMZA 3GYKA 4NWYA 3WGDA 1MEKA 1TP9A 5KEJA 4O5QA 1WP0A 4OFMA 3K8NA 3TRXA 4AJ8A 2X8GA 5HFKA 5DCGA 8GSSA 4GF0A 4EL1A 1KEBA 4L0UA 2YWMA 3UL3A 3GMFA 4I2TA 1N8JA 2PMTA 2C0GA 3TJFA 2X99A 3GRXA 2BTOT 3FKFA 1G0TA 2HNLA 3UBLA 5EL8A 4ML1A 1VF2A 2IWTA 4KCAA 1OKDA 3GURA 2AB6A 2B5XA 1G7EA 3D21A 5AGYA 1TRUA 3P2AA 1SJIA 3IK7A 4N10A 4DEJA 2LJKA 2HZFA 1ZYEA 2WGRA 2OKAA 2O7KA 3HHVA 4XHMA 3CBUA 3DWVA 2GQLA 2E2GA 2P5RA 2DKHA 3F8UA 1AQVA 2YCDA 3HJMA 3M9JA 2N5FA 1XW9A 3M1GA 2H1AA 5HR0A 1JZOA 4TN8A 4N30A 2KOKA 5DQYA 1Z5YE 1MD4A 2N5AA 1K0OA 4EF0A 3H79A 5H5QA 3WYWA 6GSUA 1GL8A 2B3SA 2HRFA 2X8CA 5B8BA 2YP6A 4YQMA 2VL2A 1ZYQB 2K8VA 3BD2A 2ZNMA 3C73A 5ECHB 1K3OA 3ZTLA 1B9XC 2NDOA 2YN1A 4G2EA 1O8XA 4NXIA 2I9HA 1BG5A 4K7NA 4MZWA 2LTKA 4F82A 4OFNA 3LEFA 4PQIA 3KEBA 2GSQA 2H30A 2ALBA 2MMNA 1GSUA 3CSJA 3GIXA 2FA4A 1EOGA 4NHZA 2ES7A 2X49A 4AJ7A 1O6JA 4ZBDA 2FCHA 1XWCA 1X9MB 2GLRA 6GSWA 4Z7XA 4YAPA 4IP6A 4ZL7A 4FQUA 5ECOB 2V1MA 2L57A 1S3DA 1MD3A 4OO5A 2IMKA 1Z7RA 4EE0A 2PVQA 1WPIA 3LQ7A 4ZB6A 3UEMA 3BOAA 2R2JA 4WF4A 1EEJA 2HRAA 1F37A 5LD0A 3KD0A 1EP8A 3DYRA 4Q5QA 2H66A 4LLRA 4I6XA 5ENUA 3ZZXA 4LMWA 1C72A 4PQHA 1HNAA 1YKAA 2DJ2A 4IQAA 4Z2UA 2LUSA 2HZEB 4XIHA 2C0DA 1ML6A 4GLTA 2AJQB 5IMDA 3L9UA 4GTUA 5CO3A 4LA1A 2WRTA 1WMJA 1YEXA 1JZDA 2ZUPA 4MA9A 3L9VA 4MDCA 3MNGA 4USSA 1ZCPA 5DAKA 2CAIA 3E9JB 3TDGA 1ACVA 4ACSA 3N9JA 1QQ2A 1JLWA 4OCFA 5COHA 1OYJA 5ECRB 4MF7A 2C0FA 2H74A 2VLVA 5B6NA 4X0XA 4LL1B 4ZIJA 4D73A 1VGLA 2J23A 4XS4A 2HZEA 2EIOA 3R2QA 1PGTA 3IHGA 1TW9A 2REMA 1SKSB 1BEDA 1M2BA 4FIWA 1YQ1A 1V9WA 5C00A 4K1FA 3ERFA 2GSSA 2YV7A 2GZZA 2WCIA 5INYA 1THOA 4YKFA 4BVYB 4FYUA 1U87A 9GSSA 3A5WA 1VRSD 1MDIA 3FR6A 5E4WA 4NV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F06 A;  14GS A;  2IL3 A;  1ERV A;  3QFA C;  2VOC A;  1GUL A;  2C4J A;  5E59 A;  2L4C A;  1GH2 A;  19GS A;  3H1N A;  4PUR A;  4DSS B;  4WR4 A;  5IIZ A;  1V58 A;  2CX4 A;  4ZL9 A;  4N0V A;  1U88 A;  4XTS A;  2LS5 A;  1PRX A;  4N0Z A;  3ZRD A;  4ZXG A;  3KJY A;  3ZIV A;  4HJM A;  4KA0 A;  4FYB A;  4I8B A;  4KGI A;  1K0N A;  3KP8 A;  22GS A;  3GX8 A;  2HT9 A;  2V32 A;  3TKR A;  3F0I A;  2VCT A;  1X5D A;  3ZYW A;  5KN3 A;  4K7I A;  4HOJ A;  1FO5 A;  2DBC A;  2O89 A;  4MH3 A;  1PL1 A;  1FB0 A;  4EC0 A;  2OE0 A;  4K8M A;  2YJH A;  2DC5 A;  1O85 A;  2NPB A;  4O32 A;  1ON4 A;  2OA7 A;  4TR3 A;  1SL2 B;  2LQQ A;  3FW2 A;  3QAW A;  5J4U A;  10GS A;  2VUP A;  1SK1 A;  1GLQ A;  1GUM A;  1LJR A;  4MH2 A;  2G2Q A;  1SYX A;  3PH9 A;  4HQS A;  2H75 A;  2LNT A;  1B4P A;  2JAD A;  4WET A;  1GUH A;  4JR6 A;  3HJO A;  3ZFL A;  3LJR A;  3L4N A;  3CTF A;  4Q5R A;  4L5O A;  4F03 A;  1JZW A;  1FW1 A;  1GSS A;  3TOU A;  2LEG A;  2I4A A;  2EIQ A;  1EWX A;  4KB3 A;  5IQY A;  4MJA A;  2FUG 2;  1TXX A;  5G1K A;  3I69 A;  1OC9 A;  1GNW A;  2OJL A;  2VL3 A;  1F2E A;  1S3C A;  2HSH A;  3LSZ A;  4G10 A;  2WS2 A;  5EVO A;  1H75 A;  2VLT A;  4V2N A;  3RBT A;  3LYK A;  1GWC A;  3GUS A;  3RPP A;  5JWR B;  3HVV A;  5FHI A;  1HQO A;  2OE3 A;  2GT6 A;  4YQU A;  2H1G A;  3TB2 A;  3VPT A;  1A2L A;  4FYC A;  1SL0 B;  2LJA A;  4WXT A;  4MPG A;  4E8E A;  4KND A;  2CVB A;  2YWI A;  2MYG A;  1Y6E A;  5DBQ A;  1SKW B;  2RM5 A;  7GSS A;  5EPF A;  2VCQ A;  3KZQ A;  4ECC A;  5B6M A;  1VF4 A;  1T4Z A;  1V2A A;  1Q98 A;  2CVD A;  3QR6 A;  3QAG A;  5IMF A;  1AAZ A;  3MAK A;  4OFT A;  1FOV A;  4K0G A;  5DQS A;  4HUA A;  1J0F A;  4O92 A;  1SK0 A;  2IJY A;  4V1A p;  3W6G A;  1AW9 A;  3PGT A;  1GP1 A;  4TR1 A;  4XRA A;  3A2V A;  2C0E A;  1T1V A;  1Z6N A;  2Z9S A;  3IC4 A;  2JZT A;  5ECS A;  1B8X A;  1O8W A;  4EKZ A;  2DJ0 A;  1QK8 A;  1O81 A;  2VIM A;  1M7T A;  1VF3 A;  3WGX A;  1FG4 A;  2PWJ A;  3EMP A;  4IBP A;  4KX4 A;  4NV5 A;  4PUA A;  3DRN A;  3G9B A;  5KN2 A;  3KGK A;  4MF6 A;  1R5A A;  2HFD A;  1WJK A;  1AQX A;  4MMM A;  3PR8 A;  4EO3 A;  1A23 A;  18GS A;  2PER A;  1G6Y A;  2O85 A;  3HKR A;  4ZBB A;  5KN1 A;  1XVQ A;  2K9F A;  4MJB A;  4KDX A;  3QOU A;  2JSY A;  5GAP D;  3WT2 A;  2DLX A;  3GKX A;  1ILO A;  5DJL A;  3P7X A;  1OKT A;  3L9S A;  5L71 A;  2VLU A;  3IA1 A;  4PUF C;  2H6X A;  2IY2 A;  3TRP A;  1ZMA A;  3DIE A;  5JWQ B;  2H70 A;  2RUE A;  5ECL B;  2GDR A;  4QL9 A;  12GS A;  20GS A;  3D6I A;  1YY7 A;  1I5G A;  1WRY A;  1ZGN A;  2QGV A;  1KNG A;  1XCC A;  4J2F A;  1UC7 A;  2GSR A;  2V2G A;  2CX3 A;  3VWX A;  4GXZ A;  1TI1 A;  3J7Y k;  1NM3 A;  2VD1 A;  2RUF A;  2JU5 A;  2K8S A;  1U3A A;  3SWL A;  4XRD A;  2I81 A;  1NW2 A;  1T7P B;  4I97 A;  1OC3 A;  4P3Y B;  2DJ1 A;  3GV1 A;  5G5F A;  4BWQ A;  4K7O A;  4ID0 A;  3VI7 A;  4IVF A;  3VWW A;  3FR3 A;  4EDZ A;  2YWN A;  5H5R A;  1ERT A;  3NIV A;  4AF2 A;  4HZ4 A;  4O5R A;  5AN1 A;  2H1D A;  1NHO A;  1YDK A;  5CRE A;  4G19 A;  1OE8 A;  4DSQ A;  1X5C A;  3DD3 A;  4ZL8 A;  2L6D A;  4KCE A;  2FLS A;  3KH7 A;  4GSN A;  2P5Q A;  5ABR A;  4HU9 A;  3S9F A;  2YJ7 A;  3BCI A;  5IOX A;  5ID2 B;  3ZVJ D;  2DSA A;  5F0G A;  3HXS A;  2KP2 A;  3E3E A;  1TRS A;  2M46 A;  5ELA A;  3CTG A;  2FY6 A;  2YZH A;  2R37 A;  1F9M A;  1B48 A;  2VL2 C;  1SD9 A;  2LJR A;  3C71 A;  4F9Z A;  4PXO A;  4G9H A;  2K18 A;  4MF5 A;  2YPM A;  1SJ6 A;  4JED A;  2VM2 A;  4H86 A;  2B7K A;  2I3Y A;  5ID2 A;  5J3R A;  2F8F A;  3QFB C;  4EDY A;  4GQC A;  2GGT A;  1AUC A;  1ST9 A;  1T8E B;  4ZIL A;  2B6M A;  4KSO A;  1XBS A;  1THX A;  4CHS A;  3GKK A;  3KIJ A;  1PL2 A;  3DVW A;  5CRG A;  2RLI A;  3D4T A;  5DAK B;  3EU3 A;  3UAP A;  1KTE A;  5AIV A;  5HR2 A;  4JBB A;  3DXB A;  1PD2 1;  5AIS A;  2P31 A;  3VK9 A;  4KSM A;  3WT1 A;  1U3I A;  2A2R A;  4IQ1 A;  2H8L A;  4D73 B;  5G2Z A;  3SBC A;  1HNC A;  1W4V A;  2MBT A;  1J9B A;  4XS4 B;  1R5P A;  4BWS A;  4LL4 B;  3VWV A;  3FY7 A;  1IYH A;  1G7O A;  4NMU A;  2HSY A;  3I9V 2;  1M2A A;  3GKN A;  2IME A;  4MAB A;  3TKQ A;  4PX1 A;  2LKU A;  4BPY A;  2NBS A;  4J56 E;  4FO5 A;  2H0H A;  1HYU A;  3FYG A;  4DVC A;  3HVX A;  2KHP A;  1WIK A;  2H73 A;  5D9T A;  5IOW A;  5ECM B;  2AUV A;  1VF1 A;  3KMN A;  4TXV A;  4EUY A;  3ZMK A;  1DSB A;  1K0A A;  3TKS E;  1TDI A;  4IKH A;  1H4O A;  2CZ2 A;  2YAN A;  3ME8 A;  5GSS A;  4IP1 A;  4ILF A;  5CRD A;  1XPV A;  1X9S B;  2X8H A;  4TXO A;  1A24 A;  3KMO A;  3HA9 A;  1FAA A;  1ZOF A;  3RPN A;  4V2M A;  1M99 A;  2L4Q A;  3KP9 A;  4I5Q A;  3IAM 2;  2PPT A;  1K0B A;  5IPH A;  3P8W A;  1TRW A;  2AYT A;  1N2A A;  1GTI A;  2YWO A;  5G30 A;  4BVX A;  2GQM A;  3F9U A;  5F05 A;  4KAE A;  2C3T A;  1F3A A;  1SD8 A;  3F4T A;  3Q6O A;  3DKS A;  4NPB A;  2BMX A;  1QMV A;  2R5G A;  3RAZ A;  5LNK e;  2KLX A;  4O7H A;  2E0Q A;  3Q19 A;  3HD5 A;  5DJM A;  2TRC P;  2EIR A;  2H76 A;  2G0F A;  4K0N A;  2FHE A;  1ABA A;  2B7J A;  3KCM A;  2N5B A;  3G7J A;  3ZML A;  5C04 A;  3EYT A;  2C3N A;  13GS A;  5CRH A;  3C1R A;  2LRN A;  3RHC A;  5B7C A;  2MMA A;  4ISD A;  4GQF A;  3I43 A;  2F9S A;  2ON7 A;  2IMD A;  2OAC A;  2C1Y A;  5D9V A;  1FHE A;  3GA4 A;  5J5N A;  2H72 A;  1K0C A;  3FR9 A;  2MBS A;  4N11 A;  1XWK A;  4F0B A;  2JSZ A;  5H5S A;  4TOP A;  1XVW A;  3IOS A;  4J57 E;  5A4W A;  4ECB A;  1SYR A;  2O87 A;  3APS A;  3GNJ A;  2LRT A;  1UN2 A;  3NOF A;  1BYE A;  4WF5 A;  2C8U A;  2WB9 A;  4IJI A;  2K6V A;  3CSI A;  5G31 A;  1XOA A;  2M80 A;  2J9H A;  1M9A A;  4ECI A;  4K9Z A;  4MZC A;  1OC9 B;  1GSD A;  3DGQ A;  3IR4 A;  1TK0 B;  3TJG A;  4F0C A;  5B8A A;  1E2Y A;  2LV3 A;  3IK9 A;  1YJ6 A;  2JZR A;  3C7M A;  3M8N A;  4KUN A;  4JU5 A;  1EP7 A;  1PQN A;  2H19 A;  2AAW A;  2XBI A;  3QMX A;  3IBH A;  4JRR A;  1FVK A;  3TKS A;  4ZB9 A;  4MLY A;  4KDU A;  2GVP A;  5HFG A;  1V40 A;  1SK2 A;  1TK5 B;  3HDC A;  1OAZ A;  5DCH A;  2R6K A;  1K3Y A;  1DE2 A;  4I2U A;  1XOB A;  2VD0 A;  3HZ8 A;  3CSH A;  1U6T A;  5JCG A;  3IHQ A;  2DIZ A;  4TR1 B;  1CQG A;  3CMI A;  1GSY A;  1JFU A;  2IFQ A;  2TRX A;  1TU8 A;  1GSE A;  1PA3 A;  2HRN A;  2YOI A;  4MP4 A;  4OMV A;  3LWA A;  1OE7 A;  4L0W A;  2IMF A;  2PBJ A;  1TU7 A;  3TJK A;  3FZ9 A;  2IMI A;  2VO4 A;  3OR5 A;  1FVJ A;  1PKW A;  1R4W A;  4HS1 A;  3RHB A;  1SKR B;  1DUG A;  4POK A;  3IRA A;  1QXH A;  2LST A;  3D22 A;  2YZU A;  2D2Z A;  3GN3 A;  1TK8 B;  2C3Q A;  1Z6M A;  3I6A A;  3BBY A;  2OE1 A;  5ECI B;  3H93 A;  1CQH A;  3M9K A;  1GRX A;  3VUR A;  1K0M A;  1LU4 A;  3WGE A;  2FWF A;  1XIY A;  4XCS A;  1QUW A;  4XS6 A;  3EC3 A;  3LFL A;  2IYJ A;  3V1W A;  3MWH A;  4BL7 A;  4HI7 A;  1V57 A;  2FA8 A;  3LYP A;  2DJJ A;  5DDL A;  4IS0 A;  3LXZ A;  4IGJ A;  3GSS A;  4YAV A;  1M2D A;  2KUC A;  4KE3 A;  2PGT A;  2QC7 A;  5IMZ A;  4MJC A;  3M3M A;  3UMA A;  5G5E A;  2NTO A;  1ZL9 A;  5FT3 A;  3TGZ A;  2A4V A;  1IYI A;  3IE3 A;  1UA5 A;  4WBR D;  3FK8 A;  3O3T A;  3D0Z A;  4HU7 A;  2PVO C;  2E7P A;  1PKZ A;  4V2L A;  4AGS A;  4DSR A;  1O73 A;  2B1K A;  1W89 A;  2CVK A;  2B5Y A;  5IO0 A;  2X64 A;  1AXD A;  3LGC A;  1G6W A;  2OBI A;  1A8L A;  5DAL A;  1AQW A;  1LBK A;  2FGX A;  4WEY A;  1F3B A;  2F3M A;  3GX0 A;  3ERG A;  3LG6 A;  3HY2 A;  2WZ9 A;  3U5R E;  5IO2 A;  4KDY A;  1GTU A;  2H1B A;  1GLP A;  5HQP A;  1EGR A;  3L78 A;  1F6M C;  4RI6 A;  4EVM A;  3FEU A;  2DIY A;  1RK4 A;  1R26 A;  1OC8 A;  2FD3 A;  1TTZ A;  1XW5 A;  2XHF A;  1GTB A;  2HXK A;  2E2M A;  2QSI A;  3UJ1 A;  2VM1 A;  1XWB A;  4LMV A;  2F8A A;  5IMA A;  3GH6 A;  5D96 A;  1XWA A;  5CYY A;  2YV9 A;  1GSF A;  1XXU A;  2LRC A;  1TI3 A;  3TKP A;  3GKM A;  2HYX A;  2DMM A;  1TKD B;  4MCU A;  3ED3 A;  1TJD A;  2IN3 A;  4IJ3 A;  3GL5 A;  3F4R A;  1E6B A;  3J7Y b;  5CRW A;  4X43 A;  6GST A;  3Q74 A;  4PNG A;  5ECN B;  3DEX A;  3VI5 A;  3IPZ A;  1WE0 A;  2IIY A;  2V41 A;  2PUK C;  1MDK A;  6GSX A;  1YKC A;  1HD2 A;  3IXR A;  4TW5 A;  2H71 A;  4MZB A;  3DML A;  3HYP A;  5G1L A;  6GSV A;  4AJ6 A;  2H6Y A;  1Z3E A;  4PNF A;  2AV4 A;  1BAY A;  4F2I A;  4Q5F A;  4POB A;  5J9C A;  3TJB A;  4TKY A;  2JL4 A;  2GTU A;  1X0R A;  3UIW A;  2WJU A;  5GST A;  3W8S A;  2A2S A;  3GHA A;  2GST A;  2DJ3 A;  1EGO A;  1QFN A;  5JCU A;  2JZS A;  3E0U A;  4HDE A;  1A2M A;  3JCM L;  1K0D A;  1YF0 A;  4EXJ A;  2EC4 A;  1A0R P;  1YF1 A;  1B9Y C;  1GSQ A;  1UVZ A;  4PGT A;  3D5J A;  3BJ5 A;  4L5L A;  1SL1 B;  4NHW A;  16GS A;  4TR4 A;  3ZLP A;  3EUR A;  5KN0 A;  5J9B A;  1B4Q A;  1A8Y A;  1M0U A;  2JAC A;  3NZN A;  3CXG A;  1TOF A;  5A4V A;  4JR4 A;  5IM9 A;  3US3 A;  2HE3 A;  3UVH A;  1TRV A;  3ZIT A;  2LNS A;  2AHE A;  1I9D A;  3QCP A;  3IDV A;  4ZB8 A;  1XWG A;  3LXT A;  1MDJ A;  5A5K A;  17GS A;  3G7Y A;  3A3T A;  3CRT A;  4KW6 A;  3LOR A;  2R4V A;  2CQ9 A;  3ME7 A;  1QGV A;  4TXO B;  4XS1 A;  2O8V B;  1PN9 A;  4BA7 A;  2IPA A;  4K6X A;  3WD6 A;  1J08 A;  3KM6 A;  3UOM A;  3HJP A;  2B5E A;  4MJE A;  2GQK A;  3G7I A;  3VLN A;  1RW1 A;  1DBY A;  2H6Z A;  1M9B A;  3HCZ A;  1EZK A;  1X5E A;  2ON5 A;  5CNW A;  4CDO A;  3UVT A;  3ZFB A;  3F3Q A;  3ZL5 A;  2PU9 C;  4RUV A;  5DVB A;  2VCZ A;  5ECQ B;  5CAX A;  1EEM A;  3F3R A;  5LCZ A;  3EE2 A;  3TRQ A;  3PIN A;  1PX6 A;  5GAN D;  3TUE A;  6GSS A;  3QDN A;  4RQX A;  1Z7P A;  5D8I A;  3A2W A;  5F8B A;  1EOH A;  1S3A A;  3ZRE A;  5JWO B;  5JCW A;  3GFK A;  2FWE A;  4WBJ A;  3FZA A;  3U6V A;  5A4U A;  1O7U A;  2FNO A;  3HZ4 A;  3ZIJ A;  3KXO A;  4GST A;  2HLS A;  3L0H A;  1A2J A;  2WDU A;  1JLV A;  2GS3 A;  4X1U A;  3TCO A;  5HFI A;  2HI7 A;  1OVN A;  5AIX A;  3EWL A;  4JE1 A;  1GUK A;  4TRX A;  3APQ A;  2GZP A;  4BVY A;  4QQ7 A;  5IMV A;  1K3L A;  2XPD A;  4IN0 A;  3F6D A;  4L8E A;  1V98 A;  1T4Y A;  1AIU A;  1ERW A;  2DML A;  3GH9 A;  4HQZ A;  5J41 A;  3EIN A;  2XPE A;  3UAR A;  1JHB A;  1USB A;  2FWG A;  4GRF A;  3MDK A;  3QPM A;  3RDW A;  3GTU B;  3M0F A;  3H8Q A;  1PMT A;  4IEL A;  4JZQ A;  1WWJ A;  4MK3 A;  2VAF A;  2OBK A;  2OAD A;  3H4K A;  4DSS A;  4IHU A;  2V6K A;  4ULX A;  3F4S A;  3EU4 A;  2PN8 A;  2CA8 A;  5FWG A;  4OD7 A;  4OCE A;  3QAV A;  4FH8 A;  3IV4 A;  5CP1 A;  3EVI A;  3BCK A;  5ECK B;  4ECJ A;  1Z9H A;  1GTA A;  3GL3 A;  1PX7 A;  5D73 A;  4GSS A;  2MMO A;  4ZBA A;  4MPF A;  3CRU A;  3ZVJ A;  3GTU A;  2TIR A;  1JZR A;  4KH7 A;  1ERU A;  3CYN A;  4HZ2 A;  2FWH A;  3APO A;  1PSQ A;  1RQM A;  2VCV A;  3N5O A;  2NVL A;  1R7H A;  4TR0 A;  1GNE A;  4OWY A;  3FZ4 A;  4QL7 A;  3EMX A;  4RQR A;  1XZO A;  2CAQ A;  3DVX A;  5HR3 A;  4IW9 A;  4GCI A;  2VL9 A;  5ELG A;  1MTC A;  3KTB A;  2QKE A;  4YQV A;  1SJZ A;  1Y25 A;  4WR5 A;  2IFQ B;  3KTL A;  2XC2 A;  5F07 A;  1YEP A;  4WKW A;  4HJ2 A;  1YZX A;  4RI7 A;  2L6C A;  3D4M A;  2YNX A;  2DJK A;  3TKS C;  5D9X A;  5D93 A;  5IPG A;  1Q4J A;  2M72 A;  3C8E A;  1BQ7 A;  1AC1 A;  3P90 A;  11GS A;  6GSY A;  2LQO A;  2WFC A;  2GZY A;  1FB6 A;  4GWR A;  3IAS 2;  4TVE A;  3AY8 A;  2BJX A;  3C1S A;  4PQ1 A;  5IMC A;  2GT5 A;  3ERW A;  1SEN A;  1NHY A;  2H0I A;  1KBN A;  5D9W A;  3FHK A;  1WOU A;  1BJX A;  1NSW A;  2MZC A;  2CT6 A;  2WUL A;  2H01 A;  4NAX A;  2R3X A;  2RM6 A;  3TOT A;  3A2X A;  2V6O A;  1ZZY A;  5ECP B;  5GZZ B;  2KP1 A;  3TJJ A;  1DE1 A;  3FZ5 A;  4POM A;  3HVS A;  1URM A;  5HR1 A;  2RII A;  2CZ3 A;  3FRC A;  2B1L A;  3QD9 A;  3W8J A;  2VCW A;  1SU9 A;  1X9W B;  2P0G A;  2CV4 A;  1EV4 A;  3Q18 A;  2XBQ A;  3F63 A;  2F51 A;  1A0F A;  1HNB A;  2L5L A;  2C80 A;  3VPQ A;  3MSZ A;  1T3B A;  1EV9 A;  3GST A;  4ML6 A;  5EY6 A;  4HEA 2;  2L59 A;  4K2D A;  4V1A g;  3O76 A;  3UBK A;  2H0G A;  2I1U A;  1BX9 A;  3VWU A;  1T00 A;  4POL A;  3KH9 A;  4Q5N A;  4YH2 A;  3ISO A;  5DAL B;  2ZCT A;  4OO4 A;  4E8H A;  3VFI A;  1XFL A;  2L5O A;  2VCX A;  3O6T A;  3F6F A;  4CW9 A;  1XW6 A;  2MMZ A;  3GYK A;  4NWY A;  3WGD A;  1MEK A;  1TP9 A;  5KEJ A;  1WP0 A;  4OFM A;  3K8N A;  3TRX A;  4AJ8 A;  2X8G A;  5HFK A;  5DCG A;  8GSS A;  4GF0 A;  4EL1 A;  1KEB A;  4L0U A;  2YWM A;  3UL3 A;  3GMF A;  4I2T A;  1N8J A;  2PMT A;  2C0G A;  3TJF A;  2X99 A;  3GRX A;  2BTO T;  3FKF A;  1G0T A;  2HNL A;  3UBL A;  5EL8 A;  4ML1 A;  1VF2 A;  2IWT A;  4KCA A;  1OKD A;  3GUR A;  2AB6 A;  2B5X A;  1G7E A;  3D21 A;  5AGY A;  1TRU A;  3P2A A;  1SJI A;  3IK7 A;  4N10 A;  4DEJ A;  2LJK A;  2HZF A;  1ZYE A;  2WGR A;  2OKA A;  2O7K A;  3HHV A;  4XHM A;  3CBU A;  3DWV A;  2GQL A;  2E2G A;  2P5R A;  3F8U A;  1AQV A;  2YCD A;  3HJM A;  3M9J A;  2N5F A;  1XW9 A;  3M1G A;  2H1A A;  5HR0 A;  1JZO A;  4TN8 A;  4N30 A;  2KOK A;  5DQY A;  1Z5Y E;  1MD4 A;  2N5A A;  1K0O A;  4EF0 A;  3H79 A;  5H5Q A;  3WYW A;  6GSU A;  1GL8 A;  2B3S A;  2HRF A;  2X8C A;  5B8B A;  2YP6 A;  4YQM A;  2VL2 A;  1ZYQ B;  2K8V A;  3BD2 A;  2ZNM A;  3C73 A;  5ECH B;  1K3O A;  3ZTL A;  1B9X C;  2NDO A;  2YN1 A;  4G2E A;  1O8X A;  4NXI A;  2I9H A;  1BG5 A;  4K7N A;  4MZW A;  2LTK A;  4F82 A;  4OFN A;  3LEF A;  4PQI A;  3KEB A;  2GSQ A;  2H30 A;  2ALB A;  2MMN A;  1GSU A;  3CSJ A;  3GIX A;  2FA4 A;  1EOG A;  4NHZ A;  2ES7 A;  4AJ7 A;  1O6J A;  4ZBD A;  2FCH A;  1XWC A;  1X9M B;  2GLR A;  6GSW A;  4Z7X A;  4YAP A;  4IP6 A;  4ZL7 A;  5ECO B;  2V1M A;  2L57 A;  1S3D A;  1MD3 A;  4OO5 A;  2IMK A;  1Z7R A;  4EE0 A;  2PVQ A;  1WPI A;  3LQ7 A;  4ZB6 A;  3UEM A;  3BOA A;  2R2J A;  4WF4 A;  1EEJ A;  1F37 A;  5LD0 A;  3KD0 A;  1EP8 A;  3DYR A;  4Q5Q A;  2H66 A;  4LLR A;  4I6X A;  5ENU A;  3ZZX A;  4LMW A;  1C72 A;  4PQH A;  1HNA A;  1YKA A;  2DJ2 A;  4IQA A;  2LUS A;  2HZE B;  4XIH A;  2C0D A;  1ML6 A;  4GLT A;  2AJQ B;  5IMD A;  3L9U A;  4GTU A;  5CO3 A;  4LA1 A;  2WRT A;  1WMJ A;  1YEX A;  1JZD A;  2ZUP A;  4MA9 A;  3L9V A;  4MDC A;  3MNG A;  1ZCP A;  5DAK A;  2CAI A;  3E9J B;  3TDG A;  1ACV A;  4ACS A;  3N9J A;  1QQ2 A;  1JLW A;  4OCF A;  5COH A;  1OYJ A;  5ECR B;  4MF7 A;  2C0F A;  2H74 A;  2VLV A;  5B6N A;  4X0X A;  4LL1 B;  4ZIJ A;  4D73 A;  1VGL A;  2J23 A;  4XS4 A;  2HZE A;  2EIO A;  3R2Q A;  1PGT A;  1TW9 A;  2REM A;  1SKS B;  1BED A;  1M2B A;  4FIW A;  1YQ1 A;  1V9W A;  5C00 A;  4K1F A;  3ERF A;  2GSS A;  2YV7 A;  2GZZ A;  2WCI A;  5INY A;  1THO A;  4FYU A;  1U87 A;  9GSS A;  3A5W A;  1VRS D;  1MDI A;  3FR6 A;  5E4W A;  4NV2 A; 
#chains in the Genus database with same CATH topology
 5F06 A;  3EBT A;  3S5C A;  4EC6 A;  2V1L A;  14GS A;  5IEP A;  1TFO A;  2IL3 A;  4KFF A;  1ERV A;  3QFA C;  2HML B;  1KD1 4;  2VOC A;  1GUL A;  2C4J A;  5E59 A;  4CPK A;  2L4C A;  1GH2 A;  3FF0 A;  1MGW A;  19GS A;  3H1N A;  4PUR A;  4DSS B;  4WR4 A;  5IIZ A;  1V58 A;  1TTO A;  1IV9 A;  3K5T A;  1VQO 3;  2CX4 A;  4ZL9 A;  4N0V A;  5BXQ A;  3NBR A;  3WDG B;  1U88 A;  4XTS A;  2LS5 A;  3LT8 A;  1PRX A;  4N0Z A;  3ZRD A;  4ZXG A;  3KJY A;  3ZIV A;  1SII A;  3K7C A;  3FG3 A;  1I0X A;  5IEN A;  3H51 A;  1K8A 4;  4HJM A;  2JDI H;  3MHE A;  1QVG 2;  2OCT A;  4KA0 A;  1FUT A;  2K54 A;  5HOH A;  4FYB A;  4I8B A;  4KGI A;  1D6U A;  1K0N A;  3KP8 A;  3EF8 A;  22GS A;  1YIJ 3;  3GX8 A;  3D5I A;  4MEI A;  1OGX A;  1FGR A;  2HT9 A;  2V32 A;  3TKR A;  3F0I A;  2VCT A;  1X5D A;  3ZYW A;  5KN3 A;  4K7I A;  1DVC A;  4HOJ A;  1FO5 A;  2DBC A;  2O89 A;  4BU4 A;  1YNV X;  4BIK A;  1JN5 B;  1UUG B;  4MH3 A;  2CWT A;  1PL1 A;  1TUH A;  1FB0 A;  4EC0 A;  1C54 A;  2OE0 A;  4FMB A;  4K8M A;  2YJH A;  2DC5 A;  1O85 A;  2NPB A;  1X1W A;  1TFK A;  1ON4 A;  1PFP A;  1YI2 3;  2OA7 A;  4O32 A;  4TR3 A;  1BNF A;  3UNL A;  3X3Y A;  1SL2 B;  1N5P A;  2LQQ A;  3FW2 A;  3LW9 A;  3QAW A;  5J4U A;  10GS A;  2VUP A;  1SK1 A;  3CQF A;  1GLQ A;  3CPW 2;  1GUM A;  1KSI A;  1LJR A;  3IC8 A;  4MH2 A;  4WYK B;  2G2Q A;  1SYX A;  4QWT A;  3PH9 A;  1B2S A;  4HQS A;  1BOX A;  2H75 A;  1JN5 A;  2LNT A;  1B4P A;  3WA2 X;  2JAD A;  1BNR A;  1GUH A;  4WET A;  4JR6 A;  3HJO A;  1LNH A;  3DGO A;  3ZFL A;  5BVB A;  3LJR A;  5STD A;  3U97 A;  3F9S A;  2XGN A;  3L4N A;  2XFS A;  3CTF A;  2WOH A;  3T8U A;  2CK3 H;  1ROA A;  4Q5R A;  4L5O A;  4F03 A;  2CC3 A;  2W2C A;  1JZW A;  1FW1 A;  1GSS A;  3TOU A;  2LEG A;  2I4A A;  2P0X A;  2EIQ A;  2P05 A;  1Q82 4;  3F40 A;  1EWX A;  4KB3 A;  5IQY A;  5M1A A;  4MJA A;  2FUG 2;  1F8N A;  3BNC A;  4WYK A;  4K2X A;  1TXX A;  5G1K A;  4L8O A;  2E2T A;  1BRH A;  3I69 A;  1OC9 A;  1GNW A;  2FXT A;  4FCM A;  1BAO A;  3F7S A;  3F7X A;  3KSE D;  5AEW B;  2OJL A;  2VL3 A;  1F2E A;  1S3C A;  2HSH A;  3LSZ A;  4G10 A;  4HM0 B;  2WS2 A;  5EVO A;  2CKF B;  1H75 A;  2VLT A;  4V2N A;  3RBT A;  3NBJ A;  3LYK A;  1GWC A;  3GUS A;  3CPO A;  3RPP A;  1UGH I;  2MC8 A;  5JWR B;  5KP1 A;  4XBT A;  3HVV A;  5FHI A;  1HQO A;  4KZ1 A;  1S3R A;  2OE3 A;  2GT6 A;  4Q53 A;  2H1G A;  4YQU A;  3TB2 A;  4X4J A;  2HSM A;  3VPT A;  1A2L A;  4FYC A;  3HX8 A;  1SL0 B;  2LJA A;  4WXT A;  4MPG A;  4E8E A;  1HKX A;  2I9W A;  4KND A;  2CVB A;  2YWI A;  1I0V A;  4HAA A;  2W6J H;  2MYG A;  1Y6E A;  5DBQ A;  2BU4 A;  1SKW B;  3GZR A;  2RM5 A;  7GSS A;  5TGN A;  5EPF A;  2E2V A;  2XSH B;  2VCQ A;  3KZQ A;  1IVX A;  4ECC A;  5B6M A;  1VF4 A;  1T4Z A;  1V2A A;  1Q98 A;  1TP6 A;  3JUP A;  1ZYN A;  2CVD A;  3QR6 A;  3QAG A;  5IMF A;  1US1 A;  1AAZ A;  3MAK A;  4OFT A;  1FOV A;  1VQ8 3;  4K0G A;  5DQS A;  4HUA A;  1J0F A;  2K0M A;  4O92 A;  1SK0 A;  2IJY A;  3AGO A;  4V1A p;  3W6G A;  1AW9 A;  3PGT A;  1GP1 A;  3HI7 A;  4TR1 A;  4XRA A;  3A2V A;  2C0E A;  1T1V A;  2QA2 A;  1Z6N A;  2Z9S A;  3IC4 A;  2JZT A;  1BRN L;  3LTD A;  5ECS A;  2F56 A;  1B8X A;  6RNT A;  1O8W A;  4EKZ A;  2DJ0 A;  1QK8 A;  3S67 A;  1O81 A;  3PYJ A;  4HZ9 B;  2VIM A;  1M7T A;  1VF3 A;  3WGX A;  4R9K A;  3JUO A;  3T0U A;  1FG4 A;  1VQM 3;  1BSE A;  2KF3 A;  2PWJ A;  4EXR A;  1LQM B;  2CFG A;  1ISK A;  3EMP A;  4IBP A;  4KX4 A;  4NV5 A;  4PUA A;  1MWU A;  1RCL A;  1CQS A;  2W9P A;  3DRN A;  4LMI A;  3G9B A;  5KN2 A;  2Y73 A;  3KGK A;  4XDW A;  4MF6 A;  1R5A A;  2HFD A;  4A5P A;  2KF4 A;  3OW2 2;  2IA7 A;  1WJK A;  1AQX A;  1ZYP A;  4MMM A;  4AEQ A;  3PR8 A;  4EO3 A;  1DE3 A;  1A23 A;  18GS A;  2PER A;  1G6Y A;  2O85 A;  3HKR A;  4ZBB A;  5KN1 A;  1OF5 A;  1XVQ A;  2K9F A;  4MJB A;  4KDX A;  4HM3 B;  1EQK A;  3QOU A;  2JSY A;  5GAP D;  4HM6 B;  1IDP A;  3WT2 A;  2DLX A;  3K9M C;  1I2E A;  1UCL A;  3GKX A;  3Q3F A;  5DJL A;  1ILO A;  3P7X A;  1OKT A;  3L9S A;  5L71 A;  2VLU A;  3X41 A;  3IA1 A;  4PUF C;  2H6X A;  2IY2 A;  3TRP A;  2ML6 A;  1ZMA A;  3DIE A;  5JWQ B;  3FKA A;  2H70 A;  2RUE A;  5ECL B;  2OTJ 3;  2GDR A;  4QL9 A;  12GS A;  20GS A;  3D6I A;  1YY7 A;  1I5G A;  2QIY A;  1WRY A;  4L8P A;  1ZGN A;  1SQW A;  4CJN A;  2QGV A;  1KNG A;  1XCC A;  4J2F A;  4WP5 A;  1UC7 A;  2GSR A;  2BMR B;  4EV2 A;  2V2G A;  2CX3 A;  1RN7 A;  3VWX A;  5KP3 A;  4GXZ A;  1TI1 A;  4N6N B;  1RNB A;  1BIR A;  4KFE A;  5CXO A;  3J7Y k;  1NM3 A;  2VD1 A;  4HM8 B;  1J2B A;  2RUF A;  2JU5 A;  3IMA B;  2K8S A;  1U3A A;  1AR0 A;  2RNT A;  3SWL A;  4XRD A;  5AYR B;  2I81 A;  3UB1 A;  5AEU B;  1NW2 A;  1T7P B;  3GZB A;  3Q1C A;  4I97 A;  4LGQ A;  1OC3 A;  3WA3 A;  4P3Y B;  2YFL B;  3RGR A;  2DJ1 A;  3GV1 A;  5G5F A;  4BWQ A;  4K7O A;  4ID0 A;  3VI7 A;  1A90 A;  1SPU A;  4IVF A;  3VWW A;  3ALA A;  2HMO B;  4O02 B;  3FR3 A;  3PCS A;  4EDZ A;  3UL5 A;  2YWN A;  5H5R A;  1ERT A;  3NIV A;  2QEX 3;  4AF2 A;  4HZ4 A;  1WQL B;  4O5R A;  1NWW A;  5AN1 A;  1W2Z A;  2H1D A;  2KXG A;  1NHO A;  1N8Q A;  1YDK A;  5CRE A;  4G19 A;  1OE8 A;  4DSQ A;  1X5C A;  3DY5 A;  3DD3 A;  4ZL8 A;  2L6D A;  4KCE A;  1KC8 4;  2FLS A;  3KH7 A;  4GSN A;  2P5Q A;  5JPP A;  4HU9 A;  5ABR A;  3S9F A;  1RSN A;  3EBY A;  2YJ7 A;  9RNT A;  1VQ5 3;  1NDO B;  2GXF A;  3BCI A;  3T8N A;  5IOX A;  5M18 A;  5ID2 B;  3PPU A;  3ZVJ D;  2DSA A;  1JNQ A;  5F0G A;  3HXS A;  2KP2 A;  3E3E A;  1TRS A;  2M46 A;  1ROV A;  5ELA A;  3DGY A;  3CTG A;  1RGC A;  3ROB A;  2FY6 A;  2YZH A;  1G02 A;  3GWR A;  2R37 A;  1F9M A;  2XGL A;  5AIG A;  2LQV A;  1B48 A;  1IQ8 A;  2VL2 C;  1LOV A;  1SJW A;  1BAN A;  1SD9 A;  2LJR A;  3C71 A;  4F9Z A;  4PXO A;  4G9H A;  2CX1 A;  1E3V A;  2K18 A;  4MF5 A;  1AVK A;  1VQK 3;  4Z2R A;  3FG4 A;  1FGM A;  3CC4 3;  1SJ6 A;  2YPM A;  4JED A;  1MWR A;  4WHA A;  3D3L A;  8CHO A;  2VM2 A;  4H86 A;  2CIU A;  2RGQ A;  2B7K A;  2I3Y A;  5ID2 A;  5J3R A;  3RDE A;  4HSC X;  2F8F A;  2RSX A;  3QFB C;  4EDY A;  4GQC A;  1UCK A;  3HZP A;  2GGT A;  5CLK A;  3G6E 3;  1AUC A;  1ST9 A;  1CYU A;  3QRD A;  1T8E B;  4ZIL A;  3CD6 3;  2HMN B;  2B6M A;  4KSO A;  3Q2P A;  1N5H A;  1THX A;  1XBS A;  4CHS A;  1VZZ A;  3GKK A;  3HOH A;  3KIJ A;  1PL2 A;  3DVW A;  5CRG A;  2W56 A;  2RLI A;  1A2V A;  3D4T A;  1I3I A;  5DAK B;  3EU3 A;  3UAP A;  2OTL 3;  2AAE A;  1KTE A;  3NXJ A;  5AIV A;  5HR2 A;  4JBB A;  1UW1 A;  4RNY A;  3DXB A;  1PD2 1;  5AIS A;  2P31 A;  1FGQ A;  3VK9 A;  2R0G A;  4K5S A;  4KSM A;  3WT1 A;  1U3I A;  1S5A A;  2A2R A;  4IQ1 A;  2H8L A;  4D73 B;  5G2Z A;  3SBC A;  1HNC A;  1W4V A;  2MBT A;  1I70 A;  4N6V 0;  1J9B A;  4XS4 B;  1IV7 A;  1R5P A;  4AKY A;  4BWS A;  4LL4 B;  2C10 A;  3VWV A;  5IEO A;  3FY7 A;  1IYH A;  2CH9 A;  1G7O A;  4NMU A;  1RNT A;  2AAD A;  2HSY A;  4Z2T A;  3I9V 2;  4LYL B;  1M2A A;  3GKN A;  3MIX A;  1GMR A;  2HOH A;  2IME A;  4MAB A;  3TKQ A;  4RNT A;  4PX1 A;  3GSP A;  2LKU A;  1BNI A;  4BPY A;  4EV5 A;  2UX0 A;  2NBS A;  1BGS A;  1FUS A;  1WMP A;  4J56 E;  1W01 A;  4XM4 A;  4FO5 A;  2H0H A;  1HYU A;  1VQP 3;  2RCD A;  3FYG A;  4DVC A;  3HVX A;  4BL2 A;  1U5O A;  2KHP A;  1WIK A;  2H73 A;  3DGM A;  5D9T A;  5IOW A;  4EBG A;  3RNT A;  1UI7 A;  5ECM B;  2AUV A;  2CW9 A;  4G0K A;  1VF1 A;  3KMN A;  4TXV A;  5FGO A;  2P0M A;  3ZMK A;  4EUY A;  4BVX B;  1RLS A;  1CH0 A;  1AVL A;  4L7K A;  1DSB A;  1K0A A;  1W2B 2;  3TKS E;  1TDI A;  4IKH A;  1H4O A;  1UCJ A;  2CZ2 A;  2YAN A;  3ME8 A;  4YKG A;  5GSS A;  4IP1 A;  3LH4 A;  4ILF A;  3SOY A;  1XPV A;  5CRD A;  1X9S B;  2X8H A;  4TXO A;  1A24 A;  3CU3 A;  2OQE C;  3KMO A;  3HA9 A;  3BIR A;  1FAA A;  1ZOF A;  3RPN A;  1N9E A;  4V2M A;  1SAR A;  2BIR A;  1M99 A;  2Z77 A;  2L4Q A;  2QGU A;  3KP9 A;  4K61 A;  4I5Q A;  3IAM 2;  1YJN 3;  1RGK A;  2PPT A;  1K0B A;  5IPH A;  1LQG C;  3P8W A;  1TRW A;  2AYT A;  4IIA A;  3VF1 A;  3S29 A;  1N2A A;  3JUQ A;  1GTI A;  2YWO A;  5G30 A;  4BVX A;  1Q42 A;  2GQM A;  3F9U A;  5F05 A;  4KAE A;  2B1X B;  2C3T A;  5RNT A;  1F3A A;  1SD8 A;  3F4T A;  3Q6O A;  1YGE A;  3DKS A;  4NPB A;  3D79 A;  4J9A A;  2BMX A;  1O7G B;  1QMV A;  2R5G A;  3RAZ A;  5LNK e;  2KLX A;  4O7H A;  2E0Q A;  3Q19 A;  3HD5 A;  5DJM A;  4GL6 A;  2TRC P;  1HYF A;  2EIR A;  2H76 A;  2G0F A;  3CXC 2;  3NM7 A;  1RGH A;  4K0N A;  1AQZ A;  2BHM A;  2FHE A;  1ABA A;  1Q9E A;  5ELJ A;  4HJL B;  1RN4 A;  2B7J A;  3B7C A;  1YVB I;  3IJE B;  4HYZ A;  3KCM A;  2N5B A;  3G7J A;  3ZML A;  1M90 4;  1GMP A;  5C04 A;  1Q40 A;  4GB5 A;  3EYT A;  1BSA A;  2C3N A;  3OWU A;  13GS A;  5CRH A;  4HVN A;  3C1R A;  1Q7Y 4;  2LRN A;  3RHC A;  1MOL A;  5B7C A;  2MMA A;  4ISD A;  4GQF A;  1NB5 I;  2YFJ B;  2UZ8 A;  3I43 A;  5D81 A;  3LZA A;  2F9S A;  2XH9 A;  4GSP A;  1Q81 4;  2ZHX B;  1N8R 4;  1OH0 A;  2ON7 A;  1NNV A;  2IMD A;  2OAC A;  1WTH A;  2CFD A;  1FHE A;  2C1Y A;  1W7C A;  1OGZ A;  3GA4 A;  5D9V A;  1DYU A;  3KN4 A;  5J5N A;  2H72 A;  1K0C A;  4O2H A;  3FR9 A;  1JRQ A;  1RRH A;  2IUK A;  2MBS A;  4N11 A;  1XWK A;  1JJ2 2;  3DMC A;  4F0B A;  2JSZ A;  5H5S A;  4TOP A;  3DH2 A;  1XVW A;  3IOS A;  4J57 E;  5A4W A;  4ECB A;  4HM2 B;  1PY3 A;  1SYR A;  2O87 A;  2UGI A;  4H3U A;  3APS A;  1LRA A;  3GNJ A;  3G16 A;  1W6C A;  3CCQ 3;  3FLJ A;  4CCV A;  2LRT A;  1STD A;  3CME 3;  2F86 B;  1UN2 A;  1BYE A;  3NOF A;  4WF5 A;  2C8U A;  1B2U A;  2PZV A;  1T2I A;  2WB9 A;  4IJI A;  2K6V A;  3FH1 A;  3CSI A;  5G31 A;  1XOA A;  1K28 A;  2M80 A;  2J9H A;  1M9A A;  4ECI A;  3ZFZ A;  4K9Z A;  4MZC A;  1OC9 B;  2F5M A;  1STF I;  3AMO A;  1GSD A;  3DGQ A;  1PFO A;  3IR4 A;  1TK0 B;  3TJG A;  4F0C A;  4R9L A;  5B8A A;  1E2Y A;  1B27 A;  1YJW 3;  3WOD G;  2CHC A;  1BSB A;  3MSO A;  2LV3 A;  1CEW I;  3IK9 A;  1YJ6 A;  2JZR A;  3C7M A;  4JRF A;  1W5Z A;  3M8N A;  4KUN A;  4JU5 A;  1EP7 A;  1PQN A;  2H19 A;  3D9R A;  2AAW A;  2XBI A;  1B20 A;  3MG2 A;  3QMX A;  3EN1 B;  3IBH A;  4JRR A;  1FVK A;  3TKS A;  3AHW A;  3LYG A;  4ZB9 A;  4MLY A;  4KDU A;  2GVP A;  5HFG A;  5HGR A;  1V40 A;  1SK2 A;  3EN8 A;  3AGN A;  4GHO A;  1TK5 B;  3CCV 3;  2Z76 A;  3HDC A;  1S72 3;  1OAZ A;  2XFT A;  4FMA A;  1Q86 4;  1RGL A;  1ZX2 A;  3SVA A;  2R6K A;  3UL6 A;  5DCH A;  1BNJ A;  1NO3 A;  1K3Y A;  1DE2 A;  4I2U A;  1XOB A;  2QA4 3;  2VD0 A;  4O8S A;  3HZ8 A;  3CSH A;  1BRG A;  1U6T A;  5JCG A;  1FGO A;  3IHQ A;  2DIZ A;  4TR1 B;  1CQG A;  2BMQ B;  3CMI A;  4ORL A;  1GSY A;  1JFU A;  2IFQ A;  2TRX A;  3CCS 3;  4PTS A;  3CCU 3;  5AIH A;  1TU8 A;  1GSE A;  1PA3 A;  1G96 A;  2HRN A;  4XBY A;  2C4B A;  2YOI A;  2HMK B;  1A2K A;  4MP4 A;  4OMV A;  3LWA A;  1OE7 A;  4L0W A;  1D6Y A;  2IMF A;  1TU7 A;  2PBJ A;  3FZ9 A;  3TJK A;  2IMI A;  1M3I A;  2VO4 A;  3I56 3;  3OR5 A;  1FVJ A;  1PKW A;  1R4W A;  3FZW A;  4BL7 B;  4HS1 A;  3RHB A;  1SKR B;  3V92 A;  1DUG A;  3BB9 A;  2O9U X;  1FOH A;  4POK A;  3IRA A;  1QXH A;  2LST A;  1RJO A;  1K9M 4;  3D22 A;  2YZU A;  2D2Z A;  3GN3 A;  1TK8 B;  1OF5 B;  2C3Q A;  1Z6M A;  3I6A A;  3BBY A;  2OE1 A;  3PXM A;  5ECI B;  4G0I A;  5BU4 A;  3H93 A;  1M9G A;  1CQH A;  3M9K A;  5IG5 A;  3CCJ 3;  3CC7 3;  1GRX A;  4J5K A;  3VUR A;  1K0M A;  1LU4 A;  1GSP A;  3WGE A;  2YX9 A;  1GMQ A;  1OHO A;  3MYT A;  2FWF A;  1XIY A;  4XCS A;  1QUW A;  4XS6 A;  1BVI A;  3EC3 A;  3LFL A;  2IYJ A;  3V1W A;  2F5W A;  3MWH A;  4BL7 A;  4HI7 A;  2GU3 A;  3LOY A;  1V57 A;  2FA8 A;  1FYS A;  4HM1 B;  4FCZ A;  3LYP A;  2DJJ A;  5DDL A;  1GY6 A;  4IS0 A;  1RHL A;  3LXZ A;  1BRS A;  4O3V A;  3DGL A;  2GEY A;  4MJD A;  4IGJ A;  3GSS A;  1UUV B;  4YAV A;  1M2D A;  2KUC A;  4KE3 A;  2PGT A;  2IUJ A;  2QC7 A;  5IMZ A;  4MJC A;  1K41 A;  3M3M A;  3UMA A;  5G5E A;  2NTO A;  1ZL9 A;  4JF8 A;  5FT3 A;  3TGZ A;  2A4V A;  1WNH A;  2Z7A A;  2F98 A;  1IYI A;  3IE3 A;  1UA5 A;  3HVN A;  4WBR D;  1X1X A;  3NM2 A;  3FK8 A;  3O3T A;  1NU3 A;  3D0Z A;  4HU7 A;  2PVO C;  2E7P A;  1PKZ A;  3BND A;  4V2L A;  4AGS A;  4DSR A;  1SIH A;  1O73 A;  3CNM A;  2B1K A;  1W89 A;  2CVK A;  2B5Y A;  5IO0 A;  2X64 A;  2JQ5 A;  1AXD A;  1LOW A;  2XSO B;  3LGC A;  4HM4 B;  1G6W A;  2OBI A;  1A8L A;  3LML A;  5DAL A;  1AQW A;  1LBK A;  2FGX A;  4WEY A;  1JBS A;  1F3B A;  2F3M A;  3GX0 A;  1VQL 3;  3ERG A;  3LG6 A;  1C7H A;  3HY2 A;  2WZ9 A;  2R4I A;  3U5R E;  2Y74 A;  5IO2 A;  1GY5 A;  6GSP A;  5IG0 A;  4KDY A;  4WWU C;  1GTU A;  3CCM 3;  2H1B A;  1GLP A;  5HQP A;  3QK9 A;  5AII A;  1EGR A;  1WMN A;  3L78 A;  4U13 A;  5BIR A;  1F6M C;  4RI6 A;  4EVM A;  1OAC A;  2SBL A;  3FEU A;  2DIY A;  1EA2 A;  1RK4 A;  3FF2 A;  1R26 A;  1OC8 A;  2FD3 A;  3FG1 A;  4EYC A;  1TTZ A;  3KFQ C;  1XW5 A;  1IT7 A;  2XHF A;  1GTB A;  2HXK A;  2E2M A;  2QSI A;  3UJ1 A;  2VM1 A;  2XEP A;  1XWB A;  4LMV A;  2F8A A;  4AKZ A;  5IMA A;  3GH6 A;  5BRT A;  5D96 A;  2BNG A;  5AI1 A;  4NHF A;  1XWA A;  5CYY A;  1ZS7 A;  2GBX B;  2YV9 A;  1GSF A;  1XXU A;  2LRC A;  1O7P B;  1W02 A;  2KF6 A;  3EB8 A;  1TI3 A;  3TKP A;  3GKM A;  2HYX A;  2OOV A;  2DMM A;  1RN1 A;  1TKD B;  1GOV A;  4MCU A;  3ED3 A;  1TJD A;  2IN3 A;  4X2O A;  4IJ3 A;  1RGE A;  3GL5 A;  3NV0 A;  2XRX B;  3F4R A;  1E6B A;  3NQZ A;  3J7Y b;  5CRW A;  4X43 A;  6GST A;  3Q74 A;  4PNG A;  3KSP A;  7STD A;  5ECN B;  3DEX A;  1LOY A;  3VI5 A;  3IPZ A;  1WE0 A;  2IIY A;  3WR2 A;  2V41 A;  2PUK C;  4MMY B;  1MDK A;  3F14 A;  1I2G A;  2MF7 A;  1YKC A;  2BT3 A;  6GSX A;  1XG8 A;  1HD2 A;  3IXR A;  4TW5 A;  2H71 A;  4MZB A;  3DML A;  3HYP A;  5G1L A;  5EEO A;  5ELU A;  4ICY A;  6GSV A;  4KVH A;  2L1S A;  4AJ6 A;  4FMC A;  3PZW A;  2H6Y A;  1Z3E A;  4PNF A;  3O8Y A;  2W56 B;  1BUJ A;  2AV4 A;  1BAY A;  1BRI A;  3N8B A;  2ML5 A;  4J8T A;  4F2I A;  5KOX A;  5GSP A;  4Q5F A;  4POB A;  5J9C A;  3TJB A;  4CY6 A;  4TKY A;  4G0L A;  1DMN A;  1U8C B;  3M8C A;  2JL4 A;  3MG1 A;  1NJI 4;  2GTU A;  1X0R A;  1W6Y A;  3E99 A;  2WO0 A;  3UIW A;  2WJU A;  5GST A;  2ZA4 A;  1IVW A;  3W8S A;  4BL3 A;  2A2S A;  3GHA A;  2GST A;  2BO9 B;  2DJ3 A;  3SX1 A;  1EGO A;  2SAR A;  1QFN A;  5JCU A;  2GEX A;  2JZS A;  3E0U A;  1UDI I;  4HDE A;  1A2M A;  3JCM L;  1K0D A;  5D83 A;  1YF0 A;  4EXJ A;  1K73 4;  4MNN A;  2EC4 A;  2FNQ A;  3V99 A;  1A0R P;  1OUN A;  1YF1 A;  1B9Y C;  1GSQ A;  1UVZ A;  4PGT A;  3D5J A;  3BJ5 A;  4L5L A;  3A76 A;  1PYL A;  1DVD A;  3LXU X;  1SL1 B;  1TU5 A;  4STD A;  4G1M B;  4NHW A;  16GS A;  4TR4 A;  3ZLP A;  3PCR A;  3EUR A;  1UCI A;  5J9B A;  5KN0 A;  1B4Q A;  1A8Y A;  1M0U A;  5KOW A;  2JAC A;  1FGT A;  3NZN A;  3CXG A;  1TOF A;  4HM7 B;  5A4V A;  3N54 B;  4JR4 A;  5IM9 A;  3KKG A;  3NHX A;  4R80 A;  4OUQ A;  3OXA A;  2R0C A;  3MWZ A;  3US3 A;  1JV2 B;  2HE3 A;  1IU7 A;  1QAF A;  5D82 A;  3UVH A;  1TRV A;  3WOF B;  3ZIT A;  1UI8 A;  2W9Q A;  2LNS A;  2AHE A;  1I9D A;  3QCP A;  3IDV A;  4ZB8 A;  3G0K A;  3SXX A;  3KZT A;  1GY7 A;  1XWG A;  3LXT A;  1MDJ A;  5A5K A;  2Z6B A;  1PN0 A;  2A2P A;  3LTA A;  17GS A;  3R3E A;  3G7Y A;  3A3T A;  3CRT A;  5IW9 A;  4TX4 A;  4KW6 A;  2HMJ B;  3LOR A;  2R4V A;  2CQ9 A;  3ME7 A;  1QGV A;  4TXO B;  4XS1 A;  2O8V B;  2P09 A;  1PN9 A;  4BA7 A;  3DUK A;  2IPA A;  1KWI A;  4K6X A;  3LTB A;  3WD6 A;  1J08 A;  3I55 3;  2ZDJ A;  3KM6 A;  3MYD A;  3UOM A;  2KCD A;  3HJP A;  2B5E A;  4EW5 A;  4MJE A;  2GQK A;  3G7I A;  3VLN A;  3ZG0 A;  1RW1 A;  1IVV A;  1DBY A;  2H6Z A;  4KF9 A;  3OWY A;  1M9B A;  3HCZ A;  1EZK A;  3X3Z A;  2R41 A;  3OWS A;  2GSP A;  3CCR 3;  1X5E A;  2ON5 A;  5CNW A;  4CDO A;  3UVT A;  3ZFB A;  3F3Q A;  3ZL5 A;  2PU9 C;  4RUV A;  5DVB A;  2VCZ A;  4N6M A;  5ECQ B;  5CAX A;  1EEM A;  1EUI C;  3F3R A;  5LCZ A;  3EE2 A;  1E3R A;  4BIR A;  3TRQ A;  3PIN A;  4OK0 A;  1PX6 A;  5GAN D;  3TUE A;  6GSS A;  3EX9 A;  3RGA A;  3QDN A;  4RQX A;  1Z7P A;  5D8I A;  3A2W A;  5F8B A;  3JVC A;  5AIF A;  1EOH A;  3VSY A;  1S3A A;  3ZRE A;  7RNT A;  2L4V A;  5A0O B;  1VQ4 3;  3SLU A;  3J7Y d;  1GOU A;  1VQN 3;  5JWO B;  1Q40 B;  1D6Z A;  5JCW A;  5EQL A;  1FW7 A;  3GFK A;  2FWE A;  4WBJ A;  1ZO2 A;  3FZA A;  1L5G B;  3U6V A;  4BTX A;  5A4U A;  3PS8 A;  1O7W B;  3DZL A;  3BLZ A;  1O7U A;  4XBX A;  2X4A A;  2D1W A;  4EIP A;  1BRK A;  2FNO A;  1OHP A;  3HZ4 A;  1BSC A;  3G4S 3;  3ZIJ A;  3KXO A;  2HLS A;  3L0H A;  4GST A;  1A2J A;  2P38 A;  1YIT 3;  1GOY A;  2WDU A;  4HZB B;  1OCV A;  4WFO A;  4ZM8 A;  1JLV A;  2GS3 A;  4X1U A;  3TCO A;  5HFI A;  3NUV A;  2HI7 A;  1OVN A;  5AIX A;  1ASK A;  3EWL A;  4JE1 A;  3KE7 A;  1GUK A;  3D4A A;  4TRX A;  3APQ A;  2GZP A;  2CFK A;  4BVY A;  4QQ7 A;  5IMV A;  4HOH A;  1K3L A;  2XPD A;  4IN0 A;  2HRK A;  3F6D A;  3ZG5 A;  3WHO A;  5JBS A;  4L8E A;  1V98 A;  5IG3 A;  2WGO A;  1T4Y A;  1AIU A;  1ERW A;  2DML A;  1DET A;  3GH9 A;  1JB4 A;  4HQZ A;  4K1V A;  5J41 A;  5KP4 A;  3EIN A;  2XPE A;  3EJV A;  3UAR A;  1JHB A;  1ZGX A;  1USB A;  3FSD A;  3AMO B;  2FWG A;  2M7O A;  4GRF A;  3MDK A;  3QPM A;  3RDW A;  1B21 A;  4BTW A;  3GTU B;  1QAK A;  3H8Q A;  3M0F A;  1FUW A;  1PMT A;  3DM8 A;  4IEL A;  4JZQ A;  1WWJ A;  3X42 A;  4MK3 A;  2VAF A;  2OBK A;  2OAD A;  2XF3 A;  3H4K A;  4DSS A;  4IHU A;  2V6K A;  4ULX A;  3X40 A;  3F4S A;  3EU4 A;  2PN8 A;  2CA8 A;  5FWG A;  4I4K A;  5CF1 A;  4OD7 A;  4OCE A;  3QAV A;  2CWU A;  4R4K A;  4FH8 A;  3IV4 A;  5CP1 A;  4OVM A;  2J8X B;  3EVI A;  1I3F A;  3BCK A;  5ECK B;  4ECJ A;  2KAA A;  1UGI A;  2OWP A;  3SED A;  1Z9H A;  1GTA A;  3GL3 A;  1MNL A;  1PX7 A;  5D73 A;  4GSS A;  1RGG A;  5M19 A;  4LSO A;  4R1K A;  2MMO A;  4ZBA A;  2RBI A;  4MPF A;  3MPH A;  4K1U A;  3NQY A;  4J5G A;  3CRU A;  3ZVJ A;  3GTU A;  1AV4 A;  4XB5 A;  2HMM B;  7GSP A;  2TIR A;  1BU4 A;  1JZR A;  5BMU A;  4IPB A;  1BSD A;  4KH7 A;  2STD A;  1ERU A;  3CYN A;  4HZ2 A;  2FWH A;  1HU9 A;  3APO A;  1PSQ A;  1RQM A;  2VCV A;  3N5O A;  2NVL A;  1R7H A;  4TR0 A;  1GNE A;  4OWY A;  4KT3 B;  3X3X A;  3FZ4 A;  4QL7 A;  3EMX A;  4RQR A;  1B2X A;  1XZO A;  2CAQ A;  3DVX A;  3GRD A;  5HR3 A;  4IW9 A;  4GCI A;  2VL9 A;  5ELG A;  1IYY A;  5G2G A;  1MTC A;  3KTB A;  2GU1 A;  2QKE A;  4YQV A;  1SJZ A;  1Y25 A;  4WR5 A;  2IFQ B;  3KTL A;  2XC2 A;  1KQS 2;  1M1K 4;  5F07 A;  1YEP A;  1B2Z A;  4WKW A;  2PNC A;  4HJ2 A;  5IER A;  1BUQ A;  1YZX A;  3Q90 A;  5DRV A;  4RI7 A;  2L6C A;  3LT9 A;  3D4M A;  2YNX A;  2DJK A;  3TKS C;  2KF5 A;  5D9X A;  2CFW A;  5D93 A;  5IPG A;  1Q4J A;  2M72 A;  4K5R A;  3C8E A;  1RKY A;  1BQ7 A;  1AC1 A;  3P90 A;  11GS A;  6GSY A;  3EC9 A;  6STD A;  2LQO A;  2WFC A;  2GZY A;  1LOX A;  1MWS A;  1FB6 A;  1E97 A;  4GWR A;  1IQY A;  3IAS 2;  3DXO A;  4TVE A;  1RTU A;  3AY8 A;  3OX9 A;  2BJX A;  1TIJ A;  3C1S A;  1IVU A;  4PQ1 A;  4CY8 A;  1O7M B;  1W4N A;  2C11 A;  2GT5 A;  3EPT A;  5IMC A;  1I2F A;  3ERW A;  3L0R A;  3S27 A;  2R0P A;  1SEN A;  1NHY A;  2H0I A;  2IMJ A;  1KBN A;  5D9W A;  3FHK A;  1WOU A;  1BJX A;  1NSW A;  2MZC A;  3HII A;  2CT6 A;  2WUL A;  1LXE A;  2H01 A;  3NBB A;  4NAX A;  2R3X A;  2RM6 A;  3TOT A;  3A2X A;  2V6O A;  1ZZY A;  5ECP B;  1TRQ A;  5GZZ B;  5IF6 A;  2KP1 A;  4N6O B;  3TJJ A;  3U1W A;  3CC2 3;  1DE1 A;  3FZ5 A;  4POM A;  1Q7H A;  3F8H A;  3HVS A;  1URM A;  5HR1 A;  2RII A;  3BNB A;  2CZ3 A;  3FRC A;  3JUM A;  4CDL A;  5AYS C;  2B1L A;  3QD9 A;  3W8J A;  2VCW A;  2DKI A;  1SU9 A;  1I8V A;  3GZX B;  3STD A;  2P0G A;  1X9W B;  2QA1 A;  1QJG A;  2CV4 A;  1EV4 A;  3Q18 A;  2XBQ A;  3F63 A;  8RNT A;  2F51 A;  1A0F A;  3PGB A;  3FMW A;  1HNB A;  2L5L A;  1OPY A;  2C80 A;  3VPQ A;  3MSZ A;  1T3B A;  4MMX B;  1EV9 A;  3GST A;  4ML6 A;  1RCK A;  1GS3 A;  3IPT A;  5EY6 A;  1T5Y A;  4HEA 2;  2L59 A;  4HM5 B;  4K2D A;  4V1A g;  3O76 A;  3UBK A;  2H0G A;  3BNE A;  2I1U A;  1BX9 A;  4O5U A;  3VWU A;  1T00 A;  1UUW B;  3S28 A;  4K90 B;  4POL A;  2D42 A;  3KH9 A;  3HK4 A;  4LZI A;  1GYB A;  3K0Z A;  4Q5N A;  4YH2 A;  1FZU A;  5CK6 A;  3ISO A;  1BNS A;  5DAL B;  2ZCT A;  1N9J A;  3KII A;  4OO4 A;  4E8H A;  3VFI A;  1HZ1 A;  1M1X B;  3A5I A;  3NX0 A;  1XFL A;  1QMA A;  2L5O A;  2VCX A;  3O6T A;  3F6F A;  4HKV B;  4CW9 A;  1XW6 A;  4EIQ A;  2CWV A;  2A4H A;  2MMZ A;  2BMO B;  3GYK A;  4NWY A;  1ULJ B;  3WGD A;  2WGQ A;  1VQ7 3;  1MEK A;  3FGY A;  1TP9 A;  5KEJ A;  4O5Q A;  5LC6 A;  1WP0 A;  3G8Z A;  2CFL A;  4KFD A;  4OFM A;  3EQQ B;  3K8N A;  3TRX A;  1GD3 A;  5LC7 A;  2CG0 A;  1VQ6 3;  4AJ8 A;  3VGN A;  2X8G A;  3LTC A;  5HFK A;  1JB5 A;  2O3O A;  5DCG A;  8GSS A;  4GF0 A;  4EL1 A;  1KEB A;  4L0U A;  2YWM A;  1IT8 A;  3UL3 A;  3GMF A;  4I2T A;  3DGN A;  1N8J A;  1EG9 B;  2PMT A;  2Q07 A;  3H3H A;  1RGA A;  2C0G A;  3TJF A;  1X1U A;  2X99 A;  3GRX A;  3NV0 B;  3A5E A;  2BTO T;  3FKF A;  1G0T A;  4HBR A;  2HNL A;  3UBL A;  2RFR A;  5EL8 A;  4ML1 A;  1VF2 A;  2IWT A;  4KCA A;  1OKD A;  3GUR A;  3MG3 A;  1A67 A;  2AB6 A;  2B5X A;  3B8L A;  1G7E A;  3D21 A;  5AGY A;  1TRU A;  3P2A A;  1SJI A;  3IK7 A;  1MGR A;  4N10 A;  1DMQ A;  1BNE A;  4DEJ A;  2LJK A;  2HZF A;  1ZYE A;  3B4O A;  4DKI A;  2WGR A;  1AY7 A;  2OKA A;  3HIG A;  2CX0 A;  5JPU A;  1EKM A;  2O7K A;  3HHV A;  4XHM A;  2YFI B;  1BNG A;  3CBU A;  4MMZ B;  3DWV A;  3K63 A;  2GQL A;  2E2G A;  1R4Y A;  2P5R A;  2DKH A;  3EE1 A;  4N6T A;  3F8U A;  1AQV A;  2YCD A;  3HJM A;  3M9J A;  1T2H A;  1XW9 A;  2N5F A;  4N3V A;  3M1G A;  4FMD A;  2OOV C;  2H1A A;  1W00 A;  5HR0 A;  1BRJ A;  1Z1S A;  1JZO A;  1NB3 I;  4TN8 A;  4N30 A;  4NRE A;  5CF2 A;  1JB2 A;  2KOK A;  5DQY A;  1Z5Y E;  1MD4 A;  1Y4K A;  2N5A A;  3WOE B;  1K0O A;  3CCL 3;  4EF0 A;  3H79 A;  1V74 A;  2GBW B;  1B2M A;  5H5Q A;  3WYW A;  6GSU A;  1GL8 A;  2B3S A;  1QVF 2;  2HRF A;  2X8C A;  3FCS B;  1B3S A;  5B8B A;  2YP6 A;  1VQQ A;  4YQM A;  2VL2 A;  1ZYQ B;  1YGW A;  5FW5 A;  2K8V A;  3BD2 A;  2ZNM A;  3C73 A;  5ECH B;  1K3O A;  3ZTL A;  1B9X C;  3G71 3;  2NDO A;  2YN1 A;  1MWT A;  4G2E A;  2INX A;  4X2H A;  4H61 A;  4N6L A;  1OHS A;  3KCH A;  1O8X A;  2K3D A;  2W03 A;  3CMA 3;  1R4C A;  4NXI A;  2I9H A;  2A15 A;  1BG5 A;  4K7N A;  1JKG B;  4MZW A;  2E2U A;  1O7H B;  1YVS A;  2LTK A;  1RMS A;  4F82 A;  3URP A;  1LVN A;  4OFN A;  3LEF A;  3KEB A;  1X1Y A;  2GSQ A;  2H30 A;  2ALB A;  2MMN A;  4PQI A;  1GSU A;  1W6G A;  3ER7 A;  3CSJ A;  3GIX A;  2FA4 A;  1EOG A;  4NHZ A;  4PEJ A;  2ES7 A;  2X49 A;  4AJ7 A;  1O6J A;  4ZBD A;  2FCH A;  1XWC A;  1X9M B;  2F4Y A;  2GLR A;  6GSW A;  4Z7X A;  4YAP A;  1GD4 A;  4IP6 A;  4ZL7 A;  4RBN A;  4FQU A;  5ECO B;  2V1M A;  2L57 A;  5IG4 A;  1S3D A;  2LYX A;  1MD3 A;  1IK3 A;  5DRE A;  3GAX A;  4IT7 A;  4OO5 A;  2B24 B;  2IMK A;  1Z7R A;  4EE0 A;  2PVQ A;  4LEH A;  1WPI A;  3LQ7 A;  4ZB6 A;  3V98 A;  1JKG A;  3UEM A;  3BOA A;  2R2J A;  3D5G A;  4WF4 A;  3F8X A;  1EEJ A;  2HRA A;  1VQ9 3;  1F37 A;  5LD0 A;  3KD0 A;  4XDV A;  1EP8 A;  3MKI A;  3UJM A;  3DYR A;  5I97 A;  4Q5Q A;  2KRT A;  2H66 A;  4RZM A;  4I6X A;  4LLR A;  5ENU A;  1CYV A;  3ZZX A;  4N6U A;  3SOA A;  4LMW A;  1C72 A;  4PQH A;  4BTY A;  1YJ9 3;  1HNA A;  1YKA A;  2DJ2 A;  4IQA A;  4Z2U A;  2LUS A;  2HZE B;  1O7N B;  1YHQ 3;  4XIH A;  2C0D A;  1ML6 A;  1PU4 A;  4GLT A;  4FCJ A;  3AHS A;  3CCE 3;  2AJQ B;  5IMD A;  3L9U A;  1ULI B;  4GTU A;  5CO3 A;  4LA1 A;  2WRT A;  1WMJ A;  1YEX A;  1JZD A;  2ZUP A;  3WMD A;  4MA9 A;  3L9V A;  4MDC A;  3MNG A;  4USS A;  1ZCP A;  5DAK A;  1JBR A;  2CAI A;  2F99 A;  3E9J B;  1WMO A;  3N9H A;  3GZY B;  3TDG A;  5EVH A;  1ACV A;  4ACS A;  1A2P A;  2UUG C;  1QQ2 A;  1IQX A;  3N9J A;  1JLW A;  1RRL A;  4RNZ A;  4OCF A;  5COH A;  2W04 A;  3EHC A;  1OYJ A;  5ECR B;  1RGF A;  4MF7 A;  2C0F A;  2H74 A;  2VLV A;  1QAL A;  2W0Q A;  3BU4 A;  5B6N A;  1TRP A;  4LL1 B;  4X0X A;  4ZIJ A;  3OV4 A;  2WOF A;  4D73 A;  1VGL A;  2J23 A;  4XS4 A;  4FR9 A;  2HZE A;  1DMM A;  1JBT A;  2EIO A;  3R2Q A;  2CG1 A;  1LNI A;  1PGT A;  3IHG A;  1TW9 A;  2REM A;  1SKS B;  1BED A;  3B4P A;  1M2B A;  4FIW A;  1YQ1 A;  1V9W A;  2ZL8 A;  5C00 A;  4K1F A;  2OQE A;  3ERF A;  2GSS A;  1RDS A;  2YV7 A;  2GZZ A;  2WCI A;  5INY A;  1THO A;  4YKF A;  3ECF A;  2FGT A;  4BVY B;  3SYU A;  3JUN A;  4FYU A;  1U87 A;  9GSS A;  3A5W A;  1M3J A;  1VRS D;  2XR8 B;  1MDI A;  3I0Y A;  3FR6 A;  1FA3 A;  5E4W A;  3CNX A;  4NV2 A; 
#chains in the Genus database with same CATH homology
 5F06 A;  14GS A;  2IL3 A;  1ERV A;  3QFA C;  2VOC A;  1GUL A;  2C4J A;  5E59 A;  2L4C A;  1GH2 A;  19GS A;  3H1N A;  4PUR A;  4DSS B;  4WR4 A;  5IIZ A;  1V58 A;  2CX4 A;  4ZL9 A;  4N0V A;  1U88 A;  4XTS A;  2LS5 A;  1PRX A;  4N0Z A;  3ZRD A;  4ZXG A;  3KJY A;  3ZIV A;  4HJM A;  4KA0 A;  4FYB A;  4I8B A;  4KGI A;  1K0N A;  3KP8 A;  22GS A;  3GX8 A;  2HT9 A;  2V32 A;  3TKR A;  3F0I A;  2VCT A;  1X5D A;  3ZYW A;  5KN3 A;  4K7I A;  4HOJ A;  1FO5 A;  2DBC A;  2O89 A;  4MH3 A;  1PL1 A;  1FB0 A;  4EC0 A;  2OE0 A;  4K8M A;  2YJH A;  2DC5 A;  1O85 A;  2NPB A;  4O32 A;  1ON4 A;  2OA7 A;  4TR3 A;  1SL2 B;  2LQQ A;  3FW2 A;  3LW9 A;  3QAW A;  5J4U A;  10GS A;  2VUP A;  1SK1 A;  1GLQ A;  1GUM A;  1LJR A;  3IC8 A;  4MH2 A;  2G2Q A;  1SYX A;  3PH9 A;  4HQS A;  2H75 A;  2LNT A;  1B4P A;  2JAD A;  4WET A;  1GUH A;  4JR6 A;  3HJO A;  3ZFL A;  3LJR A;  3L4N A;  3CTF A;  4Q5R A;  4L5O A;  4F03 A;  1JZW A;  1FW1 A;  1GSS A;  3TOU A;  2LEG A;  2I4A A;  2EIQ A;  1EWX A;  4KB3 A;  5IQY A;  4MJA A;  2FUG 2;  4K2X A;  1TXX A;  5G1K A;  3I69 A;  1OC9 A;  1GNW A;  2OJL A;  2VL3 A;  1F2E A;  1S3C A;  2HSH A;  3LSZ A;  4G10 A;  2WS2 A;  5EVO A;  1H75 A;  2VLT A;  4V2N A;  3RBT A;  3LYK A;  1GWC A;  3GUS A;  3RPP A;  5JWR B;  3HVV A;  5FHI A;  1HQO A;  2OE3 A;  2GT6 A;  4YQU A;  2H1G A;  3TB2 A;  4X4J A;  2HSM A;  3VPT A;  1A2L A;  4FYC A;  1SL0 B;  2LJA A;  4WXT A;  4MPG A;  4E8E A;  4KND A;  2CVB A;  2YWI A;  2MYG A;  1Y6E A;  5DBQ A;  1SKW B;  2RM5 A;  7GSS A;  5EPF A;  2VCQ A;  3KZQ A;  4ECC A;  5B6M A;  1VF4 A;  1T4Z A;  1V2A A;  1Q98 A;  1ZYN A;  2CVD A;  3QR6 A;  3QAG A;  5IMF A;  1AAZ A;  3MAK A;  4OFT A;  1FOV A;  4K0G A;  5DQS A;  4HUA A;  1J0F A;  4O92 A;  1SK0 A;  2IJY A;  4V1A p;  3W6G A;  1AW9 A;  3PGT A;  1GP1 A;  4TR1 A;  4XRA A;  3A2V A;  2C0E A;  1T1V A;  2QA2 A;  1Z6N A;  2Z9S A;  3IC4 A;  2JZT A;  5ECS A;  1B8X A;  1O8W A;  4EKZ A;  2DJ0 A;  1QK8 A;  1O81 A;  2VIM A;  1M7T A;  1VF3 A;  3WGX A;  1FG4 A;  2PWJ A;  3EMP A;  4IBP A;  4KX4 A;  4NV5 A;  4PUA A;  3DRN A;  3G9B A;  5KN2 A;  3KGK A;  4MF6 A;  1R5A A;  2HFD A;  4A5P A;  1WJK A;  1ZYP A;  1AQX A;  4MMM A;  3PR8 A;  4EO3 A;  1A23 A;  18GS A;  2PER A;  1G6Y A;  2O85 A;  3HKR A;  4ZBB A;  5KN1 A;  1XVQ A;  2K9F A;  4MJB A;  4KDX A;  3QOU A;  2JSY A;  5GAP D;  3WT2 A;  2DLX A;  3GKX A;  1ILO A;  5DJL A;  3P7X A;  1OKT A;  3L9S A;  5L71 A;  2VLU A;  3IA1 A;  4PUF C;  2H6X A;  2IY2 A;  3TRP A;  1ZMA A;  3DIE A;  5JWQ B;  2H70 A;  2RUE A;  5ECL B;  2GDR A;  4QL9 A;  12GS A;  20GS A;  3D6I A;  1YY7 A;  1I5G A;  1WRY A;  1ZGN A;  2QGV A;  1KNG A;  1XCC A;  4J2F A;  1UC7 A;  2GSR A;  2V2G A;  2CX3 A;  3VWX A;  4GXZ A;  1TI1 A;  3J7Y k;  1NM3 A;  2VD1 A;  2RUF A;  2JU5 A;  2K8S A;  1U3A A;  3SWL A;  4XRD A;  2I81 A;  1NW2 A;  1T7P B;  4I97 A;  1OC3 A;  4P3Y B;  2DJ1 A;  3GV1 A;  5G5F A;  4BWQ A;  4K7O A;  4ID0 A;  3VI7 A;  4IVF A;  3VWW A;  3FR3 A;  4EDZ A;  2YWN A;  5H5R A;  1ERT A;  3NIV A;  4AF2 A;  4HZ4 A;  4O5R A;  5AN1 A;  2H1D A;  1NHO A;  1YDK A;  5CRE A;  4G19 A;  1OE8 A;  4DSQ A;  1X5C A;  3DD3 A;  4ZL8 A;  2L6D A;  4KCE A;  2FLS A;  3KH7 A;  4GSN A;  2P5Q A;  5ABR A;  4HU9 A;  3S9F A;  2YJ7 A;  3BCI A;  5IOX A;  5ID2 B;  3PPU A;  3ZVJ D;  2DSA A;  5F0G A;  3HXS A;  2KP2 A;  3E3E A;  1TRS A;  2M46 A;  5ELA A;  3CTG A;  2FY6 A;  2YZH A;  2R37 A;  1F9M A;  1B48 A;  2VL2 C;  1SD9 A;  2LJR A;  3C71 A;  4F9Z A;  4PXO A;  4G9H A;  2K18 A;  4MF5 A;  4Z2R A;  2YPM A;  1SJ6 A;  4JED A;  2VM2 A;  4H86 A;  2B7K A;  2I3Y A;  5ID2 A;  5J3R A;  2F8F A;  3QFB C;  4EDY A;  4GQC A;  2GGT A;  1AUC A;  1ST9 A;  1T8E B;  4ZIL A;  2B6M A;  4KSO A;  1XBS A;  1THX A;  4CHS A;  3GKK A;  3KIJ A;  1PL2 A;  3DVW A;  5CRG A;  2RLI A;  3D4T A;  5DAK B;  3EU3 A;  3UAP A;  1KTE A;  5AIV A;  5HR2 A;  4JBB A;  3DXB A;  1PD2 1;  5AIS A;  2P31 A;  3VK9 A;  2R0G A;  4K5S A;  4KSM A;  3WT1 A;  1U3I A;  2A2R A;  4IQ1 A;  2H8L A;  4D73 B;  5G2Z A;  3SBC A;  1HNC A;  1W4V A;  2MBT A;  1J9B A;  4XS4 B;  1R5P A;  4BWS A;  4LL4 B;  3VWV A;  3FY7 A;  1IYH A;  1G7O A;  4NMU A;  2HSY A;  4Z2T A;  3I9V 2;  1M2A A;  3GKN A;  3MIX A;  2IME A;  4MAB A;  3TKQ A;  4PX1 A;  2LKU A;  4BPY A;  2NBS A;  4J56 E;  4FO5 A;  2H0H A;  1HYU A;  3FYG A;  4DVC A;  3HVX A;  2KHP A;  1WIK A;  2H73 A;  5D9T A;  5IOW A;  5ECM B;  2AUV A;  4G0K A;  1VF1 A;  3KMN A;  4TXV A;  4EUY A;  3ZMK A;  4BVX B;  1DSB A;  1K0A A;  3TKS E;  1TDI A;  4IKH A;  1H4O A;  2CZ2 A;  2YAN A;  3ME8 A;  4YKG A;  5GSS A;  4IP1 A;  4ILF A;  5CRD A;  1XPV A;  1X9S B;  2X8H A;  4TXO A;  1A24 A;  3KMO A;  3HA9 A;  1FAA A;  1ZOF A;  3RPN A;  4V2M A;  1M99 A;  2L4Q A;  3KP9 A;  4I5Q A;  3IAM 2;  2PPT A;  1K0B A;  5IPH A;  3P8W A;  1TRW A;  2AYT A;  1N2A A;  1GTI A;  2YWO A;  5G30 A;  4BVX A;  2GQM A;  3F9U A;  5F05 A;  4KAE A;  2C3T A;  1F3A A;  1SD8 A;  3F4T A;  3Q6O A;  3DKS A;  4NPB A;  2BMX A;  1QMV A;  2R5G A;  3RAZ A;  5LNK e;  2KLX A;  4O7H A;  2E0Q A;  3Q19 A;  3HD5 A;  5DJM A;  2TRC P;  2EIR A;  2H76 A;  2G0F A;  4K0N A;  2FHE A;  1ABA A;  2B7J A;  3KCM A;  2N5B A;  3G7J A;  3ZML A;  5C04 A;  3EYT A;  2C3N A;  13GS A;  5CRH A;  3C1R A;  2LRN A;  3RHC A;  5B7C A;  2MMA A;  4ISD A;  4GQF A;  2UZ8 A;  3I43 A;  2F9S A;  2ON7 A;  2IMD A;  2OAC A;  2C1Y A;  5D9V A;  1FHE A;  3GA4 A;  5J5N A;  2H72 A;  1K0C A;  3FR9 A;  2MBS A;  4N11 A;  1XWK A;  4F0B A;  2JSZ A;  5H5S A;  4TOP A;  1XVW A;  3IOS A;  4J57 E;  5A4W A;  4ECB A;  1SYR A;  2O87 A;  3APS A;  3GNJ A;  2LRT A;  1UN2 A;  3NOF A;  1BYE A;  4WF5 A;  2C8U A;  2WB9 A;  4IJI A;  2K6V A;  3CSI A;  5G31 A;  1XOA A;  2M80 A;  2J9H A;  1M9A A;  4ECI A;  4K9Z A;  4MZC A;  1OC9 B;  1GSD A;  3DGQ A;  3IR4 A;  1TK0 B;  3TJG A;  4F0C A;  5B8A A;  1E2Y A;  2LV3 A;  3IK9 A;  1YJ6 A;  2JZR A;  3C7M A;  3M8N A;  4KUN A;  4JU5 A;  1EP7 A;  1PQN A;  2H19 A;  2AAW A;  2XBI A;  3QMX A;  3IBH A;  4JRR A;  1FVK A;  3TKS A;  4ZB9 A;  4MLY A;  4KDU A;  2GVP A;  5HFG A;  1V40 A;  1SK2 A;  1TK5 B;  3HDC A;  1OAZ A;  5DCH A;  2R6K A;  1K3Y A;  1DE2 A;  4I2U A;  1XOB A;  2VD0 A;  3HZ8 A;  3CSH A;  1U6T A;  5JCG A;  3IHQ A;  2DIZ A;  4TR1 B;  1CQG A;  3CMI A;  1GSY A;  1JFU A;  2IFQ A;  2TRX A;  4PTS A;  1TU8 A;  1GSE A;  1PA3 A;  2HRN A;  2YOI A;  4MP4 A;  4OMV A;  3LWA A;  1OE7 A;  4L0W A;  2IMF A;  2PBJ A;  1TU7 A;  3TJK A;  3FZ9 A;  2IMI A;  2VO4 A;  3OR5 A;  1FVJ A;  1PKW A;  1R4W A;  4BL7 B;  4HS1 A;  3RHB A;  1SKR B;  1DUG A;  1FOH A;  4POK A;  3IRA A;  1QXH A;  2LST A;  3D22 A;  2YZU A;  2D2Z A;  3GN3 A;  1TK8 B;  2C3Q A;  1Z6M A;  3I6A A;  3BBY A;  2OE1 A;  5ECI B;  4G0I A;  3H93 A;  1CQH A;  3M9K A;  1GRX A;  3VUR A;  1K0M A;  1LU4 A;  3WGE A;  2FWF A;  1XIY A;  4XCS A;  1QUW A;  4XS6 A;  3EC3 A;  3LFL A;  2IYJ A;  3V1W A;  3MWH A;  4BL7 A;  4HI7 A;  1V57 A;  2FA8 A;  3LYP A;  2DJJ A;  5DDL A;  4IS0 A;  3LXZ A;  4IGJ A;  3GSS A;  4YAV A;  1M2D A;  2KUC A;  4KE3 A;  2PGT A;  2QC7 A;  5IMZ A;  4MJC A;  3M3M A;  3UMA A;  5G5E A;  2NTO A;  1ZL9 A;  5FT3 A;  3TGZ A;  2A4V A;  1IYI A;  3IE3 A;  1UA5 A;  4WBR D;  3FK8 A;  3O3T A;  3D0Z A;  4HU7 A;  2PVO C;  2E7P A;  1PKZ A;  4V2L A;  4AGS A;  4DSR A;  1O73 A;  2B1K A;  1W89 A;  2CVK A;  2B5Y A;  5IO0 A;  2X64 A;  1AXD A;  3LGC A;  1G6W A;  2OBI A;  1A8L A;  5DAL A;  1AQW A;  1LBK A;  2FGX A;  4WEY A;  1F3B A;  2F3M A;  3GX0 A;  3ERG A;  3LG6 A;  3HY2 A;  2WZ9 A;  3U5R E;  5IO2 A;  4KDY A;  1GTU A;  2H1B A;  1GLP A;  5HQP A;  1EGR A;  3L78 A;  1F6M C;  4RI6 A;  4EVM A;  3FEU A;  2DIY A;  1RK4 A;  1R26 A;  1OC8 A;  2FD3 A;  1TTZ A;  1XW5 A;  2XHF A;  1GTB A;  2HXK A;  2E2M A;  2QSI A;  3UJ1 A;  2VM1 A;  1XWB A;  4LMV A;  2F8A A;  5IMA A;  3GH6 A;  5BRT A;  5D96 A;  1XWA A;  5CYY A;  2YV9 A;  1GSF A;  1XXU A;  2LRC A;  1TI3 A;  3TKP A;  3GKM A;  2HYX A;  2DMM A;  1TKD B;  4MCU A;  3ED3 A;  1TJD A;  2IN3 A;  4IJ3 A;  3GL5 A;  3F4R A;  1E6B A;  3J7Y b;  5CRW A;  4X43 A;  6GST A;  3Q74 A;  4PNG A;  5ECN B;  3DEX A;  3VI5 A;  3IPZ A;  1WE0 A;  2IIY A;  2V41 A;  2PUK C;  1MDK A;  6GSX A;  1YKC A;  1HD2 A;  3IXR A;  4TW5 A;  2H71 A;  4MZB A;  3DML A;  3HYP A;  5G1L A;  4ICY A;  6GSV A;  4AJ6 A;  2H6Y A;  1Z3E A;  4PNF A;  2AV4 A;  1BAY A;  4F2I A;  5KOX A;  4Q5F A;  4POB A;  5J9C A;  3TJB A;  4CY6 A;  4TKY A;  4G0L A;  2JL4 A;  2GTU A;  1X0R A;  3UIW A;  2WJU A;  5GST A;  3W8S A;  2A2S A;  3GHA A;  2GST A;  2DJ3 A;  1EGO A;  1QFN A;  5JCU A;  2JZS A;  3E0U A;  4HDE A;  1A2M A;  3JCM L;  1K0D A;  1YF0 A;  4EXJ A;  4MNN A;  2EC4 A;  1A0R P;  1YF1 A;  1B9Y C;  1GSQ A;  1UVZ A;  4PGT A;  3D5J A;  3BJ5 A;  4L5L A;  1SL1 B;  4NHW A;  16GS A;  4TR4 A;  3ZLP A;  3EUR A;  5KN0 A;  5J9B A;  1B4Q A;  1A8Y A;  1M0U A;  5KOW A;  2JAC A;  3NZN A;  3CXG A;  1TOF A;  5A4V A;  4JR4 A;  5IM9 A;  2R0C A;  3US3 A;  2HE3 A;  3UVH A;  1TRV A;  3ZIT A;  2LNS A;  2AHE A;  1I9D A;  3QCP A;  3IDV A;  4ZB8 A;  1XWG A;  3LXT A;  1MDJ A;  5A5K A;  1PN0 A;  2A2P A;  17GS A;  3R3E A;  3G7Y A;  3A3T A;  3CRT A;  4KW6 A;  3LOR A;  2R4V A;  2CQ9 A;  3ME7 A;  1QGV A;  4TXO B;  4XS1 A;  2O8V B;  1PN9 A;  4BA7 A;  2IPA A;  4K6X A;  3WD6 A;  1J08 A;  3KM6 A;  3MYD A;  3UOM A;  3HJP A;  2B5E A;  4MJE A;  2GQK A;  3G7I A;  3VLN A;  1RW1 A;  1DBY A;  2H6Z A;  4KF9 A;  1M9B A;  3HCZ A;  1EZK A;  1X5E A;  2ON5 A;  5CNW A;  4CDO A;  3UVT A;  3ZFB A;  3F3Q A;  3ZL5 A;  2PU9 C;  4RUV A;  5DVB A;  2VCZ A;  5ECQ B;  5CAX A;  1EEM A;  3F3R A;  5LCZ A;  3EE2 A;  3TRQ A;  3PIN A;  1PX6 A;  5GAN D;  3TUE A;  6GSS A;  3QDN A;  4RQX A;  1Z7P A;  5D8I A;  3A2W A;  5F8B A;  1EOH A;  1S3A A;  3ZRE A;  5JWO B;  5JCW A;  3GFK A;  2FWE A;  4WBJ A;  3FZA A;  3U6V A;  5A4U A;  1O7U A;  2X4A A;  4EIP A;  2FNO A;  3HZ4 A;  3ZIJ A;  3KXO A;  4GST A;  2HLS A;  3L0H A;  1A2J A;  2WDU A;  1JLV A;  2GS3 A;  4X1U A;  3TCO A;  5HFI A;  2HI7 A;  1OVN A;  5AIX A;  3EWL A;  4JE1 A;  1GUK A;  4TRX A;  3APQ A;  2GZP A;  4BVY A;  4QQ7 A;  5IMV A;  1K3L A;  2XPD A;  4IN0 A;  2HRK A;  3F6D A;  4L8E A;  1V98 A;  1T4Y A;  1AIU A;  1ERW A;  2DML A;  3GH9 A;  4HQZ A;  5J41 A;  3EIN A;  2XPE A;  3UAR A;  1JHB A;  1USB A;  2FWG A;  4GRF A;  3MDK A;  3QPM A;  3RDW A;  3GTU B;  3M0F A;  3H8Q A;  1PMT A;  4IEL A;  4JZQ A;  1WWJ A;  4MK3 A;  2VAF A;  2OBK A;  2OAD A;  3H4K A;  4DSS A;  4IHU A;  2V6K A;  4ULX A;  3F4S A;  3EU4 A;  2PN8 A;  2CA8 A;  5FWG A;  4OD7 A;  4OCE A;  3QAV A;  4FH8 A;  3IV4 A;  5CP1 A;  3EVI A;  3BCK A;  5ECK B;  4ECJ A;  1Z9H A;  1GTA A;  3GL3 A;  1PX7 A;  5D73 A;  4GSS A;  2MMO A;  4ZBA A;  4MPF A;  3CRU A;  3ZVJ A;  3GTU A;  2TIR A;  1JZR A;  5BMU A;  4KH7 A;  1ERU A;  3CYN A;  4HZ2 A;  2FWH A;  3APO A;  1PSQ A;  1RQM A;  2VCV A;  3N5O A;  2NVL A;  1R7H A;  4TR0 A;  1GNE A;  4OWY A;  3FZ4 A;  4QL7 A;  3EMX A;  4RQR A;  1XZO A;  2CAQ A;  3DVX A;  5HR3 A;  4IW9 A;  4GCI A;  2VL9 A;  5ELG A;  1MTC A;  3KTB A;  2QKE A;  4YQV A;  1SJZ A;  1Y25 A;  4WR5 A;  2IFQ B;  3KTL A;  2XC2 A;  5F07 A;  1YEP A;  4WKW A;  4HJ2 A;  1YZX A;  4RI7 A;  2L6C A;  3D4M A;  2YNX A;  2DJK A;  3TKS C;  5D9X A;  5D93 A;  5IPG A;  1Q4J A;  2M72 A;  4K5R A;  3C8E A;  1BQ7 A;  1AC1 A;  3P90 A;  11GS A;  6GSY A;  2LQO A;  2WFC A;  2GZY A;  1FB6 A;  4GWR A;  3IAS 2;  4TVE A;  3AY8 A;  2BJX A;  3C1S A;  4PQ1 A;  4CY8 A;  5IMC A;  2GT5 A;  3EPT A;  3ERW A;  2R0P A;  1SEN A;  1NHY A;  2H0I A;  1KBN A;  5D9W A;  3FHK A;  1WOU A;  1BJX A;  1NSW A;  2MZC A;  2CT6 A;  2WUL A;  2H01 A;  4NAX A;  2R3X A;  2RM6 A;  3TOT A;  3A2X A;  2V6O A;  1ZZY A;  5ECP B;  5GZZ B;  2KP1 A;  3TJJ A;  1DE1 A;  3FZ5 A;  4POM A;  3HVS A;  1URM A;  5HR1 A;  2RII A;  2CZ3 A;  3FRC A;  2B1L A;  3QD9 A;  3W8J A;  2VCW A;  2DKI A;  1SU9 A;  1X9W B;  2P0G A;  2QA1 A;  2CV4 A;  1EV4 A;  3Q18 A;  2XBQ A;  3F63 A;  2F51 A;  1A0F A;  3FMW A;  1HNB A;  2L5L A;  2C80 A;  3VPQ A;  3MSZ A;  1T3B A;  1EV9 A;  3GST A;  4ML6 A;  5EY6 A;  4HEA 2;  2L59 A;  4K2D A;  4V1A g;  3O76 A;  3UBK A;  2H0G A;  2I1U A;  1BX9 A;  4O5U A;  3VWU A;  1T00 A;  4POL A;  3KH9 A;  4Q5N A;  4YH2 A;  3ISO A;  5DAL B;  2ZCT A;  4OO4 A;  4E8H A;  3VFI A;  3A5I A;  1XFL A;  2L5O A;  2VCX A;  3O6T A;  3F6F A;  4CW9 A;  1XW6 A;  4EIQ A;  2A4H A;  2MMZ A;  3GYK A;  4NWY A;  3WGD A;  1MEK A;  1TP9 A;  5KEJ A;  4O5Q A;  1WP0 A;  4OFM A;  3K8N A;  3TRX A;  4AJ8 A;  2X8G A;  5HFK A;  5DCG A;  8GSS A;  4GF0 A;  4EL1 A;  1KEB A;  4L0U A;  2YWM A;  3UL3 A;  3GMF A;  4I2T A;  1N8J A;  2PMT A;  2C0G A;  3TJF A;  2X99 A;  3GRX A;  2BTO T;  3FKF A;  1G0T A;  2HNL A;  3UBL A;  5EL8 A;  4ML1 A;  1VF2 A;  2IWT A;  4KCA A;  1OKD A;  3GUR A;  2AB6 A;  2B5X A;  1G7E A;  3D21 A;  5AGY A;  1TRU A;  3P2A A;  1SJI A;  3IK7 A;  4N10 A;  4DEJ A;  2LJK A;  2HZF A;  1ZYE A;  2WGR A;  2OKA A;  2O7K A;  3HHV A;  4XHM A;  3CBU A;  3DWV A;  2GQL A;  2E2G A;  2P5R A;  2DKH A;  3F8U A;  1AQV A;  2YCD A;  3HJM A;  3M9J A;  2N5F A;  1XW9 A;  3M1G A;  2H1A A;  5HR0 A;  1JZO A;  4TN8 A;  4N30 A;  2KOK A;  5DQY A;  1Z5Y E;  1MD4 A;  2N5A A;  1K0O A;  4EF0 A;  3H79 A;  5H5Q A;  3WYW A;  6GSU A;  1GL8 A;  2B3S A;  2HRF A;  2X8C A;  5B8B A;  2YP6 A;  4YQM A;  2VL2 A;  1ZYQ B;  2K8V A;  3BD2 A;  2ZNM A;  3C73 A;  5ECH B;  1K3O A;  3ZTL A;  1B9X C;  2NDO A;  2YN1 A;  4G2E A;  1O8X A;  4NXI A;  2I9H A;  1BG5 A;  4K7N A;  4MZW A;  2LTK A;  4F82 A;  4OFN A;  3LEF A;  4PQI A;  3KEB A;  2GSQ A;  2H30 A;  2ALB A;  2MMN A;  1GSU A;  3CSJ A;  3GIX A;  2FA4 A;  1EOG A;  4NHZ A;  2ES7 A;  2X49 A;  4AJ7 A;  1O6J A;  4ZBD A;  2FCH A;  1XWC A;  1X9M B;  2GLR A;  6GSW A;  4Z7X A;  4YAP A;  4IP6 A;  4ZL7 A;  4FQU A;  5ECO B;  2V1M A;  2L57 A;  1S3D A;  1MD3 A;  4OO5 A;  2IMK A;  1Z7R A;  4EE0 A;  2PVQ A;  1WPI A;  3LQ7 A;  4ZB6 A;  3UEM A;  3BOA A;  2R2J A;  4WF4 A;  1EEJ A;  2HRA A;  1F37 A;  5LD0 A;  3KD0 A;  1EP8 A;  3DYR A;  4Q5Q A;  2H66 A;  4LLR A;  4I6X A;  5ENU A;  3ZZX A;  4LMW A;  1C72 A;  4PQH A;  1HNA A;  1YKA A;  2DJ2 A;  4IQA A;  4Z2U A;  2LUS A;  2HZE B;  4XIH A;  2C0D A;  1ML6 A;  4GLT A;  2AJQ B;  5IMD A;  3L9U A;  4GTU A;  5CO3 A;  4LA1 A;  2WRT A;  1WMJ A;  1YEX A;  1JZD A;  2ZUP A;  4MA9 A;  3L9V A;  4MDC A;  3MNG A;  4USS A;  1ZCP A;  5DAK A;  2CAI A;  3E9J B;  3TDG A;  1ACV A;  4ACS A;  3N9J A;  1QQ2 A;  1JLW A;  4OCF A;  5COH A;  1OYJ A;  5ECR B;  4MF7 A;  2C0F A;  2H74 A;  2VLV A;  5B6N A;  4X0X A;  4LL1 B;  4ZIJ A;  4D73 A;  1VGL A;  2J23 A;  4XS4 A;  2HZE A;  2EIO A;  3R2Q A;  1PGT A;  3IHG A;  1TW9 A;  2REM A;  1SKS B;  1BED A;  1M2B A;  4FIW A;  1YQ1 A;  1V9W A;  5C00 A;  4K1F A;  3ERF A;  2GSS A;  2YV7 A;  2GZZ A;  2WCI A;  5INY A;  1THO A;  4YKF A;  4BVY B;  4FYU A;  1U87 A;  9GSS A;  3A5W A;  1VRS D;  1MDI A;  3FR6 A;  5E4W A;  4NV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...