1T3BA

X-ray structure of dsbc from haemophilus influenzae
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
209
structure length
209
Chain Sequence
DAAIKRKLQSFNISNIVIKSSPISGIKTAVTDQGILYVSEDGKYLFEGKLYELTNNGPVDVAGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDITCHYCHLLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTAKDPVFALNEAEKGNLPKEVKTPNIVKKHYELGIQFGVRGTPSIVTSTGELIGGYLKPADLLRALEETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbC
publication title Structure of DsbC from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Isomerase
total genus 53
structure length 209
sequence length 209
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2004-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1t3bA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1t3bA02
3GL3A 4ECBA 5CYYA 2HXKA 1TRVA 3LSZA 4EDYA 1Q4JA 2OADA 4YH2A 3BBYA 4QL7A 5HR0A 3KGKA 2A2RA 2QSIA 2P5QA 1GSUA 2XBQA 3M9KA 2GZPA 4ZBBA 3LORA 7GSSA 2CVKA 4Q5NA 1NHOA 2VLUA 4EUYA 1GLQA 3PINA 5CO3A 3BCKA 1THXA 4RQXA 3IE3A 5D93A 3C8EA 1GLPA 2JZTA 4WETA 1V57A 1V58A 2O85A 2F8AA 1OKTA 2LV3A 2NDOA 1CQHA 3RDWA 4EL1A 2X8GA 1GUHA 3UMAA 2F8FA 3G7IA 1YY7A 5AN1A 3G9BA 1X5CA 3GH9A 3H8QA 3CRTA 2C0FA 2GSTA 4HZ4A 5D9WA 3DIEA 2WRTA 1K0CA 1GSQA 4I8BA 2TIRA 2WFCA 2WJUA 2EIRA 5INYA 5DQSA 4L0WA 3KTBA 6GSUA 1Z6MA 1NHYA 1PL1A 4DVCA 1K0MA 1Z9HA 2R3XA 1DE1A 1OE8A 4IJ3A 2OE0A 1ABAA 5GAPD 1HNBA 1WIKA 4AF2A 4WEYA 2ALBA 2LEGA 3OR5A 1U87A 2H6XA 3I9V2 3GURA 2RIIA 5DBQA 1K3YA 1K0AA 1GUMA 2TRCP 1ZOFA 4KCAA 2H72A 1QUWA 1B9XC 2GDRA 2G2QA 3HYPA 5EL8A 5B7CA 1AIUA 2GZZA 1AQVA 3F3RA 3DWVA 1SK0A 3GSTA 3HD5A 4PURA 3RHCA 2ZUPA 2HNLA 4BL7A 3EU4A 1G6WA 1XWAA 3ZYWA 1JLWA 5J9CA 1QFNA 5IOXA 2VM2A 10GSA 3CYNA 1WWJA 3ZRDA 1FB6A 1PSQA 2YWNA 4GTUA 3V1WA 1TRWA 2GQLA 4O32A 1EOHA 1SD9A 2H6YA 12GSA 2JSZA 5J41A 2PMTA 4ZL9A 3W8JA 6GSWA 5J4UA 3ME7A 3Q18A 4O7HA 3BCIA 3ZVJA 2BMXA 4GQCA 1GTBA 3HCZA 2X8CA 1YEXA 3SWLA 3N5OA 1EZKA 2D2ZA 3UVTA 3C73A 4K2DA 2JU5A 1ERTA 3ZITA 1THOA 3VWXA 2X64A 4MA9A 2LKUA 2FWHA 3IDVA 1GWCA 2AUVA 2GT6A 4KDUA 1RQMA 4Q5FA 1WPIA 3QFBC 5DCHA 1GSYA 4MCUA 2VLVA 1UVZA 4V2NA 2L6DA 1SKWB 3F4SA 5IIZA 2GTUA 2A2SA 2PVOC 2I81A 5B8BA 2G0FA 5AIVA 2HRFA 3NIVA 2X99A 2VL9A 2DJJA 1YKCA 3QMXA 2ZCTA 5DJMA 4TXVA 2LQOA 1N8JA 1XBSA 1F3BA 4V1Ag 2GVPA 2LTKA 3CTFA 4RQRA 1IYHA 2FY6A 4RI6A 4BWQA 3KH7A 2R5GA 1GTUA 4K7NA 5H5RA 2IY2A 2ES7A 1FHEA 3Q19A 2M80A 3J7Yk 4D73B 4TW5A 3FHKA 1M2AA 4KDXA 4XRDA 2PERA 2C0EA 3FZ5A 4ZBAA 2DMLA 3F9UA 2L57A 3KM6A 2HFDA 4L5LA 5HFIA 5ELGA 3WGEA 1X5DA 2WZ9A 1VF3A 2MBTA 5G2ZA 5ECRB 2GQMA 1SK2A 2H71A 3R2QA 1AUCA 2VCQA 3APOA 3LJRA 1JHBA 3FKFA 5DALB 2KP2A 1OYJA 4DSQA 2HZFA 2E7PA 3WT1A 2F9SA 3TKSE 1EOGA 3UEMA 3FEUA 4EDZA 1ST9A 4MH3A 4AJ8A 2C8UA 4IKHA 2M46A 5ECKB 1GL8A 3D0ZA 1GP1A 4MH2A 4K6XA 4F0CA 4IQAA 4WR4A 2B5XA 4Z7XA 2K6VA 3WT2A 3HJPA 4XS1A 1GULA 3ZIJA 1LU4A 1JFUA 1TJDA 2DC5A 3CRUA 3P7XA 3FR6A 5D8IA 3N9JA 2CT6A 2VCWA 1SYXA 3NZNA 2CX3A 3FW2A 4IELA 2MMOA 2RM5A 3L4NA 3KXOA 1WJKA 3GKKA 3IK7A 2B5EA 1XOBA 1A2MA 4YAVA 4PNGA 5A5KA 5JWQB 3D4TA 1OAZA 4FO5A 3ISOA 3IAM2 1DSBA 1EEJA 4TXOA 4MPFA 2YWMA 3ZFBA 2R2JA 4KNDA 2EIQA 2PBJA 3L9VA 1XFLA 4D73A 1TU7A 4KSOA 4N10A 2YNXA 4MZWA 1XWCA 3KEBA 2CVDA 1OC8A 2VD0A 5GSTA 4AJ6A 4JRRA 1TDIA 3CTGA 3GA4A 1C72A 2IMKA 3QOUA 4HU9A 3HXSA 1SKSB 4Q5RA 3ERGA 4HDEA 2OBKA 2AV4A 4FYCA 2DJKA 5ECIB 1PX7A 4GF0A 1OE7A 4XS4B 2EIOA 5DALA 4WF4A 4NXIA 4ZB8A 5G1LA 22GSA 2KP1A 4AJ7A 1U3IA 3H1NA 3H79A 4OCEA 4XS6A 2P31A 5G1KA 2IFQB 2HI7A 4ECJA 1TOFA 4PUAA 2H6ZA 2AHEA 4I5QA 4MP4A 3TRXA 3QDNA 2JSYA 4XHMA 5ECNB 2OE3A 4E8EA 5AGYA 3EINA 2B1LA 2Z9SA 5ECSA 1E6BA 2AYTA 4X1UA 5CRHA 1PD21 4MABA 1USBA 2LNTA 4G9HA 4K9ZA 4XCSA 4PXOA 1W4VA 1EP7A 2NVLA 1A23A 2X8HA 2E0QA 5G5FA 3GNJA 3VPQA 3KMNA 4TR3A 5F06A 1TKDB 4O92A 3TCOA 3MAKA 4NHZA 3ZIVA 3US3A 1JZRA 5CRDA 3HDCA 1OC9B 3GH6A 1JZWA 5C04A 2IYJA 4MJAA 3EU3A 1A0FA 4GSNA 3IBHA 4KW6A 5GSSA 3QAVA 5G30A 3TGZA 5DDLA 2VL2C 3IRAA 3A5WA 3HHVA 3RBTA 5ABRA 2XPEA 4MJCA 2AJQB 2C3QA 4BVYA 5LNKe 3CSIA 3M9JA 1FOVA 1B4PA 5IMFA 9GSSA 4HU7A 1Z7PA 1G6YA 2HSYA 2HRNA 2K8VA 3GKXA 3P90A 2H8LA 4X0XA 4ISDA 2LS5A 3F3QA 3EC3A 1X9WB 2IJYA 5IPGA 1M7TA 1DUGA 4XS4A 2C4JA 1S3CA 2NPBA 3I69A 3HKRA 1G7EA 1K0BA 4IP1A 4ZB6A 1URMA 5AISA 2FWEA 4KB3A 2MBSA 2B1KA 1ZMAA 2O87A 2H73A 2IFQA 4GLTA 4NWYA 3IAS2 3VPTA 5ECOB 3KIJA 2IL3A 3GTUB 4AGSA 1EEMA 1J0FA 4MF7A 3F4TA 3TJJA 1T00A 1GTIA 1T4YA 2QC7A 4PX1A 6GSTA 5JWOB 1U88A 1YF1A 2K18A 5B6MA 3TJFA 3DVXA 1EP8A 5KN0A 3D6IA 5G31A 3L9SA 5J9BA 3LXTA 1ZZYA 1O81A 2RLIA 2H75A 1V98A 4J56E 14GSA 1FVJA 2VIMA 4F03A 4MJEA 2FNOA 4RI7A 2B3SA 5GZZB 4ZB9A 4O5RA 2HT9A 1OC9A 2BTOT 3EURA 3TJBA 1O7UA 13GSA 1K3LA 1GUKA 1SJ6A 2C3TA 3C1RA 4OWYA 3O3TA 5DJLA 5CREA 3QCPA 4HQZA 2LNSA 4ID0A 2LRTA 4ILFA 3QFAC 3KZQA 1M9BA 3J7Yb 1F2EA 2DJ0A 4G10A 4IBPA 2KUCA 5ECQB 2N5FA 17GSA 1X9SB 5CRWA 3ZMLA 3KMOA 3WGDA 4MLYA 5L71A 4PQHA 4PQ1A 3A2XA 3ZREA 6GSSA 4KGIA 3VI5A 1ILOA 1MTCA 3LXZA 3FR9A 1GSDA 1XVWA 4ZIJA 3FZAA 4JR4A 3P8WA 4IW9A 4HUAA 1PQNA 4ZBDA 3GRXA 3RPPA 3HZ8A 1TK0B 2ON5A 3GYKA 2I9HA 2H70A 4P3YB 3MDKA 5EVOA 2B6MA 1NM3A 1QXHA 2PPTA 3VWUA 2YWOA 1AAZA 2B7JA 2RM6A 2V2GA 1A8LA 1SKRB 4HQSA 3DEXA 2HYXA 4IQ1A 3W8SA 2FA4A 1A0RP 1XOAA 4HI7A 3DYRA 3FR3A 1TXXA 2OE1A 1Y6EA 3GTUA 1DE2A 2IMIA 1LJRA 1TI3A 3FZ9A 2H30A 2XBIA 2TRXA 4ML6A 2WDUA 1AQXA 1WOUA 4OMVA 1M2BA 1WMJA 1BEDA 4GQFA 1HYUA 5A4UA 2C1YA 4OO4A 3LFLA 2H66A 1EGOA 3DD3A 4LL1B 5ECHB 4XTSA 3MNGA 4HJ2A 2BJXA 4TXOB 1MD4A 4NHWA 2HZEB 2IPAA 1TW9A 1TU8A 5CNWA 1MDIA 5DAKB 4POKA 1JZOA 1N2AA 3CBUA 4F9ZA 1ON4A 3ZMKA 3EMXA 4BPYA 1FW1A 4XRAA 3TJGA 1PMTA 2FLSA 4JEDA 4TR1B 1QK8A 3ERWA 5HR1A 2LRCA 1KTEA 2B5YA 1R5AA 2O8VB 2JACA 2XPDA 5FT3A 2YZHA 1O8XA 2DJ3A 1FG4A 4TKYA 2J23A 2H19A 4EVMA 4BA7A 2CQ9A 4HOJA 3FRCA 3HY2A 2DLXA 2NBSA 2E2GA 4GCIA 2PUKC 3LYKA 4FH8A 3HZ4A 5ENUA 3M8NA 4JR6A 4TOPA 4GWRA 5KEJA 3MSZA 2P5RA 1SL2B 5CAXA 1BQ7A 3GX8A 1PN9A 4F2IA 1K0OA 1GH2A 4OCFA 5KN3A 11GSA 1E2YA 3RAZA 1ZYQB 3NOFA 1VRSD 3S9FA 3TDGA 3EWLA 4RUVA 1XCCA 1GSFA 3PR8A 2WS2A 1VF1A 1XPVA 1TI1A 2YWIA 2MYGA 4WXTA 1TP9A 4OFNA 3SBCA 1V2AA 1ZL9A 3VWWA 4GSTA 3M3MA 18GSA 3TOTA 4YQVA 4L5OA 2C0GA 2WB9A 1SENA 2V1MA 5LCZA 3UJ1A 2I1UA 2B7KA 5E4WA 4DEJA 2HE3A 4V2LA 1WE0A 4LL4B 4I2TA 3APQA 2HZEA 3TKSA 1Q98A 4HJMA 5DAKA 3U5RE 2V6KA 3FY7A 3L9UA 4FYUA 3UARA 1KBNA 2GQKA 2K9FA 3EE2A 1W89A 1PGTA 1UN2A 1PRXA 4BWSA 3ZVJD 4I97A 2GLRA 2IN3A 1MEKA 2EC4A 2IWTA 4TR1A 4YQUA 1Z3EA 5HR2A 2REMA 4CHSA 5LD0A 5FHIA 4NV2A 4FYBA 2IMEA 1IYIA 4EC0A 1X5EA 16GSA 1Y25A 2HLSA 19GSA 4IHUA 4NMUA 3TB2A 3TRQA 1X9MB 2FD3A 3K8NA 1HNCA 3M0FA 5HFGA 4NPBA 3ZLPA 3M1GA 2VOCA 1O6JA 3TUEA 1OC3A 2LQQA 4IJIA 1ERVA 1NW2A 2DMMA 5IMZA 4TR4A 5IO2A 3EMPA 1J08A 1VF2A 2PU9C 1ERWA 5ECLB 5EY6A 4GRFA 3E0UA 3HA9A 4WF5A 3FYGA 1HQOA 3HVXA 4K0GA 1GNWA 2L5OA 4N0VA 2VCTA 5KN2A 3ZFLA 2QKEA 3L0HA 4ECCA 1V9WA 1U6TA 2CX4A 1JLVA 4PNFA 4ZXGA 2PWJA 3QPMA 5E59A 1F3AA 1O73A 4H86A 3GL5A 2V41A 1YEPA 1X0RA 2LJAA 1XWGA 1J9BA 1XXUA 2N5AA 2YANA 4V1Ap 4E8HA 5IMAA 1EGRA 3Q6OA 3LYPA 5CRGA 5JWRB 3EVIA 5A4VA 1S3DA 3KH9A 1XW5A 4TR0A 1SD8A 2RUEA 4N11A 2YCDA 3A2WA 2GS3A 4MJBA 3ED3A 2H76A 2H0GA 3IA1A 4ML1A 3GKMA 3LWAA 1M99A 3IR4A 2PN8A 3GV1A 3KCMA 3HJMA 3D4MA 5D73A 2OKAA 2O89A 1B9YC 1VF4A 1YF0A 3F4RA 3TKRA 1ERUA 4WR5A 5IM9A 5B6NA 1BAYA 1KEBA 4CDOA 20GSA 4IP6A 1A24A 4FIWA 3GMFA 2C0DA 4QL9A 5COHA 1AQWA 1QMVA 2GZYA 5HQPA 2FUG2 3W6GA 2RUFA 3G7YA 5B8AA 4EF0A 1R5PA 2C3NA 4KE3A 5ID2B 5DCGA 2VL2A 2M72A 2JZRA 3G7JA 2VL3A 2PVQA 1BX9A 2VLTA 2OJLA 2VO4A 4ZILA 4K7OA 5D96A 4EE0A 3GSSA 4K0NA 3ME8A 1TRUA 2ON7A 2OBIA 2XHFA 3FK8A 3RPNA 1RK4A 2JZSA 1WRYA 2CZ2A 3VI7A 4QQ7A 1DBYA 4DSSA 1GTAA 1F6MC 4PQIA 4XIHA 3UL3A 1G0TA 4IS0A 1YKAA 3LQ7A 5D9TA 1H4OA 1Z7RA 2MMNA 2IMFA 1WP0A 3UVHA 8GSSA 2V6OA 3D22A 4F0BA 3QD9A 3KP9A 1SK1A 3DGQA 1ACVA 2GSQA 3C71A 3LG6A 1HD2A 5IMCA 5IMDA 1PKWA 1KNGA 3KP8A 1PA3A 3H93A 3UBLA 1YQ1A 1GRXA 4PUFC 2I3YA 5ELAA 3GKNA 1B48A 3E3EA 3A2VA 3IOSA 3KTLA 1MDJA 1PKZA 4CW9A 3D21A 3UOMA 5EPFA 4G2EA 4ULXA 4BVXA 5AIXA 2CAIA 3PH9A 3IHQA 4N0ZA 3RHBA 3APSA 4LMVA 2F3MA 3F63A 2R4VA 4ECIA 4ZL8A 1T4ZA 2V32A 3DKSA 1PL2A 3HJOA 3GUSA 2YJHA 4K7IA 2DJ2A 1XIYA 4HEA2 5JCGA 4KSMA 3ZTLA 3TKQA 2AAWA 4V2MA 2GT5A 3DMLA 2GSSA 3F0IA 2OA7A 5IMVA 4L0UA 4X43A 3IK9A 3ZZXA 4N30A 4MDCA 2H1AA 3VLNA 2P0GA 3TRPA 1TTZA 1LBKA 2YN1A 3DXBA 5ID2A 2YJ7A 2XC2A 1XWKA 4K8MA 4I6XA 3HVSA 4PGTA 1CQGA 3CMIA 2VM1A 1OKDA 3KJYA 3TKPA 5H5QA 2H74A 2CZ3A 2L5LA 2VAFA 3KD0A 1S3AA 5F05A 2DIYA 5D9XA 4EXJA 2WGRA 3VK9A 2MMZA 1K3OA 3GN3A 3HVVA 2IMDA 4KH7A 4F82A 2QGVA 1AC1A 4LMWA 2LJRA 4L8EA 1PX6A 2C80A 1XW9A 2VCZA 3ZL5A 5DVBA 2JL4A 1A8YA 4POLA 2L6CA 2H0IA 1A2LA 2FCHA 2NTOA 3A3TA 4EKZA 4K1FA 1T1VA 1YJ6A 2DBCA 1MD3A 4IN0A 1R4WA 2VCVA 4MMMA 2L4QA 5IQYA 4TRXA 4LLRA 5DQYA 1EV4A 1XVQA 2CAQA 2MZCA 2R6KA 4IVFA 4GSSA 4EO3A 3PGTA 1EWXA 2CA8A 1QQ2A 2I4AA 1T8EB 1ML6A 3GX0A 1T7PB 1Z6NA 4TN8A 5J3RA 6GSVA 2DIZA 1AW9A 5JCWA 4IGJA 1ZGNA 1SJIA 2IIYA 1R7HA 4TVEA 5D9VA 2MMAA 2JADA 1FO5A 3C7MA 1GSSA 3E9JB 2H0HA 3TKSC 1M2DA 3DVWA 2YV7A 1YDKA 2CVBA 2VCXA 4MPGA 5F8BA 4LA1A 2FHEA 2L4CA 2GSRA 1GNEA 1T3BA 4JE1A 4MZBA 3WGXA 3QR6A 1SL0B 5JCUA 2WCIA 1V40A 2GGTA 1UA5A 1UC7A 1M0UA 3U6VA 2WULA 1I9DA 2LJKA 3IXRA 3LGCA 2LSTA 5G5EA 5J5NA 2HSHA 3EYTA 3QAGA 4GXZA 5GAND 3TOUA 2FWFA 3Q74A 2H1BA 2H01A 2L59A 4OFMA 1FVKA 3I6AA 3CXGA 5HR3A 3O6TA 1YZXA 2VUPA 2ZNMA 2LUSA 1FB0A 4JZQA 4YAPA 5IO0A 5HFKA 3LEFA 3VURA 6GSYA 1F37A 5IPHA 2H1GA 3IC4A 4ZL7A 3ERFA 3L78A 4G19A 4MF6A 4J57E 3JCML 4KDYA 2H1DA 2LRNA 1K0DA 4MF5A 1A2JA 1NSWA 1FAAA 1Z5YE 4POMA 3QAWA 4JBBA 4MZCA 6GSXA 1SU9A 5IOWA 2KOKA 3FZ4A 3GHAA 1HNAA 1TK5B 1R26A 1OVNA 2FA8A 3GFKA 3IV4A 3DRNA 2YPMA 4NV5A 3TJKA 3C1SA 1BYEA 4HZ2A 1SJZA 2KLXA 4POBA 4Q5QA 4ACSA 2O7KA 3WYWA 3IPZA 1VGLA 1GSEA 1F9MA 3UAPA 2FGXA 1O8WA 3I43A 1ZYEA 5ECMB 2R37A 3VFIA 1TK8B 1QGVA 5C00A 1XZOA 1XWBA 1JZDA 3CSHA 1SYRA 3AY8A 1U3AA 4MK3A 2DJ1A 3CSJA 4KUNA 1SL1B 2PGTA 4YQMA 1TRSA 4WBJA 3D5JA 1I5GA 4HS1A 4KAEA 4OFTA 3VWVA 1AXDA 4DSSB 1ZCPA 4J2FA 5ECPB 3BOAA 2N5BA 4NAXA 3BD2A 1B8XA 1XW6A 5F07A 3BJ5A 5KN1A 4WBRD 1EV9A 3UBKA 3WD6A 1M9AA 4OO5A 2YOIA 3GIXA 3O76A 2YP6A 4I2UA 2KHPA 4KCEA 1RW1A 2FWGA 4JU5A 5F0GA 3F8UA 1BJXA 2AB6A 2J9HA 3UIWA 1G7OA 2K8SA 3P2AA 2YZUA 3F6DA 5FWGA 3H4KA 5A4WA 1K0NA 2CV4A 1O85A 4WKWA 5H5SA 2DSAA 2VD1A 2OACA 4KX4A 4DSRA 1BG5A 2F51A 2YV9A 4OD7A 5CP1A 2A4VA 2E2MA 1H75A 1B4QA 4KA0A 1MDKA 3F6FA 3MWHA
chains in the Genus database with same CATH superfamily
1NWWA 3GL3A 5AIFA 4ECBA 5CYYA 2HMKB 5ELUA 2HXKA 4FMCA 1TRVA 3LSZA 3IPTA 4EDYA 1Q4JA 2OADA 2UX0A 1W2ZA 4G0IA 4YH2A 3JUOA 3BBYA 4QL7A 3KGKA 5HR0A 5AI1A 2A2RA 4MMZB 3KSPA 2QSIA 2P5QA 1DE3A 1GSUA 2XBQA 3M9KA 1BANA 3EN1B 1GY5A 2GZPA 5BVBA 3LORA 4HM0B 2CVKA 4Q5NA 4ZBBA 7GSSA 1NHOA 3IJEB 2VLUA 4EUYA 2CG0A 1YIJ3 1GLQA 1W02A 3PINA 5CO3A 5A0OB 3BCKA 2YFLB 3LH4A 4WHAA 1THXA 1B2UA 4RQXA 3IE3A 2STDA 5D93A 1RN4A 3C8EA 1GOVA 1PFOA 5FW5A 1GLPA 2CH9A 5RNTA 2JZTA 4WETA 1RRLA 1BOXA 1OGXA 1V57A 4FCJA 1V58A 2O85A 2F8AA 2OTL3 1OKTA 2LV3A 1JBTA 2NDOA 1CQHA 3RDWA 4EL1A 2X8GA 2CWVA 1GUHA 2RCDA 3MYDA 3UMAA 2F8FA 4EV2A 3G7IA 1YY7A 5AN1A 1IQXA 3G9BA 1X5CA 3GH9A 4LGQA 3F40A 3CRTA 2C0FA 2GSTA 3H8QA 4HZ4A 5D9WA 3DIEA 2WRTA 1K0CA 3F8HA 1GSQA 4I8BA 2TIRA 2WFCA 2WJUA 2EIRA 3VSYA 1V74A 5DQSA 5INYA 1B21A 4L0WA 1K41A 3KTBA 6GSUA 1E97A 1M904 1Z6MA 1NHYA 1OPYA 5KP3A 1OACA 1PL1A 3NBRA 3S27A 4DVCA 4HYZA 1ROAA 1K0MA 1Z9HA 1B2MA 4H61A 1NJI4 4RNTA 2R3XA 1DE1A 2F5MA 1OE8A 4IJ3A 2E2UA 5EEOA 2OE0A 1ABAA 5GAPD 1HNBA 2E2TA 1WIKA 4WEYA 4AF2A 2ALBA 2LEGA 2RGQA 3OR5A 1U87A 2H6XA 1LOVA 3I9V2 3GURA 2RIIA 5DBQA 1K3YA 2CC3A 1K0AA 1GUMA 1UCKA 2TRCP 1ZOFA 4KCAA 2H72A 1QUWA 1B9XC 2GDRA 2Q07A 1F8NA 4BTWA 1FZUA 2G2QA 2KXGA 3HYPA 5EL8A 5B7CA 4U13A 3FCSB 1AIUA 2GZZA 1AQVA 3F3RA 1O7WB 3DWVA 1BRSA 5M1AA 1SK0A 4XBYA 3DGOA 1ZYNA 3GSTA 3HD5A 5AYRB 1TUHA 4PURA 3RHCA 2ZUPA 4K1UA 2HNLA 4EC6A 2C11A 3EF8A 4BL7A 1FW7A 3KCHA 3EU4A 1IVVA 1G6WA 1XWAA 3ZYWA 3UL5A 1JLWA 5J9CA 1QFNA 5IOXA 3K7CA 2VM2A 10GSA 3CYNA 1Q814 1MWSA 3CCJ3 3AGOA 1WWJA 3ZRDA 2QIYA 1FB6A 1PSQA 1IV7A 3ZG5A 4WWUC 1OHSA 3HZPA 2YWNA 4GTUA 2IA7A 3V1WA 1TRWA 2GQLA 4O32A 1K28A 3D4AA 1BSAA 1EOHA 1SD9A 3URPA 2H6YA 12GSA 2JSZA 5J41A 1JB2A 1NB3I 4LZIA 2Y74A 2PMTA 4ZL9A 3W8JA 6GSWA 2LYXA 1BSCA 3V98A 5J4UA 3MSOA 3ME7A 3Q18A 4O7HA 3BCIA 1QAKA 2BMXA 3ZVJA 4GQCA 1GTBA 3HCZA 1RGLA 2X8CA 8CHOA 1OGZA 5HOHA 1DMNA 1OHOA 1RNTA 1YEXA 1MWTA 1O7GB 3SWLA 3GRDA 3N5OA 1EZKA 2D2ZA 3UVTA 1E3RA 2R41A 3LTDA 3C73A 2CK3H 4K2DA 3LTCA 2JU5A 1ERTA 4FQUA 2M7OA 3ZITA 1THOA 2QA43 3VWXA 2X64A 5JBSA 4MA9A 2LKUA 2CHCA 2FWHA 3IDVA 4PEJA 2F4YA 1GWCA 2AUVA 2GT6A 4KDUA 2I9WA 1RQMA 4Q5FA 1WPIA 3QFBC 5DCHA 1GSYA 4MCUA 1DMMA 2VLVA 1UVZA 1TRPA 4V2NA 3DY5A 1U5OA 2L6DA 4MEIA 1QVG2 1O7MB 1SKWB 3F4SA 5IIZA 1OF5B 3STDA 2GTUA 1Q9EA 2A2SA 2OOVC 2PVOC 2I81A 5B8BA 2G0FA 5AIVA 4O3VA 2HRFA 2OWPA 4N6TA 3NIVA 2X99A 2VL9A 2KF5A 2DJJA 1VQN3 3BIRA 3CC43 1YKCA 3QMXA 3FH1A 3JUQA 2ZCTA 5DJMA 4TXVA 3FG1A 2LQOA 3NUVA 1N8JA 1XBSA 1F3BA 3FKAA 1FGRA 4XBXA 1EQKA 1RN1A 4V1Ag 2GVPA 2LTKA 3CTFA 4RQRA 3K5TA 2INXA 1IYHA 2CG1A 4N6MA 2FY6A 4RI6A 4BWQA 3KH7A 1QAFA 2R5GA 2GU3A 1C54A 1GTUA 3OV4A 1GD4A 1DVDA 1TRQA 4K7NA 5HGRA 3UB1A 5H5RA 2IY2A 2ES7A 1FHEA 4BIKA 3Q19A 1RMSA 2M80A 3J7Yk 4D73B 7STDA 4TW5A 5JPUA 3DH2A 3NV0A 3FHKA 1M2AA 4KDXA 4XRDA 1UI7A 2PERA 4HM6B 4BL2A 2C0EA 2HRAA 3FZ5A 4ZBAA 2DMLA 3F9UA 3SOAA 3CCS3 2L57A 2A2PA 3KM6A 2HFDA 4L5LA 5HFIA 5ELGA 3WGEA 1X5DA 1IU7A 1LQGC 2WZ9A 1VF3A 2MBTA 5G2ZA 1Q824 4HAAA 5ECRB 2GQMA 2Y73A 1SK2A 2E2VA 2H71A 1W6YA 3R2QA 3G0KA 3OX9A 3S28A 1AUCA 2VCQA 3APOA 1TFKA 3LJRA 1JHBA 3FKFA 1FOHA 2AAEA 3DGNA 3B4PA 2KP2A 5DALB 1OYJA 4DSQA 2HZFA 2DKIA 2E7PA 1GOUA 3WT1A 2R0CA 2F9SA 1YVBI 1ZX2A 3TKSE 1BGSA 1EOGA 3UEMA 3FEUA 3AHSA 1K9M4 4EDZA 2P05A 1ST9A 4MH3A 1W6CA 1JN5A 3CCE3 4AJ8A 2C8UA 3H3HA 4IKHA 2M46A 5ECKB 1BNIA 3X40A 1GL8A 1BSEA 2OCTA 3D0ZA 1EKMA 1GP1A 1JV2B 4MH2A 4K6XA 4F0CA 4IQAA 4WR4A 1STDA 2B5XA 4Z7XA 3NQZA 3A5EA 2K6VA 3QRDA 1W00A 1QALA 3WT2A 3HJPA 1Q42A 4XS1A 1LOYA 3I553 1GULA 3LXUX 3ZIJA 1IVUA 1JFUA 1OF5A 1LU4A 5IENA 1TJDA 2DC5A 3CRUA 3P7XA 3FR6A 1KD14 5D8IA 3N9JA 2CT6A 3DGLA 2VCWA 4HM5B 2KAAA 1SYXA 3NZNA 2CX3A 3FW2A 4IELA 2MMOA 2CIUA 1LVNA 1VQQA 2RM5A 4HM3B 3L4NA 4I4KA 3KXOA 1WJKA 2MC8A 1QVF2 3GKKA 3IK7A 2B5EA 1XOBA 1A2MA 4YAVA 4PNGA 1W7CA 1Z1SA 5A5KA 5JWQB 3D4TA 1OAZA 4FO5A 2W03A 3ISOA 3IAM2 1DSBA 1EEJA 3F7XA 2BHMA 3GWRA 4TXOA 5IG5A 5IG0A 4MPFA 2YWMA 4KFEA 3DMCA 1PFPA 3ZFBA 2R2JA 2X49A 2J8XB 2EIQA 2PBJA 4KNDA 1BVIA 2PZVA 1KWIA 4HM4B 3RDEA 3L9VA 1XFLA 4D73A 4G1MB 1TU7A 4KSOA 4N10A 1I2EA 3CNMA 3MG2A 2YNXA 1AR0A 3EQQB 4MZWA 1I0XA 4J9AA 4OVMA 1XWCA 1I2FA 1MWRA 4FMAA 3KEBA 2ZL8A 2CVDA 1OC8A 1BRKA 1GSPA 2VD0A 5GSTA 4AJ6A 4FCZA 4JRRA 1TDIA 3WOEB 3CTGA 3GA4A 1C72A 2IMKA 1R4YA 3BNCA 3QOUA 4HU9A 3MHEA 3HXSA 1SKSB 4Q5RA 4EIPA 3ERGA 4HDEA 4K90B 1LXEA 5GSPA 3FMWA 2OBKA 1B27A 4MMXB 8RNTA 2AV4A 4FYCA 2DJKA 3HVNA 5ECIB 1PX7A 4GF0A 1RLSA 1OE7A 1HZ1A 1ZO2A 4XS4B 3S5CA 2EIOA 5DALA 4WF4A 2K0MA 2YX9A 4NXIA 1MGRA 3G6E3 5G1LA 4ZB8A 22GSA 3MG1A 2KP1A 3CCU3 1IVXA 1BNSA 3EN8A 4AJ7A 1JKGA 3MPHA 1TFOA 3EJVA 1U3IA 3H1NA 3H79A 1RJOA 4OCEA 4XS6A 2P31A 1X1XA 1T2HA 5G1KA 2RBIA 2HI7A 2IFQB 4WFOA 4ECJA 4OK0A 1TOFA 4PUAA 2H6ZA 2QEX3 2AHEA 4I5QA 4MP4A 3TRXA 3QDNA 2JSYA 4CCVA 4XHMA 5ECNB 5KP1A 3T8UA 3AGNA 2OE3A 3PCRA 4E8EA 5AGYA 3EINA 3BNBA 3WDGB 2B1LA 2Z9SA 2HMLB 2Z76A 5ECSA 5CLKA 1E6BA 2AYTA 4X1UA 2W56A 1PD21 5CRHA 4MABA 1VQO3 1USBA 1NB5I 4CY6A 2LNTA 4G9HA 4K9ZA 4XCSA 4PXOA 1EP7A 2RSXA 1W4VA 2NVLA 1A23A 2X8HA 5KOWA 1CH0A 4RNZA 2E0QA 1Q7HA 5G5FA 3GNJA 3VPQA 2ML6A 1WMOA 4K5RA 1US1A 3KMNA 4TR3A 5F06A 1TKDB 4O92A 3ECFA 3TCOA 3MAKA 4NHZA 1I8VA 3ZIVA 1JBRA 3US3A 1JZRA 5CRDA 2GBXB 3HDCA 4HOHA 2X4AA 1OC9B 3GH6A 1JZWA 3WR2A 5C04A 3RNTA 2XEPA 1GMPA 1JNQA 2IYJA 1FYSA 4MJAA 4N6NB 3EU3A 1A0FA 4GSNA 3IBHA 2D42A 4L8OA 4MJDA 4KW6A 1RCLA 5GSSA 5CF1A 3QAVA 5G30A 4ZM8A 2GEXA 3TGZA 5DDLA 1UDII 2GEYA 2VL2C 3IRAA 3A5WA 2O3OA 3HHVA 3RBTA 1MWUA 5ABRA 3HOHA 3LZAA 2XPEA 2ZA4A 4MJCA 2AJQB 3OWUA 5AIHA 3ER7A 3RGRA 2C3QA 4BVYA 5LNKe 1SIIA 3CSIA 2BMOB 3M9JA 1FOVA 1B4PA 1BAOA 3LMLA 5IMFA 9GSSA 4HU7A 1M3IA 1Z7PA 3JUNA 1BRHA 1MNLA 1G6YA 2HSYA 2HRNA 2K8VA 3GKXA 3CPOA 3P90A 2B24B 2H8LA 4X0XA 7GSPA 2LS5A 4ISDA 1S5AA 3F3QA 5IEOA 3NBJA 3S29A 3EC3A 1X9WB 2IJYA 2W04A 5IPGA 4HM7B 5IG3A 1M7TA 1DUGA 4XS4A 2C4JA 1S3CA 2NPBA 3I69A 3HKRA 4XDVA 1G7EA 3N54B 1K0BA 2HSMA 4IP1A 1ZGXA 4ZB6A 1URMA 3CQFA 4EXRA 5AISA 2JDIH 2FWEA 3QK9A 3F9SA 1MOLA 4KB3A 2MBSA 2B1KA 1ZMAA 2HRKA 2O87A 2H73A 2IFQA 4GLTA 1FGOA 4NWYA 3IAS2 2W9QA 3VPTA 5ECOB 3KIJA 2GBWB 4N6V0 2IL3A 3GTUB 4AGSA 1EEMA 1J0FA 4MF7A 3F4TA 3TJJA 1T00A 2P09A 4X2HA 1GTIA 1T4YA 1IT8A 1RGHA 2QC7A 4PX1A 6GSTA 5JWOB 1U88A 1YF1A 2KRTA 2K18A 5B6MA 3TJFA 3DVXA 1EP8A 5KN0A 2P0MA 3D6IA 5G31A 3L9SA 5J9BA 3LXTA 1ZZYA 1VQ53 1O81A 2RLIA 1YIT3 5TGNA 2AADA 2H75A 3FG3A 1V98A 4J56E 14GSA 1FVJA 3EBTA 2VIMA 4F03A 2JQ5A 1X1WA 4EV5A 2FNOA 1N8QA 4MJEA 4RI7A 1T5YA 2B3SA 5GZZB 4ZB9A 1RGKA 3BB9A 3V99A 4O5RA 3OWYA 2HT9A 1OC9A 2BTOT 3EURA 3TJBA 1O7UA 13GSA 1K3LA 1GUKA 1A67A 1SJ6A 1GOYA 2C3TA 3C1RA 4OWYA 3O3TA 4EBGA 1W6GA 2BMQB 4USSA 5DJLA 4A5PA 5CREA 3QCPA 4HQZA 3NV0B 2LNSA 4ID0A 2LRTA 1YJ93 4ILFA 3F14A 3QFAC 3IMAB 3KZQA 3FZWA 1M9BA 3J7Yb 2CX0A 4J5GA 4HJLB 1F2EA 2DJ0A 1RCKA 4G10A 3PPUA 4IBPA 1UCJA 3OXAA 3X3XA 2Z7AA 3CCM3 2KUCA 3FF2A 2XF3A 5ECQB 2N5FA 17GSA 1X9SB 3CC73 1X1UA 4TX4A 3X3YA 5CRWA 3UJMA 3ZMLA 3PZWA 3KMOA 3WGDA 4MLYA 5L71A 4PQHA 4PQ1A 3A2XA 3ZREA 6GSSA 4KGIA 3VI5A 1ILOA 1MTCA 3LXZA 3FR9A 3EX9A 1GSDA 1JB5A 3N9HA 1YGWA 1XVWA 4ZIJA 3PCSA 3FZAA 4XBTA 3K0ZA 4JR4A 3P8WA 4IW9A 4HUAA 1PQNA 2WOFA 4ZBDA 1JB4A 3GRXA 4YKFA 3E99A 3FG4A 3RPPA 3J7Yd 2DKHA 3HZ8A 2QA2A 1TK0B 5D83A 2ON5A 3VGNA 1B3SA 1MGWA 3GYKA 2I9HA 4O02B 2H70A 4P3YB 2PNCA 3MDKA 2P0XA 5EVOA 2B6MA 1NM3A 1UCLA 1QXHA 2PPTA 1JN5B 1B20A 3VWUA 2YWOA 1RGEA 1AAZA 2B7JA 2RM6A 2V2GA 4EIQA 3F7SA 1A8LA 1SKRB 5M19A 4HQSA 3DEXA 2HYXA 4IQ1A 3W8SA 2CWTA 4RZMA 2FA4A 4KFFA 1A0RP 1XOAA 4HI7A 3DYRA 3FR3A 1TXXA 1O7NB 2OE1A 1DYUA 1Y6EA 3GTUA 1DE2A 2L4VA 2IMIA 1YGEA 3NM2A 1LJRA 1TI3A 4OUQA 3FZ9A 2H30A 2XBIA 3CCR3 2TRXA 4ML6A 3PGBA 2WDUA 1AQXA 1B2ZA 1WOUA 1M2BA 1WMJA 4OMVA 5IW9A 1BEDA 4GQFA 4BU4A 1W2B2 3CCQ3 1HYUA 5A4UA 3GAXA 2C1YA 2FGTA 4OO4A 3LFLA 2H66A 3I0YA 3KFQC 1EGOA 3DD3A 4EYCA 1M3JA 4LL1B 5ECHB 4XTSA 3MNGA 2CFLA 1BIRA 2FNQA 4HJ2A 2BJXA 4TXOB 2XGNA 3F8XA 3HI7A 3FF0A 1MD4A 4NHWA 2HZEB 2IPAA 1TW9A 5ELJA 1TU8A 5CNWA 2R4IA 1K734 1MDIA 1UUVB 1D6UA 5DAKB 1LNHA 1BNRA 4POKA 1JZOA 1N2AA 5AYSC 3CBUA 4F9ZA 1VQL3 1NNVA 3D5IA 1ON4A 1D6ZA 1IT7A 2BNGA 1TIJA 3ZMKA 1LNIA 3EMXA 1FW1A 4XRAA 4BPYA 3TJGA 1PMTA 2XFSA 4WYKB 4CY8A 2FLSA 4JEDA 4TR1B 1QK8A 3ERWA 3SXXA 5HR1A 2LRCA 1KTEA 3UNLA 4GSPA 1R5AA 2B5YA 5IEPA 2O8VB 2JACA 2XPDA 3U97A 1B2SA 3UL6A 5FT3A 3A76A 5FGOA 3CMA3 2YZHA 2OOVA 1A90A 1O8XA 2DJ3A 4CDLA 1FG4A 4TKYA 1M1XB 1PY3A 1BRNL 1EA2A 2R0PA 2J23A 1CEWI 1IV9A 1YHQ3 4N6OB 2H19A 4EVMA 1BUJA 3BU4A 3CU3A 4BA7A 3NM7A 2CQ9A 4HOJA 3KN4A 3FRCA 3HY2A 2DLXA 3MKIA 2NBSA 2E2GA 5BIRA 4GCIA 2PUKC 3LYKA 1JKGB 4FH8A 3HZ4A 1E3VA 3SEDA 5ENUA 3M8NA 4JR6A 4TOPA 1DMQA 1QJGA 1VQ63 4GWRA 3MSZA 1LQMB 2P5RA 1GS3A 5KEJA 1SL2B 3R3EA 5CAXA 2D1WA 1BQ7A 3GX8A 1PN9A 4F2IA 1K0OA 1GH2A 4OCFA 5KN3A 11GSA 4O2HA 3G16A 3G8ZA 1E2YA 3Q3FA 3RAZA 4NHFA 4XM4A 1ZYQB 2W56B 1VRSD 3NOFA 3S9FA 3TDGA 3EWLA 2CW9A 2FXTA 4RUVA 1XCCA 1GSFA 3PR8A 2WS2A 3EC9A 4X2OA 1VF1A 1XPVA 2C4BA 1S723 1TI1A 4K2XA 1A2VA 2YWIA 2MYGA 1Q40B 2UZ8A 4WXTA 2HOHA 1TP9A 4OFNA 1A2PA 3SBCA 1V2AA 1I2GA 3CXC2 1ZL9A 2F86B 1RKYA 3VWWA 3NHXA 3M3MA 4GSTA 1BSDA 18GSA 3TOTA 4YQVA 4L5OA 4J5KA 2C0GA 2WB9A 1SENA 2V1MA 4N6LA 5LCZA 2XH9A 3UJ1A 1N9EA 2I1UA 5DRVA 3NQYA 2B7KA 5E4WA 1BNFA 4DEJA 2HE3A 1BRIA 4LMIA 2Z6BA 2B1XB 2WGQA 4R9LA 4V2LA 1N5PA 1WE0A 2O9UX 4LL4B 4I2TA 1ISKA 3APQA 3AMOB 2HZEA 3TKSA 1Q98A 4YKGA 4HJMA 4CPKA 1AQZA 5DAKA 3U5RE 2ZHXB 2V6KA 3KZTA 3FY7A 1HYFA 3L9UA 4BVYB 1YJN3 4FYUA 1PYLA 3UARA 1KBNA 2GQKA 2K9FA 1RDSA 1VQ93 3EE2A 1W89A 1PGTA 1UN2A 2XFTA 1PRXA 3WMDA 1HKXA 5JPPA 4BWSA 3ZVJD 3EBYA 3K63A 5STDA 4I97A 2GLRA 2IN3A 1OHPA 4WYKA 4O8SA 1MEKA 2EC4A 2IWTA 1AV4A 4TR1A 1OCVA 4YQUA 1Z3EA 5HR2A 2REMA 3SVAA 4CHSA 5LD0A 5FHIA 5LC6A 3EPTA 4BTXA 2UGIA 4AKZA 4NV2A 1IQ8A 3MG3A 4FYBA 2IMEA 1IYIA 3IHGA 1FA3A 4EC0A 2BIRA 4LSOA 3WHOA 1X5EA 16GSA 1L5GB 1Y25A 2HLSA 3VF1A 19GSA 2C10A 4G0LA 4ICYA 4IHUA 4NMUA 3TB2A 2HMOB 3TRQA 1X9MB 2FD3A 5BRTA 3K8NA 1HNCA 5CXOA 3M0FA 2F56A 2V1LA 5HFGA 2OQEC 1CQSA 4NPBA 3ZLPA 3M1GA 2HMMB 2VOCA 4AKYA 1O6JA 3TUEA 1OC3A 2LQQA 2XSOB 4IJIA 1ERVA 1NW2A 3CNXA 3L0RA 2HMNB 4O5UA 3HX8A 2DMMA 5IMZA 4TR4A 1N5HA 3CCL3 4HM2B 5IO2A 3MIXA 2XR8B 3EMPA 1J08A 1YJW3 1VF2A 2PU9C 5IG4A 1ERWA 2W0QA 5ECLB 3GZXB 1KSIA 3I563 4GRFA 4QWTA 3E0UA 5EY6A 3HA9A 4WF5A 4LYLB 3FYGA 1HQOA 4GL6A 6GSPA 3HVXA 4K0GA 1GNWA 1FUWA 2L5OA 4N0VA 2VCTA 5KN2A 3ZFLA 2QKEA 1NDOB 3L0HA 4N6UA 1Q40A 4ECCA 1V9WA 1BNEA 1U6TA 2CX4A 4HM1B 3DM8A 1M1K4 3ALAA 3RGAA 1JLVA 4PNFA 1ZS7A 4ZXGA 1WQLB 4HVNA 2PWJA 3QPMA 4R4KA 1SARA 1ROVA 3GSPA 1I3FA 5E59A 1F3AA 1O73A 4H86A 1GYBA 3GL5A 4IT7A 3Q1CA 4KVHA 1NU3A 3U1WA 1YEPA 1X0RA 2V41A 1BU4A 2LJAA 1XWGA 1J9BA 1XXUA 2N5AA 2YANA 4V1Ap 4E8HA 5IMAA 3HK4A 1Q864 1EGRA 3Q6OA 3LYPA 3B7CA 5CRGA 5JWRB 1A2KA 4IIAA 1YI23 3EVIA 2KF4A 5A4VA 2F5WA 1S3DA 3T8NA 3AMOA 1FGTA 3FLJA 3KH9A 1JJ22 1LOWA 1XW5A 4TR0A 1SD8A 2RUEA 4N11A 1BRJA 1W5ZA 2YCDA 3HIGA 1FUTA 3KSED 3A2WA 1SIHA 2GS3A 1SJWA 4MJBA 3ED3A 2H76A 4BL3A 2H0GA 3IA1A 1BRGA 4ML1A 3GKMA 4RBNA 3NBBA 6STDA 3LWAA 1M99A 3IR4A 2PN8A 4BVXB 3GV1A 3KCMA 3HJMA 3D4MA 2SBLA 2OKAA 5D73A 2O89A 1B9YC 1LRAA 1VF4A 1YF0A 3F4RA 3TKRA 1U8CB 1BSBA 4EW5A 4JF8A 3NXJA 3WOFB 1AY7A 1ERUA 4JRFA 1I0VA 3JUMA 4WR5A 5IM9A 5B6NA 1BAYA 1KEBA 4CDOA 1STFI 4XB5A 20GSA 4IP6A 1A24A 5LC7A 4FIWA 3GMFA 1RRHA 2C0DA 4QL9A 5COHA 1AQWA 1QMVA 2GZYA 3DZLA 2FUG2 5HQPA 1AVKA 1RGFA 3W6GA 2RUFA 4HZBB 4Z2UA 3G7YA 1IDPA 1WTHA 4KT3B 5B8AA 2CFWA 2F99A 4EF0A 2CX1A 1R5PA 1O7HB 2C3NA 4KE3A 5ID2B 4CJNA 3PXMA 3FGYA 5DCGA 2VL2A 2M72A 2JZRA 3G7JA 2VL3A 4GHOA 7RNTA 2PVQA 1EG9B 1BX9A 2VLTA 4R1KA 2OJLA 2VO4A 4ZILA 4K7OA 1WMPA 4FMDA 5D96A 1WNHA 4EE0A 3GSSA 4K0NA 3AHWA 3ME8A 1TRUA 2ON7A 2OBIA 2XHFA 3FK8A 3RPNA 5G2GA 1TP6A 1RK4A 2JZSA 1WRYA 2CZ2A 2YFJB 3VI7A 4QQ7A 1DBYA 3PYJA 2GXFA 4DSSA 1GTAA 1F6MC 1GMRA 2BT3A 4PQIA 4XIHA 3UL3A 1G0TA 5CF2A 4HSCX 4IS0A 4STDA 1YKAA 3LQ7A 5D9TA 2W9PA 1H4OA 1Z7RA 2MMNA 2XSHB 2IMFA 1WP0A 2RFRA 1RHLA 4WP5A 3UVHA 8GSSA 2V6OA 2P38A 3D22A 2QGUA 5DREA 4F0BA 3QD9A 3KP9A 1SK1A 3DGQA 1ACVA 2GSQA 3C71A 1PN0A 3PS8A 3LG6A 1HD2A 3WODG 4MNNA 5IMCA 5IMDA 1PKWA 3X41A 1KNGA 3KP8A 1PA3A 3H93A 1G02A 1YQ1A 3UBLA 2KCDA 1GRXA 3O8YA 4PUFC 4O5QA 2I3YA 1O7PB 5ELAA 4RNYA 5CK6A 3GKNA 3BLZA 1B48A 3E3EA 3A2VA 3N8BA 2QA1A 3IOSA 3KTLA 3B4OA 1KC84 1OUNA 1MDJA 1PKZA 4CW9A 3D21A 3UOMA 5EPFA 4G2EA 4ULXA 4BVXA 5AIXA 2CAIA 3PH9A 3MYTA 4KFDA 3IHQA 4N0ZA 3RHBA 2K54A 3Q90A 3APSA 2L1SA 2F3MA 3F63A 4LMVA 2SARA 2R4VA 4ECIA 4ZL8A 1T4ZA 1ZYPA 2V32A 3DKSA 3LTBA 1PL2A 3HJOA 4KZ1A 3GUSA 1RNBA 1VQ73 2YJHA 3A5IA 2ML5A 4K7IA 3H51A 2DJ2A 1XIYA 4HEA2 4N3VA 1SPUA 1VQP3 5JCGA 4KSMA 1S3RA 3ZTLA 3TKQA 4XDWA 2AAWA 4V2MA 2WO0A 2GT5A 3DMLA 1DVCA 3LW9A 2GSSA 4R9KA 5AEWB 3F0IA 2OA7A 5IMVA 4L0UA 4X43A 3IK9A 3ZZXA 4N30A 4MDCA 2H1AA 4FMBA 3VLNA 2P0GA 3TRPA 1TTZA 1LBKA 2YN1A 3DXBA 5ID2A 3G4S3 2YJ7A 1J2BA 2XC2A 1XWKA 4K8MA 2LQVA 3D79A 4I6XA 3HVSA 4K1VA 3JUPA 6RNTA 4PGTA 4FCMA 1AVLA 1CQGA 3CMIA 2VM1A 1OKDA 3D3LA 3KJYA 3TKPA 3BNEA 1KQS2 4BIRA 2H74A 2CZ3A 5H5QA 2L5LA 2VAFA 3LT8A 3KD0A 2HMJB 1S3AA 2BMRB 5F05A 4L7KA 2W6JH 1FUSA 2DIYA 5D9XA 4EXJA 3WA2X 2WGRA 3VK9A 2MMZA 1K3OA 3GN3A 4H3UA 3MWZA 2RNTA 1VQK3 3HVVA 2IMDA 4KH7A 4F82A 2QGVA 1AC1A 4FR9A 9RNTA 2CWUA 4LMWA 2LJRA 1I70A 4L8EA 1PX6A 5AIIA 1XW9A 2C80A 3CME3 2VCZA 3ZL5A 4Q53A 5DVBA 2JL4A 2K3DA 3JVCA 1A8YA 4POLA 3X42A 2L6CA 2H0IA 2KF3A 1CYUA 1UCIA 1A2LA 2FCHA 5KP4A 1LOXA 1BUQA 2NTOA 3A3TA 1Y4KA 4EKZA 2YFIB 4R80A 4K1FA 1T1VA 1YJ6A 2WGOA 2DBCA 1MD3A 4NREA 3EHCA 4IN0A 1R4WA 2VCVA 4MMMA 2L4QA 5IQYA 4TRXA 4LLRA 3V92A 2GSPA 5DQYA 1JRQA 1EV4A 3GZBA 1XVQA 2CAQA 2MZCA 2CFDA 1QMAA 2R6KA 3EB8A 3NX0A 4IVFA 4GSSA 4EO3A 3PGTA 3ZFZA 1EWXA 2CA8A 5AEUB 1QQ2A 1UGIA 2I4AA 1T8EB 1ML6A 3GX0A 1T7PB 4HBRA 1Z6NA 1VZZA 4TN8A 2GU1A 5J3RA 6GSVA 3SX1A 1T2IA 2DIZA 1W4NA 1VQ43 1AW9A 1GY6A 5JCWA 4IGJA 1ZGNA 1SJIA 2IIYA 1R7HA 2CKFB 3DGYA 4TVEA 5D9VA 3Q2PA 3BNDA 2MMAA 3SYUA 2JADA 1UUGB 1FO5A 3C7MA 1G96A 1GSSA 4G0KA 3E9JB 2H0HA 1M9GA 4PTSA 3TKSC 1M2DA 3DVWA 1IK3A 2YV7A 1WMNA 1YDKA 2CVBA 2WOHA 2VCXA 2F98A 4MPGA 5F8BA 3OW22 4LA1A 3M8CA 1ASKA 1R4CA 2FHEA 3KKGA 2A15A 1K8A4 2L4CA 2GSRA 1GNEA 3B8LA 1T3BA 4JE1A 4MZBA 3WGXA 1GY7A 1Q7Y4 4LEHA 3FSDA 4K5SA 3QR6A 1SL0B 4K61A 1SQWA 5JCUA 2WCIA 1V40A 2GGTA 1UA5A 1X1YA 1UC7A 5IERA 1JBSA 1M0UA 3U6VA 2WULA 1I9DA 2LJKA 3D9RA 3IXRA 3LGCA 1YNVX 2LSTA 5G5EA 5J5NA 2HSHA 1ULJB 3EYTA 3QAGA 3DUKA 1GMQA 1EUIC 4HM8B 1RGAA 1N9JA 4GXZA 4IPBA 5GAND 1XG8A 3TOUA 1RGCA 2IUKA 2FWFA 3Q74A 2H1BA 2H01A 2L59A 4OFMA 3LOYA 1FVKA 3I6AA 3CXGA 5HR3A 5EQLA 1UGHI 1YZXA 3O6TA 2VUPA 2ZNMA 2LUSA 1FB0A 4JZQA 5D81A 4YAPA 5IO0A 5HFKA 3LEFA 3VURA 1PU4A 6GSYA 2BU4A 2MF7A 1F37A 1UUWB 5IPHA 2H1GA 3IC4A 1IYYA 4ZL7A 3ERFA 3L78A 1IQYA 4G19A 4MF6A 1YVSA 1HU9A 2OTJ3 4J57E 1GD3A 3JCML 5M18A 4KDYA 2H1DA 2LRNA 1K0DA 2CFKA 3GZRA 3OWSA 4MF5A 1A2JA 1IVWA 1NSWA 4Z2TA 1FAAA 1Z5YE 4POMA 3QAWA 1D6YA 4JBBA 4MZCA 1UW1A 6GSXA 1SU9A 5IOWA 2KOKA 3FZ4A 1OH0A 3GHAA 1DETA 1HNAA 1TK5B 1R26A 1I3IA 1RGGA 1RSNA 5BXQA 1VQ83 1OVNA 2FA8A 3GFKA 5KOXA 3IV4A 3DRNA 2UUGC 3CD63 2YPMA 2R0GA 3CC23 4NV5A 3TJKA 4HKVB 1TU5A 3C1SA 1BYEA 4X4JA 4HZ2A 5BMUA 1SJZA 4HZ9B 2KLXA 4J8TA 1FGMA 4POBA 4Q5QA 2IUJA 3CPW2 1ULIB 4ACSA 3G713 3DGMA 2BO9B 2O7KA 1FGQA 5EVHA 3WYWA 3DXOA 2XGLA 3S67A 3IPZA 3T0UA 1VGLA 1GSEA 1F9MA 3UAPA 1BNJA 2FGXA 1O8WA 3I43A 5I97A 1ZYEA 5ECMB 5D82A 2R37A 1B2XA 3VFIA 1TK8B 1QGVA 5C00A 3D5GA 1XZOA 4GB5A 1RN7A 1XWBA 1JZDA 3CSHA 1SYRA 1TTOA 3AY8A 3SLUA 3IC8A 1U3AA 4MK3A 2Z77A 2DJ1A 3CSJA 4KUNA 3ROBA 3KIIA 1SL1B 1RTUA 2CFGA 2PGTA 4YQMA 1TRSA 4BTYA 4WBJA 1W01A 3D5JA 2ZDJA 1I5GA 4HS1A 4KAEA 4OFTA 3VWVA 1AXDA 5IF6A 4MMYB 4DSSB 1ZCPA 4J2FA 5ECPB 3BOAA 2N5BA 4NAXA 3BD2A 1B8XA 1XW6A 5F07A 3BJ5A 5KN1A 4WBRD 1VQM3 2W2CA 3EE1A 4DKIA 3LYGA 1EV9A 3UBKA 5AIGA 4AEQA 3WD6A 2XRXB 1M9AA 1C7HA 4OO5A 1N8R4 2YOIA 3GIXA 3SOYA 3K9MC 3CCV3 1UI8A 3O76A 4KF9A 2YP6A 4I2UA 2KHPA 4KCEA 3X3ZA 2IMJA 1RW1A 2FWGA 4JU5A 2A4HA 3F8UA 1CYVA 5F0GA 1BJXA 2AB6A 2J9HA 3UIWA 1G7OA 1BNGA 3KE7A 2OQEA 2K8SA 3P2AA 3GZYB 2YZUA 3F6DA 5FWGA 3H4KA 5A4WA 1K0NA 4L8PA 2CV4A 1O85A 4Z2RA 4WKWA 5H5SA 2DSAA 2VD1A 2OACA 4KX4A 4BL7B 4DSRA 3WA3A 1BG5A 4ORLA 2F51A 3LT9A 2YV9A 3LTAA 3HIIA 5BU4A 4OD7A 5CP1A 2KF6A 2A4VA 2E2MA 1H75A 1B4QA 4KA0A 1MDKA 1NO3A 3ZG0A 3F6FA 3MWHA
chains in the Genus database with same CATH topology
3GL3A 4ECBA 5CYYA 2HXKA 1TRVA 3LSZA 4EDYA 1Q4JA 2OADA 4G0IA 4YH2A 3BBYA 4QL7A 5HR0A 3KGKA 2A2RA 2QSIA 2P5QA 1GSUA 2XBQA 3M9KA 2GZPA 4ZBBA 3LORA 7GSSA 2CVKA 4Q5NA 1NHOA 2VLUA 4EUYA 1GLQA 3PINA 5CO3A 3BCKA 1THXA 4RQXA 3IE3A 5D93A 3C8EA 1GLPA 2JZTA 4WETA 1V57A 1V58A 2O85A 2F8AA 1OKTA 2LV3A 2NDOA 1CQHA 3RDWA 4EL1A 2X8GA 1GUHA 3MYDA 3UMAA 2F8FA 3G7IA 1YY7A 5AN1A 3G9BA 1X5CA 3GH9A 3H8QA 3CRTA 2C0FA 2GSTA 4HZ4A 5D9WA 3DIEA 2WRTA 1K0CA 1GSQA 4I8BA 2TIRA 2WFCA 2WJUA 2EIRA 5INYA 5DQSA 4L0WA 3KTBA 6GSUA 1Z6MA 1NHYA 1PL1A 4DVCA 1K0MA 1Z9HA 2R3XA 1DE1A 1OE8A 4IJ3A 2OE0A 1ABAA 5GAPD 1HNBA 1WIKA 4AF2A 4WEYA 2ALBA 2LEGA 3OR5A 1U87A 2H6XA 3I9V2 3GURA 2RIIA 5DBQA 1K3YA 1K0AA 1GUMA 2TRCP 1ZOFA 4KCAA 2H72A 1QUWA 1B9XC 2GDRA 2G2QA 3HYPA 5EL8A 5B7CA 1AIUA 2GZZA 1AQVA 3F3RA 3DWVA 1SK0A 3GSTA 1ZYNA 3HD5A 4PURA 3RHCA 2ZUPA 2HNLA 4BL7A 3EU4A 1G6WA 1XWAA 3ZYWA 1JLWA 5J9CA 1QFNA 5IOXA 2VM2A 10GSA 3CYNA 1WWJA 3ZRDA 1FB6A 1PSQA 2YWNA 4GTUA 3V1WA 1TRWA 2GQLA 4O32A 1EOHA 1SD9A 2H6YA 12GSA 2JSZA 5J41A 2PMTA 4ZL9A 3W8JA 6GSWA 5J4UA 3ME7A 3Q18A 4O7HA 3BCIA 3ZVJA 2BMXA 4GQCA 1GTBA 3HCZA 2X8CA 1YEXA 3SWLA 3N5OA 1EZKA 2D2ZA 3UVTA 3C73A 4K2DA 2JU5A 1ERTA 4FQUA 3ZITA 1THOA 3VWXA 2X64A 4MA9A 2LKUA 2FWHA 3IDVA 1GWCA 2AUVA 2GT6A 4KDUA 1RQMA 4Q5FA 1WPIA 3QFBC 5DCHA 1GSYA 4MCUA 2VLVA 1UVZA 4V2NA 2L6DA 1SKWB 3F4SA 5IIZA 2GTUA 2A2SA 2PVOC 2I81A 5B8BA 2G0FA 5AIVA 2HRFA 3NIVA 2X99A 2VL9A 2DJJA 1YKCA 3QMXA 2ZCTA 5DJMA 4TXVA 2LQOA 1N8JA 1XBSA 1F3BA 4V1Ag 2GVPA 2LTKA 3CTFA 4RQRA 1IYHA 2FY6A 4RI6A 4BWQA 3KH7A 2R5GA 1GTUA 4K7NA 5H5RA 2IY2A 2ES7A 1FHEA 3Q19A 2M80A 3J7Yk 4D73B 4TW5A 3FHKA 1M2AA 4KDXA 4XRDA 2PERA 2C0EA 2HRAA 3FZ5A 4ZBAA 2DMLA 3F9UA 2L57A 2A2PA 3KM6A 2HFDA 4L5LA 5HFIA 5ELGA 3WGEA 1X5DA 2WZ9A 1VF3A 2MBTA 5G2ZA 5ECRB 2GQMA 1SK2A 2H71A 3R2QA 1AUCA 2VCQA 3APOA 3LJRA 1JHBA 3FKFA 1FOHA 5DALB 2KP2A 1OYJA 4DSQA 2HZFA 2DKIA 2E7PA 3WT1A 2R0CA 2F9SA 3TKSE 1EOGA 3UEMA 3FEUA 4EDZA 1ST9A 4MH3A 4AJ8A 2C8UA 4IKHA 2M46A 5ECKB 1GL8A 3D0ZA 1GP1A 4MH2A 4K6XA 4F0CA 4IQAA 4WR4A 2B5XA 4Z7XA 2K6VA 3WT2A 3HJPA 4XS1A 1GULA 3ZIJA 1LU4A 1JFUA 1TJDA 2DC5A 3CRUA 3P7XA 3FR6A 5D8IA 3N9JA 2CT6A 2VCWA 1SYXA 3NZNA 2CX3A 3FW2A 4IELA 2MMOA 2RM5A 3L4NA 3KXOA 1WJKA 3GKKA 3IK7A 2B5EA 1XOBA 1A2MA 4YAVA 4PNGA 5A5KA 5JWQB 3D4TA 1OAZA 4FO5A 3ISOA 3IAM2 1DSBA 1EEJA 4TXOA 4MPFA 2YWMA 3ZFBA 2R2JA 2X49A 2EIQA 2PBJA 4KNDA 3L9VA 1XFLA 4D73A 1TU7A 4KSOA 4N10A 2YNXA 4MZWA 1XWCA 3KEBA 2CVDA 1OC8A 2VD0A 5GSTA 4AJ6A 4JRRA 1TDIA 3CTGA 3GA4A 1C72A 2IMKA 3QOUA 4HU9A 3HXSA 1SKSB 4Q5RA 4EIPA 3ERGA 4HDEA 3FMWA 2OBKA 2AV4A 4FYCA 2DJKA 5ECIB 1PX7A 4GF0A 1OE7A 4XS4B 2EIOA 5DALA 4WF4A 4NXIA 4ZB8A 5G1LA 22GSA 2KP1A 4AJ7A 1U3IA 3H1NA 3H79A 4OCEA 4XS6A 2P31A 5G1KA 2IFQB 2HI7A 4ECJA 1TOFA 4PUAA 2H6ZA 2AHEA 4I5QA 4MP4A 3TRXA 3QDNA 2JSYA 4XHMA 5ECNB 2OE3A 4E8EA 5AGYA 3EINA 2B1LA 2Z9SA 5ECSA 1E6BA 2AYTA 4X1UA 5CRHA 1PD21 4MABA 1USBA 4CY6A 2LNTA 4G9HA 4K9ZA 4XCSA 4PXOA 1W4VA 1EP7A 2NVLA 1A23A 2X8HA 5KOWA 2E0QA 5G5FA 3GNJA 3VPQA 4K5RA 3KMNA 4TR3A 5F06A 1TKDB 4O92A 3TCOA 3MAKA 4NHZA 3ZIVA 3US3A 1JZRA 5CRDA 3HDCA 2X4AA 1OC9B 3GH6A 1JZWA 5C04A 2IYJA 4MJAA 3EU3A 1A0FA 4GSNA 3IBHA 4KW6A 5GSSA 3QAVA 5G30A 3TGZA 5DDLA 2VL2C 3IRAA 3A5WA 3HHVA 3RBTA 5ABRA 2XPEA 4MJCA 2AJQB 2C3QA 4BVYA 5LNKe 3CSIA 3M9JA 1FOVA 1B4PA 5IMFA 9GSSA 4HU7A 1Z7PA 1G6YA 2HSYA 2HRNA 2K8VA 3GKXA 3P90A 2H8LA 4X0XA 4ISDA 2LS5A 3F3QA 3EC3A 1X9WB 2IJYA 5IPGA 1M7TA 1DUGA 4XS4A 2C4JA 1S3CA 2NPBA 3I69A 3HKRA 1G7EA 1K0BA 2HSMA 4IP1A 4ZB6A 1URMA 5AISA 2FWEA 4KB3A 2MBSA 2B1KA 1ZMAA 2HRKA 2O87A 2H73A 2IFQA 4GLTA 4NWYA 3IAS2 3VPTA 5ECOB 3KIJA 2IL3A 3GTUB 4AGSA 1EEMA 1J0FA 4MF7A 3F4TA 3TJJA 1T00A 1GTIA 1T4YA 2QC7A 4PX1A 6GSTA 5JWOB 1U88A 1YF1A 2K18A 5B6MA 3TJFA 3DVXA 1EP8A 5KN0A 3D6IA 5G31A 3L9SA 5J9BA 3LXTA 1ZZYA 1O81A 2RLIA 2H75A 1V98A 4J56E 14GSA 1FVJA 2VIMA 4F03A 4MJEA 2FNOA 4RI7A 2B3SA 5GZZB 4ZB9A 4O5RA 2HT9A 1OC9A 2BTOT 3EURA 3TJBA 1O7UA 13GSA 1K3LA 1GUKA 1SJ6A 2C3TA 3C1RA 4OWYA 3O3TA 5DJLA 4USSA 4A5PA 5CREA 3QCPA 4HQZA 2LNSA 4ID0A 2LRTA 4ILFA 3QFAC 3KZQA 1M9BA 3J7Yb 1F2EA 2DJ0A 4G10A 3PPUA 4IBPA 2KUCA 5ECQB 2N5FA 17GSA 1X9SB 5CRWA 3ZMLA 3KMOA 3WGDA 4MLYA 5L71A 4PQHA 4PQ1A 3A2XA 3ZREA 6GSSA 4KGIA 3VI5A 1ILOA 1MTCA 3LXZA 3FR9A 1GSDA 1XVWA 4ZIJA 3FZAA 4JR4A 3P8WA 4IW9A 4HUAA 1PQNA 4ZBDA 4YKFA 3GRXA 3RPPA 2DKHA 3HZ8A 2QA2A 1TK0B 2ON5A 3GYKA 2I9HA 2H70A 4P3YB 3MDKA 5EVOA 2B6MA 1NM3A 1QXHA 2PPTA 3VWUA 2YWOA 1AAZA 2B7JA 2RM6A 2V2GA 4EIQA 1A8LA 1SKRB 4HQSA 3DEXA 2HYXA 4IQ1A 3W8SA 2FA4A 1A0RP 1XOAA 4HI7A 3DYRA 3FR3A 1TXXA 2OE1A 1Y6EA 3GTUA 1DE2A 2IMIA 1LJRA 1TI3A 3FZ9A 2H30A 2XBIA 2TRXA 4ML6A 2WDUA 1AQXA 1WOUA 4OMVA 1M2BA 1WMJA 1BEDA 4GQFA 1HYUA 5A4UA 2C1YA 4OO4A 3LFLA 2H66A 1EGOA 3DD3A 4LL1B 5ECHB 4XTSA 3MNGA 4HJ2A 2BJXA 4TXOB 1MD4A 4NHWA 2HZEB 2IPAA 1TW9A 1TU8A 5CNWA 1MDIA 5DAKB 4POKA 1JZOA 1N2AA 3CBUA 4F9ZA 1ON4A 3ZMKA 3EMXA 4BPYA 1FW1A 4XRAA 3TJGA 1PMTA 4CY8A 2FLSA 4JEDA 4TR1B 1QK8A 3ERWA 5HR1A 2LRCA 1KTEA 2B5YA 1R5AA 2O8VB 2JACA 2XPDA 5FT3A 2YZHA 1O8XA 2DJ3A 1FG4A 4TKYA 2R0PA 2J23A 2H19A 4EVMA 4BA7A 2CQ9A 4HOJA 3FRCA 3HY2A 2DLXA 2NBSA 2E2GA 4GCIA 2PUKC 3LYKA 4FH8A 3HZ4A 5ENUA 3M8NA 4JR6A 4TOPA 4GWRA 5KEJA 3MSZA 2P5RA 1SL2B 3R3EA 5CAXA 1BQ7A 3GX8A 1PN9A 4F2IA 1K0OA 1GH2A 4OCFA 5KN3A 11GSA 1E2YA 3RAZA 1ZYQB 3NOFA 1VRSD 3S9FA 3TDGA 3EWLA 4RUVA 1XCCA 1GSFA 3PR8A 2WS2A 1VF1A 1XPVA 1TI1A 4K2XA 2YWIA 2MYGA 2UZ8A 4WXTA 1TP9A 4OFNA 3SBCA 1V2AA 1ZL9A 3VWWA 4GSTA 3M3MA 18GSA 3TOTA 4YQVA 4L5OA 2C0GA 2WB9A 1SENA 2V1MA 5LCZA 3UJ1A 2I1UA 2B7KA 5E4WA 4DEJA 2HE3A 4V2LA 1WE0A 4LL4B 4I2TA 3APQA 2HZEA 3TKSA 1Q98A 4YKGA 4HJMA 5DAKA 3U5RE 2V6KA 3FY7A 3L9UA 4BVYB 4FYUA 3UARA 1KBNA 2GQKA 2K9FA 3EE2A 1W89A 1PGTA 1UN2A 1PRXA 4BWSA 3ZVJD 4I97A 2GLRA 2IN3A 1MEKA 2EC4A 2IWTA 4TR1A 4YQUA 1Z3EA 5HR2A 2REMA 4CHSA 5LD0A 5FHIA 3EPTA 4NV2A 4FYBA 2IMEA 1IYIA 3IHGA 4EC0A 1X5EA 16GSA 1Y25A 2HLSA 19GSA 4G0LA 4ICYA 4IHUA 4NMUA 3TB2A 3TRQA 1X9MB 2FD3A 5BRTA 3K8NA 1HNCA 3M0FA 5HFGA 4NPBA 3ZLPA 3M1GA 2VOCA 1O6JA 3TUEA 1OC3A 2LQQA 4IJIA 1ERVA 1NW2A 4O5UA 2DMMA 5IMZA 4TR4A 5IO2A 3MIXA 3EMPA 1J08A 1VF2A 2PU9C 1ERWA 5ECLB 5EY6A 4GRFA 3E0UA 3HA9A 4WF5A 3FYGA 1HQOA 3HVXA 4K0GA 1GNWA 2L5OA 4N0VA 2VCTA 5KN2A 3ZFLA 2QKEA 3L0HA 4ECCA 1V9WA 1U6TA 2CX4A 1JLVA 4PNFA 4ZXGA 2PWJA 3QPMA 5E59A 1F3AA 1O73A 4H86A 3GL5A 2V41A 1YEPA 1X0RA 2LJAA 1XWGA 1J9BA 1XXUA 2N5AA 2YANA 4V1Ap 4E8HA 5IMAA 1EGRA 3Q6OA 3LYPA 5CRGA 5JWRB 3EVIA 5A4VA 1S3DA 3KH9A 1XW5A 4TR0A 1SD8A 2RUEA 4N11A 2YCDA 3A2WA 2GS3A 4MJBA 3ED3A 2H76A 2H0GA 3IA1A 4ML1A 3GKMA 3LWAA 1M99A 3IR4A 2PN8A 4BVXB 3GV1A 3KCMA 3HJMA 3D4MA 2OKAA 5D73A 2O89A 1B9YC 1VF4A 1YF0A 3F4RA 3TKRA 1ERUA 4WR5A 5IM9A 5B6NA 1BAYA 1KEBA 4CDOA 20GSA 4IP6A 1A24A 4FIWA 3GMFA 2C0DA 4QL9A 5COHA 1AQWA 1QMVA 2GZYA 5HQPA 2FUG2 3W6GA 2RUFA 4Z2UA 3G7YA 5B8AA 4EF0A 1R5PA 2C3NA 4KE3A 5ID2B 5DCGA 2VL2A 2M72A 2JZRA 3G7JA 2VL3A 2PVQA 1BX9A 2VLTA 2OJLA 2VO4A 4ZILA 4K7OA 5D96A 4EE0A 3GSSA 4K0NA 3ME8A 1TRUA 2ON7A 2OBIA 2XHFA 3FK8A 3RPNA 1RK4A 2JZSA 1WRYA 2CZ2A 3VI7A 4QQ7A 1DBYA 4DSSA 1GTAA 1F6MC 4PQIA 4XIHA 3UL3A 1G0TA 4IS0A 1YKAA 3LQ7A 5D9TA 1H4OA 1Z7RA 2MMNA 2IMFA 1WP0A 3UVHA 8GSSA 2V6OA 3D22A 4F0BA 3QD9A 3KP9A 1SK1A 3DGQA 1ACVA 2GSQA 3C71A 1PN0A 3LG6A 1HD2A 4MNNA 5IMCA 5IMDA 1PKWA 1KNGA 3KP8A 1PA3A 3H93A 3UBLA 1YQ1A 1GRXA 4PUFC 4O5QA 2I3YA 5ELAA 3GKNA 1B48A 3E3EA 3A2VA 2QA1A 3IOSA 3KTLA 1MDJA 1PKZA 4CW9A 3D21A 3UOMA 5EPFA 4G2EA 4ULXA 4BVXA 5AIXA 2CAIA 3PH9A 3IHQA 4N0ZA 3RHBA 3APSA 4LMVA 2F3MA 3F63A 2R4VA 4ECIA 4ZL8A 1T4ZA 1ZYPA 2V32A 3DKSA 1PL2A 3HJOA 3GUSA 2YJHA 3A5IA 4K7IA 2DJ2A 1XIYA 4HEA2 5JCGA 4KSMA 3ZTLA 3TKQA 2AAWA 4V2MA 2GT5A 3DMLA 3LW9A 2GSSA 3F0IA 2OA7A 5IMVA 4L0UA 4X43A 3IK9A 3ZZXA 4N30A 4MDCA 2H1AA 3VLNA 2P0GA 3TRPA 1TTZA 1LBKA 2YN1A 3DXBA 5ID2A 2YJ7A 2XC2A 1XWKA 4K8MA 4I6XA 3HVSA 4PGTA 1CQGA 3CMIA 2VM1A 1OKDA 3KJYA 3TKPA 5H5QA 2H74A 2CZ3A 2L5LA 2VAFA 3KD0A 1S3AA 5F05A 2DIYA 5D9XA 4EXJA 2WGRA 3VK9A 2MMZA 1K3OA 3GN3A 3HVVA 2IMDA 4KH7A 4F82A 2QGVA 1AC1A 4LMWA 2LJRA 4L8EA 1PX6A 2C80A 1XW9A 2VCZA 3ZL5A 5DVBA 2JL4A 1A8YA 4POLA 2L6CA 2H0IA 1A2LA 2FCHA 2NTOA 3A3TA 4EKZA 4K1FA 1T1VA 1YJ6A 2DBCA 1MD3A 4IN0A 1R4WA 2VCVA 4MMMA 2L4QA 5IQYA 4TRXA 4LLRA 5DQYA 1EV4A 1XVQA 2CAQA 2MZCA 2R6KA 4IVFA 4GSSA 4EO3A 3PGTA 1EWXA 2CA8A 1QQ2A 2I4AA 1T8EB 1ML6A 3GX0A 1T7PB 1Z6NA 4TN8A 5J3RA 6GSVA 2DIZA 1AW9A 5JCWA 4IGJA 1ZGNA 1SJIA 2IIYA 1R7HA 4TVEA 5D9VA 2MMAA 2JADA 1FO5A 3C7MA 1GSSA 4G0KA 3E9JB 2H0HA 4PTSA 3TKSC 1M2DA 3DVWA 2YV7A 1YDKA 2CVBA 2VCXA 4MPGA 5F8BA 4LA1A 2FHEA 2L4CA 2GSRA 1GNEA 1T3BA 4JE1A 4MZBA 3WGXA 4K5SA 3QR6A 1SL0B 5JCUA 2WCIA 1V40A 2GGTA 1UA5A 1UC7A 1M0UA 3U6VA 2WULA 1I9DA 2LJKA 3IXRA 3LGCA 2LSTA 5G5EA 5J5NA 2HSHA 3EYTA 3QAGA 4GXZA 5GAND 3TOUA 2FWFA 3Q74A 2H1BA 2H01A 2L59A 4OFMA 1FVKA 3I6AA 3CXGA 5HR3A 3O6TA 1YZXA 2VUPA 2ZNMA 2LUSA 1FB0A 4JZQA 4YAPA 5IO0A 5HFKA 3LEFA 3VURA 6GSYA 1F37A 5IPHA 2H1GA 3IC4A 4ZL7A 3ERFA 3L78A 4G19A 4MF6A 4J57E 3JCML 4KDYA 2H1DA 2LRNA 1K0DA 4MF5A 1A2JA 1NSWA 4Z2TA 1FAAA 1Z5YE 4POMA 3QAWA 4JBBA 4MZCA 6GSXA 1SU9A 5IOWA 2KOKA 3FZ4A 3GHAA 1HNAA 1TK5B 1R26A 1OVNA 2FA8A 5KOXA 3GFKA 3IV4A 3DRNA 2YPMA 2R0GA 4NV5A 3TJKA 3C1SA 1BYEA 4X4JA 4HZ2A 5BMUA 1SJZA 2KLXA 4POBA 4Q5QA 4ACSA 2O7KA 3WYWA 3IPZA 1VGLA 1GSEA 1F9MA 3UAPA 2FGXA 1O8WA 3I43A 1ZYEA 5ECMB 2R37A 3VFIA 1TK8B 1QGVA 5C00A 1XZOA 1XWBA 1JZDA 3CSHA 1SYRA 3AY8A 3IC8A 1U3AA 4MK3A 2DJ1A 3CSJA 4KUNA 1SL1B 2PGTA 4YQMA 1TRSA 4WBJA 3D5JA 1I5GA 4HS1A 4KAEA 4OFTA 3VWVA 1AXDA 4DSSB 1ZCPA 4J2FA 5ECPB 3BOAA 2N5BA 4NAXA 3BD2A 1B8XA 1XW6A 5F07A 3BJ5A 5KN1A 4WBRD 1EV9A 3UBKA 3WD6A 1M9AA 4OO5A 2YOIA 3GIXA 3O76A 4KF9A 2YP6A 4I2UA 2KHPA 4KCEA 1RW1A 2FWGA 4JU5A 2A4HA 3F8UA 5F0GA 1BJXA 2AB6A 2J9HA 3UIWA 1G7OA 2K8SA 3P2AA 2YZUA 3F6DA 5FWGA 3H4KA 5A4WA 1K0NA 2CV4A 4Z2RA 1O85A 4WKWA 5H5SA 2DSAA 2VD1A 2OACA 4KX4A 4BL7B 4DSRA 1BG5A 2F51A 2YV9A 4OD7A 5CP1A 2A4VA 2E2MA 1H75A 1B4QA 4KA0A 1MDKA 3F6FA 3MWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL3 A;  4ECB A;  5CYY A;  2HXK A;  1TRV A;  3LSZ A;  4EDY A;  1Q4J A;  2OAD A;  4YH2 A;  3BBY A;  4QL7 A;  5HR0 A;  3KGK A;  2A2R A;  2QSI A;  2P5Q A;  1GSU A;  2XBQ A;  3M9K A;  2GZP A;  4ZBB A;  3LOR A;  7GSS A;  2CVK A;  4Q5N A;  1NHO A;  2VLU A;  4EUY A;  1GLQ A;  3PIN A;  5CO3 A;  3BCK A;  1THX A;  4RQX A;  3IE3 A;  5D93 A;  3C8E A;  1GLP A;  2JZT A;  4WET A;  1V57 A;  1V58 A;  2O85 A;  2F8A A;  1OKT A;  2LV3 A;  2NDO A;  1CQH A;  3RDW A;  4EL1 A;  2X8G A;  1GUH A;  3UMA A;  2F8F A;  3G7I A;  1YY7 A;  5AN1 A;  3G9B A;  1X5C A;  3GH9 A;  3H8Q A;  3CRT A;  2C0F A;  2GST A;  4HZ4 A;  5D9W A;  3DIE A;  2WRT A;  1K0C A;  1GSQ A;  4I8B A;  2TIR A;  2WFC A;  2WJU A;  2EIR A;  5INY A;  5DQS A;  4L0W A;  3KTB A;  6GSU A;  1Z6M A;  1NHY A;  1PL1 A;  4DVC A;  1K0M A;  1Z9H A;  2R3X A;  1DE1 A;  1OE8 A;  4IJ3 A;  2OE0 A;  1ABA A;  5GAP D;  1HNB A;  1WIK A;  4AF2 A;  4WEY A;  2ALB A;  2LEG A;  3OR5 A;  1U87 A;  2H6X A;  3I9V 2;  3GUR A;  2RII A;  5DBQ A;  1K3Y A;  1K0A A;  1GUM A;  2TRC P;  1ZOF A;  4KCA A;  2H72 A;  1QUW A;  1B9X C;  2GDR A;  2G2Q A;  3HYP A;  5EL8 A;  5B7C A;  1AIU A;  2GZZ A;  1AQV A;  3F3R A;  3DWV A;  1SK0 A;  3GST A;  3HD5 A;  4PUR A;  3RHC A;  2ZUP A;  2HNL A;  4BL7 A;  3EU4 A;  1G6W A;  1XWA A;  3ZYW A;  1JLW A;  5J9C A;  1QFN A;  5IOX A;  2VM2 A;  10GS A;  3CYN A;  1WWJ A;  3ZRD A;  1FB6 A;  1PSQ A;  2YWN A;  4GTU A;  3V1W A;  1TRW A;  2GQL A;  4O32 A;  1EOH A;  1SD9 A;  2H6Y A;  12GS A;  2JSZ A;  5J41 A;  2PMT A;  4ZL9 A;  3W8J A;  6GSW A;  5J4U A;  3ME7 A;  3Q18 A;  4O7H A;  3BCI A;  3ZVJ A;  2BMX A;  4GQC A;  1GTB A;  3HCZ A;  2X8C A;  1YEX A;  3SWL A;  3N5O A;  1EZK A;  2D2Z A;  3UVT A;  3C73 A;  4K2D A;  2JU5 A;  1ERT A;  3ZIT A;  1THO A;  3VWX A;  2X64 A;  4MA9 A;  2LKU A;  2FWH A;  3IDV A;  1GWC A;  2AUV A;  2GT6 A;  4KDU A;  1RQM A;  4Q5F A;  1WPI A;  3QFB C;  5DCH A;  1GSY A;  4MCU A;  2VLV A;  1UVZ A;  4V2N A;  2L6D A;  1SKW B;  3F4S A;  5IIZ A;  2GTU A;  2A2S A;  2PVO C;  2I81 A;  5B8B A;  2G0F A;  5AIV A;  2HRF A;  3NIV A;  2X99 A;  2VL9 A;  2DJJ A;  1YKC A;  3QMX A;  2ZCT A;  5DJM A;  4TXV A;  2LQO A;  1N8J A;  1XBS A;  1F3B A;  4V1A g;  2GVP A;  2LTK A;  3CTF A;  4RQR A;  1IYH A;  2FY6 A;  4RI6 A;  4BWQ A;  3KH7 A;  2R5G A;  1GTU A;  4K7N A;  5H5R A;  2IY2 A;  2ES7 A;  1FHE A;  3Q19 A;  2M80 A;  3J7Y k;  4D73 B;  4TW5 A;  3FHK A;  1M2A A;  4KDX A;  4XRD A;  2PER A;  2C0E A;  3FZ5 A;  4ZBA A;  2DML A;  3F9U A;  2L57 A;  3KM6 A;  2HFD A;  4L5L A;  5HFI A;  5ELG A;  3WGE A;  1X5D A;  2WZ9 A;  1VF3 A;  2MBT A;  5G2Z A;  5ECR B;  2GQM A;  1SK2 A;  2H71 A;  3R2Q A;  1AUC A;  2VCQ A;  3APO A;  3LJR A;  1JHB A;  3FKF A;  5DAL B;  2KP2 A;  1OYJ A;  4DSQ A;  2HZF A;  2E7P A;  3WT1 A;  2F9S A;  3TKS E;  1EOG A;  3UEM A;  3FEU A;  4EDZ A;  1ST9 A;  4MH3 A;  4AJ8 A;  2C8U A;  4IKH A;  2M46 A;  5ECK B;  1GL8 A;  3D0Z A;  1GP1 A;  4MH2 A;  4K6X A;  4F0C A;  4IQA A;  4WR4 A;  2B5X A;  4Z7X A;  2K6V A;  3WT2 A;  3HJP A;  4XS1 A;  1GUL A;  3ZIJ A;  1LU4 A;  1JFU A;  1TJD A;  2DC5 A;  3CRU A;  3P7X A;  3FR6 A;  5D8I A;  3N9J A;  2CT6 A;  2VCW A;  1SYX A;  3NZN A;  2CX3 A;  3FW2 A;  4IEL A;  2MMO A;  2RM5 A;  3L4N A;  3KXO A;  1WJK A;  3GKK A;  3IK7 A;  2B5E A;  1XOB A;  1A2M A;  4YAV A;  4PNG A;  5A5K A;  5JWQ B;  3D4T A;  1OAZ A;  4FO5 A;  3ISO A;  3IAM 2;  1DSB A;  1EEJ A;  4TXO A;  4MPF A;  2YWM A;  3ZFB A;  2R2J A;  4KND A;  2EIQ A;  2PBJ A;  3L9V A;  1XFL A;  4D73 A;  1TU7 A;  4KSO A;  4N10 A;  2YNX A;  4MZW A;  1XWC A;  3KEB A;  2CVD A;  1OC8 A;  2VD0 A;  5GST A;  4AJ6 A;  4JRR A;  1TDI A;  3CTG A;  3GA4 A;  1C72 A;  2IMK A;  3QOU A;  4HU9 A;  3HXS A;  1SKS B;  4Q5R A;  3ERG A;  4HDE A;  2OBK A;  2AV4 A;  4FYC A;  2DJK A;  5ECI B;  1PX7 A;  4GF0 A;  1OE7 A;  4XS4 B;  2EIO A;  5DAL A;  4WF4 A;  4NXI A;  4ZB8 A;  5G1L A;  22GS A;  2KP1 A;  4AJ7 A;  1U3I A;  3H1N A;  3H79 A;  4OCE A;  4XS6 A;  2P31 A;  5G1K A;  2IFQ B;  2HI7 A;  4ECJ A;  1TOF A;  4PUA A;  2H6Z A;  2AHE A;  4I5Q A;  4MP4 A;  3TRX A;  3QDN A;  2JSY A;  4XHM A;  5ECN B;  2OE3 A;  4E8E A;  5AGY A;  3EIN A;  2B1L A;  2Z9S A;  5ECS A;  1E6B A;  2AYT A;  4X1U A;  5CRH A;  1PD2 1;  4MAB A;  1USB A;  2LNT A;  4G9H A;  4K9Z A;  4XCS A;  4PXO A;  1W4V A;  1EP7 A;  2NVL A;  1A23 A;  2X8H A;  2E0Q A;  5G5F A;  3GNJ A;  3VPQ A;  3KMN A;  4TR3 A;  5F06 A;  1TKD B;  4O92 A;  3TCO A;  3MAK A;  4NHZ A;  3ZIV A;  3US3 A;  1JZR A;  5CRD A;  3HDC A;  1OC9 B;  3GH6 A;  1JZW A;  5C04 A;  2IYJ A;  4MJA A;  3EU3 A;  1A0F A;  4GSN A;  3IBH A;  4KW6 A;  5GSS A;  3QAV A;  5G30 A;  3TGZ A;  5DDL A;  2VL2 C;  3IRA A;  3A5W A;  3HHV A;  3RBT A;  5ABR A;  2XPE A;  4MJC A;  2AJQ B;  2C3Q A;  4BVY A;  5LNK e;  3CSI A;  3M9J A;  1FOV A;  1B4P A;  5IMF A;  9GSS A;  4HU7 A;  1Z7P A;  1G6Y A;  2HSY A;  2HRN A;  2K8V A;  3GKX A;  3P90 A;  2H8L A;  4X0X A;  4ISD A;  2LS5 A;  3F3Q A;  3EC3 A;  1X9W B;  2IJY A;  5IPG A;  1M7T A;  1DUG A;  4XS4 A;  2C4J A;  1S3C A;  2NPB A;  3I69 A;  3HKR A;  1G7E A;  1K0B A;  4IP1 A;  4ZB6 A;  1URM A;  5AIS A;  2FWE A;  4KB3 A;  2MBS A;  2B1K A;  1ZMA A;  2O87 A;  2H73 A;  2IFQ A;  4GLT A;  4NWY A;  3IAS 2;  3VPT A;  5ECO B;  3KIJ A;  2IL3 A;  3GTU B;  4AGS A;  1EEM A;  1J0F A;  4MF7 A;  3F4T A;  3TJJ A;  1T00 A;  1GTI A;  1T4Y A;  2QC7 A;  4PX1 A;  6GST A;  5JWO B;  1U88 A;  1YF1 A;  2K18 A;  5B6M A;  3TJF A;  3DVX A;  1EP8 A;  5KN0 A;  3D6I A;  5G31 A;  3L9S A;  5J9B A;  3LXT A;  1ZZY A;  1O81 A;  2RLI A;  2H75 A;  1V98 A;  4J56 E;  14GS A;  1FVJ A;  2VIM A;  4F03 A;  4MJE A;  2FNO A;  4RI7 A;  2B3S A;  5GZZ B;  4ZB9 A;  4O5R A;  2HT9 A;  1OC9 A;  2BTO T;  3EUR A;  3TJB A;  1O7U A;  13GS A;  1K3L A;  1GUK A;  1SJ6 A;  2C3T A;  3C1R A;  4OWY A;  3O3T A;  5DJL A;  5CRE A;  3QCP A;  4HQZ A;  2LNS A;  4ID0 A;  2LRT A;  4ILF A;  3QFA C;  3KZQ A;  1M9B A;  3J7Y b;  1F2E A;  2DJ0 A;  4G10 A;  4IBP A;  2KUC A;  5ECQ B;  2N5F A;  17GS A;  1X9S B;  5CRW A;  3ZML A;  3KMO A;  3WGD A;  4MLY A;  5L71 A;  4PQH A;  4PQ1 A;  3A2X A;  3ZRE A;  6GSS A;  4KGI A;  3VI5 A;  1ILO A;  1MTC A;  3LXZ A;  3FR9 A;  1GSD A;  1XVW A;  4ZIJ A;  3FZA A;  4JR4 A;  3P8W A;  4IW9 A;  4HUA A;  1PQN A;  4ZBD A;  3GRX A;  3RPP A;  3HZ8 A;  1TK0 B;  2ON5 A;  3GYK A;  2I9H A;  2H70 A;  4P3Y B;  3MDK A;  5EVO A;  2B6M A;  1NM3 A;  1QXH A;  2PPT A;  3VWU A;  2YWO A;  1AAZ A;  2B7J A;  2RM6 A;  2V2G A;  1A8L A;  1SKR B;  4HQS A;  3DEX A;  2HYX A;  4IQ1 A;  3W8S A;  2FA4 A;  1A0R P;  1XOA A;  4HI7 A;  3DYR A;  3FR3 A;  1TXX A;  2OE1 A;  1Y6E A;  3GTU A;  1DE2 A;  2IMI A;  1LJR A;  1TI3 A;  3FZ9 A;  2H30 A;  2XBI A;  2TRX A;  4ML6 A;  2WDU A;  1AQX A;  1WOU A;  4OMV A;  1M2B A;  1WMJ A;  1BED A;  4GQF A;  1HYU A;  5A4U A;  2C1Y A;  4OO4 A;  3LFL A;  2H66 A;  1EGO A;  3DD3 A;  4LL1 B;  5ECH B;  4XTS A;  3MNG A;  4HJ2 A;  2BJX A;  4TXO B;  1MD4 A;  4NHW A;  2HZE B;  2IPA A;  1TW9 A;  1TU8 A;  5CNW A;  1MDI A;  5DAK B;  4POK A;  1JZO A;  1N2A A;  3CBU A;  4F9Z A;  1ON4 A;  3ZMK A;  3EMX A;  4BPY A;  1FW1 A;  4XRA A;  3TJG A;  1PMT A;  2FLS A;  4JED A;  4TR1 B;  1QK8 A;  3ERW A;  5HR1 A;  2LRC A;  1KTE A;  2B5Y A;  1R5A A;  2O8V B;  2JAC A;  2XPD A;  5FT3 A;  2YZH A;  1O8X A;  2DJ3 A;  1FG4 A;  4TKY A;  2J23 A;  2H19 A;  4EVM A;  4BA7 A;  2CQ9 A;  4HOJ A;  3FRC A;  3HY2 A;  2DLX A;  2NBS A;  2E2G A;  4GCI A;  2PUK C;  3LYK A;  4FH8 A;  3HZ4 A;  5ENU A;  3M8N A;  4JR6 A;  4TOP A;  4GWR A;  5KEJ A;  3MSZ A;  2P5R A;  1SL2 B;  5CAX A;  1BQ7 A;  3GX8 A;  1PN9 A;  4F2I A;  1K0O A;  1GH2 A;  4OCF A;  5KN3 A;  11GS A;  1E2Y A;  3RAZ A;  1ZYQ B;  3NOF A;  1VRS D;  3S9F A;  3TDG A;  3EWL A;  4RUV A;  1XCC A;  1GSF A;  3PR8 A;  2WS2 A;  1VF1 A;  1XPV A;  1TI1 A;  2YWI A;  2MYG A;  4WXT A;  1TP9 A;  4OFN A;  3SBC A;  1V2A A;  1ZL9 A;  3VWW A;  4GST A;  3M3M A;  18GS A;  3TOT A;  4YQV A;  4L5O A;  2C0G A;  2WB9 A;  1SEN A;  2V1M A;  5LCZ A;  3UJ1 A;  2I1U A;  2B7K A;  5E4W A;  4DEJ A;  2HE3 A;  4V2L A;  1WE0 A;  4LL4 B;  4I2T A;  3APQ A;  2HZE A;  3TKS A;  1Q98 A;  4HJM A;  5DAK A;  3U5R E;  2V6K A;  3FY7 A;  3L9U A;  4FYU A;  3UAR A;  1KBN A;  2GQK A;  2K9F A;  3EE2 A;  1W89 A;  1PGT A;  1UN2 A;  1PRX A;  4BWS A;  3ZVJ D;  4I97 A;  2GLR A;  2IN3 A;  1MEK A;  2EC4 A;  2IWT A;  4TR1 A;  4YQU A;  1Z3E A;  5HR2 A;  2REM A;  4CHS A;  5LD0 A;  5FHI A;  4NV2 A;  4FYB A;  2IME A;  1IYI A;  4EC0 A;  1X5E A;  16GS A;  1Y25 A;  2HLS A;  19GS A;  4IHU A;  4NMU A;  3TB2 A;  3TRQ A;  1X9M B;  2FD3 A;  3K8N A;  1HNC A;  3M0F A;  5HFG A;  4NPB A;  3ZLP A;  3M1G A;  2VOC A;  1O6J A;  3TUE A;  1OC3 A;  2LQQ A;  4IJI A;  1ERV A;  1NW2 A;  2DMM A;  5IMZ A;  4TR4 A;  5IO2 A;  3EMP A;  1J08 A;  1VF2 A;  2PU9 C;  1ERW A;  5ECL B;  5EY6 A;  4GRF A;  3E0U A;  3HA9 A;  4WF5 A;  3FYG A;  1HQO A;  3HVX A;  4K0G A;  1GNW A;  2L5O A;  4N0V A;  2VCT A;  5KN2 A;  3ZFL A;  2QKE A;  3L0H A;  4ECC A;  1V9W A;  1U6T A;  2CX4 A;  1JLV A;  4PNF A;  4ZXG A;  2PWJ A;  3QPM A;  5E59 A;  1F3A A;  1O73 A;  4H86 A;  3GL5 A;  2V41 A;  1YEP A;  1X0R A;  2LJA A;  1XWG A;  1J9B A;  1XXU A;  2N5A A;  2YAN A;  4V1A p;  4E8H A;  5IMA A;  1EGR A;  3Q6O A;  3LYP A;  5CRG A;  5JWR B;  3EVI A;  5A4V A;  1S3D A;  3KH9 A;  1XW5 A;  4TR0 A;  1SD8 A;  2RUE A;  4N11 A;  2YCD A;  3A2W A;  2GS3 A;  4MJB A;  3ED3 A;  2H76 A;  2H0G A;  3IA1 A;  4ML1 A;  3GKM A;  3LWA A;  1M99 A;  3IR4 A;  2PN8 A;  3GV1 A;  3KCM A;  3HJM A;  3D4M A;  5D73 A;  2OKA A;  2O89 A;  1B9Y C;  1VF4 A;  1YF0 A;  3F4R A;  3TKR A;  1ERU A;  4WR5 A;  5IM9 A;  5B6N A;  1BAY A;  1KEB A;  4CDO A;  20GS A;  4IP6 A;  1A24 A;  4FIW A;  3GMF A;  2C0D A;  4QL9 A;  5COH A;  1AQW A;  1QMV A;  2GZY A;  5HQP A;  2FUG 2;  3W6G A;  2RUF A;  3G7Y A;  5B8A A;  4EF0 A;  1R5P A;  2C3N A;  4KE3 A;  5ID2 B;  5DCG A;  2VL2 A;  2M72 A;  2JZR A;  3G7J A;  2VL3 A;  2PVQ A;  1BX9 A;  2VLT A;  2OJL A;  2VO4 A;  4ZIL A;  4K7O A;  5D96 A;  4EE0 A;  3GSS A;  4K0N A;  3ME8 A;  1TRU A;  2ON7 A;  2OBI A;  2XHF A;  3FK8 A;  3RPN A;  1RK4 A;  2JZS A;  1WRY A;  2CZ2 A;  3VI7 A;  4QQ7 A;  1DBY A;  4DSS A;  1GTA A;  1F6M C;  4PQI A;  4XIH A;  3UL3 A;  1G0T A;  4IS0 A;  1YKA A;  3LQ7 A;  5D9T A;  1H4O A;  1Z7R A;  2MMN A;  2IMF A;  1WP0 A;  3UVH A;  8GSS A;  2V6O A;  3D22 A;  4F0B A;  3QD9 A;  3KP9 A;  1SK1 A;  3DGQ A;  1ACV A;  2GSQ A;  3C71 A;  3LG6 A;  1HD2 A;  5IMC A;  5IMD A;  1PKW A;  1KNG A;  3KP8 A;  1PA3 A;  3H93 A;  3UBL A;  1YQ1 A;  1GRX A;  4PUF C;  2I3Y A;  5ELA A;  3GKN A;  1B48 A;  3E3E A;  3A2V A;  3IOS A;  3KTL A;  1MDJ A;  1PKZ A;  4CW9 A;  3D21 A;  3UOM A;  5EPF A;  4G2E A;  4ULX A;  4BVX A;  5AIX A;  2CAI A;  3PH9 A;  3IHQ A;  4N0Z A;  3RHB A;  3APS A;  4LMV A;  2F3M A;  3F63 A;  2R4V A;  4ECI A;  4ZL8 A;  1T4Z A;  2V32 A;  3DKS A;  1PL2 A;  3HJO A;  3GUS A;  2YJH A;  4K7I A;  2DJ2 A;  1XIY A;  4HEA 2;  5JCG A;  4KSM A;  3ZTL A;  3TKQ A;  2AAW A;  4V2M A;  2GT5 A;  3DML A;  2GSS A;  3F0I A;  2OA7 A;  5IMV A;  4L0U A;  4X43 A;  3IK9 A;  3ZZX A;  4N30 A;  4MDC A;  2H1A A;  3VLN A;  2P0G A;  3TRP A;  1TTZ A;  1LBK A;  2YN1 A;  3DXB A;  5ID2 A;  2YJ7 A;  2XC2 A;  1XWK A;  4K8M A;  4I6X A;  3HVS A;  4PGT A;  1CQG A;  3CMI A;  2VM1 A;  1OKD A;  3KJY A;  3TKP A;  5H5Q A;  2H74 A;  2CZ3 A;  2L5L A;  2VAF A;  3KD0 A;  1S3A A;  5F05 A;  2DIY A;  5D9X A;  4EXJ A;  2WGR A;  3VK9 A;  2MMZ A;  1K3O A;  3GN3 A;  3HVV A;  2IMD A;  4KH7 A;  4F82 A;  2QGV A;  1AC1 A;  4LMW A;  2LJR A;  4L8E A;  1PX6 A;  2C80 A;  1XW9 A;  2VCZ A;  3ZL5 A;  5DVB A;  2JL4 A;  1A8Y A;  4POL A;  2L6C A;  2H0I A;  1A2L A;  2FCH A;  2NTO A;  3A3T A;  4EKZ A;  4K1F A;  1T1V A;  1YJ6 A;  2DBC A;  1MD3 A;  4IN0 A;  1R4W A;  2VCV A;  4MMM A;  2L4Q A;  5IQY A;  4TRX A;  4LLR A;  5DQY A;  1EV4 A;  1XVQ A;  2CAQ A;  2MZC A;  2R6K A;  4IVF A;  4GSS A;  4EO3 A;  3PGT A;  1EWX A;  2CA8 A;  1QQ2 A;  2I4A A;  1T8E B;  1ML6 A;  3GX0 A;  1T7P B;  1Z6N A;  4TN8 A;  5J3R A;  6GSV A;  2DIZ A;  1AW9 A;  5JCW A;  4IGJ A;  1ZGN A;  1SJI A;  2IIY A;  1R7H A;  4TVE A;  5D9V A;  2MMA A;  2JAD A;  1FO5 A;  3C7M A;  1GSS A;  3E9J B;  2H0H A;  3TKS C;  1M2D A;  3DVW A;  2YV7 A;  1YDK A;  2CVB A;  2VCX A;  4MPG A;  5F8B A;  4LA1 A;  2FHE A;  2L4C A;  2GSR A;  1GNE A;  1T3B A;  4JE1 A;  4MZB A;  3WGX A;  3QR6 A;  1SL0 B;  5JCU A;  2WCI A;  1V40 A;  2GGT A;  1UA5 A;  1UC7 A;  1M0U A;  3U6V A;  2WUL A;  1I9D A;  2LJK A;  3IXR A;  3LGC A;  2LST A;  5G5E A;  5J5N A;  2HSH A;  3EYT A;  3QAG A;  4GXZ A;  5GAN D;  3TOU A;  2FWF A;  3Q74 A;  2H1B A;  2H01 A;  2L59 A;  4OFM A;  1FVK A;  3I6A A;  3CXG A;  5HR3 A;  3O6T A;  1YZX A;  2VUP A;  2ZNM A;  2LUS A;  1FB0 A;  4JZQ A;  4YAP A;  5IO0 A;  5HFK A;  3LEF A;  3VUR A;  6GSY A;  1F37 A;  5IPH A;  2H1G A;  3IC4 A;  4ZL7 A;  3ERF A;  3L78 A;  4G19 A;  4MF6 A;  4J57 E;  3JCM L;  4KDY A;  2H1D A;  2LRN A;  1K0D A;  4MF5 A;  1A2J A;  1NSW A;  1FAA A;  1Z5Y E;  4POM A;  3QAW A;  4JBB A;  4MZC A;  6GSX A;  1SU9 A;  5IOW A;  2KOK A;  3FZ4 A;  3GHA A;  1HNA A;  1TK5 B;  1R26 A;  1OVN A;  2FA8 A;  3GFK A;  3IV4 A;  3DRN A;  2YPM A;  4NV5 A;  3TJK A;  3C1S A;  1BYE A;  4HZ2 A;  1SJZ A;  2KLX A;  4POB A;  4Q5Q A;  4ACS A;  2O7K A;  3WYW A;  3IPZ A;  1VGL A;  1GSE A;  1F9M A;  3UAP A;  2FGX A;  1O8W A;  3I43 A;  1ZYE A;  5ECM B;  2R37 A;  3VFI A;  1TK8 B;  1QGV A;  5C00 A;  1XZO A;  1XWB A;  1JZD A;  3CSH A;  1SYR A;  3AY8 A;  1U3A A;  4MK3 A;  2DJ1 A;  3CSJ A;  4KUN A;  1SL1 B;  2PGT A;  4YQM A;  1TRS A;  4WBJ A;  3D5J A;  1I5G A;  4HS1 A;  4KAE A;  4OFT A;  3VWV A;  1AXD A;  4DSS B;  1ZCP A;  4J2F A;  5ECP B;  3BOA A;  2N5B A;  4NAX A;  3BD2 A;  1B8X A;  1XW6 A;  5F07 A;  3BJ5 A;  5KN1 A;  4WBR D;  1EV9 A;  3UBK A;  3WD6 A;  1M9A A;  4OO5 A;  2YOI A;  3GIX A;  3O76 A;  2YP6 A;  4I2U A;  2KHP A;  4KCE A;  1RW1 A;  2FWG A;  4JU5 A;  5F0G A;  3F8U A;  1BJX A;  2AB6 A;  2J9H A;  3UIW A;  1G7O A;  2K8S A;  3P2A A;  2YZU A;  3F6D A;  5FWG A;  3H4K A;  5A4W A;  1K0N A;  2CV4 A;  1O85 A;  4WKW A;  5H5S A;  2DSA A;  2VD1 A;  2OAC A;  4KX4 A;  4DSR A;  1BG5 A;  2F51 A;  2YV9 A;  4OD7 A;  5CP1 A;  2A4V A;  2E2M A;  1H75 A;  1B4Q A;  4KA0 A;  1MDK A;  3F6F A;  3MWH A; 
#chains in the Genus database with same CATH topology
 1NWW A;  3GL3 A;  5AIF A;  4ECB A;  5CYY A;  2HMK B;  5ELU A;  2HXK A;  4FMC A;  1TRV A;  3LSZ A;  3IPT A;  4EDY A;  1Q4J A;  2OAD A;  2UX0 A;  1W2Z A;  4G0I A;  4YH2 A;  3JUO A;  3BBY A;  4QL7 A;  3KGK A;  5HR0 A;  5AI1 A;  2A2R A;  4MMZ B;  3KSP A;  2QSI A;  2P5Q A;  1DE3 A;  1GSU A;  2XBQ A;  3M9K A;  1BAN A;  3EN1 B;  1GY5 A;  2GZP A;  5BVB A;  3LOR A;  4HM0 B;  2CVK A;  4Q5N A;  4ZBB A;  7GSS A;  1NHO A;  3IJE B;  2VLU A;  4EUY A;  2CG0 A;  1YIJ 3;  1GLQ A;  1W02 A;  3PIN A;  5CO3 A;  5A0O B;  3BCK A;  2YFL B;  3LH4 A;  4WHA A;  1THX A;  1B2U A;  4RQX A;  3IE3 A;  2STD A;  5D93 A;  1RN4 A;  3C8E A;  1GOV A;  1PFO A;  5FW5 A;  1GLP A;  2CH9 A;  5RNT A;  2JZT A;  4WET A;  1RRL A;  1BOX A;  1OGX A;  1V57 A;  4FCJ A;  1V58 A;  2O85 A;  2F8A A;  2OTL 3;  1OKT A;  2LV3 A;  1JBT A;  2NDO A;  1CQH A;  3RDW A;  4EL1 A;  2X8G A;  2CWV A;  1GUH A;  2RCD A;  3MYD A;  3UMA A;  2F8F A;  4EV2 A;  3G7I A;  1YY7 A;  5AN1 A;  1IQX A;  3G9B A;  1X5C A;  3GH9 A;  4LGQ A;  3F40 A;  3CRT A;  2C0F A;  2GST A;  3H8Q A;  4HZ4 A;  5D9W A;  3DIE A;  2WRT A;  1K0C A;  3F8H A;  1GSQ A;  4I8B A;  2TIR A;  2WFC A;  2WJU A;  2EIR A;  3VSY A;  1V74 A;  5DQS A;  5INY A;  1B21 A;  4L0W A;  1K41 A;  3KTB A;  6GSU A;  1E97 A;  1M90 4;  1Z6M A;  1NHY A;  1OPY A;  5KP3 A;  1OAC A;  1PL1 A;  3NBR A;  3S27 A;  4DVC A;  4HYZ A;  1ROA A;  1K0M A;  1Z9H A;  1B2M A;  4H61 A;  1NJI 4;  4RNT A;  2R3X A;  1DE1 A;  2F5M A;  1OE8 A;  4IJ3 A;  2E2U A;  5EEO A;  2OE0 A;  1ABA A;  5GAP D;  1HNB A;  2E2T A;  1WIK A;  4WEY A;  4AF2 A;  2ALB A;  2LEG A;  2RGQ A;  3OR5 A;  1U87 A;  2H6X A;  1LOV A;  3I9V 2;  3GUR A;  2RII A;  5DBQ A;  1K3Y A;  2CC3 A;  1K0A A;  1GUM A;  1UCK A;  2TRC P;  1ZOF A;  4KCA A;  2H72 A;  1QUW A;  1B9X C;  2GDR A;  2Q07 A;  1F8N A;  4BTW A;  1FZU A;  2G2Q A;  2KXG A;  3HYP A;  5EL8 A;  5B7C A;  4U13 A;  3FCS B;  1AIU A;  2GZZ A;  1AQV A;  3F3R A;  1O7W B;  3DWV A;  1BRS A;  5M1A A;  1SK0 A;  4XBY A;  3DGO A;  1ZYN A;  3GST A;  3HD5 A;  5AYR B;  1TUH A;  4PUR A;  3RHC A;  2ZUP A;  4K1U A;  2HNL A;  4EC6 A;  2C11 A;  3EF8 A;  4BL7 A;  1FW7 A;  3KCH A;  3EU4 A;  1IVV A;  1G6W A;  1XWA A;  3ZYW A;  3UL5 A;  1JLW A;  5J9C A;  1QFN A;  5IOX A;  3K7C A;  2VM2 A;  10GS A;  3CYN A;  1Q81 4;  1MWS A;  3CCJ 3;  3AGO A;  1WWJ A;  3ZRD A;  2QIY A;  1FB6 A;  1PSQ A;  1IV7 A;  3ZG5 A;  4WWU C;  1OHS A;  3HZP A;  2YWN A;  4GTU A;  2IA7 A;  3V1W A;  1TRW A;  2GQL A;  4O32 A;  1K28 A;  3D4A A;  1BSA A;  1EOH A;  1SD9 A;  3URP A;  2H6Y A;  12GS A;  2JSZ A;  5J41 A;  1JB2 A;  1NB3 I;  4LZI A;  2Y74 A;  2PMT A;  4ZL9 A;  3W8J A;  6GSW A;  2LYX A;  1BSC A;  3V98 A;  5J4U A;  3MSO A;  3ME7 A;  3Q18 A;  4O7H A;  3BCI A;  1QAK A;  2BMX A;  3ZVJ A;  4GQC A;  1GTB A;  3HCZ A;  1RGL A;  2X8C A;  8CHO A;  1OGZ A;  5HOH A;  1DMN A;  1OHO A;  1RNT A;  1YEX A;  1MWT A;  1O7G B;  3SWL A;  3GRD A;  3N5O A;  1EZK A;  2D2Z A;  3UVT A;  1E3R A;  2R41 A;  3LTD A;  3C73 A;  2CK3 H;  4K2D A;  3LTC A;  2JU5 A;  1ERT A;  4FQU A;  2M7O A;  3ZIT A;  1THO A;  2QA4 3;  3VWX A;  2X64 A;  5JBS A;  4MA9 A;  2LKU A;  2CHC A;  2FWH A;  3IDV A;  4PEJ A;  2F4Y A;  1GWC A;  2AUV A;  2GT6 A;  4KDU A;  2I9W A;  1RQM A;  4Q5F A;  1WPI A;  3QFB C;  5DCH A;  1GSY A;  4MCU A;  1DMM A;  2VLV A;  1UVZ A;  1TRP A;  4V2N A;  3DY5 A;  1U5O A;  2L6D A;  4MEI A;  1QVG 2;  1O7M B;  1SKW B;  3F4S A;  5IIZ A;  1OF5 B;  3STD A;  2GTU A;  1Q9E A;  2A2S A;  2OOV C;  2PVO C;  2I81 A;  5B8B A;  2G0F A;  5AIV A;  4O3V A;  2HRF A;  2OWP A;  4N6T A;  3NIV A;  2X99 A;  2VL9 A;  2KF5 A;  2DJJ A;  1VQN 3;  3BIR A;  3CC4 3;  1YKC A;  3QMX A;  3FH1 A;  3JUQ A;  2ZCT A;  5DJM A;  4TXV A;  3FG1 A;  2LQO A;  3NUV A;  1N8J A;  1XBS A;  1F3B A;  3FKA A;  1FGR A;  4XBX A;  1EQK A;  1RN1 A;  4V1A g;  2GVP A;  2LTK A;  3CTF A;  4RQR A;  3K5T A;  2INX A;  1IYH A;  2CG1 A;  4N6M A;  2FY6 A;  4RI6 A;  4BWQ A;  3KH7 A;  1QAF A;  2R5G A;  2GU3 A;  1C54 A;  1GTU A;  3OV4 A;  1GD4 A;  1DVD A;  1TRQ A;  4K7N A;  5HGR A;  3UB1 A;  5H5R A;  2IY2 A;  2ES7 A;  1FHE A;  4BIK A;  3Q19 A;  1RMS A;  2M80 A;  3J7Y k;  4D73 B;  7STD A;  4TW5 A;  5JPU A;  3DH2 A;  3NV0 A;  3FHK A;  1M2A A;  4KDX A;  4XRD A;  1UI7 A;  2PER A;  4HM6 B;  4BL2 A;  2C0E A;  2HRA A;  3FZ5 A;  4ZBA A;  2DML A;  3F9U A;  3SOA A;  3CCS 3;  2L57 A;  2A2P A;  3KM6 A;  2HFD A;  4L5L A;  5HFI A;  5ELG A;  3WGE A;  1X5D A;  1IU7 A;  1LQG C;  2WZ9 A;  1VF3 A;  2MBT A;  5G2Z A;  1Q82 4;  4HAA A;  5ECR B;  2GQM A;  2Y73 A;  1SK2 A;  2E2V A;  2H71 A;  1W6Y A;  3R2Q A;  3G0K A;  3OX9 A;  3S28 A;  1AUC A;  2VCQ A;  3APO A;  1TFK A;  3LJR A;  1JHB A;  3FKF A;  1FOH A;  2AAE A;  3DGN A;  3B4P A;  2KP2 A;  5DAL B;  1OYJ A;  4DSQ A;  2HZF A;  2DKI A;  2E7P A;  1GOU A;  3WT1 A;  2R0C A;  2F9S A;  1YVB I;  1ZX2 A;  3TKS E;  1BGS A;  1EOG A;  3UEM A;  3FEU A;  3AHS A;  1K9M 4;  4EDZ A;  2P05 A;  1ST9 A;  4MH3 A;  1W6C A;  1JN5 A;  3CCE 3;  4AJ8 A;  2C8U A;  3H3H A;  4IKH A;  2M46 A;  5ECK B;  1BNI A;  3X40 A;  1GL8 A;  1BSE A;  2OCT A;  3D0Z A;  1EKM A;  1GP1 A;  1JV2 B;  4MH2 A;  4K6X A;  4F0C A;  4IQA A;  4WR4 A;  1STD A;  2B5X A;  4Z7X A;  3NQZ A;  3A5E A;  2K6V A;  3QRD A;  1W00 A;  1QAL A;  3WT2 A;  3HJP A;  1Q42 A;  4XS1 A;  1LOY A;  3I55 3;  1GUL A;  3LXU X;  3ZIJ A;  1IVU A;  1JFU A;  1OF5 A;  1LU4 A;  5IEN A;  1TJD A;  2DC5 A;  3CRU A;  3P7X A;  3FR6 A;  1KD1 4;  5D8I A;  3N9J A;  2CT6 A;  3DGL A;  2VCW A;  4HM5 B;  2KAA A;  1SYX A;  3NZN A;  2CX3 A;  3FW2 A;  4IEL A;  2MMO A;  2CIU A;  1LVN A;  1VQQ A;  2RM5 A;  4HM3 B;  3L4N A;  4I4K A;  3KXO A;  1WJK A;  2MC8 A;  1QVF 2;  3GKK A;  3IK7 A;  2B5E A;  1XOB A;  1A2M A;  4YAV A;  4PNG A;  1W7C A;  1Z1S A;  5A5K A;  5JWQ B;  3D4T A;  1OAZ A;  4FO5 A;  2W03 A;  3ISO A;  3IAM 2;  1DSB A;  1EEJ A;  3F7X A;  2BHM A;  3GWR A;  4TXO A;  5IG5 A;  5IG0 A;  4MPF A;  2YWM A;  4KFE A;  3DMC A;  1PFP A;  3ZFB A;  2R2J A;  2X49 A;  2J8X B;  2EIQ A;  2PBJ A;  4KND A;  1BVI A;  2PZV A;  1KWI A;  4HM4 B;  3RDE A;  3L9V A;  1XFL A;  4D73 A;  4G1M B;  1TU7 A;  4KSO A;  4N10 A;  1I2E A;  3CNM A;  3MG2 A;  2YNX A;  1AR0 A;  3EQQ B;  4MZW A;  1I0X A;  4J9A A;  4OVM A;  1XWC A;  1I2F A;  1MWR A;  4FMA A;  3KEB A;  2ZL8 A;  2CVD A;  1OC8 A;  1BRK A;  1GSP A;  2VD0 A;  5GST A;  4AJ6 A;  4FCZ A;  4JRR A;  1TDI A;  3WOE B;  3CTG A;  3GA4 A;  1C72 A;  2IMK A;  1R4Y A;  3BNC A;  3QOU A;  4HU9 A;  3MHE A;  3HXS A;  1SKS B;  4Q5R A;  4EIP A;  3ERG A;  4HDE A;  4K90 B;  1LXE A;  5GSP A;  3FMW A;  2OBK A;  1B27 A;  4MMX B;  8RNT A;  2AV4 A;  4FYC A;  2DJK A;  3HVN A;  5ECI B;  1PX7 A;  4GF0 A;  1RLS A;  1OE7 A;  1HZ1 A;  1ZO2 A;  4XS4 B;  3S5C A;  2EIO A;  5DAL A;  4WF4 A;  2K0M A;  2YX9 A;  4NXI A;  1MGR A;  3G6E 3;  5G1L A;  4ZB8 A;  22GS A;  3MG1 A;  2KP1 A;  3CCU 3;  1IVX A;  1BNS A;  3EN8 A;  4AJ7 A;  1JKG A;  3MPH A;  1TFO A;  3EJV A;  1U3I A;  3H1N A;  3H79 A;  1RJO A;  4OCE A;  4XS6 A;  2P31 A;  1X1X A;  1T2H A;  5G1K A;  2RBI A;  2HI7 A;  2IFQ B;  4WFO A;  4ECJ A;  4OK0 A;  1TOF A;  4PUA A;  2H6Z A;  2QEX 3;  2AHE A;  4I5Q A;  4MP4 A;  3TRX A;  3QDN A;  2JSY A;  4CCV A;  4XHM A;  5ECN B;  5KP1 A;  3T8U A;  3AGN A;  2OE3 A;  3PCR A;  4E8E A;  5AGY A;  3EIN A;  3BNB A;  3WDG B;  2B1L A;  2Z9S A;  2HML B;  2Z76 A;  5ECS A;  5CLK A;  1E6B A;  2AYT A;  4X1U A;  2W56 A;  1PD2 1;  5CRH A;  4MAB A;  1VQO 3;  1USB A;  1NB5 I;  4CY6 A;  2LNT A;  4G9H A;  4K9Z A;  4XCS A;  4PXO A;  1EP7 A;  2RSX A;  1W4V A;  2NVL A;  1A23 A;  2X8H A;  5KOW A;  1CH0 A;  4RNZ A;  2E0Q A;  1Q7H A;  5G5F A;  3GNJ A;  3VPQ A;  2ML6 A;  1WMO A;  4K5R A;  1US1 A;  3KMN A;  4TR3 A;  5F06 A;  1TKD B;  4O92 A;  3ECF A;  3TCO A;  3MAK A;  4NHZ A;  1I8V A;  3ZIV A;  1JBR A;  3US3 A;  1JZR A;  5CRD A;  2GBX B;  3HDC A;  4HOH A;  2X4A A;  1OC9 B;  3GH6 A;  1JZW A;  3WR2 A;  5C04 A;  3RNT A;  2XEP A;  1GMP A;  1JNQ A;  2IYJ A;  1FYS A;  4MJA A;  4N6N B;  3EU3 A;  1A0F A;  4GSN A;  3IBH A;  2D42 A;  4L8O A;  4MJD A;  4KW6 A;  1RCL A;  5GSS A;  5CF1 A;  3QAV A;  5G30 A;  4ZM8 A;  2GEX A;  3TGZ A;  5DDL A;  1UDI I;  2GEY A;  2VL2 C;  3IRA A;  3A5W A;  2O3O A;  3HHV A;  3RBT A;  1MWU A;  5ABR A;  3HOH A;  3LZA A;  2XPE A;  2ZA4 A;  4MJC A;  2AJQ B;  3OWU A;  5AIH A;  3ER7 A;  3RGR A;  2C3Q A;  4BVY A;  5LNK e;  1SII A;  3CSI A;  2BMO B;  3M9J A;  1FOV A;  1B4P A;  1BAO A;  3LML A;  5IMF A;  9GSS A;  4HU7 A;  1M3I A;  1Z7P A;  3JUN A;  1BRH A;  1MNL A;  1G6Y A;  2HSY A;  2HRN A;  2K8V A;  3GKX A;  3CPO A;  3P90 A;  2B24 B;  2H8L A;  4X0X A;  7GSP A;  2LS5 A;  4ISD A;  1S5A A;  3F3Q A;  5IEO A;  3NBJ A;  3S29 A;  3EC3 A;  1X9W B;  2IJY A;  2W04 A;  5IPG A;  4HM7 B;  5IG3 A;  1M7T A;  1DUG A;  4XS4 A;  2C4J A;  1S3C A;  2NPB A;  3I69 A;  3HKR A;  4XDV A;  1G7E A;  3N54 B;  1K0B A;  2HSM A;  4IP1 A;  1ZGX A;  4ZB6 A;  1URM A;  3CQF A;  4EXR A;  5AIS A;  2JDI H;  2FWE A;  3QK9 A;  3F9S A;  1MOL A;  4KB3 A;  2MBS A;  2B1K A;  1ZMA A;  2HRK A;  2O87 A;  2H73 A;  2IFQ A;  4GLT A;  1FGO A;  4NWY A;  3IAS 2;  2W9Q A;  3VPT A;  5ECO B;  3KIJ A;  2GBW B;  4N6V 0;  2IL3 A;  3GTU B;  4AGS A;  1EEM A;  1J0F A;  4MF7 A;  3F4T A;  3TJJ A;  1T00 A;  2P09 A;  4X2H A;  1GTI A;  1T4Y A;  1IT8 A;  1RGH A;  2QC7 A;  4PX1 A;  6GST A;  5JWO B;  1U88 A;  1YF1 A;  2KRT A;  2K18 A;  5B6M A;  3TJF A;  3DVX A;  1EP8 A;  5KN0 A;  2P0M A;  3D6I A;  5G31 A;  3L9S A;  5J9B A;  3LXT A;  1ZZY A;  1VQ5 3;  1O81 A;  2RLI A;  1YIT 3;  5TGN A;  2AAD A;  2H75 A;  3FG3 A;  1V98 A;  4J56 E;  14GS A;  1FVJ A;  3EBT A;  2VIM A;  4F03 A;  2JQ5 A;  1X1W A;  4EV5 A;  2FNO A;  1N8Q A;  4MJE A;  4RI7 A;  1T5Y A;  2B3S A;  5GZZ B;  4ZB9 A;  1RGK A;  3BB9 A;  3V99 A;  4O5R A;  3OWY A;  2HT9 A;  1OC9 A;  2BTO T;  3EUR A;  3TJB A;  1O7U A;  13GS A;  1K3L A;  1GUK A;  1A67 A;  1SJ6 A;  1GOY A;  2C3T A;  3C1R A;  4OWY A;  3O3T A;  4EBG A;  1W6G A;  2BMQ B;  4USS A;  5DJL A;  4A5P A;  5CRE A;  3QCP A;  4HQZ A;  3NV0 B;  2LNS A;  4ID0 A;  2LRT A;  1YJ9 3;  4ILF A;  3F14 A;  3QFA C;  3IMA B;  3KZQ A;  3FZW A;  1M9B A;  3J7Y b;  2CX0 A;  4J5G A;  4HJL B;  1F2E A;  2DJ0 A;  1RCK A;  4G10 A;  3PPU A;  4IBP A;  1UCJ A;  3OXA A;  3X3X A;  2Z7A A;  3CCM 3;  2KUC A;  3FF2 A;  2XF3 A;  5ECQ B;  2N5F A;  17GS A;  1X9S B;  3CC7 3;  1X1U A;  4TX4 A;  3X3Y A;  5CRW A;  3UJM A;  3ZML A;  3PZW A;  3KMO A;  3WGD A;  4MLY A;  5L71 A;  4PQH A;  4PQ1 A;  3A2X A;  3ZRE A;  6GSS A;  4KGI A;  3VI5 A;  1ILO A;  1MTC A;  3LXZ A;  3FR9 A;  3EX9 A;  1GSD A;  1JB5 A;  3N9H A;  1YGW A;  1XVW A;  4ZIJ A;  3PCS A;  3FZA A;  4XBT A;  3K0Z A;  4JR4 A;  3P8W A;  4IW9 A;  4HUA A;  1PQN A;  2WOF A;  4ZBD A;  1JB4 A;  3GRX A;  4YKF A;  3E99 A;  3FG4 A;  3RPP A;  3J7Y d;  2DKH A;  3HZ8 A;  2QA2 A;  1TK0 B;  5D83 A;  2ON5 A;  3VGN A;  1B3S A;  1MGW A;  3GYK A;  2I9H A;  4O02 B;  2H70 A;  4P3Y B;  2PNC A;  3MDK A;  2P0X A;  5EVO A;  2B6M A;  1NM3 A;  1UCL A;  1QXH A;  2PPT A;  1JN5 B;  1B20 A;  3VWU A;  2YWO A;  1RGE A;  1AAZ A;  2B7J A;  2RM6 A;  2V2G A;  4EIQ A;  3F7S A;  1A8L A;  1SKR B;  5M19 A;  4HQS A;  3DEX A;  2HYX A;  4IQ1 A;  3W8S A;  2CWT A;  4RZM A;  2FA4 A;  4KFF A;  1A0R P;  1XOA A;  4HI7 A;  3DYR A;  3FR3 A;  1TXX A;  1O7N B;  2OE1 A;  1DYU A;  1Y6E A;  3GTU A;  1DE2 A;  2L4V A;  2IMI A;  1YGE A;  3NM2 A;  1LJR A;  1TI3 A;  4OUQ A;  3FZ9 A;  2H30 A;  2XBI A;  3CCR 3;  2TRX A;  4ML6 A;  3PGB A;  2WDU A;  1AQX A;  1B2Z A;  1WOU A;  1M2B A;  1WMJ A;  4OMV A;  5IW9 A;  1BED A;  4GQF A;  4BU4 A;  1W2B 2;  3CCQ 3;  1HYU A;  5A4U A;  3GAX A;  2C1Y A;  2FGT A;  4OO4 A;  3LFL A;  2H66 A;  3I0Y A;  3KFQ C;  1EGO A;  3DD3 A;  4EYC A;  1M3J A;  4LL1 B;  5ECH B;  4XTS A;  3MNG A;  2CFL A;  1BIR A;  2FNQ A;  4HJ2 A;  2BJX A;  4TXO B;  2XGN A;  3F8X A;  3HI7 A;  3FF0 A;  1MD4 A;  4NHW A;  2HZE B;  2IPA A;  1TW9 A;  5ELJ A;  1TU8 A;  5CNW A;  2R4I A;  1K73 4;  1MDI A;  1UUV B;  1D6U A;  5DAK B;  1LNH A;  1BNR A;  4POK A;  1JZO A;  1N2A A;  5AYS C;  3CBU A;  4F9Z A;  1VQL 3;  1NNV A;  3D5I A;  1ON4 A;  1D6Z A;  1IT7 A;  2BNG A;  1TIJ A;  3ZMK A;  1LNI A;  3EMX A;  1FW1 A;  4XRA A;  4BPY A;  3TJG A;  1PMT A;  2XFS A;  4WYK B;  4CY8 A;  2FLS A;  4JED A;  4TR1 B;  1QK8 A;  3ERW A;  3SXX A;  5HR1 A;  2LRC A;  1KTE A;  3UNL A;  4GSP A;  1R5A A;  2B5Y A;  5IEP A;  2O8V B;  2JAC A;  2XPD A;  3U97 A;  1B2S A;  3UL6 A;  5FT3 A;  3A76 A;  5FGO A;  3CMA 3;  2YZH A;  2OOV A;  1A90 A;  1O8X A;  2DJ3 A;  4CDL A;  1FG4 A;  4TKY A;  1M1X B;  1PY3 A;  1BRN L;  1EA2 A;  2R0P A;  2J23 A;  1CEW I;  1IV9 A;  1YHQ 3;  4N6O B;  2H19 A;  4EVM A;  1BUJ A;  3BU4 A;  3CU3 A;  4BA7 A;  3NM7 A;  2CQ9 A;  4HOJ A;  3KN4 A;  3FRC A;  3HY2 A;  2DLX A;  3MKI A;  2NBS A;  2E2G A;  5BIR A;  4GCI A;  2PUK C;  3LYK A;  1JKG B;  4FH8 A;  3HZ4 A;  1E3V A;  3SED A;  5ENU A;  3M8N A;  4JR6 A;  4TOP A;  1DMQ A;  1QJG A;  1VQ6 3;  4GWR A;  3MSZ A;  1LQM B;  2P5R A;  1GS3 A;  5KEJ A;  1SL2 B;  3R3E A;  5CAX A;  2D1W A;  1BQ7 A;  3GX8 A;  1PN9 A;  4F2I A;  1K0O A;  1GH2 A;  4OCF A;  5KN3 A;  11GS A;  4O2H A;  3G16 A;  3G8Z A;  1E2Y A;  3Q3F A;  3RAZ A;  4NHF A;  4XM4 A;  1ZYQ B;  2W56 B;  1VRS D;  3NOF A;  3S9F A;  3TDG A;  3EWL A;  2CW9 A;  2FXT A;  4RUV A;  1XCC A;  1GSF A;  3PR8 A;  2WS2 A;  3EC9 A;  4X2O A;  1VF1 A;  1XPV A;  2C4B A;  1S72 3;  1TI1 A;  4K2X A;  1A2V A;  2YWI A;  2MYG A;  1Q40 B;  2UZ8 A;  4WXT A;  2HOH A;  1TP9 A;  4OFN A;  1A2P A;  3SBC A;  1V2A A;  1I2G A;  3CXC 2;  1ZL9 A;  2F86 B;  1RKY A;  3VWW A;  3NHX A;  3M3M A;  4GST A;  1BSD A;  18GS A;  3TOT A;  4YQV A;  4L5O A;  4J5K A;  2C0G A;  2WB9 A;  1SEN A;  2V1M A;  4N6L A;  5LCZ A;  2XH9 A;  3UJ1 A;  1N9E A;  2I1U A;  5DRV A;  3NQY A;  2B7K A;  5E4W A;  1BNF A;  4DEJ A;  2HE3 A;  1BRI A;  4LMI A;  2Z6B A;  2B1X B;  2WGQ A;  4R9L A;  4V2L A;  1N5P A;  1WE0 A;  2O9U X;  4LL4 B;  4I2T A;  1ISK A;  3APQ A;  3AMO B;  2HZE A;  3TKS A;  1Q98 A;  4YKG A;  4HJM A;  4CPK A;  1AQZ A;  5DAK A;  3U5R E;  2ZHX B;  2V6K A;  3KZT A;  3FY7 A;  1HYF A;  3L9U A;  4BVY B;  1YJN 3;  4FYU A;  1PYL A;  3UAR A;  1KBN A;  2GQK A;  2K9F A;  1RDS A;  1VQ9 3;  3EE2 A;  1W89 A;  1PGT A;  1UN2 A;  2XFT A;  1PRX A;  3WMD A;  1HKX A;  5JPP A;  4BWS A;  3ZVJ D;  3EBY A;  3K63 A;  5STD A;  4I97 A;  2GLR A;  2IN3 A;  1OHP A;  4WYK A;  4O8S A;  1MEK A;  2EC4 A;  2IWT A;  1AV4 A;  4TR1 A;  1OCV A;  4YQU A;  1Z3E A;  5HR2 A;  2REM A;  3SVA A;  4CHS A;  5LD0 A;  5FHI A;  5LC6 A;  3EPT A;  4BTX A;  2UGI A;  4AKZ A;  4NV2 A;  1IQ8 A;  3MG3 A;  4FYB A;  2IME A;  1IYI A;  3IHG A;  1FA3 A;  4EC0 A;  2BIR A;  4LSO A;  3WHO A;  1X5E A;  16GS A;  1L5G B;  1Y25 A;  2HLS A;  3VF1 A;  19GS A;  2C10 A;  4G0L A;  4ICY A;  4IHU A;  4NMU A;  3TB2 A;  2HMO B;  3TRQ A;  1X9M B;  2FD3 A;  5BRT A;  3K8N A;  1HNC A;  5CXO A;  3M0F A;  2F56 A;  2V1L A;  5HFG A;  2OQE C;  1CQS A;  4NPB A;  3ZLP A;  3M1G A;  2HMM B;  2VOC A;  4AKY A;  1O6J A;  3TUE A;  1OC3 A;  2LQQ A;  2XSO B;  4IJI A;  1ERV A;  1NW2 A;  3CNX A;  3L0R A;  2HMN B;  4O5U A;  3HX8 A;  2DMM A;  5IMZ A;  4TR4 A;  1N5H A;  3CCL 3;  4HM2 B;  5IO2 A;  3MIX A;  2XR8 B;  3EMP A;  1J08 A;  1YJW 3;  1VF2 A;  2PU9 C;  5IG4 A;  1ERW A;  2W0Q A;  5ECL B;  3GZX B;  1KSI A;  3I56 3;  4GRF A;  4QWT A;  3E0U A;  5EY6 A;  3HA9 A;  4WF5 A;  4LYL B;  3FYG A;  1HQO A;  4GL6 A;  6GSP A;  3HVX A;  4K0G A;  1GNW A;  1FUW A;  2L5O A;  4N0V A;  2VCT A;  5KN2 A;  3ZFL A;  2QKE A;  1NDO B;  3L0H A;  4N6U A;  1Q40 A;  4ECC A;  1V9W A;  1BNE A;  1U6T A;  2CX4 A;  4HM1 B;  3DM8 A;  1M1K 4;  3ALA A;  3RGA A;  1JLV A;  4PNF A;  1ZS7 A;  4ZXG A;  1WQL B;  4HVN A;  2PWJ A;  3QPM A;  4R4K A;  1SAR A;  1ROV A;  3GSP A;  1I3F A;  5E59 A;  1F3A A;  1O73 A;  4H86 A;  1GYB A;  3GL5 A;  4IT7 A;  3Q1C A;  4KVH A;  1NU3 A;  3U1W A;  1YEP A;  1X0R A;  2V41 A;  1BU4 A;  2LJA A;  1XWG A;  1J9B A;  1XXU A;  2N5A A;  2YAN A;  4V1A p;  4E8H A;  5IMA A;  3HK4 A;  1Q86 4;  1EGR A;  3Q6O A;  3LYP A;  3B7C A;  5CRG A;  5JWR B;  1A2K A;  4IIA A;  1YI2 3;  3EVI A;  2KF4 A;  5A4V A;  2F5W A;  1S3D A;  3T8N A;  3AMO A;  1FGT A;  3FLJ A;  3KH9 A;  1JJ2 2;  1LOW A;  1XW5 A;  4TR0 A;  1SD8 A;  2RUE A;  4N11 A;  1BRJ A;  1W5Z A;  2YCD A;  3HIG A;  1FUT A;  3KSE D;  3A2W A;  1SIH A;  2GS3 A;  1SJW A;  4MJB A;  3ED3 A;  2H76 A;  4BL3 A;  2H0G A;  3IA1 A;  1BRG A;  4ML1 A;  3GKM A;  4RBN A;  3NBB A;  6STD A;  3LWA A;  1M99 A;  3IR4 A;  2PN8 A;  4BVX B;  3GV1 A;  3KCM A;  3HJM A;  3D4M A;  2SBL A;  2OKA A;  5D73 A;  2O89 A;  1B9Y C;  1LRA A;  1VF4 A;  1YF0 A;  3F4R A;  3TKR A;  1U8C B;  1BSB A;  4EW5 A;  4JF8 A;  3NXJ A;  3WOF B;  1AY7 A;  1ERU A;  4JRF A;  1I0V A;  3JUM A;  4WR5 A;  5IM9 A;  5B6N A;  1BAY A;  1KEB A;  4CDO A;  1STF I;  4XB5 A;  20GS A;  4IP6 A;  1A24 A;  5LC7 A;  4FIW A;  3GMF A;  1RRH A;  2C0D A;  4QL9 A;  5COH A;  1AQW A;  1QMV A;  2GZY A;  3DZL A;  2FUG 2;  5HQP A;  1AVK A;  1RGF A;  3W6G A;  2RUF A;  4HZB B;  4Z2U A;  3G7Y A;  1IDP A;  1WTH A;  4KT3 B;  5B8A A;  2CFW A;  2F99 A;  4EF0 A;  2CX1 A;  1R5P A;  1O7H B;  2C3N A;  4KE3 A;  5ID2 B;  4CJN A;  3PXM A;  3FGY A;  5DCG A;  2VL2 A;  2M72 A;  2JZR A;  3G7J A;  2VL3 A;  4GHO A;  7RNT A;  2PVQ A;  1EG9 B;  1BX9 A;  2VLT A;  4R1K A;  2OJL A;  2VO4 A;  4ZIL A;  4K7O A;  1WMP A;  4FMD A;  5D96 A;  1WNH A;  4EE0 A;  3GSS A;  4K0N A;  3AHW A;  3ME8 A;  1TRU A;  2ON7 A;  2OBI A;  2XHF A;  3FK8 A;  3RPN A;  5G2G A;  1TP6 A;  1RK4 A;  2JZS A;  1WRY A;  2CZ2 A;  2YFJ B;  3VI7 A;  4QQ7 A;  1DBY A;  3PYJ A;  2GXF A;  4DSS A;  1GTA A;  1F6M C;  1GMR A;  2BT3 A;  4PQI A;  4XIH A;  3UL3 A;  1G0T A;  5CF2 A;  4HSC X;  4IS0 A;  4STD A;  1YKA A;  3LQ7 A;  5D9T A;  2W9P A;  1H4O A;  1Z7R A;  2MMN A;  2XSH B;  2IMF A;  1WP0 A;  2RFR A;  1RHL A;  4WP5 A;  3UVH A;  8GSS A;  2V6O A;  2P38 A;  3D22 A;  2QGU A;  5DRE A;  4F0B A;  3QD9 A;  3KP9 A;  1SK1 A;  3DGQ A;  1ACV A;  2GSQ A;  3C71 A;  1PN0 A;  3PS8 A;  3LG6 A;  1HD2 A;  3WOD G;  4MNN A;  5IMC A;  5IMD A;  1PKW A;  3X41 A;  1KNG A;  3KP8 A;  1PA3 A;  3H93 A;  1G02 A;  1YQ1 A;  3UBL A;  2KCD A;  1GRX A;  3O8Y A;  4PUF C;  4O5Q A;  2I3Y A;  1O7P B;  5ELA A;  4RNY A;  5CK6 A;  3GKN A;  3BLZ A;  1B48 A;  3E3E A;  3A2V A;  3N8B A;  2QA1 A;  3IOS A;  3KTL A;  3B4O A;  1KC8 4;  1OUN A;  1MDJ A;  1PKZ A;  4CW9 A;  3D21 A;  3UOM A;  5EPF A;  4G2E A;  4ULX A;  4BVX A;  5AIX A;  2CAI A;  3PH9 A;  3MYT A;  4KFD A;  3IHQ A;  4N0Z A;  3RHB A;  2K54 A;  3Q90 A;  3APS A;  2L1S A;  2F3M A;  3F63 A;  4LMV A;  2SAR A;  2R4V A;  4ECI A;  4ZL8 A;  1T4Z A;  1ZYP A;  2V32 A;  3DKS A;  3LTB A;  1PL2 A;  3HJO A;  4KZ1 A;  3GUS A;  1RNB A;  1VQ7 3;  2YJH A;  3A5I A;  2ML5 A;  4K7I A;  3H51 A;  2DJ2 A;  1XIY A;  4HEA 2;  4N3V A;  1SPU A;  1VQP 3;  5JCG A;  4KSM A;  1S3R A;  3ZTL A;  3TKQ A;  4XDW A;  2AAW A;  4V2M A;  2WO0 A;  2GT5 A;  3DML A;  1DVC A;  3LW9 A;  2GSS A;  4R9K A;  5AEW B;  3F0I A;  2OA7 A;  5IMV A;  4L0U A;  4X43 A;  3IK9 A;  3ZZX A;  4N30 A;  4MDC A;  2H1A A;  4FMB A;  3VLN A;  2P0G A;  3TRP A;  1TTZ A;  1LBK A;  2YN1 A;  3DXB A;  5ID2 A;  3G4S 3;  2YJ7 A;  1J2B A;  2XC2 A;  1XWK A;  4K8M A;  2LQV A;  3D79 A;  4I6X A;  3HVS A;  4K1V A;  3JUP A;  6RNT A;  4PGT A;  4FCM A;  1AVL A;  1CQG A;  3CMI A;  2VM1 A;  1OKD A;  3D3L A;  3KJY A;  3TKP A;  3BNE A;  1KQS 2;  4BIR A;  2H74 A;  2CZ3 A;  5H5Q A;  2L5L A;  2VAF A;  3LT8 A;  3KD0 A;  2HMJ B;  1S3A A;  2BMR B;  5F05 A;  4L7K A;  2W6J H;  1FUS A;  2DIY A;  5D9X A;  4EXJ A;  3WA2 X;  2WGR A;  3VK9 A;  2MMZ A;  1K3O A;  3GN3 A;  4H3U A;  3MWZ A;  2RNT A;  1VQK 3;  3HVV A;  2IMD A;  4KH7 A;  4F82 A;  2QGV A;  1AC1 A;  4FR9 A;  9RNT A;  2CWU A;  4LMW A;  2LJR A;  1I70 A;  4L8E A;  1PX6 A;  5AII A;  1XW9 A;  2C80 A;  3CME 3;  2VCZ A;  3ZL5 A;  4Q53 A;  5DVB A;  2JL4 A;  2K3D A;  3JVC A;  1A8Y A;  4POL A;  3X42 A;  2L6C A;  2H0I A;  2KF3 A;  1CYU A;  1UCI A;  1A2L A;  2FCH A;  5KP4 A;  1LOX A;  1BUQ A;  2NTO A;  3A3T A;  1Y4K A;  4EKZ A;  2YFI B;  4R80 A;  4K1F A;  1T1V A;  1YJ6 A;  2WGO A;  2DBC A;  1MD3 A;  4NRE A;  3EHC A;  4IN0 A;  1R4W A;  2VCV A;  4MMM A;  2L4Q A;  5IQY A;  4TRX A;  4LLR A;  3V92 A;  2GSP A;  5DQY A;  1JRQ A;  1EV4 A;  3GZB A;  1XVQ A;  2CAQ A;  2MZC A;  2CFD A;  1QMA A;  2R6K A;  3EB8 A;  3NX0 A;  4IVF A;  4GSS A;  4EO3 A;  3PGT A;  3ZFZ A;  1EWX A;  2CA8 A;  5AEU B;  1QQ2 A;  1UGI A;  2I4A A;  1T8E B;  1ML6 A;  3GX0 A;  1T7P B;  4HBR A;  1Z6N A;  1VZZ A;  4TN8 A;  2GU1 A;  5J3R A;  6GSV A;  3SX1 A;  1T2I A;  2DIZ A;  1W4N A;  1VQ4 3;  1AW9 A;  1GY6 A;  5JCW A;  4IGJ A;  1ZGN A;  1SJI A;  2IIY A;  1R7H A;  2CKF B;  3DGY A;  4TVE A;  5D9V A;  3Q2P A;  3BND A;  2MMA A;  3SYU A;  2JAD A;  1UUG B;  1FO5 A;  3C7M A;  1G96 A;  1GSS A;  4G0K A;  3E9J B;  2H0H A;  1M9G A;  4PTS A;  3TKS C;  1M2D A;  3DVW A;  1IK3 A;  2YV7 A;  1WMN A;  1YDK A;  2CVB A;  2WOH A;  2VCX A;  2F98 A;  4MPG A;  5F8B A;  3OW2 2;  4LA1 A;  3M8C A;  1ASK A;  1R4C A;  2FHE A;  3KKG A;  2A15 A;  1K8A 4;  2L4C A;  2GSR A;  1GNE A;  3B8L A;  1T3B A;  4JE1 A;  4MZB A;  3WGX A;  1GY7 A;  1Q7Y 4;  4LEH A;  3FSD A;  4K5S A;  3QR6 A;  1SL0 B;  4K61 A;  1SQW A;  5JCU A;  2WCI A;  1V40 A;  2GGT A;  1UA5 A;  1X1Y A;  1UC7 A;  5IER A;  1JBS A;  1M0U A;  3U6V A;  2WUL A;  1I9D A;  2LJK A;  3D9R A;  3IXR A;  3LGC A;  1YNV X;  2LST A;  5G5E A;  5J5N A;  2HSH A;  1ULJ B;  3EYT A;  3QAG A;  3DUK A;  1GMQ A;  1EUI C;  4HM8 B;  1RGA A;  1N9J A;  4GXZ A;  4IPB A;  5GAN D;  1XG8 A;  3TOU A;  1RGC A;  2IUK A;  2FWF A;  3Q74 A;  2H1B A;  2H01 A;  2L59 A;  4OFM A;  3LOY A;  1FVK A;  3I6A A;  3CXG A;  5HR3 A;  5EQL A;  1UGH I;  1YZX A;  3O6T A;  2VUP A;  2ZNM A;  2LUS A;  1FB0 A;  4JZQ A;  5D81 A;  4YAP A;  5IO0 A;  5HFK A;  3LEF A;  3VUR A;  1PU4 A;  6GSY A;  2BU4 A;  2MF7 A;  1F37 A;  1UUW B;  5IPH A;  2H1G A;  3IC4 A;  1IYY A;  4ZL7 A;  3ERF A;  3L78 A;  1IQY A;  4G19 A;  4MF6 A;  1YVS A;  1HU9 A;  2OTJ 3;  4J57 E;  1GD3 A;  3JCM L;  5M18 A;  4KDY A;  2H1D A;  2LRN A;  1K0D A;  2CFK A;  3GZR A;  3OWS A;  4MF5 A;  1A2J A;  1IVW A;  1NSW A;  4Z2T A;  1FAA A;  1Z5Y E;  4POM A;  3QAW A;  1D6Y A;  4JBB A;  4MZC A;  1UW1 A;  6GSX A;  1SU9 A;  5IOW A;  2KOK A;  3FZ4 A;  1OH0 A;  3GHA A;  1DET A;  1HNA A;  1TK5 B;  1R26 A;  1I3I A;  1RGG A;  1RSN A;  5BXQ A;  1VQ8 3;  1OVN A;  2FA8 A;  3GFK A;  5KOX A;  3IV4 A;  3DRN A;  2UUG C;  3CD6 3;  2YPM A;  2R0G A;  3CC2 3;  4NV5 A;  3TJK A;  4HKV B;  1TU5 A;  3C1S A;  1BYE A;  4X4J A;  4HZ2 A;  5BMU A;  1SJZ A;  4HZ9 B;  2KLX A;  4J8T A;  1FGM A;  4POB A;  4Q5Q A;  2IUJ A;  3CPW 2;  1ULI B;  4ACS A;  3G71 3;  3DGM A;  2BO9 B;  2O7K A;  1FGQ A;  5EVH A;  3WYW A;  3DXO A;  2XGL A;  3S67 A;  3IPZ A;  3T0U A;  1VGL A;  1GSE A;  1F9M A;  3UAP A;  1BNJ A;  2FGX A;  1O8W A;  3I43 A;  5I97 A;  1ZYE A;  5ECM B;  5D82 A;  2R37 A;  1B2X A;  3VFI A;  1TK8 B;  1QGV A;  5C00 A;  3D5G A;  1XZO A;  4GB5 A;  1RN7 A;  1XWB A;  1JZD A;  3CSH A;  1SYR A;  1TTO A;  3AY8 A;  3SLU A;  3IC8 A;  1U3A A;  4MK3 A;  2Z77 A;  2DJ1 A;  3CSJ A;  4KUN A;  3ROB A;  3KII A;  1SL1 B;  1RTU A;  2CFG A;  2PGT A;  4YQM A;  1TRS A;  4BTY A;  4WBJ A;  1W01 A;  3D5J A;  2ZDJ A;  1I5G A;  4HS1 A;  4KAE A;  4OFT A;  3VWV A;  1AXD A;  5IF6 A;  4MMY B;  4DSS B;  1ZCP A;  4J2F A;  5ECP B;  3BOA A;  2N5B A;  4NAX A;  3BD2 A;  1B8X A;  1XW6 A;  5F07 A;  3BJ5 A;  5KN1 A;  4WBR D;  1VQM 3;  2W2C A;  3EE1 A;  4DKI A;  3LYG A;  1EV9 A;  3UBK A;  5AIG A;  4AEQ A;  3WD6 A;  2XRX B;  1M9A A;  1C7H A;  4OO5 A;  1N8R 4;  2YOI A;  3GIX A;  3SOY A;  3K9M C;  3CCV 3;  1UI8 A;  3O76 A;  4KF9 A;  2YP6 A;  4I2U A;  2KHP A;  4KCE A;  3X3Z A;  2IMJ A;  1RW1 A;  2FWG A;  4JU5 A;  2A4H A;  3F8U A;  1CYV A;  5F0G A;  1BJX A;  2AB6 A;  2J9H A;  3UIW A;  1G7O A;  1BNG A;  3KE7 A;  2OQE A;  2K8S A;  3P2A A;  3GZY B;  2YZU A;  3F6D A;  5FWG A;  3H4K A;  5A4W A;  1K0N A;  4L8P A;  2CV4 A;  1O85 A;  4Z2R A;  4WKW A;  5H5S A;  2DSA A;  2VD1 A;  2OAC A;  4KX4 A;  4BL7 B;  4DSR A;  3WA3 A;  1BG5 A;  4ORL A;  2F51 A;  3LT9 A;  2YV9 A;  3LTA A;  3HII A;  5BU4 A;  4OD7 A;  5CP1 A;  2KF6 A;  2A4V A;  2E2M A;  1H75 A;  1B4Q A;  4KA0 A;  1MDK A;  1NO3 A;  3ZG0 A;  3F6F A;  3MWH A; 
#chains in the Genus database with same CATH homology
 3GL3 A;  4ECB A;  5CYY A;  2HXK A;  1TRV A;  3LSZ A;  4EDY A;  1Q4J A;  2OAD A;  4G0I A;  4YH2 A;  3BBY A;  4QL7 A;  5HR0 A;  3KGK A;  2A2R A;  2QSI A;  2P5Q A;  1GSU A;  2XBQ A;  3M9K A;  2GZP A;  4ZBB A;  3LOR A;  7GSS A;  2CVK A;  4Q5N A;  1NHO A;  2VLU A;  4EUY A;  1GLQ A;  3PIN A;  5CO3 A;  3BCK A;  1THX A;  4RQX A;  3IE3 A;  5D93 A;  3C8E A;  1GLP A;  2JZT A;  4WET A;  1V57 A;  1V58 A;  2O85 A;  2F8A A;  1OKT A;  2LV3 A;  2NDO A;  1CQH A;  3RDW A;  4EL1 A;  2X8G A;  1GUH A;  3MYD A;  3UMA A;  2F8F A;  3G7I A;  1YY7 A;  5AN1 A;  3G9B A;  1X5C A;  3GH9 A;  3H8Q A;  3CRT A;  2C0F A;  2GST A;  4HZ4 A;  5D9W A;  3DIE A;  2WRT A;  1K0C A;  1GSQ A;  4I8B A;  2TIR A;  2WFC A;  2WJU A;  2EIR A;  5INY A;  5DQS A;  4L0W A;  3KTB A;  6GSU A;  1Z6M A;  1NHY A;  1PL1 A;  4DVC A;  1K0M A;  1Z9H A;  2R3X A;  1DE1 A;  1OE8 A;  4IJ3 A;  2OE0 A;  1ABA A;  5GAP D;  1HNB A;  1WIK A;  4AF2 A;  4WEY A;  2ALB A;  2LEG A;  3OR5 A;  1U87 A;  2H6X A;  3I9V 2;  3GUR A;  2RII A;  5DBQ A;  1K3Y A;  1K0A A;  1GUM A;  2TRC P;  1ZOF A;  4KCA A;  2H72 A;  1QUW A;  1B9X C;  2GDR A;  2G2Q A;  3HYP A;  5EL8 A;  5B7C A;  1AIU A;  2GZZ A;  1AQV A;  3F3R A;  3DWV A;  1SK0 A;  3GST A;  1ZYN A;  3HD5 A;  4PUR A;  3RHC A;  2ZUP A;  2HNL A;  4BL7 A;  3EU4 A;  1G6W A;  1XWA A;  3ZYW A;  1JLW A;  5J9C A;  1QFN A;  5IOX A;  2VM2 A;  10GS A;  3CYN A;  1WWJ A;  3ZRD A;  1FB6 A;  1PSQ A;  2YWN A;  4GTU A;  3V1W A;  1TRW A;  2GQL A;  4O32 A;  1EOH A;  1SD9 A;  2H6Y A;  12GS A;  2JSZ A;  5J41 A;  2PMT A;  4ZL9 A;  3W8J A;  6GSW A;  5J4U A;  3ME7 A;  3Q18 A;  4O7H A;  3BCI A;  3ZVJ A;  2BMX A;  4GQC A;  1GTB A;  3HCZ A;  2X8C A;  1YEX A;  3SWL A;  3N5O A;  1EZK A;  2D2Z A;  3UVT A;  3C73 A;  4K2D A;  2JU5 A;  1ERT A;  4FQU A;  3ZIT A;  1THO A;  3VWX A;  2X64 A;  4MA9 A;  2LKU A;  2FWH A;  3IDV A;  1GWC A;  2AUV A;  2GT6 A;  4KDU A;  1RQM A;  4Q5F A;  1WPI A;  3QFB C;  5DCH A;  1GSY A;  4MCU A;  2VLV A;  1UVZ A;  4V2N A;  2L6D A;  1SKW B;  3F4S A;  5IIZ A;  2GTU A;  2A2S A;  2PVO C;  2I81 A;  5B8B A;  2G0F A;  5AIV A;  2HRF A;  3NIV A;  2X99 A;  2VL9 A;  2DJJ A;  1YKC A;  3QMX A;  2ZCT A;  5DJM A;  4TXV A;  2LQO A;  1N8J A;  1XBS A;  1F3B A;  4V1A g;  2GVP A;  2LTK A;  3CTF A;  4RQR A;  1IYH A;  2FY6 A;  4RI6 A;  4BWQ A;  3KH7 A;  2R5G A;  1GTU A;  4K7N A;  5H5R A;  2IY2 A;  2ES7 A;  1FHE A;  3Q19 A;  2M80 A;  3J7Y k;  4D73 B;  4TW5 A;  3FHK A;  1M2A A;  4KDX A;  4XRD A;  2PER A;  2C0E A;  2HRA A;  3FZ5 A;  4ZBA A;  2DML A;  3F9U A;  2L57 A;  2A2P A;  3KM6 A;  2HFD A;  4L5L A;  5HFI A;  5ELG A;  3WGE A;  1X5D A;  2WZ9 A;  1VF3 A;  2MBT A;  5G2Z A;  5ECR B;  2GQM A;  1SK2 A;  2H71 A;  3R2Q A;  1AUC A;  2VCQ A;  3APO A;  3LJR A;  1JHB A;  3FKF A;  1FOH A;  5DAL B;  2KP2 A;  1OYJ A;  4DSQ A;  2HZF A;  2DKI A;  2E7P A;  3WT1 A;  2R0C A;  2F9S A;  3TKS E;  1EOG A;  3UEM A;  3FEU A;  4EDZ A;  1ST9 A;  4MH3 A;  4AJ8 A;  2C8U A;  4IKH A;  2M46 A;  5ECK B;  1GL8 A;  3D0Z A;  1GP1 A;  4MH2 A;  4K6X A;  4F0C A;  4IQA A;  4WR4 A;  2B5X A;  4Z7X A;  2K6V A;  3WT2 A;  3HJP A;  4XS1 A;  1GUL A;  3ZIJ A;  1LU4 A;  1JFU A;  1TJD A;  2DC5 A;  3CRU A;  3P7X A;  3FR6 A;  5D8I A;  3N9J A;  2CT6 A;  2VCW A;  1SYX A;  3NZN A;  2CX3 A;  3FW2 A;  4IEL A;  2MMO A;  2RM5 A;  3L4N A;  3KXO A;  1WJK A;  3GKK A;  3IK7 A;  2B5E A;  1XOB A;  1A2M A;  4YAV A;  4PNG A;  5A5K A;  5JWQ B;  3D4T A;  1OAZ A;  4FO5 A;  3ISO A;  3IAM 2;  1DSB A;  1EEJ A;  4TXO A;  4MPF A;  2YWM A;  3ZFB A;  2R2J A;  2X49 A;  2EIQ A;  2PBJ A;  4KND A;  3L9V A;  1XFL A;  4D73 A;  1TU7 A;  4KSO A;  4N10 A;  2YNX A;  4MZW A;  1XWC A;  3KEB A;  2CVD A;  1OC8 A;  2VD0 A;  5GST A;  4AJ6 A;  4JRR A;  1TDI A;  3CTG A;  3GA4 A;  1C72 A;  2IMK A;  3QOU A;  4HU9 A;  3HXS A;  1SKS B;  4Q5R A;  4EIP A;  3ERG A;  4HDE A;  3FMW A;  2OBK A;  2AV4 A;  4FYC A;  2DJK A;  5ECI B;  1PX7 A;  4GF0 A;  1OE7 A;  4XS4 B;  2EIO A;  5DAL A;  4WF4 A;  4NXI A;  4ZB8 A;  5G1L A;  22GS A;  2KP1 A;  4AJ7 A;  1U3I A;  3H1N A;  3H79 A;  4OCE A;  4XS6 A;  2P31 A;  5G1K A;  2IFQ B;  2HI7 A;  4ECJ A;  1TOF A;  4PUA A;  2H6Z A;  2AHE A;  4I5Q A;  4MP4 A;  3TRX A;  3QDN A;  2JSY A;  4XHM A;  5ECN B;  2OE3 A;  4E8E A;  5AGY A;  3EIN A;  2B1L A;  2Z9S A;  5ECS A;  1E6B A;  2AYT A;  4X1U A;  5CRH A;  1PD2 1;  4MAB A;  1USB A;  4CY6 A;  2LNT A;  4G9H A;  4K9Z A;  4XCS A;  4PXO A;  1W4V A;  1EP7 A;  2NVL A;  1A23 A;  2X8H A;  5KOW A;  2E0Q A;  5G5F A;  3GNJ A;  3VPQ A;  4K5R A;  3KMN A;  4TR3 A;  5F06 A;  1TKD B;  4O92 A;  3TCO A;  3MAK A;  4NHZ A;  3ZIV A;  3US3 A;  1JZR A;  5CRD A;  3HDC A;  2X4A A;  1OC9 B;  3GH6 A;  1JZW A;  5C04 A;  2IYJ A;  4MJA A;  3EU3 A;  1A0F A;  4GSN A;  3IBH A;  4KW6 A;  5GSS A;  3QAV A;  5G30 A;  3TGZ A;  5DDL A;  2VL2 C;  3IRA A;  3A5W A;  3HHV A;  3RBT A;  5ABR A;  2XPE A;  4MJC A;  2AJQ B;  2C3Q A;  4BVY A;  5LNK e;  3CSI A;  3M9J A;  1FOV A;  1B4P A;  5IMF A;  9GSS A;  4HU7 A;  1Z7P A;  1G6Y A;  2HSY A;  2HRN A;  2K8V A;  3GKX A;  3P90 A;  2H8L A;  4X0X A;  4ISD A;  2LS5 A;  3F3Q A;  3EC3 A;  1X9W B;  2IJY A;  5IPG A;  1M7T A;  1DUG A;  4XS4 A;  2C4J A;  1S3C A;  2NPB A;  3I69 A;  3HKR A;  1G7E A;  1K0B A;  2HSM A;  4IP1 A;  4ZB6 A;  1URM A;  5AIS A;  2FWE A;  4KB3 A;  2MBS A;  2B1K A;  1ZMA A;  2HRK A;  2O87 A;  2H73 A;  2IFQ A;  4GLT A;  4NWY A;  3IAS 2;  3VPT A;  5ECO B;  3KIJ A;  2IL3 A;  3GTU B;  4AGS A;  1EEM A;  1J0F A;  4MF7 A;  3F4T A;  3TJJ A;  1T00 A;  1GTI A;  1T4Y A;  2QC7 A;  4PX1 A;  6GST A;  5JWO B;  1U88 A;  1YF1 A;  2K18 A;  5B6M A;  3TJF A;  3DVX A;  1EP8 A;  5KN0 A;  3D6I A;  5G31 A;  3L9S A;  5J9B A;  3LXT A;  1ZZY A;  1O81 A;  2RLI A;  2H75 A;  1V98 A;  4J56 E;  14GS A;  1FVJ A;  2VIM A;  4F03 A;  4MJE A;  2FNO A;  4RI7 A;  2B3S A;  5GZZ B;  4ZB9 A;  4O5R A;  2HT9 A;  1OC9 A;  2BTO T;  3EUR A;  3TJB A;  1O7U A;  13GS A;  1K3L A;  1GUK A;  1SJ6 A;  2C3T A;  3C1R A;  4OWY A;  3O3T A;  5DJL A;  4USS A;  4A5P A;  5CRE A;  3QCP A;  4HQZ A;  2LNS A;  4ID0 A;  2LRT A;  4ILF A;  3QFA C;  3KZQ A;  1M9B A;  3J7Y b;  1F2E A;  2DJ0 A;  4G10 A;  3PPU A;  4IBP A;  2KUC A;  5ECQ B;  2N5F A;  17GS A;  1X9S B;  5CRW A;  3ZML A;  3KMO A;  3WGD A;  4MLY A;  5L71 A;  4PQH A;  4PQ1 A;  3A2X A;  3ZRE A;  6GSS A;  4KGI A;  3VI5 A;  1ILO A;  1MTC A;  3LXZ A;  3FR9 A;  1GSD A;  1XVW A;  4ZIJ A;  3FZA A;  4JR4 A;  3P8W A;  4IW9 A;  4HUA A;  1PQN A;  4ZBD A;  4YKF A;  3GRX A;  3RPP A;  2DKH A;  3HZ8 A;  2QA2 A;  1TK0 B;  2ON5 A;  3GYK A;  2I9H A;  2H70 A;  4P3Y B;  3MDK A;  5EVO A;  2B6M A;  1NM3 A;  1QXH A;  2PPT A;  3VWU A;  2YWO A;  1AAZ A;  2B7J A;  2RM6 A;  2V2G A;  4EIQ A;  1A8L A;  1SKR B;  4HQS A;  3DEX A;  2HYX A;  4IQ1 A;  3W8S A;  2FA4 A;  1A0R P;  1XOA A;  4HI7 A;  3DYR A;  3FR3 A;  1TXX A;  2OE1 A;  1Y6E A;  3GTU A;  1DE2 A;  2IMI A;  1LJR A;  1TI3 A;  3FZ9 A;  2H30 A;  2XBI A;  2TRX A;  4ML6 A;  2WDU A;  1AQX A;  1WOU A;  4OMV A;  1M2B A;  1WMJ A;  1BED A;  4GQF A;  1HYU A;  5A4U A;  2C1Y A;  4OO4 A;  3LFL A;  2H66 A;  1EGO A;  3DD3 A;  4LL1 B;  5ECH B;  4XTS A;  3MNG A;  4HJ2 A;  2BJX A;  4TXO B;  1MD4 A;  4NHW A;  2HZE B;  2IPA A;  1TW9 A;  1TU8 A;  5CNW A;  1MDI A;  5DAK B;  4POK A;  1JZO A;  1N2A A;  3CBU A;  4F9Z A;  1ON4 A;  3ZMK A;  3EMX A;  4BPY A;  1FW1 A;  4XRA A;  3TJG A;  1PMT A;  4CY8 A;  2FLS A;  4JED A;  4TR1 B;  1QK8 A;  3ERW A;  5HR1 A;  2LRC A;  1KTE A;  2B5Y A;  1R5A A;  2O8V B;  2JAC A;  2XPD A;  5FT3 A;  2YZH A;  1O8X A;  2DJ3 A;  1FG4 A;  4TKY A;  2R0P A;  2J23 A;  2H19 A;  4EVM A;  4BA7 A;  2CQ9 A;  4HOJ A;  3FRC A;  3HY2 A;  2DLX A;  2NBS A;  2E2G A;  4GCI A;  2PUK C;  3LYK A;  4FH8 A;  3HZ4 A;  5ENU A;  3M8N A;  4JR6 A;  4TOP A;  4GWR A;  5KEJ A;  3MSZ A;  2P5R A;  1SL2 B;  3R3E A;  5CAX A;  1BQ7 A;  3GX8 A;  1PN9 A;  4F2I A;  1K0O A;  1GH2 A;  4OCF A;  5KN3 A;  11GS A;  1E2Y A;  3RAZ A;  1ZYQ B;  3NOF A;  1VRS D;  3S9F A;  3TDG A;  3EWL A;  4RUV A;  1XCC A;  1GSF A;  3PR8 A;  2WS2 A;  1VF1 A;  1XPV A;  1TI1 A;  4K2X A;  2YWI A;  2MYG A;  2UZ8 A;  4WXT A;  1TP9 A;  4OFN A;  3SBC A;  1V2A A;  1ZL9 A;  3VWW A;  4GST A;  3M3M A;  18GS A;  3TOT A;  4YQV A;  4L5O A;  2C0G A;  2WB9 A;  1SEN A;  2V1M A;  5LCZ A;  3UJ1 A;  2I1U A;  2B7K A;  5E4W A;  4DEJ A;  2HE3 A;  4V2L A;  1WE0 A;  4LL4 B;  4I2T A;  3APQ A;  2HZE A;  3TKS A;  1Q98 A;  4YKG A;  4HJM A;  5DAK A;  3U5R E;  2V6K A;  3FY7 A;  3L9U A;  4BVY B;  4FYU A;  3UAR A;  1KBN A;  2GQK A;  2K9F A;  3EE2 A;  1W89 A;  1PGT A;  1UN2 A;  1PRX A;  4BWS A;  3ZVJ D;  4I97 A;  2GLR A;  2IN3 A;  1MEK A;  2EC4 A;  2IWT A;  4TR1 A;  4YQU A;  1Z3E A;  5HR2 A;  2REM A;  4CHS A;  5LD0 A;  5FHI A;  3EPT A;  4NV2 A;  4FYB A;  2IME A;  1IYI A;  3IHG A;  4EC0 A;  1X5E A;  16GS A;  1Y25 A;  2HLS A;  19GS A;  4G0L A;  4ICY A;  4IHU A;  4NMU A;  3TB2 A;  3TRQ A;  1X9M B;  2FD3 A;  5BRT A;  3K8N A;  1HNC A;  3M0F A;  5HFG A;  4NPB A;  3ZLP A;  3M1G A;  2VOC A;  1O6J A;  3TUE A;  1OC3 A;  2LQQ A;  4IJI A;  1ERV A;  1NW2 A;  4O5U A;  2DMM A;  5IMZ A;  4TR4 A;  5IO2 A;  3MIX A;  3EMP A;  1J08 A;  1VF2 A;  2PU9 C;  1ERW A;  5ECL B;  5EY6 A;  4GRF A;  3E0U A;  3HA9 A;  4WF5 A;  3FYG A;  1HQO A;  3HVX A;  4K0G A;  1GNW A;  2L5O A;  4N0V A;  2VCT A;  5KN2 A;  3ZFL A;  2QKE A;  3L0H A;  4ECC A;  1V9W A;  1U6T A;  2CX4 A;  1JLV A;  4PNF A;  4ZXG A;  2PWJ A;  3QPM A;  5E59 A;  1F3A A;  1O73 A;  4H86 A;  3GL5 A;  2V41 A;  1YEP A;  1X0R A;  2LJA A;  1XWG A;  1J9B A;  1XXU A;  2N5A A;  2YAN A;  4V1A p;  4E8H A;  5IMA A;  1EGR A;  3Q6O A;  3LYP A;  5CRG A;  5JWR B;  3EVI A;  5A4V A;  1S3D A;  3KH9 A;  1XW5 A;  4TR0 A;  1SD8 A;  2RUE A;  4N11 A;  2YCD A;  3A2W A;  2GS3 A;  4MJB A;  3ED3 A;  2H76 A;  2H0G A;  3IA1 A;  4ML1 A;  3GKM A;  3LWA A;  1M99 A;  3IR4 A;  2PN8 A;  4BVX B;  3GV1 A;  3KCM A;  3HJM A;  3D4M A;  2OKA A;  5D73 A;  2O89 A;  1B9Y C;  1VF4 A;  1YF0 A;  3F4R A;  3TKR A;  1ERU A;  4WR5 A;  5IM9 A;  5B6N A;  1BAY A;  1KEB A;  4CDO A;  20GS A;  4IP6 A;  1A24 A;  4FIW A;  3GMF A;  2C0D A;  4QL9 A;  5COH A;  1AQW A;  1QMV A;  2GZY A;  5HQP A;  2FUG 2;  3W6G A;  2RUF A;  4Z2U A;  3G7Y A;  5B8A A;  4EF0 A;  1R5P A;  2C3N A;  4KE3 A;  5ID2 B;  5DCG A;  2VL2 A;  2M72 A;  2JZR A;  3G7J A;  2VL3 A;  2PVQ A;  1BX9 A;  2VLT A;  2OJL A;  2VO4 A;  4ZIL A;  4K7O A;  5D96 A;  4EE0 A;  3GSS A;  4K0N A;  3ME8 A;  1TRU A;  2ON7 A;  2OBI A;  2XHF A;  3FK8 A;  3RPN A;  1RK4 A;  2JZS A;  1WRY A;  2CZ2 A;  3VI7 A;  4QQ7 A;  1DBY A;  4DSS A;  1GTA A;  1F6M C;  4PQI A;  4XIH A;  3UL3 A;  1G0T A;  4IS0 A;  1YKA A;  3LQ7 A;  5D9T A;  1H4O A;  1Z7R A;  2MMN A;  2IMF A;  1WP0 A;  3UVH A;  8GSS A;  2V6O A;  3D22 A;  4F0B A;  3QD9 A;  3KP9 A;  1SK1 A;  3DGQ A;  1ACV A;  2GSQ A;  3C71 A;  1PN0 A;  3LG6 A;  1HD2 A;  4MNN A;  5IMC A;  5IMD A;  1PKW A;  1KNG A;  3KP8 A;  1PA3 A;  3H93 A;  3UBL A;  1YQ1 A;  1GRX A;  4PUF C;  4O5Q A;  2I3Y A;  5ELA A;  3GKN A;  1B48 A;  3E3E A;  3A2V A;  2QA1 A;  3IOS A;  3KTL A;  1MDJ A;  1PKZ A;  4CW9 A;  3D21 A;  3UOM A;  5EPF A;  4G2E A;  4ULX A;  4BVX A;  5AIX A;  2CAI A;  3PH9 A;  3IHQ A;  4N0Z A;  3RHB A;  3APS A;  4LMV A;  2F3M A;  3F63 A;  2R4V A;  4ECI A;  4ZL8 A;  1T4Z A;  1ZYP A;  2V32 A;  3DKS A;  1PL2 A;  3HJO A;  3GUS A;  2YJH A;  3A5I A;  4K7I A;  2DJ2 A;  1XIY A;  4HEA 2;  5JCG A;  4KSM A;  3ZTL A;  3TKQ A;  2AAW A;  4V2M A;  2GT5 A;  3DML A;  3LW9 A;  2GSS A;  3F0I A;  2OA7 A;  5IMV A;  4L0U A;  4X43 A;  3IK9 A;  3ZZX A;  4N30 A;  4MDC A;  2H1A A;  3VLN A;  2P0G A;  3TRP A;  1TTZ A;  1LBK A;  2YN1 A;  3DXB A;  5ID2 A;  2YJ7 A;  2XC2 A;  1XWK A;  4K8M A;  4I6X A;  3HVS A;  4PGT A;  1CQG A;  3CMI A;  2VM1 A;  1OKD A;  3KJY A;  3TKP A;  5H5Q A;  2H74 A;  2CZ3 A;  2L5L A;  2VAF A;  3KD0 A;  1S3A A;  5F05 A;  2DIY A;  5D9X A;  4EXJ A;  2WGR A;  3VK9 A;  2MMZ A;  1K3O A;  3GN3 A;  3HVV A;  2IMD A;  4KH7 A;  4F82 A;  2QGV A;  1AC1 A;  4LMW A;  2LJR A;  4L8E A;  1PX6 A;  2C80 A;  1XW9 A;  2VCZ A;  3ZL5 A;  5DVB A;  2JL4 A;  1A8Y A;  4POL A;  2L6C A;  2H0I A;  1A2L A;  2FCH A;  2NTO A;  3A3T A;  4EKZ A;  4K1F A;  1T1V A;  1YJ6 A;  2DBC A;  1MD3 A;  4IN0 A;  1R4W A;  2VCV A;  4MMM A;  2L4Q A;  5IQY A;  4TRX A;  4LLR A;  5DQY A;  1EV4 A;  1XVQ A;  2CAQ A;  2MZC A;  2R6K A;  4IVF A;  4GSS A;  4EO3 A;  3PGT A;  1EWX A;  2CA8 A;  1QQ2 A;  2I4A A;  1T8E B;  1ML6 A;  3GX0 A;  1T7P B;  1Z6N A;  4TN8 A;  5J3R A;  6GSV A;  2DIZ A;  1AW9 A;  5JCW A;  4IGJ A;  1ZGN A;  1SJI A;  2IIY A;  1R7H A;  4TVE A;  5D9V A;  2MMA A;  2JAD A;  1FO5 A;  3C7M A;  1GSS A;  4G0K A;  3E9J B;  2H0H A;  4PTS A;  3TKS C;  1M2D A;  3DVW A;  2YV7 A;  1YDK A;  2CVB A;  2VCX A;  4MPG A;  5F8B A;  4LA1 A;  2FHE A;  2L4C A;  2GSR A;  1GNE A;  1T3B A;  4JE1 A;  4MZB A;  3WGX A;  4K5S A;  3QR6 A;  1SL0 B;  5JCU A;  2WCI A;  1V40 A;  2GGT A;  1UA5 A;  1UC7 A;  1M0U A;  3U6V A;  2WUL A;  1I9D A;  2LJK A;  3IXR A;  3LGC A;  2LST A;  5G5E A;  5J5N A;  2HSH A;  3EYT A;  3QAG A;  4GXZ A;  5GAN D;  3TOU A;  2FWF A;  3Q74 A;  2H1B A;  2H01 A;  2L59 A;  4OFM A;  1FVK A;  3I6A A;  3CXG A;  5HR3 A;  3O6T A;  1YZX A;  2VUP A;  2ZNM A;  2LUS A;  1FB0 A;  4JZQ A;  4YAP A;  5IO0 A;  5HFK A;  3LEF A;  3VUR A;  6GSY A;  1F37 A;  5IPH A;  2H1G A;  3IC4 A;  4ZL7 A;  3ERF A;  3L78 A;  4G19 A;  4MF6 A;  4J57 E;  3JCM L;  4KDY A;  2H1D A;  2LRN A;  1K0D A;  4MF5 A;  1A2J A;  1NSW A;  4Z2T A;  1FAA A;  1Z5Y E;  4POM A;  3QAW A;  4JBB A;  4MZC A;  6GSX A;  1SU9 A;  5IOW A;  2KOK A;  3FZ4 A;  3GHA A;  1HNA A;  1TK5 B;  1R26 A;  1OVN A;  2FA8 A;  5KOX A;  3GFK A;  3IV4 A;  3DRN A;  2YPM A;  2R0G A;  4NV5 A;  3TJK A;  3C1S A;  1BYE A;  4X4J A;  4HZ2 A;  5BMU A;  1SJZ A;  2KLX A;  4POB A;  4Q5Q A;  4ACS A;  2O7K A;  3WYW A;  3IPZ A;  1VGL A;  1GSE A;  1F9M A;  3UAP A;  2FGX A;  1O8W A;  3I43 A;  1ZYE A;  5ECM B;  2R37 A;  3VFI A;  1TK8 B;  1QGV A;  5C00 A;  1XZO A;  1XWB A;  1JZD A;  3CSH A;  1SYR A;  3AY8 A;  3IC8 A;  1U3A A;  4MK3 A;  2DJ1 A;  3CSJ A;  4KUN A;  1SL1 B;  2PGT A;  4YQM A;  1TRS A;  4WBJ A;  3D5J A;  1I5G A;  4HS1 A;  4KAE A;  4OFT A;  3VWV A;  1AXD A;  4DSS B;  1ZCP A;  4J2F A;  5ECP B;  3BOA A;  2N5B A;  4NAX A;  3BD2 A;  1B8X A;  1XW6 A;  5F07 A;  3BJ5 A;  5KN1 A;  4WBR D;  1EV9 A;  3UBK A;  3WD6 A;  1M9A A;  4OO5 A;  2YOI A;  3GIX A;  3O76 A;  4KF9 A;  2YP6 A;  4I2U A;  2KHP A;  4KCE A;  1RW1 A;  2FWG A;  4JU5 A;  2A4H A;  3F8U A;  5F0G A;  1BJX A;  2AB6 A;  2J9H A;  3UIW A;  1G7O A;  2K8S A;  3P2A A;  2YZU A;  3F6D A;  5FWG A;  3H4K A;  5A4W A;  1K0N A;  2CV4 A;  4Z2R A;  1O85 A;  4WKW A;  5H5S A;  2DSA A;  2VD1 A;  2OAC A;  4KX4 A;  4BL7 B;  4DSR A;  1BG5 A;  2F51 A;  2YV9 A;  4OD7 A;  5CP1 A;  2A4V A;  2E2M A;  1H75 A;  1B4Q A;  4KA0 A;  1MDK A;  3F6F A;  3MWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...