1T3BA

X-ray structure of dsbc from haemophilus influenzae
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
209
structure length
209
Chain Sequence
b'DAAIKRKLQSFNISNIVIKSSPISGIKTAVTDQGILYVSEDGKYLFEGKLYELTNNGPVDVAGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDITCHYCHLLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTAKDPVFALNEAEKGNLPKEVKTPNIVKKHYELGIQFGVRGTPSIVTSTGELIGGYLKPADLLRALEETA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbC
publication title Structure of DsbC from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Isomerase
total genus 53
structure length 209
sequence length 209
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2004-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1t3bA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1t3bA02
2F8AA 3ZVJD 1OE7A 3GURA 3D4TA 3TB2A 10GSA 5D9WA 2FHEA 2GQMA 2K8SA 2B7JA 2F8FA 4MF7A 4AJ8A 1EGOA 5D9XA 1C72A 3L9VA 4AJ7A 1F6MC 4F82A 1A2MA 2YPMA 3UIWA 5D93A 3WT1A 2OA7A 1TXXA 2E7PA 1JZOA 4OWYA 1NM3A 3CSIA 1JHBA 4GXZA 5IMFA 1V58A 3FR6A 3L78A 2L57A 2YV9A 3TRQA 2V32A 1PA3A 5DCHA 2C0DA 3VWUA 2IMIA 3KH7A 2M72A 1AXDA 5HFIA 3ZYWA 1V2AA 2MYGA 3D21A 3DEXA 1G0TA 2FD3A 3KZQA 4KA0A 2CZ3A 2CAIA 2HZFA 2K8VA 2YANA 5ABRA 4JBBA 1AQVA 1Z6MA 1OAZA 4JE1A 2N5BA 3UARA 3TJJA 2H71A 2GGTA 3D6IA 2FY6A 1ZOFA 3JCML 1AUCA 4L0WA 3GA4A 2CAQA 3HA9A 4J56E 4XTSA 1K0NA 4IELA 2BJXA 2DIYA 1AC1A 1ZMAA 3O3TA 5F07A 3RPPA 3GKMA 3H79A 4EVMA 2PPTA 3VI7A 4EKZA 2P5RA 4BL7A 4GQCA 2NVLA 4K7IA 4HJ2A 4MP4A 2CT6A 1H4OA 2REMA 2J23A 4D73A 1V9WA 2GT5A 4IQ1A 1TI3A 3VURA 1HD2A 4TN8A 2VM2A 2GZPA 1BG5A 1E2YA 2KUCA 1WJKA 2YP6A 3GKNA 3ZIVA 2G0FA 2VD1A 5KN1A 2VL2A 2YZUA 4GSNA 3VWVA 2VOCA 1SKWB 1AW9A 5AISA 1AAZA 3Q6OA 1I5GA 3EMPA 2H73A 5G5FA 3KMNA 3TKRA 4XS4B 2HRNA 2WDUA 5EY6A 3Q19A 4JZQA 2B5YA 1GRXA 3L4NA 5JCGA 4IKHA 3TRPA 1Z5YE 1CQHA 2XBIA 3KTBA 2YWIA 2O85A 2I3YA 3APOA 2YWMA 1R5AA 3KD0A 2VL2C 4Q5QA 5ELGA 3ZREA 4TVEA 3ERGA 2VCZA 1X9SB 1XWKA 3DVXA 5ECQB 4PQIA 2VIMA 2YWNA 3FY7A 2XHFA 1A2LA 3KP8A 3ISOA 1YZXA 1HNBA 4J2FA 2H19A 5KN2A 4PNGA 3ZTLA 4TOPA 4PQHA 5J5NA 2R2JA 1HYUA 2RUFA 5IMAA 4Q5RA 3BOAA 2F3MA 4KB3A 2B7KA 2WS2A 2FWGA 4ZBBA 4GTUA 3VLNA 1XWGA 4N10A 3ZFLA 4J57E 1UN2A 5C04A 3P90A 2H6XA 5D73A 2LRNA 4BVYA 4NXIA 1GH2A 3DVWA 4PQ1A 1LU4A 2EC4A 2H72A 2H74A 1Q4JA 2L5OA 1B9YC 1SKRB 12GSA 1FOVA 5D9TA 1TRUA 3QD9A 4HI7A 1SL2B 3QMXA 4F9ZA 4XRDA 4EXJA 1TK0B 1M7TA 4MH2A 1R5PA 4GLTA 4POMA 3BCKA 4HJMA 4ULXA 4K0GA 1QK8A 1WWJA 1A2JA 3KEBA 3LGCA 1KNGA 4ML6A 5IPHA 1A0RP 22GSA 3DIEA 2VCQA 5ECKB 1XVQA 2E0QA 1V40A 4QL7A 4IW9A 3ZLPA 1X9MB 2XPEA 1PKZA 4XCSA 1MTCA 3MNGA 4TW5A 6GSVA 1K3LA 5ID2B 5CO3A 3TCOA 2GZYA 1G6WA 2YZHA 2YJHA 4OCFA 4LA1A 4O92A 3QOUA 5IMCA 5LD0A 4MZWA 4GQFA 4MF6A 3BJ5A 1GUMA 1JLVA 2P5QA 5AN1A 2WCIA 3CSHA 1SU9A 1YY7A 1IYHA 3EWLA 2DJKA 3GSSA 3HY2A 1NW2A 4AJ6A 5C00A 2JACA 2V6OA 2C4JA 4BWQA 2LRTA 4NPBA 1OYJA 1X9WB 1G7OA 5A4VA 3P7XA 3DMLA 3CRTA 3FZ5A 1J0FA 1QMVA 3KMOA 3F3RA 4JRRA 4L8EA 4WXTA 1GTAA 1SKSB 2LS5A 4MA9A 2R4VA 3WGDA 3A3TA 2L6CA 2FWHA 3LFLA 4KE3A 1HNCA 3NOFA 4XS4A 2FCHA 1A0FA 4JEDA 4OO5A 2FGXA 4E8EA 1F3AA 1M2DA 1ON4A 2LKUA 5IMDA 2IPAA 5ECOB 2HSYA 1TOFA 1Q98A 4KW6A 4H86A 2L59A 1EEJA 1X5EA 2RIIA 4WF5A 4KGIA 3FZ4A 2GSTA 2H0GA 2CX4A 2NTOA 3QDNA 3D5JA 3FK8A 3TJGA 3UL3A 4KDUA 5L71A 1T3BA 2IY2A 2H6ZA 2DMLA 4LLRA 2XC2A 3I9V2 4V1Ag 4FYUA 1Z9HA 2TIRA 3VPQA 1N2AA 2KLXA 4G9HA 4IP6A 3U5RE 4KNDA 2AHEA 6GSTA 4IGJA 5ECLB 1GSEA 4I8BA 5DVBA 1GSQA 2ON7A 3KM6A 4KDYA 2VCWA 2IIYA 4L5OA 4YAVA 4N11A 3FEUA 1SK1A 1U6TA 1TDIA 2PMTA 3ZMLA 5LCZA 2DJ1A 3BCIA 4TR1A 2HSHA 4NV2A 3PR8A 3ME7A 4OFMA 2F51A 2IFQB 2C1YA 5CRWA 1QFNA 4NAXA 4V2NA 1TRWA 4BPYA 4LL4B 3LYKA 2HYXA 4EDYA 4FYCA 4PGTA 1JFUA 3Q18A 3LSZA 4L5LA 2WFCA 2H01A 3SWLA 4HEA2 1SJIA 1G6YA 5JWQB 1OE8A 4KCEA 3HD5A 3HJOA 5CRGA 2LNSA 3IPZA 1K0BA 1R26A 4TXVA 4HUAA 1SYRA 5B7CA 3RBTA 3GL3A 4ECJA 2ZNMA 5G5EA 3S9FA 3GTUA 4ECBA 4JR4A 5G2ZA 4PNFA 1IYIA 1XWBA 2PUKC 3FHKA 4K7OA 3FRCA 2H76A 3QAGA 5HFGA 3IE3A 3ZRDA 1YKCA 1NHOA 3RAZA 3UVTA 4BVXA 4NHZA 4LMVA 1MDKA 5ELAA 1TK8B 4AF2A 6GSUA 1TTZA 1RQMA 1MDJA 5E4WA 3D0ZA 3KH9A 5ID2A 2O89A 5F05A 1FAAA 4HDEA 8GSSA 2JZRA 2GDRA 1PRXA 4EL1A 3QFAC 2X8HA 5D9VA 4YQVA 2GLRA 2P0GA 4O32A 3TOTA 2HE3A 2DJ2A 4X43A 1GTBA 1JZRA 4IN0A 4POKA 4GRFA 1PQNA 1USBA 1WP0A 2EIRA 5ECMB 1TU8A 5D8IA 5IQYA 1MD3A 4OFTA 1OC9A 2JU5A 2MBTA 1ZYQB 3APSA 1V57A 4WR4A 4ZB8A 1SD8A 1PSQA 5B6MA 5AGYA 1LBKA 1JLWA 3FW2A 2H70A 2QGVA 3HJMA 1UA5A 1ERTA 3WT2A 3AY8A 3CTFA 3HKRA 2GTUA 3GKXA 2C3NA 1GNWA 2N5FA 2C0FA 4KH7A 4BA7A 2LEGA 1YF0A 2FUG2 3CTGA 4FIWA 3E9JB 2MMNA 3C8EA 5KN3A 5CRDA 1BYEA 2I4AA 5ECIB 2DJJA 2XPDA 4XRAA 3GH9A 1N8JA 2AJQB 9GSSA 5E59A 3EINA 4RUVA 4MMMA 3DYRA 2H0HA 1EP7A 2H6YA 4YAPA 2R3XA 2RUEA 4MZCA 2WRTA 4O7HA 5J9BA 1VGLA 2PERA 4HZ2A 2TRXA 3HHVA 3D22A 1BQ7A 3C73A 3RHCA 4NV5A 3WD6A 4CHSA 4WBRD 4HQSA 4I6XA 1KTEA 1EZKA 3M8NA 3GH6A 1XPVA 3IK9A 4K7NA 2KP1A 1O8XA 4HU9A 2H75A 3F4TA 2BTOT 2VL3A 4N0VA 3PH9A 4IJIA 3F9UA 3GX8A 4KAEA 3N5OA 2CA8A 5DJMA 1O81A 1QUWA 1ERVA 3SBCA 1YEXA 1K3OA 2CV4A 3W8JA 3C1RA 4EDZA 1HNAA 2YN1A 3WGEA 1S3DA 1YKAA 5F06A 2N5AA 2JL4A 5B6NA 2EIOA 4DEJA 3GFKA 1XWAA 3HZ8A 3F8UA 3PGTA 3IC4A 4POBA 1B4PA 5IOWA 4I2TA 2CVKA 2PN8A 4JU5A 4G2EA 2OBKA 1VF2A 1THOA 5DAKB 2HZEB 3CXGA 1FG4A 2V2GA 4V1Ap 3TOUA 2K9FA 5DQSA 4MPGA 4WBJA 16GSA 1K0CA 3GX0A 4Q5FA 4ISDA 4TXOB 1CQGA 4MLYA 4I5QA 1BAYA 5D96A 1X5DA 1QGVA 2L4CA 5JWRB 1TP9A 3MAKA 2ES7A 2OE3A 4WEYA 5G31A 4OCEA 1OC8A 1GSFA 4EUYA 2JSZA 4OO4A 1ZL9A 4IP1A 1TK5B 5DBQA 3DRNA 3TJFA 2MMAA 1M9AA 2V41A 5IMVA 2A2RA 3KTLA 2AUVA 1XZOA 5A5KA 1YDKA 4ACSA 2IL3A 3CSJA 2OKAA 5EPFA 3HVSA 2PU9C 2R5GA 3IK7A 5DALB 4KSMA 1Z6NA 3UVHA 3Q74A 6GSXA 5LNKe 2GSSA 2C0EA 5J4UA 4POLA 2Z9SA 3QPMA 3GMFA 1SYXA 4L0UA 5AIXA 2QSIA 1ACVA 5H5RA 2B5XA 3IV4A 4ID0A 4EF0A 3CMIA 2O7KA 1HQOA 1YQ1A 4DVCA 1K0DA 2YJ7A 3ZFBA 4XS6A 3H4KA 4ZL7A 3I43A 3J7Yb 1UC7A 1A8YA 18GSA 1O8WA 5GSSA 1G7EA 2VAFA 4XS1A 1A24A 2HLSA 2VCTA 4DSSB 3M9KA 2LTKA 2J9HA 3P8WA 4XHMA 5J41A 1VF4A 4PX1A 1WOUA 5H5SA 1TU7A 2H0IA 2C0GA 3LXTA 1SJ6A 3QR6A 5HR3A 3DGQA 3IR4A 4KSOA 5ECSA 5GAND 1Z7PA 3BBYA 3TKSA 2IMEA 2R6KA 3GKKA 3ZMKA 3IDVA 1GWCA 5G1LA 4DSRA 2O8VB 1FVKA 3TUEA 3TDGA 3EVIA 3F0IA 3ERWA 1H75A 4O5RA 1BEDA 3GN3A 4RQRA 3DKSA 3QAVA 1NHYA 2IN3A 2YCDA 1O7UA 1XXUA 4QQ7A 6GSYA 3TKSC 1QXHA 3IAM2 2YNXA 4ECIA 1SENA 2LQQA 1M0UA 1R4WA 5G1KA 3LXZA 4MJAA 4K1FA 3E0UA 3LQ7A 2D2ZA 1TJDA 4ZB6A 3IXRA 4OD7A 4E8HA 5HR2A 4G19A 4RI6A 2WULA 3KIJA 1SL1B 2M80A 4X1UA 1GLQA 3MDKA 2HNLA 2AB6A 1SL0B 5ECRB 2LQOA 2RLIA 1GTUA 5IMZA 4ZB9A 2VCVA 1GSDA 3O6TA 1S3AA 3GHAA 2HFDA 2X99A 4GSSA 3HXSA 2H1GA 3HDCA 4D73B 2MBSA 1ST9A 2GVPA 1TRVA 2LJKA 2L5LA 4HU7A 3H8QA 4OMVA 4K9ZA 5DAKA 3M9JA 5GZZB 4QL9A 2EIQA 5B8AA 1DUGA 3MWHA 3O76A 5A4UA 1FVJA 2IMKA 1SK2A 1B4QA 1URMA 4ZBDA 1VRSD 1EGRA 2WB9A 5ECPB 5A4WA 5HR1A 1BX9A 1TRSA 17GSA 2GQKA 3G7JA 6GSWA 2CVDA 1GP1A 3U6VA 7GSSA 4ZIJA 2B5EA 1F2EA 3APQA 4FO5A 5DDLA 2G2QA 2H1BA 1AQWA 2NDOA 3F6DA 5IO0A 3E3EA 1SK0A 1SJZA 2KP2A 3FZ9A 2NBSA 3W6GA 2PBJA 3ZZXA 1PMTA 2GSQA 3IRAA 4GSTA 3W8SA 1PL2A 1PKWA 2L4QA 4MJEA 3VFIA 5DALA 1XBSA 5G30A 1R7HA 4MABA 5KEJA 1Y6EA 3A2XA 1UVZA 1GSYA 3IA1A 1B8XA 2FA4A 4ZXGA 2JZTA 2LJAA 3L9SA 1S3CA 4Q5NA 3LG6A 1WPIA 3GL5A 3ZVJA 3EU3A 5DQYA 1WIKA 4NHWA 5DJLA 1A8LA 1O73A 1XW5A 5J9CA 4V2LA 1XIYA 5COHA 3FYGA 3HYPA 1GUHA 3M3MA 5F0GA 1SD9A 2JADA 3ED3A 1MD4A 2DBCA 3FZAA 2XBQA 4GF0A 1THXA 4DSSA 1GTIA 3LJRA 5GAPD 2LUSA 1XW9A 2JZSA 1U88A 4IBPA 3TJBA 1YF1A 4MDCA 1JZWA 2H1DA 3GIXA 1EV4A 2B6MA 1XWCA 2VLVA 2CVBA 1PD21 3N9JA 1QQ2A 4DSQA 3C71A 1LJRA 2DMMA 2MMOA 4EE0A 4PUFC 4NMUA 2GZZA 3F63A 5IIZA 1K0AA 3H1NA 6GSSA 4HS1A 3I6AA 3WGXA 2VL9A 2IWTA 4F2IA 4IQAA 4CDOA 2H1AA 1TW9A 11GSA 2MZCA 4TRXA 2PVQA 1KEBA 1T7PB 3EU4A 3L0HA 4ILFA 2HI7A 2LNTA 2QKEA 1K3YA 2OE1A 3C1SA 3DWVA 2AYTA 2PVOC 3UAPA 1EWXA 4BWSA 1EOHA 2X8CA 2VD0A 3F4SA 5JWOB 2C3TA 4K6XA 2YOIA 3UBLA 1FW1A 2LV3A 1MDIA 2YV7A 2B1KA 3HJPA 3UJ1A 3HVVA 5EL8A 2DIZA 1WE0A 1ZCPA 3DD3A 5GSTA 5FWGA 1WMJA 3GYKA 2DJ0A 2I9HA 3VWXA 1W4VA 2DJ3A 1J08A 4TR0A 5CYYA 4FYBA 4F0CA 1PX7A 3TKPA 4RI7A 2RM5A 5KN0A 2ZUPA 1ERWA 1DE1A 3G7YA 2FLSA 1Y25A 4WETA 1NSWA 3G9BA 3UEMA 3ERFA 4PURA 2P31A 3M0FA 3GV1A 2WGRA 5HR0A 3GRXA 1ZYEA 4EC0A 2FNOA 2VUPA 1WRYA 1W89A 2NPBA 2OBIA 5J3RA 1EEMA 1GUKA 4IJ3A 2C8UA 4XIHA 3VK9A 2IFQA 1GSUA 1VF3A 1AQXA 3P2AA 3CRUA 2OACA 5EVOA 4AGSA 4YQMA 1GNEA 2X64A 2GS3A 2VLUA 4N30A 2ALBA 1YEPA 3L9UA 3F6FA 5FHIA 4F0BA 1FB0A 4LL1B 3IAS2 3M1GA 4EO3A 3CBUA 3MSZA 1AIUA 3NZNA 3A2WA 3NIVA 1XCCA 2X8GA 1M2BA 3QAWA 2OADA 4MCUA 4ZILA 4YQUA 1I9DA 4P3YB 4MK3A 1XFLA 2MMZA 5CREA 3GUSA 1F9MA 1EP8A 4WR5A 2F9SA 3D4MA 1XVWA 5AIVA 2PGTA 4RQXA 4OFNA 5H5QA 13GSA 4G10A 2K18A 2FA8A 5CRHA 1PX6A 3PINA 2L6DA 2CX3A 2B1LA 4K8MA 3LWAA 3TJKA 3KP9A 1X0RA 4TR1B 4ML1A 4GWRA 4KX4A 3ZL5A 4MJCA 4ZBAA 19GSA 3FR3A 2IMDA 2K6VA 4MPFA 3IHQA 1T8EB 5IM9A 3UBKA 4WF4A 3EMXA 5JCUA 4MH3A 1J9BA 3LYPA 3EURA 3KGKA 3TKSE 2O87A 1MEKA 2VO4A 4NWYA 3UOMA 4TKYA 3F3QA 2A4VA 1TI1A 3VWWA 1T4ZA 3H93A 3FKFA 2OJLA 2AV4A 5IOXA 2BMXA 3G7IA 2V1MA 1M9BA 3KJYA 3GTUB 2ON5A 1A23A 3BD2A 3F4RA 1DSBA 2LJRA 20GSA 2M46A 3RHBA 2KHPA 2TRCP 3EYTA 4CW9A 2E2GA 1E6BA 2FWEA 1ML6A 1F3BA 3I69A 4MF5A 1V98A 2HXKA 1RK4A 4PUAA 4TR4A 3IOSA 3IBHA 3FR9A 2WZ9A 3WYWA 4V2MA 4KDXA 2QC7A 1K0OA 4TR3A 1O85A 1ZZYA 4ZL9A 1GLPA 1GSSA 2GQLA 1Z7RA 1X5CA 4ZL8A 2C80A 4PXOA 3TKQA 2DLXA 1EOGA 2KOKA 1TKDB 1Z3EA 5IPGA 1XOAA 1M2AA 4GCIA 4KCAA 1PN9A 1OVNA 4JR6A 1BJXA 3HZ4A 4IVFA 5CAXA 2VM1A 3R2QA 1OC9B 2LSTA 1OC3A 4I2UA 3RDWA 1K0MA 1F37A 5B8BA 2A2SA 2DC5A 1ABAA 2HT9A 1EV9A 3V1WA 2H30A 1FB6A 2ZCTA 4FH8A 5ENUA 3EE2A 4KUNA 2I1UA 1B48A 2VCXA 2H8LA 3OR5A 2E2MA 3ZIJA 4X0XA 1XOBA 2GSRA 2LRCA 1YJ6A 5CNWA 2I81A 5CP1A 1GL8A 4HZ4A 2RM6A 4LMWA 2OE0A 4HOJA 2CZ2A 4ECCA 3CYNA 3LEFA 4K0NA 1M99A 1RW1A 4N0ZA 1U87A 3KXOA 1T00A 2PWJA 2IMFA 3J7Yk 3RPNA 4HQZA 2CQ9A 3LORA 4IS0A 2GT6A 2C3QA 3C7MA 4WKWA 3US3A 5JCWA 3TGZA 1JZDA 5INYA 3EC3A 5FT3A 1GULA 1OKTA 3VPTA 3QFBC 2HZEA 1XW6A 4F03A 3HCZA 1U3IA 3K8NA 3DXBA 2HRFA 2V6KA 3VI5A 4TXOA 2IJYA 2AAWA 2IYJA 3A2VA 2B3SA 3HVXA 2JSYA 1KBNA 1VF1A 2YWOA 3A5WA 4IHUA 5HFKA 3GSTA 3GNJA 1FHEA 2WJUA 3TRXA 3ME8A 1T1VA 3UMAA 4MJBA 1OKDA 1T4YA 1ZGNA 2VLTA 2R37A 1PL1A 4MZBA 1ILOA 5DCGA 3ZITA 4K2DA 5HQPA 2DSAA 3QCPA 5F8BA 5IO2A 14GSA 1ERUA 4I97A 3KCMA 1O6JA 5ECNB 1U3AA 5ECHB 1DBYA 1PGTA 2FWFA 2H66A 1DE2A 4Z7XA 1B9XC 1FO5A 4YH2A
chains in the Genus database with same CATH superfamily
2F8AA 1RGKA 3ZVJD 3S29A 3GZBA 1OE7A 3GURA 2WGQA 2Z7AA 3D4TA 3TB2A 1PN0A 10GSA 5D9WA 2FHEA 2E2UA 2GQMA 2K8SA 2B7JA 1DMNA 2F8FA 1VQ63 4IT7A 3WDGB 4MF7A 9RNTA 1HZ1A 1X1XA 4BVYB 4AJ8A 1EGOA 3D5GA 3UNLA 1O7PB 3KCHA 5D9XA 1QJGA 2M7OA 1RCKA 3LZAA 1C72A 5AIIA 3L9VA 4AJ7A 1F6MC 4F82A 1A2MA 2YPMA 3UIWA 3FGYA 3T0UA 1CQSA 5D93A 1M1XB 3WT1A 2OA7A 1TXXA 2E7PA 1JZOA 4XM4A 4OWYA 1NM3A 3CC73 2FGTA 4OVMA 1BNGA 3CSIA 1JHBA 3FG1A 4GXZA 5IMFA 1V58A 3FR6A 1PFPA 3L78A 2L57A 2ZDJA 2LYXA 4HYZA 2YV9A 3TRQA 1JB5A 1YJ93 2V32A 1IVWA 3B8LA 2CK3H 1PA3A 5DCHA 2C0DA 5EEOA 3VWUA 1FGMA 2IMIA 1UW1A 3KH7A 2M72A 1AXDA 5HFIA 3ZYWA 5BXQA 2CFGA 2XSOB 1V2AA 2MYGA 1G96A 3D21A 3DEXA 1G0TA 1QVG2 4AKZA 2FD3A 3KZQA 4KA0A 2CZ3A 2CAIA 2HZFA 2K8VA 2YANA 5ABRA 4JBBA 1RDSA 1KSIA 1GOYA 1AQVA 1Z6MA 1OAZA 4JE1A 2N5BA 3UARA 3GZYB 3MG2A 3LTAA 3TJJA 2H71A 2GGTA 1UI8A 3D6IA 3D5IA 4CJNA 2FY6A 1ZOFA 3JCML 2BU4A 1AUCA 3DGYA 1DETA 4L0WA 2ML6A 3NBBA 2CAQA 4RNYA 3GA4A 2PNCA 5KP4A 1RGHA 3HA9A 4J56E 2F4YA 4XTSA 7RNTA 3AHSA 1K0NA 1JBTA 4IELA 2GEYA 3F8HA 2BJXA 2DIYA 1AC1A 1ZMAA 3O3TA 5F07A 3RPPA 3GKMA 3H79A 4EVMA 2PPTA 3CPOA 3VI7A 5IENA 4EKZA 1OGZA 2P5RA 4BL7A 4GQCA 1O7NB 2P09A 2CC3A 2NVLA 4K7IA 4HJ2A 4MP4A 1W6CA 1IT7A 1VQK3 2CT6A 3PXMA 1H4OA 2J23A 2REMA 4D73A 1V9WA 2GT5A 4IQ1A 1TI3A 3VURA 1HD2A 4O02B 4TN8A 2VM2A 2GZPA 1JN5A 2XRXB 3HOHA 1UDII 1BG5A 1E2YA 4WFOA 2KUCA 1OHSA 1WJKA 2YP6A 3GKNA 3ZIVA 2G0FA 2VD1A 5KN1A 2VL2A 1Q9EA 2YZUA 4GSNA 3VWVA 1YGWA 3BLZA 2VOCA 1SKWB 1AW9A 5AISA 1ULIB 5LC7A 1AAZA 3Q6OA 1A90A 1I5GA 3EMPA 2H73A 5G5FA 2P0MA 3KSPA 3KMNA 3TKRA 1LOXA 4X4JA 4XS4B 2HRNA 1F8NA 2J8XB 2QGUA 2WDUA 5EY6A 3Q19A 4JZQA 2F5MA 2B5YA 1GRXA 3CCE3 3L4NA 3NM2A 5JCGA 4IKHA 3TRPA 1OUNA 1JJ22 3SYUA 4HBRA 1Z5YE 4RNZA 1UCJA 1CQHA 2XBIA 3KTBA 2YWIA 2O85A 2I3YA 1RGLA 3APOA 1BOXA 2YWMA 1I0VA 1OACA 1R5AA 4ORLA 3KD0A 1RGCA 2VL2C 4Q5QA 1DYUA 5ELGA 3PPUA 2E2TA 4TVEA 3ERGA 2VCZA 3ZREA 1X9SB 4LEHA 1C54A 1XWKA 4O5UA 3DVXA 2GSPA 1BIRA 5ECQB 3HI7A 5M18A 1SARA 1RJOA 4PQIA 3F8XA 2VIMA 2YWNA 1K8A4 3FY7A 2XHFA 1A2LA 1SJWA 1BVIA 2RBIA 3KP8A 3NV0B 3FSDA 3ISOA 1YZXA 2W04A 1HNBA 3NBRA 4J2FA 2H19A 5KN2A 4PNGA 2HMMB 4HM3B 3ZTLA 4TOPA 4PQHA 1BRHA 5J5NA 2R2JA 1HYUA 1V74A 3CCL3 2RUFA 5IMAA 4Q5RA 4USSA 3BOAA 4GL6A 2F3MA 4KB3A 3ZFZA 2B7KA 2WS2A 2FWGA 4IPBA 4ZBBA 4GTUA 3VLNA 3F14A 3GRDA 1XWGA 1GD3A 4N10A 3ZFLA 4J57E 2QIYA 1UN2A 5C04A 2F99A 3EBYA 3P90A 1A2KA 2F98A 4STDA 5BU4A 1YHQ3 2H6XA 1IQXA 5D73A 2LRNA 4BVYA 4NXIA 2HRKA 1GH2A 1D6ZA 3DVWA 4PQ1A 1LU4A 2EC4A 1WMNA 2H72A 2H74A 4CY6A 1Q4JA 4J5KA 2L5OA 1B9YC 3MHEA 2KXGA 3K63A 12GSA 1SKRB 2QA2A 5D9TA 1TRUA 3QD9A 1FOVA 4HI7A 1SL2B 4NREA 3QMXA 4F9ZA 4XRDA 4EXJA 3JUMA 1TK0B 2KRTA 1M7TA 4MH2A 1R5PA 4GLTA 4AKYA 4POMA 1W5ZA 3EX9A 3BCKA 4HJMA 4ULXA 4K0GA 3ROBA 1QK8A 2LQVA 1WWJA 1A2JA 4BL3A 3FG4A 5DRVA 3KEBA 5CK6A 1VQ43 3LGCA 1S723 3NQZA 1KNGA 4ML6A 5IPHA 1A0RP 4BTXA 22GSA 3DIEA 2VCQA 5ECKB 2XH9A 1XVQA 2E0QA 1V40A 4QL7A 2BT3A 4IW9A 3L0RA 3ZLPA 1X9MB 2XPEA 1PKZA 3X3YA 4XCSA 5FGOA 1MTCA 3MNGA 4BVXB 1DMMA 3SOAA 3CNMA 4TW5A 4X2HA 1GOVA 6GSVA 1K3LA 2CWUA 3F9SA 5AYRB 5ID2B 5CO3A 3TCOA 1N8R4 2GZYA 3CU3A 1G6WA 4HM2B 1ZYPA 2YZHA 4G0LA 2YJHA 4OCFA 4LA1A 1BRJA 4O92A 1UCIA 3QOUA 3GSPA 3PZWA 5IMCA 5LD0A 3LMLA 4MZWA 4WP5A 4GQFA 4MF6A 3BJ5A 3MSOA 1GUMA 1JLVA 2P5QA 5AN1A 2WCIA 1YI23 3CSHA 1SU9A 1YY7A 1IYHA 3EWLA 2CFKA 2DJKA 3GSSA 1RCLA 3HY2A 1NW2A 4AJ6A 5C00A 2JACA 1IV7A 2C4JA 2V6OA 3A76A 4BWQA 5GSPA 2LRTA 4NPBA 1OYJA 1X1WA 1X9WB 2JQ5A 1G7OA 1FGQA 5A4VA 3P7XA 3DMLA 5I97A 2OWPA 3EBTA 3CRTA 1R4YA 3FZ5A 1J0FA 1QMVA 3KMOA 2W2CA 5KP3A 3F3RA 1B2XA 4JRRA 3X40A 4L8EA 4WXTA 4XB5A 1GTAA 1SKSB 1BRGA 1VQO3 2LS5A 1JKGA 4BTYA 4MA9A 1US1A 2R4VA 4YKGA 3WGDA 1E3VA 3A3TA 4XBYA 2L6CA 2FWHA 3LFLA 4KE3A 2UUGC 2Y73A 5JBSA 1HNCA 3NOFA 4XS4A 2FCHA 1A0FA 2KCDA 4JEDA 2CHCA 2QEX3 1NJI4 4OO5A 1NU3A 2FGXA 4E8EA 1GMQA 1S3RA 3BNBA 2RSXA 1F3AA 1M2DA 1ON4A 2LKUA 5IMDA 4KVHA 2IPAA 1DMQA 3OX9A 3KZTA 5ECOB 1JNQA 2HSYA 1TOFA 1AVKA 1Q98A 1B27A 3EF8A 4KW6A 1BNEA 4H86A 2L59A 2KF5A 1EEJA 1X5EA 2RIIA 4WF5A 1BSCA 1ULJB 4KGIA 3FZ4A 2GSTA 2H0GA 2CX4A 2NTOA 1VQM3 3QDNA 3D5JA 1UGIA 3FK8A 3TJGA 4CCVA 1Q40B 1Q42A 3JUQA 3UL3A 4KDUA 3BNEA 5L71A 1RNBA 1T3BA 3M8CA 1QAKA 2IY2A 2H6ZA 4G0IA 2DMLA 1RN7A 4LLRA 1HU9A 3HIIA 2XC2A 3I9V2 4V1Ag 4FYUA 1LOVA 1Z9HA 2TIRA 3VPQA 1N2AA 2KLXA 4O5QA 4G9HA 4IP6A 3U5RE 4KNDA 2AHEA 6GSTA 4IGJA 5ECLB 1GSEA 4I8BA 5DVBA 1GSQA 3OWUA 2ON7A 3KM6A 4KDYA 2VCWA 2IIYA 4R9LA 4L5OA 1LQMB 4O3VA 3EB8A 2GBWB 4YAVA 4EC6A 4N11A 3FEUA 1SK1A 1TU5A 1U6TA 3KN4A 1TDIA 2PMTA 1I2FA 3ZMLA 5LCZA 2CIUA 2DJ1A 3BCIA 4TR1A 4YKFA 2HSHA 3KIIA 3NXJA 5EVHA 4NV2A 3PR8A 3DGNA 3D9RA 3EN1B 3ME7A 4OFMA 2F51A 2XFSA 2IFQB 2C1YA 3FH1A 5CRWA 1QFNA 4NAXA 4V2NA 1TRWA 1D6UA 4BPYA 4LL4B 3LYKA 1ZYNA 4EIQA 2HYXA 1PY3A 4EDYA 4FYCA 4PGTA 1JFUA 3T8UA 4KT3B 3Q18A 3LSZA 2RFRA 2C10A 4L5LA 3WHOA 2WFCA 1LRAA 2BIRA 3X3XA 3OWSA 2H01A 3SWLA 4HEA2 1SJIA 1CH0A 1G6YA 1AR0A 3SXXA 5JWQB 1OE8A 4KCEA 3HD5A 4FMCA 3HJOA 1BRKA 5CRGA 2LNSA 1VZZA 4WYKB 1RKYA 3LTBA 3CCJ3 3IPZA 3LW9A 2HMKB 3SEDA 1MWTA 4R9KA 1K0BA 1R26A 4TXVA 4HUAA 1SYRA 4K5RA 1AY7A 5B7CA 3RBTA 2IMJA 2ZHXB 1RHLA 4PTSA 3FZWA 3RDEA 2ZNMA 3GL3A 5G5EA 3GTUA 4ECJA 3S9FA 4ECBA 4JR4A 5EQLA 5G2ZA 4PNFA 1IYIA 1XWBA 2PUKC 3FHKA 4K7OA 1BRIA 1RTUA 2GU1A 2XGLA 1AQZA 3FRCA 2B24B 1GY5A 2H76A 3QAGA 5HFGA 3ER7A 3IE3A 3ZRDA 1YKCA 1NHOA 3RAZA 3UVTA 4BVXA 4NHZA 4LMVA 4A5PA 1MDKA 5ELAA 1TK8B 3SOYA 3DM8A 4AF2A 6GSUA 1TTZA 1RQMA 1MDJA 5E4WA 3D0ZA 3KH9A 1IYYA 5ID2A 4LZIA 2O89A 1BUJA 5F05A 2W03A 1FAAA 4HDEA 1W01A 3DGLA 8GSSA 2W0QA 2JZRA 2GDRA 1PRXA 3DUKA 4EL1A 3RNTA 3QFAC 2X8HA 4MMZB 5D9VA 1LQGC 4LGQA 4YQVA 2GLRA 2P0GA 4O32A 3IJEB 1OF5A 1UUWB 3CCQ3 2DJ2A 1JB2A 4HZBB 1VQL3 1GTBA 2HE3A 1JZRA 1UCKA 1MGWA 2DKIA 2DKHA 1STDA 2FXTA 4GRFA 4IN0A 4K1UA 4POKA 1PQNA 1USBA 1WP0A 2EIRA 5FW5A 5ECMB 1FA3A 5AEUB 1TU8A 3N54B 5D8IA 5IQYA 1MD3A 3B7CA 4OFTA 1OC9A 2JU5A 2MBTA 1FUSA 3X41A 1ZYQB 3APSA 2F5WA 4JRFA 1V57A 4WR4A 4ZB8A 2W56B 4BIKA 1SD8A 1STFI 4HM1B 1PSQA 5B6MA 5AGYA 1LBKA 3LYGA 1JLWA 1IT8A 2H70A 2QGVA 3FW2A 3HJMA 4RNTA 1UA5A 1ERTA 3WT2A 3AY8A 4NHFA 2GTUA 3CTFA 3BNCA 3GKXA 2C3NA 3HKRA 2X49A 1GNWA 2N5FA 3U1WA 4MMYB 2C0FA 4KH7A 4BA7A 2LEGA 3G0KA 1IVUA 1YF0A 2FUG2 3CTGA 1PU4A 4FIWA 4EIPA 3JUPA 3E9JB 1RGAA 1FW7A 2MMNA 3C8EA 1CYUA 5KN3A 5CRDA 1BYEA 2I4AA 5ECIB 1HKXA 1U8CB 2DJJA 2XPDA 4CDLA 4XRAA 3EE1A 5HOHA 3BIRA 3GH9A 1N8JA 5BRTA 1CEWI 2AJQB 5D81A 9GSSA 5E59A 3EINA 3G4S3 4RUVA 4MEIA 4MMMA 3DYRA 2H0HA 2HOHA 3PCRA 4GSPA 1EP7A 2H6YA 4YAPA 2R3XA 2RUEA 4MZCA 2WRTA 4O7HA 5J9BA 1Q40A 1VGLA 3HK4A 5AIHA 2PERA 4HZ2A 2TRXA 3DGOA 5CF2A 2HMNB 3HHVA 3VSYA 3SLUA 3D22A 3AMOA 3LTCA 1MWUA 1BQ7A 1N5PA 3C73A 2R4IA 3RHCA 5KOWA 3Q3FA 1N9EA 4NV5A 2HMJB 3WD6A 4CHSA 4OUQA 4WBRD 4AEQA 4HQSA 4I6XA 1KTEA 1EZKA 1IQYA 3CC43 3M8NA 3GH6A 2ML5A 1XPVA 3IK9A 4HOHA 2C4BA 3OWYA 4K7NA 2KP1A 4N6NB 1O8XA 4HU9A 3I0YA 2H75A 3S67A 3F4TA 2BTOT 1Q7Y4 2VL3A 5M19A 3I553 4N0VA 3PH9A 4IJIA 3F9UA 3GX8A 1T2HA 4KAEA 3N5OA 2CA8A 5DJMA 1YJW3 1O81A 1QUWA 4HAAA 3MYDA 1BNSA 1ERVA 3SBCA 1YEXA 1K3OA 1CYVA 4KFFA 2YX9A 2CV4A 3IPTA 1RGEA 3W8JA 2C11A 1BRSA 3UL6A 3O8YA 3C1RA 2R0PA 5IEOA 4EDZA 1HNAA 1M3IA 2YN1A 4FMDA 8RNTA 1VQ93 3GZRA 1YGEA 2CG1A 3WGEA 1QMAA 1S3DA 2F86B 1Q864 1YKAA 3JUNA 5F06A 2N5AA 3K9MC 2JL4A 1M9GA 5B6NA 2EIOA 4DEJA 3DGMA 3GFKA 1XWAA 3HZ8A 4MJDA 2FNQA 3KKGA 4HM5B 3F8UA 3PGTA 3IC4A 4POBA 1B4PA 5IOWA 3G6E3 4I2TA 2CVKA 2PN8A 4JU5A 4G2EA 2OBKA 1VF2A 1THOA 3DY5A 5DAKB 2HZEB 3CXGA 1FG4A 2V2GA 4V1Ap 2XEPA 3TOUA 2K9FA 5DQSA 4MPGA 4WBJA 16GSA 1K0CA 3GX0A 1JV2B 4Q5FA 4ISDA 4TXOB 1CQGA 1LNHA 3HVNA 4MLYA 4I5QA 1W00A 1BAYA 5D96A 3GAXA 2OTJ3 3NHXA 1X5DA 5CF1A 1QGVA 2L4CA 5JWRB 1TP9A 3MAKA 2ES7A 2OE3A 2WO0A 1MWRA 2GEXA 4Q53A 4WEYA 1RN1A 5G31A 4G1MB 4OCEA 1OC8A 3R3EA 4LYLB 3RGAA 1GSFA 4EUYA 2JSZA 4EXRA 4OO4A 1ZL9A 4IP1A 2YFLB 5DBQA 3DRNA 1TK5B 3TJFA 1N8QA 2MMAA 1M9AA 1RSNA 1G02A 2V41A 5IMVA 1OCVA 2A2RA 3KTLA 1K734 1XZOA 2AUVA 1W7CA 1BRNL 5A5KA 1YDKA 4ACSA 3CNXA 1NB5I 1UUVB 2IL3A 2W9QA 3F40A 3CSJA 2CW9A 3S28A 4EYCA 2OKAA 3X3ZA 3NUVA 3HVSA 5EPFA 2PU9C 1BNIA 2R5GA 1E3RA 3IK7A 5DALB 4KSMA 1Z6NA 3UVHA 3Q74A 6GSXA 4R4KA 5LNKe 2GSSA 1WTHA 2C0EA 5J4UA 1SIIA 4POLA 4BTWA 3QRDA 1IVVA 2Z9SA 1EKMA 4ZM8A 3QPMA 3GMFA 1NNVA 4KFEA 1SYXA 2X4AA 4L0UA 1IK3A 5AIXA 2QSIA 1ACVA 5H5RA 1TRQA 2B5XA 3IV4A 4ID0A 4EF0A 3D3LA 5IEPA 3CMIA 2RGQA 2O7KA 3PGBA 4K90B 2W56A 4XDWA 1HQOA 1YQ1A 1ZS7A 4DVCA 1B21A 1K0DA 2YJ7A 3HZPA 3ZFBA 4XS6A 3H4KA 2R0GA 2P0XA 2IA7A 1FOHA 4ZL7A 3I43A 5AEWB 3J7Yb 2K54A 1UC7A 18GSA 2XFTA 1A8YA 1AVLA 1O8WA 5GSSA 1G7EA 2VAFA 3OV4A 4XS1A 1A24A 2HLSA 2VCTA 4DSSB 1L5GB 1YIJ3 3M9KA 2LTKA 2J9HA 3DMCA 3P8WA 5A0OB 4XHMA 5J41A 4L7KA 1VF4A 1NO3A 4PX1A 1WOUA 5H5SA 1TU7A 4K5SA 1BNFA 5AIFA 2H0IA 2C0GA 3LXTA 1IU7A 4R1KA 1SJ6A 5G2GA 3QR6A 5HR3A 3DGQA 1LOWA 3IR4A 1EQKA 4KSOA 5ECSA 2GXFA 5GAND 2YFIB 1Z7PA 3BBYA 3TKSA 2IMEA 2R6KA 3GKKA 3V92A 1YVBI 3FMWA 3ZMKA 4BL2A 3IDVA 3Q90A 1GOUA 1GWCA 1WQLB 5G1LA 4DSRA 3F7SA 2O8VB 2KF6A 1FVKA 2I9WA 3TUEA 3TDGA 2P05A 3EVIA 1KWIA 1FGOA 3F0IA 1FGTA 3ERWA 1H75A 4O5RA 1RN4A 4Z2RA 1BEDA 3GN3A 4RQRA 3DKSA 1MGRA 1UGHI 2GBXB 3WOEB 3QAVA 2MF7A 1NHYA 2IN3A 5KOXA 2YCDA 5AIGA 1BSEA 1O7UA 3CC23 1XXUA 4EW5A 1ZO2A 6RNTA 4QQ7A 1KD14 6GSYA 7GSPA 3TKSC 1QXHA 1BGSA 2WGOA 4GB5A 3IAM2 2YNXA 2UZ8A 1K28A 4ECIA 1SENA 2LQQA 1JRQA 1M0UA 4N6LA 4G0KA 3ECFA 4BU4A 1R4WA 4L8PA 5G1KA 3LXZA 4RZMA 4MJAA 4K1FA 3E0UA 3LQ7A 1YJN3 2D2ZA 1TJDA 4ZB6A 3IXRA 1M904 4OD7A 4E8HA 5ELJA 4CPKA 5HR2A 4G19A 4RI6A 4HM8B 1W2ZA 4JF8A 2WULA 4KFDA 3KIJA 1SL1B 2M80A 4X1UA 1GLQA 3MDKA 2HNLA 1VQ73 2AB6A 1RRLA 2BMRB 1RLSA 1SL0B 5ECRB 1BSAA 2LQOA 3E99A 2RLIA 3ZG0A 1GTUA 5IMZA 4ZB9A 2VCVA 1GSDA 3O6TA 1S3AA 3NV0A 1IV9A 3GHAA 3WODG 2HFDA 1A2VA 4HSCX 2X99A 3WR2A 1MOLA 4GSSA 3HXSA 4XBXA 2H1GA 3HDCA 4D73B 3GWRA 2MBSA 1ST9A 1BSBA 2GVPA 1TRVA 2LJKA 2L5LA 4HU7A 3H8QA 4OMVA 2AAEA 4J5GA 4K9ZA 3AGNA 5DAKA 3M9JA 3MPHA 5GZZB 4QL9A 2EIQA 5B8AA 1DUGA 2Z76A 3MWHA 3O76A 1VQ53 3FKAA 5A4UA 1FVJA 1IVXA 2STDA 2IMKA 4FCMA 1FO5A 1SIHA 1SK2A 1B4QA 2YFJB 1URMA 2D1WA 4ZBDA 2K3DA 1VRSD 3Q2PA 1EGRA 2WB9A 5ECPB 4O8SA 5A4WA 4HM4B 1U5OA 5HR1A 3V99A 1BX9A 1TRSA 17GSA 2GQKA 3G7JA 6GSWA 2CVDA 1GP1A 1I2EA 2XF3A 3U6VA 7GSSA 1ZX2A 1M1K4 2F56A 4ZIJA 2B5EA 1F2EA 3APQA 1W2B2 2RCDA 4FO5A 5DDLA 1ROVA 2G2QA 4H3UA 2H1BA 1AQWA 2NDOA 3F6DA 5IO0A 3BNDA 3E3EA 1SK0A 2HRAA 1SJZA 2KP2A 5IF6A 3FZ9A 2NBSA 3W6GA 2PBJA 3ZZXA 1PMTA 1LNIA 2GSQA 3IRAA 1B2MA 2UGIA 4GSTA 3W8SA 1PL2A 1PKWA 2L4QA 6GSPA 3JVCA 4KZ1A 4MJEA 1YNVX 4X2OA 3WMDA 3VFIA 2CX0A 5DALA 1XBSA 4EBGA 5G30A 4LSOA 1R7HA 4MABA 3BB9A 5KEJA 3V98A 1Y6EA 3A2XA 1UVZA 1AV4A 1MNLA 1TTOA 2BMOB 1GSYA 2OTL3 3IA1A 1B8XA 2FA4A 4ZXGA 2JZTA 2CWVA 2LJAA 3L9SA 3A5IA 2Z6BA 1S3CA 4Q5NA 3LG6A 1SQWA 4N6V0 1WPIA 3GL5A 4MMXB 3EU3A 5DQYA 3ZVJA 1WIKA 1GYBA 4NHWA 1I70A 1A8LA 1QAFA 1O73A 5DJLA 3IHGA 1XW5A 2QA1A 5J9CA 4V2LA 1XIYA 5COHA 1IQ8A 3FYGA 1XG8A 3HYPA 2A4HA 1OHPA 4I4KA 1GUHA 3M3MA 5F0GA 1SD9A 2JADA 3CCM3 3ED3A 1MD4A 2DBCA 3FZAA 2XBQA 4GF0A 1GS3A 1THXA 4DSSA 1GTIA 5LC6A 3LJRA 3MYTA 1XW9A 2JZSA 2LUSA 4CY8A 2IUKA 1U88A 4IBPA 1S5AA 3TJBA 1YF1A 3MWZA 4MDCA 1WMPA 1JZWA 2H1DA 3NQYA 3GIXA 4J8TA 1I3IA 1VQQA 1EV4A 2B6MA 3LT8A 1XWCA 1TIJA 3G16A 2VLVA 1YIT3 2CVBA 1PD21 2AADA 5CLKA 3N9JA 3K7CA 1QQ2A 4DSQA 3C71A 1LJRA 2DMMA 2MMOA 4EE0A 2CG0A 4PUFC 4NMUA 2GZZA 1TFKA 1TP6A 2BHMA 3F63A 5IIZA 1K0AA 3DZLA 3H1NA 6GSSA 5BMUA 5GAPD 1LVNA 4HS1A 3I6AA 2PZVA 2R0CA 1WMOA 5IG3A 3WGXA 2VL9A 2IWTA 4F2IA 4IQAA 2WOFA 2H1AA 4CDOA 2KAAA 1TW9A 11GSA 3H3HA 1PFOA 2MZCA 2HSMA 2BMQB 4HZ9B 4TRXA 2PVQA 1KEBA 3OW22 3MG3A 1T7PB 1UI7A 4N3VA 3EU4A 2KF3A 3IMAB 3L0HA 3EQQB 4ILFA 2HI7A 2LNTA 3AHWA 2QKEA 1LOYA 1K3YA 2OE1A 3C1SA 3DWVA 2AYTA 2Y74A 4J9AA 2PVOC 3UAPA 3JUOA 1EWXA 4BWSA 1EOHA 2X8CA 1HYFA 2VD0A 5JPPA 4DKIA 3F4SA 5JWOB 2C3TA 4K6XA 2YOIA 1RRHA 1A67A 3UBLA 1FW1A 4PEJA 1X1UA 2GU3A 2LV3A 3WA3A 1MDIA 4XBTA 2CX1A 2YV7A 2B1KA 1WNHA 3HJPA 3UJ1A 1GMRA 1GY7A 3FCSB 3HVVA 5EL8A 2DIZA 1WE0A 3S5CA 3D4AA 3LOYA 1ZCPA 1VQP3 3DD3A 5GSTA 1B3SA 1BSDA 2BO9B 5IG0A 5FWGA 1WMJA 1Z1SA 3VF1A 1NB3I 3KE7A 2MC8A 3GYKA 2DJ0A 3STDA 2I9HA 3VWXA 1W4VA 1GMPA 1Q814 2DJ3A 1J08A 4TR0A 1Q7HA 5CYYA 3MKIA 3J7Yd 4FYBA 1VQN3 4F0CA 1PX7A 3Q1CA 4N6MA 3TKPA 1ASKA 2RM5A 4RI7A 5KN0A 4H61A 2ZUPA 1GY6A 3CCU3 3G713 2E2VA 3WA2X 3FLJA 1ERWA 1DE1A 3G7YA 2FLSA 2HMOB 1Y25A 1NWWA 2CFLA 8CHOA 2IUJA 1OH0A 4WETA 1NSWA 4QWTA 3G9BA 3UEMA 3ERFA 3SVAA 4PURA 3QK9A 3CME3 2P31A 3M0FA 3GV1A 5ELUA 2WGRA 2V1LA 4FMBA 5HR0A 3GRXA 4HM0B 1ZYEA 4EC0A 1QALA 2FNOA 2VUPA 1WRYA 3NBJA 1W89A 2NPBA 1SPUA 1JKGB 2OBIA 3B4OA 5J3RA 1EEMA 1GUKA 3CPW2 4IJ3A 3X42A 2C8UA 4XIHA 3IC8A 4HVNA 3VK9A 2IFQA 1GSUA 1VF3A 1AQXA 3P2AA 3CRUA 2OACA 2ZL8A 5EVOA 1FZUA 4KF9A 4AGSA 4YQMA 1RNTA 1TFOA 5D83A 1GNEA 3G8ZA 2X64A 1KC84 2GS3A 5BVBA 2VLUA 3B4PA 4N30A 1I2GA 1YEPA 2ALBA 4Z2UA 3L9UA 3F6FA 1N9JA 2QA43 5FHIA 4F0BA 1FB0A 4LL1B 3IAS2 3M1GA 4EO3A 3CBUA 3MSZA 1AIUA 3NZNA 3CD63 4EV5A 3A2WA 3CMA3 3NIVA 1XCCA 2X8GA 1M2BA 1E97A 3QAWA 1W6GA 4WYKA 2OADA 4MCUA 4K2XA 2HMLB 4ZILA 1TRPA 4YQUA 1I9DA 4P3YB 4MK3A 1RMSA 1DVCA 1FUWA 3CCV3 1XFLA 2MMZA 3T8NA 5CREA 3GUSA 1F9MA 1EP8A 4WR5A 2F9SA 2CWTA 2ZA4A 3D4MA 2XR8B 6STDA 1XVWA 2L1SA 2K0MA 1BAOA 4K61A 5TGNA 5AIVA 3GZXB 2PGTA 4RQXA 4OFNA 3URPA 5RNTA 5H5QA 2OOVA 13GSA 4G10A 1O7WB 1OGXA 2K18A 3WOFB 4R80A 4X43A 2FA8A 2WOHA 4HJLB 5CRHA 2Q07A 3PYJA 1PX6A 3PINA 1FGRA 2L6DA 4HM6B 5IG5A 2CX3A 2B1LA 4K8MA 4HM7B 3LWAA 1GD4A 1MWSA 3KP9A 1X0RA 4TR1B 4ML1A 3TJKA 4GWRA 4KX4A 3ZL5A 1ROAA 4ICYA 1X1YA 3HIGA 4MJCA 4N6OB 3EC9A 4ZBAA 19GSA 3MG1A 3CCS3 5DREA 3FR3A 2IMDA 2K6VA 2OOVC 2O9UX 3IHQA 4MPFA 5STDA 1T8EB 1DVDA 5IM9A 3UBKA 4WF4A 1J2BA 3EMXA 5JCUA 4MH3A 1J9BA 3LYPA 3EURA 3KGKA 4BIRA 4FCZA 2O87A 3TKSE 1MEKA 2VO4A 4NWYA 2A15A 4OK0A 1K41A 3FF0A 2D42A 3UOMA 4TKYA 3F3QA 1A2PA 2A4VA 1TI1A 3VWWA 1T4ZA 3NM7A 3H93A 3FKFA 4HKVB 2OJLA 5HGRA 1I3FA 2AV4A 5IOXA 3KSED 2BMXA 3G7IA 1O7MB 1JB4A 1M9BA 2V1MA 3ALAA 3KJYA 1O7HB 3GTUB 3MIXA 2ON5A 1A23A 4U13A 3BD2A 3F4RA 2BNGA 4RBNA 1DSBA 2SBLA 2LJRA 4MNNA 20GSA 2M46A 3RHBA 2KHPA 2TRCP 1GSPA 3EYTA 4CW9A 2E2GA 1C7HA 5D82A 1E6BA 1KQS2 2FWEA 1ML6A 1F3BA 3I69A 1T2IA 4MF5A 2CFWA 1V98A 2HXKA 1M3JA 1IDPA 1RK4A 4TX4A 4PUAA 4TR4A 3IOSA 1T5YA 3IBHA 3UJMA 3FR9A 3N9HA 1FUTA 2WZ9A 1DE3A 3WYWA 2INXA 4V2MA 4KDXA 2QC7A 1K0OA 4N6UA 4TR3A 5AI1A 2Z77A 5CXOA 3CCR3 3LH4A 1O85A 1ZZYA 4ZL9A 1GLPA 1GSSA 2OQEA 1EA2A 3LXUX 3FF2A 2GQLA 1Z7RA 1X5CA 4ZL8A 2A2PA 1R4CA 3DXOA 3EJVA 2C80A 1TUHA 4PXOA 1BANA 1OF5B 3TKQA 2DLXA 1EOGA 2KOKA 1TKDB 1Z3EA 5AYSC 1LXEA 3DH2A 5IPGA 1UUGB 1XOAA 2W9PA 1M2AA 4GCIA 4KCAA 1PN9A 3K0ZA 1OPYA 3U97A 1OVNA 3H51A 3S27A 2B1XB 4JR6A 3NX0A 5IERA 1BJXA 1D6YA 3HZ4A 4IVFA 5CAXA 4N6TA 2VM1A 3R2QA 1ZGXA 1OC9B 2LSTA 3EPTA 1OC3A 4I2UA 3RDWA 1K0MA 1F37A 3EN8A 3I563 5B8BA 2A2SA 1B20A 1UCLA 2DC5A 1PYLA 3F7XA 1ABAA 2HT9A 2OQEC 1EV9A 3V1WA 4L8OA 2H30A 1FB6A 2ZCTA 4FH8A 2JDIH 5ENUA 3EE2A 1BU4A 4EV2A 1N5HA 4KUNA 2I1UA 5BIRA 1B48A 2VCXA 2H8LA 1RGGA 1W4NA 3OR5A 3VGNA 2E2MA 3D79A 3ZIJA 4X0XA 1XOBA 2P38A 2GSRA 2LRCA 3EHCA 1YJ6A 3BU4A 3N8BA 5CNWA 1RGFA 2I81A 5CP1A 1GL8A 1I0XA 4HZ4A 1JBRA 2RM6A 3UL5A 4LMWA 2OE0A 4HOJA 2CZ2A 1JBSA 3FG3A 3UB1A 2R41A 4ECCA 4XDVA 3CYNA 3LEFA 3HX8A 1M99A 1RW1A 4K0NA 1BNRA 4N0ZA 1U87A 3KXOA 1T00A 2PWJA 4WWUC 3OXAA 4BL7B 2IMFA 5KP1A 3J7Yk 3RPNA 3SX1A 4HQZA 2CQ9A 3PS8A 3LORA 3PCSA 4IS0A 1Q824 2GT6A 2C3QA 4LMIA 4GHOA 3C7MA 4WKWA 3US3A 5JCWA 3TGZA 3AGOA 1JZDA 2KF4A 5INYA 2XSHB 3EC3A 5FT3A 1GULA 1OKTA 1JN5B 3VPTA 3QFBC 4WHAA 1W6YA 3AMOB 2HZEA 3CQFA 1XW6A 1YVSA 4F03A 3CXC2 1EUIC 3HCZA 3LTDA 1U3IA 3K8NA 3DXBA 2HRFA 2V6KA 3VI5A 4TXOA 2IJYA 4FR9A 2AAWA 2L4VA 2IYJA 2CKFB 1I8VA 1W02A 1B2SA 3A2VA 1B2ZA 2B3SA 3HVXA 2RNTA 2JSYA 1KBNA 4K1VA 1VF1A 2YWOA 1EG9B 1ISKA 3A5WA 4IHUA 5IW9A 5HFKA 5IG4A 3GSTA 3GNJA 3TOTA 1OHOA 1FHEA 2WJUA 3TRXA 3ME8A 1T1VA 1NDOB 3UMAA 2XGNA 4MJBA 2CH9A 1OKDA 5M1AA 1QVF2 1T4YA 3K5TA 1O7GB 1ZGNA 2UX0A 2VLTA 4O2HA 2R37A 2OCTA 4FQUA 1PL1A 4MZBA 1ILOA 1BNJA 1K9M4 1BUQA 2CFDA 5DCGA 3ZITA 2SARA 5JPUA 4Z2TA 1Y4KA 1B2UA 4K2DA 4FCJA 4IIAA 4FMAA 5HQPA 3LT9A 2DSAA 3QCPA 5F8BA 5IO2A 14GSA 1ERUA 7STDA 4I97A 3KCMA 1O6JA 5ECNB 3A5EA 1U3AA 5ECHB 1DBYA 1PGTA 3ZG5A 1FYSA 2FWFA 1VQ83 2H66A 3KFQC 1DE2A 3RGRA 4Z7XA 1B9XC 2W6JH 2O3OA 4YH2A
chains in the Genus database with same CATH topology
2F8AA 3ZVJD 1OE7A 3GURA 3D4TA 3TB2A 1PN0A 10GSA 5D9WA 2FHEA 2GQMA 2K8SA 2B7JA 2F8FA 4MF7A 4BVYB 4AJ8A 1EGOA 5D9XA 1C72A 3L9VA 4AJ7A 1F6MC 4F82A 1A2MA 2YPMA 3UIWA 5D93A 3WT1A 2OA7A 1TXXA 2E7PA 1JZOA 4OWYA 1NM3A 3CSIA 1JHBA 4GXZA 5IMFA 1V58A 3FR6A 3L78A 2L57A 2YV9A 3TRQA 2V32A 1PA3A 5DCHA 2C0DA 3VWUA 2IMIA 3KH7A 2M72A 1AXDA 5HFIA 3ZYWA 1V2AA 2MYGA 3D21A 3DEXA 1G0TA 2FD3A 3KZQA 4KA0A 2CZ3A 2CAIA 2HZFA 2K8VA 2YANA 5ABRA 4JBBA 1AQVA 1Z6MA 1OAZA 4JE1A 2N5BA 3UARA 3TJJA 2H71A 2GGTA 3D6IA 2FY6A 1ZOFA 3JCML 1AUCA 4L0WA 3GA4A 2CAQA 3HA9A 4J56E 4XTSA 1K0NA 4IELA 2BJXA 2DIYA 1AC1A 1ZMAA 3O3TA 5F07A 3RPPA 3GKMA 3H79A 4EVMA 2PPTA 3VI7A 4EKZA 2P5RA 4BL7A 4GQCA 2NVLA 4K7IA 4HJ2A 4MP4A 2CT6A 1H4OA 2REMA 2J23A 4D73A 1V9WA 2GT5A 4IQ1A 1TI3A 3VURA 1HD2A 4TN8A 2VM2A 2GZPA 1BG5A 1E2YA 2KUCA 1WJKA 2YP6A 3GKNA 3ZIVA 2G0FA 2VD1A 5KN1A 2VL2A 2YZUA 4GSNA 3VWVA 2VOCA 1SKWB 1AW9A 5AISA 1AAZA 3Q6OA 1I5GA 3EMPA 2H73A 5G5FA 3KMNA 3TKRA 4X4JA 4XS4B 2HRNA 2WDUA 5EY6A 3Q19A 4JZQA 2B5YA 1GRXA 3L4NA 5JCGA 4IKHA 3TRPA 1Z5YE 1CQHA 2XBIA 3KTBA 2YWIA 2O85A 2I3YA 3APOA 2YWMA 1R5AA 3KD0A 2VL2C 4Q5QA 5ELGA 3PPUA 3ZREA 4TVEA 3ERGA 2VCZA 1X9SB 4O5UA 1XWKA 3DVXA 5ECQB 4PQIA 2VIMA 2YWNA 3FY7A 2XHFA 1A2LA 3KP8A 3ISOA 1YZXA 1HNBA 4J2FA 2H19A 5KN2A 4PNGA 3ZTLA 4TOPA 4PQHA 5J5NA 2R2JA 1HYUA 2RUFA 5IMAA 4Q5RA 4USSA 3BOAA 2F3MA 4KB3A 2B7KA 2WS2A 2FWGA 4ZBBA 4GTUA 3VLNA 1XWGA 4N10A 3ZFLA 4J57E 1UN2A 5C04A 3P90A 2H6XA 5D73A 2LRNA 4BVYA 4NXIA 2HRKA 1GH2A 3DVWA 4PQ1A 1LU4A 2EC4A 2H72A 2H74A 4CY6A 1Q4JA 2L5OA 1B9YC 1SKRB 12GSA 2QA2A 5D9TA 1TRUA 3QD9A 1FOVA 4HI7A 1SL2B 3QMXA 4F9ZA 4XRDA 4EXJA 1TK0B 1M7TA 4MH2A 1R5PA 4GLTA 4POMA 3BCKA 4HJMA 4ULXA 4K0GA 1QK8A 1WWJA 1A2JA 3KEBA 3LGCA 1KNGA 4ML6A 5IPHA 1A0RP 22GSA 3DIEA 2VCQA 5ECKB 1XVQA 2E0QA 1V40A 4QL7A 4IW9A 3ZLPA 1X9MB 2XPEA 1PKZA 4XCSA 1MTCA 3MNGA 4BVXB 4TW5A 6GSVA 1K3LA 5ID2B 5CO3A 3TCOA 2GZYA 1G6WA 1ZYPA 2YZHA 4G0LA 2YJHA 4OCFA 4LA1A 4O92A 3QOUA 5IMCA 5LD0A 4MZWA 4GQFA 4MF6A 3BJ5A 1GUMA 1JLVA 2P5QA 5AN1A 2WCIA 3CSHA 1SU9A 1YY7A 1IYHA 3EWLA 2DJKA 3GSSA 3HY2A 1NW2A 4AJ6A 5C00A 2JACA 2V6OA 2C4JA 4BWQA 2LRTA 4NPBA 1OYJA 1X9WB 1G7OA 5A4VA 3P7XA 3DMLA 3CRTA 3FZ5A 1J0FA 1QMVA 3KMOA 3F3RA 4JRRA 4L8EA 4WXTA 1GTAA 1SKSB 2LS5A 4MA9A 2R4VA 4YKGA 3WGDA 3A3TA 2L6CA 2FWHA 3LFLA 4KE3A 1HNCA 3NOFA 4XS4A 2FCHA 1A0FA 4JEDA 4OO5A 2FGXA 4E8EA 1F3AA 1M2DA 1ON4A 2LKUA 5IMDA 2IPAA 5ECOB 2HSYA 1TOFA 1Q98A 4KW6A 4H86A 2L59A 1EEJA 1X5EA 2RIIA 4WF5A 4KGIA 3FZ4A 2GSTA 2H0GA 2CX4A 2NTOA 3QDNA 3D5JA 3FK8A 3TJGA 3UL3A 4KDUA 5L71A 1T3BA 2IY2A 2H6ZA 4G0IA 2DMLA 4LLRA 2XC2A 3I9V2 4V1Ag 4FYUA 1Z9HA 2TIRA 3VPQA 1N2AA 2KLXA 4O5QA 4G9HA 4IP6A 3U5RE 4KNDA 2AHEA 6GSTA 4IGJA 5ECLB 1GSEA 4I8BA 5DVBA 1GSQA 2ON7A 3KM6A 4KDYA 2VCWA 2IIYA 4L5OA 4YAVA 4N11A 3FEUA 1SK1A 1U6TA 1TDIA 2PMTA 3ZMLA 5LCZA 2DJ1A 3BCIA 4TR1A 4YKFA 2HSHA 4NV2A 3PR8A 3ME7A 4OFMA 2F51A 2IFQB 2C1YA 5CRWA 1QFNA 4NAXA 4V2NA 1TRWA 4BPYA 4LL4B 3LYKA 1ZYNA 4EIQA 2HYXA 4EDYA 4FYCA 4PGTA 1JFUA 3Q18A 3LSZA 4L5LA 2WFCA 2H01A 3SWLA 4HEA2 1SJIA 1G6YA 5JWQB 1OE8A 4KCEA 3HD5A 3HJOA 5CRGA 2LNSA 3IPZA 3LW9A 1K0BA 1R26A 4TXVA 4HUAA 1SYRA 4K5RA 5B7CA 3RBTA 4PTSA 3GL3A 4ECJA 2ZNMA 5G5EA 3S9FA 3GTUA 4ECBA 4JR4A 5G2ZA 4PNFA 1IYIA 1XWBA 2PUKC 3FHKA 4K7OA 3FRCA 2H76A 3QAGA 5HFGA 3IE3A 3ZRDA 1YKCA 1NHOA 3RAZA 3UVTA 4BVXA 4NHZA 4LMVA 4A5PA 1MDKA 5ELAA 1TK8B 4AF2A 6GSUA 1TTZA 1RQMA 1MDJA 5E4WA 3D0ZA 3KH9A 5ID2A 2O89A 5F05A 1FAAA 4HDEA 8GSSA 2JZRA 2GDRA 1PRXA 4EL1A 3QFAC 2X8HA 5D9VA 4YQVA 2GLRA 2P0GA 4O32A 3TOTA 2HE3A 2DJ2A 4X43A 1GTBA 1JZRA 2DKIA 2DKHA 4IN0A 4POKA 4GRFA 1PQNA 1USBA 1WP0A 2EIRA 5ECMB 1TU8A 5D8IA 5IQYA 1MD3A 4OFTA 1OC9A 2JU5A 2MBTA 1ZYQB 3APSA 1V57A 4WR4A 4ZB8A 1SD8A 1PSQA 5B6MA 5AGYA 1LBKA 1JLWA 3FW2A 2H70A 2QGVA 3HJMA 1UA5A 1ERTA 3WT2A 3AY8A 3CTFA 3HKRA 2GTUA 3GKXA 2C3NA 2X49A 1GNWA 2N5FA 2C0FA 4KH7A 4BA7A 2LEGA 1YF0A 2FUG2 3CTGA 4FIWA 4EIPA 3E9JB 2MMNA 3C8EA 5KN3A 5CRDA 1BYEA 2I4AA 5ECIB 2DJJA 2XPDA 4XRAA 3GH9A 1N8JA 5BRTA 2AJQB 9GSSA 5E59A 3EINA 4RUVA 4MMMA 3DYRA 2H0HA 1EP7A 2H6YA 4YAPA 2R3XA 2RUEA 4MZCA 2WRTA 4O7HA 5J9BA 1VGLA 2PERA 4HZ2A 2TRXA 3HHVA 3D22A 1BQ7A 3C73A 3RHCA 5KOWA 4NV5A 3WD6A 4CHSA 4WBRD 4HQSA 4I6XA 1KTEA 1EZKA 3M8NA 3GH6A 1XPVA 3IK9A 4K7NA 2KP1A 1O8XA 4HU9A 2H75A 3F4TA 2BTOT 2VL3A 4N0VA 3PH9A 4IJIA 3F9UA 3GX8A 4KAEA 3N5OA 2CA8A 5DJMA 1O81A 1QUWA 3MYDA 1ERVA 3SBCA 1YEXA 1K3OA 2CV4A 3W8JA 3C1RA 2R0PA 4EDZA 1HNAA 2YN1A 3WGEA 1S3DA 1YKAA 5F06A 2N5AA 2JL4A 5B6NA 2EIOA 4DEJA 3GFKA 1XWAA 3HZ8A 3F8UA 3PGTA 3IC4A 4POBA 1B4PA 5IOWA 4I2TA 2CVKA 2PN8A 4JU5A 4G2EA 2OBKA 1VF2A 1THOA 5DAKB 2HZEB 3CXGA 1FG4A 2V2GA 4V1Ap 3TOUA 2K9FA 5DQSA 4MPGA 4WBJA 16GSA 1K0CA 3GX0A 4Q5FA 4ISDA 4TXOB 1CQGA 4MLYA 4I5QA 1BAYA 5D96A 1X5DA 1QGVA 2L4CA 5JWRB 1TP9A 3MAKA 2ES7A 2OE3A 4WEYA 5G31A 4OCEA 1OC8A 3R3EA 1GSFA 4EUYA 2JSZA 4OO4A 1ZL9A 4IP1A 1TK5B 5DBQA 3DRNA 3TJFA 2MMAA 1M9AA 2V41A 5IMVA 2A2RA 3KTLA 2AUVA 1XZOA 5A5KA 1YDKA 4ACSA 2IL3A 3CSJA 2OKAA 5EPFA 3HVSA 2PU9C 2R5GA 3IK7A 5DALB 4KSMA 1Z6NA 3UVHA 3Q74A 6GSXA 5LNKe 2GSSA 2C0EA 5J4UA 4POLA 2Z9SA 3QPMA 3GMFA 1SYXA 2X4AA 4L0UA 5AIXA 2QSIA 1ACVA 5H5RA 2B5XA 3IV4A 4ID0A 4EF0A 3CMIA 2O7KA 1HQOA 1YQ1A 4DVCA 1K0DA 2YJ7A 3ZFBA 4XS6A 3H4KA 2R0GA 4ZL7A 1FOHA 3I43A 3J7Yb 1UC7A 1A8YA 18GSA 1O8WA 5GSSA 1G7EA 2VAFA 4XS1A 1A24A 2HLSA 2VCTA 4DSSB 3M9KA 2LTKA 2J9HA 3P8WA 4XHMA 5J41A 1VF4A 4PX1A 1WOUA 5H5SA 1TU7A 4K5SA 2H0IA 2C0GA 3LXTA 1SJ6A 3QR6A 5HR3A 3DGQA 3IR4A 4KSOA 5ECSA 5GAND 1Z7PA 3BBYA 3TKSA 2IMEA 2R6KA 3GKKA 3FMWA 3ZMKA 3IDVA 1GWCA 5G1LA 4DSRA 2O8VB 1FVKA 3TUEA 3TDGA 3EVIA 3F0IA 3ERWA 1H75A 4O5RA 4Z2RA 1BEDA 3GN3A 4RQRA 3DKSA 3QAVA 1NHYA 2IN3A 5KOXA 2YCDA 1O7UA 1XXUA 4QQ7A 6GSYA 3TKSC 1QXHA 3IAM2 2YNXA 2UZ8A 4ECIA 1SENA 2LQQA 1M0UA 4G0KA 1R4WA 5G1KA 3LXZA 4MJAA 4K1FA 3E0UA 3LQ7A 2D2ZA 1TJDA 4ZB6A 3IXRA 4OD7A 4E8HA 5HR2A 4G19A 4RI6A 2WULA 3KIJA 1SL1B 2M80A 4X1UA 1GLQA 3MDKA 2HNLA 2AB6A 1SL0B 5ECRB 2LQOA 2RLIA 1GTUA 5IMZA 4ZB9A 2VCVA 1GSDA 3O6TA 1S3AA 3GHAA 2HFDA 2X99A 4GSSA 3HXSA 2H1GA 3HDCA 4D73B 2MBSA 1ST9A 2GVPA 1TRVA 2LJKA 2L5LA 4HU7A 3H8QA 4OMVA 4K9ZA 5DAKA 3M9JA 5GZZB 4QL9A 2EIQA 5B8AA 1DUGA 3MWHA 3O76A 5A4UA 1FVJA 2IMKA 1SK2A 1B4QA 1URMA 4ZBDA 1VRSD 1EGRA 2WB9A 5ECPB 5A4WA 5HR1A 1BX9A 1TRSA 17GSA 2GQKA 3G7JA 6GSWA 2CVDA 1GP1A 3U6VA 7GSSA 4ZIJA 2B5EA 1F2EA 3APQA 4FO5A 5DDLA 2G2QA 2H1BA 1AQWA 2NDOA 3F6DA 5IO0A 3E3EA 1SK0A 2HRAA 1SJZA 2KP2A 3FZ9A 2NBSA 3W6GA 2PBJA 3ZZXA 1PMTA 2GSQA 3IRAA 4GSTA 3W8SA 1PL2A 1PKWA 2L4QA 4MJEA 3VFIA 5DALA 1XBSA 5G30A 1R7HA 4MABA 5KEJA 1Y6EA 3A2XA 1UVZA 1GSYA 3IA1A 1B8XA 2FA4A 4ZXGA 2JZTA 2LJAA 3L9SA 3A5IA 1S3CA 4Q5NA 3LG6A 1WPIA 3GL5A 3ZVJA 3EU3A 5DQYA 1WIKA 4NHWA 1A8LA 1O73A 5DJLA 3IHGA 1XW5A 2QA1A 5J9CA 4V2LA 1XIYA 5COHA 3FYGA 3HYPA 2A4HA 1GUHA 3M3MA 5F0GA 1SD9A 2JADA 3ED3A 1MD4A 2DBCA 3FZAA 2XBQA 4GF0A 1THXA 4DSSA 1GTIA 3LJRA 5GAPD 2LUSA 1XW9A 2JZSA 4CY8A 1U88A 4IBPA 3TJBA 1YF1A 4MDCA 1JZWA 2H1DA 3GIXA 1EV4A 2B6MA 1XWCA 2VLVA 2CVBA 1PD21 3N9JA 1QQ2A 4DSQA 3C71A 1LJRA 2DMMA 2MMOA 4EE0A 4PUFC 4NMUA 2GZZA 3F63A 5IIZA 1K0AA 3H1NA 6GSSA 5BMUA 4HS1A 3I6AA 2R0CA 3WGXA 2VL9A 2IWTA 4F2IA 4IQAA 4CDOA 2H1AA 1TW9A 11GSA 2MZCA 2HSMA 4TRXA 2PVQA 1KEBA 1T7PB 3EU4A 3L0HA 4ILFA 2HI7A 2LNTA 2QKEA 1K3YA 2OE1A 3C1SA 3DWVA 2AYTA 2PVOC 3UAPA 1EWXA 4BWSA 1EOHA 2X8CA 2VD0A 3F4SA 5JWOB 2C3TA 4K6XA 2YOIA 3UBLA 1FW1A 2LV3A 1MDIA 2YV7A 2B1KA 3HJPA 3UJ1A 3HVVA 5EL8A 2DIZA 1WE0A 1ZCPA 3DD3A 5GSTA 5FWGA 1WMJA 3GYKA 2DJ0A 2I9HA 3VWXA 1W4VA 2DJ3A 1J08A 4TR0A 5CYYA 4FYBA 4F0CA 1PX7A 3TKPA 4RI7A 2RM5A 5KN0A 2ZUPA 1ERWA 1DE1A 3G7YA 2FLSA 1Y25A 4WETA 1NSWA 3G9BA 3UEMA 3ERFA 4PURA 2P31A 3M0FA 3GV1A 2WGRA 5HR0A 3GRXA 1ZYEA 4EC0A 2FNOA 2VUPA 1WRYA 1W89A 2NPBA 2OBIA 5J3RA 1EEMA 1GUKA 4IJ3A 2C8UA 4XIHA 3IC8A 3VK9A 2IFQA 1GSUA 1VF3A 1AQXA 3P2AA 3CRUA 2OACA 5EVOA 4KF9A 4AGSA 4YQMA 1GNEA 2X64A 2GS3A 2VLUA 4N30A 2ALBA 1YEPA 4Z2UA 3L9UA 3F6FA 5FHIA 4F0BA 1FB0A 4LL1B 3IAS2 3M1GA 4EO3A 3CBUA 3MSZA 1AIUA 3NZNA 3A2WA 3NIVA 1XCCA 2X8GA 1M2BA 3QAWA 2OADA 4MCUA 4K2XA 4ZILA 4YQUA 1I9DA 4P3YB 4MK3A 1XFLA 2MMZA 5CREA 3GUSA 1F9MA 1EP8A 4WR5A 2F9SA 3D4MA 1XVWA 5AIVA 2PGTA 4RQXA 4OFNA 5H5QA 13GSA 4G10A 2K18A 2FA8A 5CRHA 1PX6A 3PINA 2L6DA 2CX3A 2B1LA 4K8MA 3LWAA 3TJKA 3KP9A 1X0RA 4TR1B 4ML1A 4GWRA 4KX4A 3ZL5A 4ICYA 4MJCA 4ZBAA 19GSA 3FR3A 2IMDA 2K6VA 4MPFA 3IHQA 1T8EB 5IM9A 3UBKA 4WF4A 3EMXA 5JCUA 4MH3A 1J9BA 3LYPA 3EURA 3KGKA 3TKSE 2O87A 1MEKA 2VO4A 4NWYA 3UOMA 4TKYA 3F3QA 2A4VA 1TI1A 3VWWA 1T4ZA 3H93A 3FKFA 2OJLA 2AV4A 5IOXA 2BMXA 3G7IA 2V1MA 1M9BA 3KJYA 3GTUB 3MIXA 2ON5A 1A23A 3BD2A 3F4RA 1DSBA 2LJRA 4MNNA 20GSA 2M46A 3RHBA 2KHPA 2TRCP 3EYTA 4CW9A 2E2GA 1E6BA 2FWEA 1ML6A 1F3BA 3I69A 4MF5A 1V98A 2HXKA 1RK4A 4PUAA 4TR4A 3IOSA 3IBHA 3FR9A 2WZ9A 3WYWA 4V2MA 4KDXA 2QC7A 1K0OA 4TR3A 1O85A 1ZZYA 4ZL9A 1GLPA 1GSSA 2GQLA 1Z7RA 1X5CA 4ZL8A 2A2PA 2C80A 4PXOA 3TKQA 2DLXA 1EOGA 2KOKA 1TKDB 1Z3EA 5IPGA 1XOAA 1M2AA 4GCIA 4KCAA 1PN9A 1OVNA 4JR6A 1BJXA 3HZ4A 4IVFA 5CAXA 2VM1A 3R2QA 1OC9B 2LSTA 3EPTA 1OC3A 4I2UA 3RDWA 1K0MA 1F37A 5B8BA 2A2SA 2DC5A 1ABAA 2HT9A 1EV9A 3V1WA 2H30A 1FB6A 2ZCTA 4FH8A 5ENUA 3EE2A 4KUNA 2I1UA 1B48A 2VCXA 2H8LA 3OR5A 2E2MA 3ZIJA 4X0XA 1XOBA 2GSRA 2LRCA 1YJ6A 5CNWA 2I81A 5CP1A 1GL8A 4HZ4A 2RM6A 4LMWA 2OE0A 4HOJA 2CZ2A 4ECCA 3CYNA 3LEFA 4K0NA 1M99A 1RW1A 4N0ZA 1U87A 3KXOA 1T00A 2PWJA 4BL7B 2IMFA 3J7Yk 3RPNA 4HQZA 2CQ9A 3LORA 4IS0A 2GT6A 2C3QA 3C7MA 4WKWA 3US3A 5JCWA 3TGZA 1JZDA 5INYA 3EC3A 5FT3A 1GULA 1OKTA 3VPTA 3QFBC 2HZEA 1XW6A 4F03A 3HCZA 1U3IA 3K8NA 3DXBA 2HRFA 2V6KA 3VI5A 4TXOA 2IJYA 2AAWA 2IYJA 3A2VA 2B3SA 3HVXA 2JSYA 1KBNA 1VF1A 2YWOA 3A5WA 4IHUA 5HFKA 3GSTA 3GNJA 1FHEA 2WJUA 3TRXA 3ME8A 1T1VA 3UMAA 4MJBA 1OKDA 1T4YA 1ZGNA 2VLTA 2R37A 4FQUA 1PL1A 4MZBA 1ILOA 5DCGA 3ZITA 4Z2TA 4K2DA 5HQPA 2DSAA 3QCPA 5F8BA 5IO2A 14GSA 1ERUA 4I97A 3KCMA 1O6JA 5ECNB 1U3AA 5ECHB 1DBYA 1PGTA 2FWFA 2H66A 1DE2A 4Z7XA 1B9XC 1FO5A 4YH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8A A;  3ZVJ D;  1OE7 A;  3GUR A;  3D4T A;  3TB2 A;  10GS A;  5D9W A;  2FHE A;  2GQM A;  2K8S A;  2B7J A;  2F8F A;  4MF7 A;  4AJ8 A;  1EGO A;  5D9X A;  1C72 A;  3L9V A;  4AJ7 A;  1F6M C;  4F82 A;  1A2M A;  2YPM A;  3UIW A;  5D93 A;  3WT1 A;  2OA7 A;  1TXX A;  2E7P A;  1JZO A;  4OWY A;  1NM3 A;  3CSI A;  1JHB A;  4GXZ A;  5IMF A;  1V58 A;  3FR6 A;  3L78 A;  2L57 A;  2YV9 A;  3TRQ A;  2V32 A;  1PA3 A;  5DCH A;  2C0D A;  3VWU A;  2IMI A;  3KH7 A;  2M72 A;  1AXD A;  5HFI A;  3ZYW A;  1V2A A;  2MYG A;  3D21 A;  3DEX A;  1G0T A;  2FD3 A;  3KZQ A;  4KA0 A;  2CZ3 A;  2CAI A;  2HZF A;  2K8V A;  2YAN A;  5ABR A;  4JBB A;  1AQV A;  1Z6M A;  1OAZ A;  4JE1 A;  2N5B A;  3UAR A;  3TJJ A;  2H71 A;  2GGT A;  3D6I A;  2FY6 A;  1ZOF A;  3JCM L;  1AUC A;  4L0W A;  3GA4 A;  2CAQ A;  3HA9 A;  4J56 E;  4XTS A;  1K0N A;  4IEL A;  2BJX A;  2DIY A;  1AC1 A;  1ZMA A;  3O3T A;  5F07 A;  3RPP A;  3GKM A;  3H79 A;  4EVM A;  2PPT A;  3VI7 A;  4EKZ A;  2P5R A;  4BL7 A;  4GQC A;  2NVL A;  4K7I A;  4HJ2 A;  4MP4 A;  2CT6 A;  1H4O A;  2REM A;  2J23 A;  4D73 A;  1V9W A;  2GT5 A;  4IQ1 A;  1TI3 A;  3VUR A;  1HD2 A;  4TN8 A;  2VM2 A;  2GZP A;  1BG5 A;  1E2Y A;  2KUC A;  1WJK A;  2YP6 A;  3GKN A;  3ZIV A;  2G0F A;  2VD1 A;  5KN1 A;  2VL2 A;  2YZU A;  4GSN A;  3VWV A;  2VOC A;  1SKW B;  1AW9 A;  5AIS A;  1AAZ A;  3Q6O A;  1I5G A;  3EMP A;  2H73 A;  5G5F A;  3KMN A;  3TKR A;  4XS4 B;  2HRN A;  2WDU A;  5EY6 A;  3Q19 A;  4JZQ A;  2B5Y A;  1GRX A;  3L4N A;  5JCG A;  4IKH A;  3TRP A;  1Z5Y E;  1CQH A;  2XBI A;  3KTB A;  2YWI A;  2O85 A;  2I3Y A;  3APO A;  2YWM A;  1R5A A;  3KD0 A;  2VL2 C;  4Q5Q A;  5ELG A;  3ZRE A;  4TVE A;  3ERG A;  2VCZ A;  1X9S B;  1XWK A;  3DVX A;  5ECQ B;  4PQI A;  2VIM A;  2YWN A;  3FY7 A;  2XHF A;  1A2L A;  3KP8 A;  3ISO A;  1YZX A;  1HNB A;  4J2F A;  2H19 A;  5KN2 A;  4PNG A;  3ZTL A;  4TOP A;  4PQH A;  5J5N A;  2R2J A;  1HYU A;  2RUF A;  5IMA A;  4Q5R A;  3BOA A;  2F3M A;  4KB3 A;  2B7K A;  2WS2 A;  2FWG A;  4ZBB A;  4GTU A;  3VLN A;  1XWG A;  4N10 A;  3ZFL A;  4J57 E;  1UN2 A;  5C04 A;  3P90 A;  2H6X A;  5D73 A;  2LRN A;  4BVY A;  4NXI A;  1GH2 A;  3DVW A;  4PQ1 A;  1LU4 A;  2EC4 A;  2H72 A;  2H74 A;  1Q4J A;  2L5O A;  1B9Y C;  1SKR B;  12GS A;  1FOV A;  5D9T A;  1TRU A;  3QD9 A;  4HI7 A;  1SL2 B;  3QMX A;  4F9Z A;  4XRD A;  4EXJ A;  1TK0 B;  1M7T A;  4MH2 A;  1R5P A;  4GLT A;  4POM A;  3BCK A;  4HJM A;  4ULX A;  4K0G A;  1QK8 A;  1WWJ A;  1A2J A;  3KEB A;  3LGC A;  1KNG A;  4ML6 A;  5IPH A;  1A0R P;  22GS A;  3DIE A;  2VCQ A;  5ECK B;  1XVQ A;  2E0Q A;  1V40 A;  4QL7 A;  4IW9 A;  3ZLP A;  1X9M B;  2XPE A;  1PKZ A;  4XCS A;  1MTC A;  3MNG A;  4TW5 A;  6GSV A;  1K3L A;  5ID2 B;  5CO3 A;  3TCO A;  2GZY A;  1G6W A;  2YZH A;  2YJH A;  4OCF A;  4LA1 A;  4O92 A;  3QOU A;  5IMC A;  5LD0 A;  4MZW A;  4GQF A;  4MF6 A;  3BJ5 A;  1GUM A;  1JLV A;  2P5Q A;  5AN1 A;  2WCI A;  3CSH A;  1SU9 A;  1YY7 A;  1IYH A;  3EWL A;  2DJK A;  3GSS A;  3HY2 A;  1NW2 A;  4AJ6 A;  5C00 A;  2JAC A;  2V6O A;  2C4J A;  4BWQ A;  2LRT A;  4NPB A;  1OYJ A;  1X9W B;  1G7O A;  5A4V A;  3P7X A;  3DML A;  3CRT A;  3FZ5 A;  1J0F A;  1QMV A;  3KMO A;  3F3R A;  4JRR A;  4L8E A;  4WXT A;  1GTA A;  1SKS B;  2LS5 A;  4MA9 A;  2R4V A;  3WGD A;  3A3T A;  2L6C A;  2FWH A;  3LFL A;  4KE3 A;  1HNC A;  3NOF A;  4XS4 A;  2FCH A;  1A0F A;  4JED A;  4OO5 A;  2FGX A;  4E8E A;  1F3A A;  1M2D A;  1ON4 A;  2LKU A;  5IMD A;  2IPA A;  5ECO B;  2HSY A;  1TOF A;  1Q98 A;  4KW6 A;  4H86 A;  2L59 A;  1EEJ A;  1X5E A;  2RII A;  4WF5 A;  4KGI A;  3FZ4 A;  2GST A;  2H0G A;  2CX4 A;  2NTO A;  3QDN A;  3D5J A;  3FK8 A;  3TJG A;  3UL3 A;  4KDU A;  5L71 A;  1T3B A;  2IY2 A;  2H6Z A;  2DML A;  4LLR A;  2XC2 A;  3I9V 2;  4V1A g;  4FYU A;  1Z9H A;  2TIR A;  3VPQ A;  1N2A A;  2KLX A;  4G9H A;  4IP6 A;  3U5R E;  4KND A;  2AHE A;  6GST A;  4IGJ A;  5ECL B;  1GSE A;  4I8B A;  5DVB A;  1GSQ A;  2ON7 A;  3KM6 A;  4KDY A;  2VCW A;  2IIY A;  4L5O A;  4YAV A;  4N11 A;  3FEU A;  1SK1 A;  1U6T A;  1TDI A;  2PMT A;  3ZML A;  5LCZ A;  2DJ1 A;  3BCI A;  4TR1 A;  2HSH A;  4NV2 A;  3PR8 A;  3ME7 A;  4OFM A;  2F51 A;  2IFQ B;  2C1Y A;  5CRW A;  1QFN A;  4NAX A;  4V2N A;  1TRW A;  4BPY A;  4LL4 B;  3LYK A;  2HYX A;  4EDY A;  4FYC A;  4PGT A;  1JFU A;  3Q18 A;  3LSZ A;  4L5L A;  2WFC A;  2H01 A;  3SWL A;  4HEA 2;  1SJI A;  1G6Y A;  5JWQ B;  1OE8 A;  4KCE A;  3HD5 A;  3HJO A;  5CRG A;  2LNS A;  3IPZ A;  1K0B A;  1R26 A;  4TXV A;  4HUA A;  1SYR A;  5B7C A;  3RBT A;  3GL3 A;  4ECJ A;  2ZNM A;  5G5E A;  3S9F A;  3GTU A;  4ECB A;  4JR4 A;  5G2Z A;  4PNF A;  1IYI A;  1XWB A;  2PUK C;  3FHK A;  4K7O A;  3FRC A;  2H76 A;  3QAG A;  5HFG A;  3IE3 A;  3ZRD A;  1YKC A;  1NHO A;  3RAZ A;  3UVT A;  4BVX A;  4NHZ A;  4LMV A;  1MDK A;  5ELA A;  1TK8 B;  4AF2 A;  6GSU A;  1TTZ A;  1RQM A;  1MDJ A;  5E4W A;  3D0Z A;  3KH9 A;  5ID2 A;  2O89 A;  5F05 A;  1FAA A;  4HDE A;  8GSS A;  2JZR A;  2GDR A;  1PRX A;  4EL1 A;  3QFA C;  2X8H A;  5D9V A;  4YQV A;  2GLR A;  2P0G A;  4O32 A;  3TOT A;  2HE3 A;  2DJ2 A;  4X43 A;  1GTB A;  1JZR A;  4IN0 A;  4POK A;  4GRF A;  1PQN A;  1USB A;  1WP0 A;  2EIR A;  5ECM B;  1TU8 A;  5D8I A;  5IQY A;  1MD3 A;  4OFT A;  1OC9 A;  2JU5 A;  2MBT A;  1ZYQ B;  3APS A;  1V57 A;  4WR4 A;  4ZB8 A;  1SD8 A;  1PSQ A;  5B6M A;  5AGY A;  1LBK A;  1JLW A;  3FW2 A;  2H70 A;  2QGV A;  3HJM A;  1UA5 A;  1ERT A;  3WT2 A;  3AY8 A;  3CTF A;  3HKR A;  2GTU A;  3GKX A;  2C3N A;  1GNW A;  2N5F A;  2C0F A;  4KH7 A;  4BA7 A;  2LEG A;  1YF0 A;  2FUG 2;  3CTG A;  4FIW A;  3E9J B;  2MMN A;  3C8E A;  5KN3 A;  5CRD A;  1BYE A;  2I4A A;  5ECI B;  2DJJ A;  2XPD A;  4XRA A;  3GH9 A;  1N8J A;  2AJQ B;  9GSS A;  5E59 A;  3EIN A;  4RUV A;  4MMM A;  3DYR A;  2H0H A;  1EP7 A;  2H6Y A;  4YAP A;  2R3X A;  2RUE A;  4MZC A;  2WRT A;  4O7H A;  5J9B A;  1VGL A;  2PER A;  4HZ2 A;  2TRX A;  3HHV A;  3D22 A;  1BQ7 A;  3C73 A;  3RHC A;  4NV5 A;  3WD6 A;  4CHS A;  4WBR D;  4HQS A;  4I6X A;  1KTE A;  1EZK A;  3M8N A;  3GH6 A;  1XPV A;  3IK9 A;  4K7N A;  2KP1 A;  1O8X A;  4HU9 A;  2H75 A;  3F4T A;  2BTO T;  2VL3 A;  4N0V A;  3PH9 A;  4IJI A;  3F9U A;  3GX8 A;  4KAE A;  3N5O A;  2CA8 A;  5DJM A;  1O81 A;  1QUW A;  1ERV A;  3SBC A;  1YEX A;  1K3O A;  2CV4 A;  3W8J A;  3C1R A;  4EDZ A;  1HNA A;  2YN1 A;  3WGE A;  1S3D A;  1YKA A;  5F06 A;  2N5A A;  2JL4 A;  5B6N A;  2EIO A;  4DEJ A;  3GFK A;  1XWA A;  3HZ8 A;  3F8U A;  3PGT A;  3IC4 A;  4POB A;  1B4P A;  5IOW A;  4I2T A;  2CVK A;  2PN8 A;  4JU5 A;  4G2E A;  2OBK A;  1VF2 A;  1THO A;  5DAK B;  2HZE B;  3CXG A;  1FG4 A;  2V2G A;  4V1A p;  3TOU A;  2K9F A;  5DQS A;  4MPG A;  4WBJ A;  16GS A;  1K0C A;  3GX0 A;  4Q5F A;  4ISD A;  4TXO B;  1CQG A;  4MLY A;  4I5Q A;  1BAY A;  5D96 A;  1X5D A;  1QGV A;  2L4C A;  5JWR B;  1TP9 A;  3MAK A;  2ES7 A;  2OE3 A;  4WEY A;  5G31 A;  4OCE A;  1OC8 A;  1GSF A;  4EUY A;  2JSZ A;  4OO4 A;  1ZL9 A;  4IP1 A;  1TK5 B;  5DBQ A;  3DRN A;  3TJF A;  2MMA A;  1M9A A;  2V41 A;  5IMV A;  2A2R A;  3KTL A;  2AUV A;  1XZO A;  5A5K A;  1YDK A;  4ACS A;  2IL3 A;  3CSJ A;  2OKA A;  5EPF A;  3HVS A;  2PU9 C;  2R5G A;  3IK7 A;  5DAL B;  4KSM A;  1Z6N A;  3UVH A;  3Q74 A;  6GSX A;  5LNK e;  2GSS A;  2C0E A;  5J4U A;  4POL A;  2Z9S A;  3QPM A;  3GMF A;  1SYX A;  4L0U A;  5AIX A;  2QSI A;  1ACV A;  5H5R A;  2B5X A;  3IV4 A;  4ID0 A;  4EF0 A;  3CMI A;  2O7K A;  1HQO A;  1YQ1 A;  4DVC A;  1K0D A;  2YJ7 A;  3ZFB A;  4XS6 A;  3H4K A;  4ZL7 A;  3I43 A;  3J7Y b;  1UC7 A;  1A8Y A;  18GS A;  1O8W A;  5GSS A;  1G7E A;  2VAF A;  4XS1 A;  1A24 A;  2HLS A;  2VCT A;  4DSS B;  3M9K A;  2LTK A;  2J9H A;  3P8W A;  4XHM A;  5J41 A;  1VF4 A;  4PX1 A;  1WOU A;  5H5S A;  1TU7 A;  2H0I A;  2C0G A;  3LXT A;  1SJ6 A;  3QR6 A;  5HR3 A;  3DGQ A;  3IR4 A;  4KSO A;  5ECS A;  5GAN D;  1Z7P A;  3BBY A;  3TKS A;  2IME A;  2R6K A;  3GKK A;  3ZMK A;  3IDV A;  1GWC A;  5G1L A;  4DSR A;  2O8V B;  1FVK A;  3TUE A;  3TDG A;  3EVI A;  3F0I A;  3ERW A;  1H75 A;  4O5R A;  1BED A;  3GN3 A;  4RQR A;  3DKS A;  3QAV A;  1NHY A;  2IN3 A;  2YCD A;  1O7U A;  1XXU A;  4QQ7 A;  6GSY A;  3TKS C;  1QXH A;  3IAM 2;  2YNX A;  4ECI A;  1SEN A;  2LQQ A;  1M0U A;  1R4W A;  5G1K A;  3LXZ A;  4MJA A;  4K1F A;  3E0U A;  3LQ7 A;  2D2Z A;  1TJD A;  4ZB6 A;  3IXR A;  4OD7 A;  4E8H A;  5HR2 A;  4G19 A;  4RI6 A;  2WUL A;  3KIJ A;  1SL1 B;  2M80 A;  4X1U A;  1GLQ A;  3MDK A;  2HNL A;  2AB6 A;  1SL0 B;  5ECR B;  2LQO A;  2RLI A;  1GTU A;  5IMZ A;  4ZB9 A;  2VCV A;  1GSD A;  3O6T A;  1S3A A;  3GHA A;  2HFD A;  2X99 A;  4GSS A;  3HXS A;  2H1G A;  3HDC A;  4D73 B;  2MBS A;  1ST9 A;  2GVP A;  1TRV A;  2LJK A;  2L5L A;  4HU7 A;  3H8Q A;  4OMV A;  4K9Z A;  5DAK A;  3M9J A;  5GZZ B;  4QL9 A;  2EIQ A;  5B8A A;  1DUG A;  3MWH A;  3O76 A;  5A4U A;  1FVJ A;  2IMK A;  1SK2 A;  1B4Q A;  1URM A;  4ZBD A;  1VRS D;  1EGR A;  2WB9 A;  5ECP B;  5A4W A;  5HR1 A;  1BX9 A;  1TRS A;  17GS A;  2GQK A;  3G7J A;  6GSW A;  2CVD A;  1GP1 A;  3U6V A;  7GSS A;  4ZIJ A;  2B5E A;  1F2E A;  3APQ A;  4FO5 A;  5DDL A;  2G2Q A;  2H1B A;  1AQW A;  2NDO A;  3F6D A;  5IO0 A;  3E3E A;  1SK0 A;  1SJZ A;  2KP2 A;  3FZ9 A;  2NBS A;  3W6G A;  2PBJ A;  3ZZX A;  1PMT A;  2GSQ A;  3IRA A;  4GST A;  3W8S A;  1PL2 A;  1PKW A;  2L4Q A;  4MJE A;  3VFI A;  5DAL A;  1XBS A;  5G30 A;  1R7H A;  4MAB A;  5KEJ A;  1Y6E A;  3A2X A;  1UVZ A;  1GSY A;  3IA1 A;  1B8X A;  2FA4 A;  4ZXG A;  2JZT A;  2LJA A;  3L9S A;  1S3C A;  4Q5N A;  3LG6 A;  1WPI A;  3GL5 A;  3ZVJ A;  3EU3 A;  5DQY A;  1WIK A;  4NHW A;  5DJL A;  1A8L A;  1O73 A;  1XW5 A;  5J9C A;  4V2L A;  1XIY A;  5COH A;  3FYG A;  3HYP A;  1GUH A;  3M3M A;  5F0G A;  1SD9 A;  2JAD A;  3ED3 A;  1MD4 A;  2DBC A;  3FZA A;  2XBQ A;  4GF0 A;  1THX A;  4DSS A;  1GTI A;  3LJR A;  5GAP D;  2LUS A;  1XW9 A;  2JZS A;  1U88 A;  4IBP A;  3TJB A;  1YF1 A;  4MDC A;  1JZW A;  2H1D A;  3GIX A;  1EV4 A;  2B6M A;  1XWC A;  2VLV A;  2CVB A;  1PD2 1;  3N9J A;  1QQ2 A;  4DSQ A;  3C71 A;  1LJR A;  2DMM A;  2MMO A;  4EE0 A;  4PUF C;  4NMU A;  2GZZ A;  3F63 A;  5IIZ A;  1K0A A;  3H1N A;  6GSS A;  4HS1 A;  3I6A A;  3WGX A;  2VL9 A;  2IWT A;  4F2I A;  4IQA A;  4CDO A;  2H1A A;  1TW9 A;  11GS A;  2MZC A;  4TRX A;  2PVQ A;  1KEB A;  1T7P B;  3EU4 A;  3L0H A;  4ILF A;  2HI7 A;  2LNT A;  2QKE A;  1K3Y A;  2OE1 A;  3C1S A;  3DWV A;  2AYT A;  2PVO C;  3UAP A;  1EWX A;  4BWS A;  1EOH A;  2X8C A;  2VD0 A;  3F4S A;  5JWO B;  2C3T A;  4K6X A;  2YOI A;  3UBL A;  1FW1 A;  2LV3 A;  1MDI A;  2YV7 A;  2B1K A;  3HJP A;  3UJ1 A;  3HVV A;  5EL8 A;  2DIZ A;  1WE0 A;  1ZCP A;  3DD3 A;  5GST A;  5FWG A;  1WMJ A;  3GYK A;  2DJ0 A;  2I9H A;  3VWX A;  1W4V A;  2DJ3 A;  1J08 A;  4TR0 A;  5CYY A;  4FYB A;  4F0C A;  1PX7 A;  3TKP A;  4RI7 A;  2RM5 A;  5KN0 A;  2ZUP A;  1ERW A;  1DE1 A;  3G7Y A;  2FLS A;  1Y25 A;  4WET A;  1NSW A;  3G9B A;  3UEM A;  3ERF A;  4PUR A;  2P31 A;  3M0F A;  3GV1 A;  2WGR A;  5HR0 A;  3GRX A;  1ZYE A;  4EC0 A;  2FNO A;  2VUP A;  1WRY A;  1W89 A;  2NPB A;  2OBI A;  5J3R A;  1EEM A;  1GUK A;  4IJ3 A;  2C8U A;  4XIH A;  3VK9 A;  2IFQ A;  1GSU A;  1VF3 A;  1AQX A;  3P2A A;  3CRU A;  2OAC A;  5EVO A;  4AGS A;  4YQM A;  1GNE A;  2X64 A;  2GS3 A;  2VLU A;  4N30 A;  2ALB A;  1YEP A;  3L9U A;  3F6F A;  5FHI A;  4F0B A;  1FB0 A;  4LL1 B;  3IAS 2;  3M1G A;  4EO3 A;  3CBU A;  3MSZ A;  1AIU A;  3NZN A;  3A2W A;  3NIV A;  1XCC A;  2X8G A;  1M2B A;  3QAW A;  2OAD A;  4MCU A;  4ZIL A;  4YQU A;  1I9D A;  4P3Y B;  4MK3 A;  1XFL A;  2MMZ A;  5CRE A;  3GUS A;  1F9M A;  1EP8 A;  4WR5 A;  2F9S A;  3D4M A;  1XVW A;  5AIV A;  2PGT A;  4RQX A;  4OFN A;  5H5Q A;  13GS A;  4G10 A;  2K18 A;  2FA8 A;  5CRH A;  1PX6 A;  3PIN A;  2L6D A;  2CX3 A;  2B1L A;  4K8M A;  3LWA A;  3TJK A;  3KP9 A;  1X0R A;  4TR1 B;  4ML1 A;  4GWR A;  4KX4 A;  3ZL5 A;  4MJC A;  4ZBA A;  19GS A;  3FR3 A;  2IMD A;  2K6V A;  4MPF A;  3IHQ A;  1T8E B;  5IM9 A;  3UBK A;  4WF4 A;  3EMX A;  5JCU A;  4MH3 A;  1J9B A;  3LYP A;  3EUR A;  3KGK A;  3TKS E;  2O87 A;  1MEK A;  2VO4 A;  4NWY A;  3UOM A;  4TKY A;  3F3Q A;  2A4V A;  1TI1 A;  3VWW A;  1T4Z A;  3H93 A;  3FKF A;  2OJL A;  2AV4 A;  5IOX A;  2BMX A;  3G7I A;  2V1M A;  1M9B A;  3KJY A;  3GTU B;  2ON5 A;  1A23 A;  3BD2 A;  3F4R A;  1DSB A;  2LJR A;  20GS A;  2M46 A;  3RHB A;  2KHP A;  2TRC P;  3EYT A;  4CW9 A;  2E2G A;  1E6B A;  2FWE A;  1ML6 A;  1F3B A;  3I69 A;  4MF5 A;  1V98 A;  2HXK A;  1RK4 A;  4PUA A;  4TR4 A;  3IOS A;  3IBH A;  3FR9 A;  2WZ9 A;  3WYW A;  4V2M A;  4KDX A;  2QC7 A;  1K0O A;  4TR3 A;  1O85 A;  1ZZY A;  4ZL9 A;  1GLP A;  1GSS A;  2GQL A;  1Z7R A;  1X5C A;  4ZL8 A;  2C80 A;  4PXO A;  3TKQ A;  2DLX A;  1EOG A;  2KOK A;  1TKD B;  1Z3E A;  5IPG A;  1XOA A;  1M2A A;  4GCI A;  4KCA A;  1PN9 A;  1OVN A;  4JR6 A;  1BJX A;  3HZ4 A;  4IVF A;  5CAX A;  2VM1 A;  3R2Q A;  1OC9 B;  2LST A;  1OC3 A;  4I2U A;  3RDW A;  1K0M A;  1F37 A;  5B8B A;  2A2S A;  2DC5 A;  1ABA A;  2HT9 A;  1EV9 A;  3V1W A;  2H30 A;  1FB6 A;  2ZCT A;  4FH8 A;  5ENU A;  3EE2 A;  4KUN A;  2I1U A;  1B48 A;  2VCX A;  2H8L A;  3OR5 A;  2E2M A;  3ZIJ A;  4X0X A;  1XOB A;  2GSR A;  2LRC A;  1YJ6 A;  5CNW A;  2I81 A;  5CP1 A;  1GL8 A;  4HZ4 A;  2RM6 A;  4LMW A;  2OE0 A;  4HOJ A;  2CZ2 A;  4ECC A;  3CYN A;  3LEF A;  4K0N A;  1M99 A;  1RW1 A;  4N0Z A;  1U87 A;  3KXO A;  1T00 A;  2PWJ A;  2IMF A;  3J7Y k;  3RPN A;  4HQZ A;  2CQ9 A;  3LOR A;  4IS0 A;  2GT6 A;  2C3Q A;  3C7M A;  4WKW A;  3US3 A;  5JCW A;  3TGZ A;  1JZD A;  5INY A;  3EC3 A;  5FT3 A;  1GUL A;  1OKT A;  3VPT A;  3QFB C;  2HZE A;  1XW6 A;  4F03 A;  3HCZ A;  1U3I A;  3K8N A;  3DXB A;  2HRF A;  2V6K A;  3VI5 A;  4TXO A;  2IJY A;  2AAW A;  2IYJ A;  3A2V A;  2B3S A;  3HVX A;  2JSY A;  1KBN A;  1VF1 A;  2YWO A;  3A5W A;  4IHU A;  5HFK A;  3GST A;  3GNJ A;  1FHE A;  2WJU A;  3TRX A;  3ME8 A;  1T1V A;  3UMA A;  4MJB A;  1OKD A;  1T4Y A;  1ZGN A;  2VLT A;  2R37 A;  1PL1 A;  4MZB A;  1ILO A;  5DCG A;  3ZIT A;  4K2D A;  5HQP A;  2DSA A;  3QCP A;  5F8B A;  5IO2 A;  14GS A;  1ERU A;  4I97 A;  3KCM A;  1O6J A;  5ECN B;  1U3A A;  5ECH B;  1DBY A;  1PGT A;  2FWF A;  2H66 A;  1DE2 A;  4Z7X A;  1B9X C;  1FO5 A;  4YH2 A; 
#chains in the Genus database with same CATH topology
 2F8A A;  1RGK A;  3ZVJ D;  3S29 A;  3GZB A;  1OE7 A;  3GUR A;  2WGQ A;  2Z7A A;  3D4T A;  3TB2 A;  1PN0 A;  10GS A;  5D9W A;  2FHE A;  2E2U A;  2GQM A;  2K8S A;  2B7J A;  1DMN A;  2F8F A;  1VQ6 3;  4IT7 A;  3WDG B;  4MF7 A;  9RNT A;  1HZ1 A;  1X1X A;  4BVY B;  4AJ8 A;  1EGO A;  3D5G A;  3UNL A;  1O7P B;  3KCH A;  5D9X A;  1QJG A;  2M7O A;  1RCK A;  3LZA A;  1C72 A;  5AII A;  3L9V A;  4AJ7 A;  1F6M C;  4F82 A;  1A2M A;  2YPM A;  3UIW A;  3FGY A;  3T0U A;  1CQS A;  5D93 A;  1M1X B;  3WT1 A;  2OA7 A;  1TXX A;  2E7P A;  1JZO A;  4XM4 A;  4OWY A;  1NM3 A;  3CC7 3;  2FGT A;  4OVM A;  1BNG A;  3CSI A;  1JHB A;  3FG1 A;  4GXZ A;  5IMF A;  1V58 A;  3FR6 A;  1PFP A;  3L78 A;  2L57 A;  2ZDJ A;  2LYX A;  4HYZ A;  2YV9 A;  3TRQ A;  1JB5 A;  1YJ9 3;  2V32 A;  1IVW A;  3B8L A;  2CK3 H;  1PA3 A;  5DCH A;  2C0D A;  5EEO A;  3VWU A;  1FGM A;  2IMI A;  1UW1 A;  3KH7 A;  2M72 A;  1AXD A;  5HFI A;  3ZYW A;  5BXQ A;  2CFG A;  2XSO B;  1V2A A;  2MYG A;  1G96 A;  3D21 A;  3DEX A;  1G0T A;  1QVG 2;  4AKZ A;  2FD3 A;  3KZQ A;  4KA0 A;  2CZ3 A;  2CAI A;  2HZF A;  2K8V A;  2YAN A;  5ABR A;  4JBB A;  1RDS A;  1KSI A;  1GOY A;  1AQV A;  1Z6M A;  1OAZ A;  4JE1 A;  2N5B A;  3UAR A;  3GZY B;  3MG2 A;  3LTA A;  3TJJ A;  2H71 A;  2GGT A;  1UI8 A;  3D6I A;  3D5I A;  4CJN A;  2FY6 A;  1ZOF A;  3JCM L;  2BU4 A;  1AUC A;  3DGY A;  1DET A;  4L0W A;  2ML6 A;  3NBB A;  2CAQ A;  4RNY A;  3GA4 A;  2PNC A;  5KP4 A;  1RGH A;  3HA9 A;  4J56 E;  2F4Y A;  4XTS A;  7RNT A;  3AHS A;  1K0N A;  1JBT A;  4IEL A;  2GEY A;  3F8H A;  2BJX A;  2DIY A;  1AC1 A;  1ZMA A;  3O3T A;  5F07 A;  3RPP A;  3GKM A;  3H79 A;  4EVM A;  2PPT A;  3CPO A;  3VI7 A;  5IEN A;  4EKZ A;  1OGZ A;  2P5R A;  4BL7 A;  4GQC A;  1O7N B;  2P09 A;  2CC3 A;  2NVL A;  4K7I A;  4HJ2 A;  4MP4 A;  1W6C A;  1IT7 A;  1VQK 3;  2CT6 A;  3PXM A;  1H4O A;  2J23 A;  2REM A;  4D73 A;  1V9W A;  2GT5 A;  4IQ1 A;  1TI3 A;  3VUR A;  1HD2 A;  4O02 B;  4TN8 A;  2VM2 A;  2GZP A;  1JN5 A;  2XRX B;  3HOH A;  1UDI I;  1BG5 A;  1E2Y A;  4WFO A;  2KUC A;  1OHS A;  1WJK A;  2YP6 A;  3GKN A;  3ZIV A;  2G0F A;  2VD1 A;  5KN1 A;  2VL2 A;  1Q9E A;  2YZU A;  4GSN A;  3VWV A;  1YGW A;  3BLZ A;  2VOC A;  1SKW B;  1AW9 A;  5AIS A;  1ULI B;  5LC7 A;  1AAZ A;  3Q6O A;  1A90 A;  1I5G A;  3EMP A;  2H73 A;  5G5F A;  2P0M A;  3KSP A;  3KMN A;  3TKR A;  1LOX A;  4X4J A;  4XS4 B;  2HRN A;  1F8N A;  2J8X B;  2QGU A;  2WDU A;  5EY6 A;  3Q19 A;  4JZQ A;  2F5M A;  2B5Y A;  1GRX A;  3CCE 3;  3L4N A;  3NM2 A;  5JCG A;  4IKH A;  3TRP A;  1OUN A;  1JJ2 2;  3SYU A;  4HBR A;  1Z5Y E;  4RNZ A;  1UCJ A;  1CQH A;  2XBI A;  3KTB A;  2YWI A;  2O85 A;  2I3Y A;  1RGL A;  3APO A;  1BOX A;  2YWM A;  1I0V A;  1OAC A;  1R5A A;  4ORL A;  3KD0 A;  1RGC A;  2VL2 C;  4Q5Q A;  1DYU A;  5ELG A;  3PPU A;  2E2T A;  4TVE A;  3ERG A;  2VCZ A;  3ZRE A;  1X9S B;  4LEH A;  1C54 A;  1XWK A;  4O5U A;  3DVX A;  2GSP A;  1BIR A;  5ECQ B;  3HI7 A;  5M18 A;  1SAR A;  1RJO A;  4PQI A;  3F8X A;  2VIM A;  2YWN A;  1K8A 4;  3FY7 A;  2XHF A;  1A2L A;  1SJW A;  1BVI A;  2RBI A;  3KP8 A;  3NV0 B;  3FSD A;  3ISO A;  1YZX A;  2W04 A;  1HNB A;  3NBR A;  4J2F A;  2H19 A;  5KN2 A;  4PNG A;  2HMM B;  4HM3 B;  3ZTL A;  4TOP A;  4PQH A;  1BRH A;  5J5N A;  2R2J A;  1HYU A;  1V74 A;  3CCL 3;  2RUF A;  5IMA A;  4Q5R A;  4USS A;  3BOA A;  4GL6 A;  2F3M A;  4KB3 A;  3ZFZ A;  2B7K A;  2WS2 A;  2FWG A;  4IPB A;  4ZBB A;  4GTU A;  3VLN A;  3F14 A;  3GRD A;  1XWG A;  1GD3 A;  4N10 A;  3ZFL A;  4J57 E;  2QIY A;  1UN2 A;  5C04 A;  2F99 A;  3EBY A;  3P90 A;  1A2K A;  2F98 A;  4STD A;  5BU4 A;  1YHQ 3;  2H6X A;  1IQX A;  5D73 A;  2LRN A;  4BVY A;  4NXI A;  2HRK A;  1GH2 A;  1D6Z A;  3DVW A;  4PQ1 A;  1LU4 A;  2EC4 A;  1WMN A;  2H72 A;  2H74 A;  4CY6 A;  1Q4J A;  4J5K A;  2L5O A;  1B9Y C;  3MHE A;  2KXG A;  3K63 A;  12GS A;  1SKR B;  2QA2 A;  5D9T A;  1TRU A;  3QD9 A;  1FOV A;  4HI7 A;  1SL2 B;  4NRE A;  3QMX A;  4F9Z A;  4XRD A;  4EXJ A;  3JUM A;  1TK0 B;  2KRT A;  1M7T A;  4MH2 A;  1R5P A;  4GLT A;  4AKY A;  4POM A;  1W5Z A;  3EX9 A;  3BCK A;  4HJM A;  4ULX A;  4K0G A;  3ROB A;  1QK8 A;  2LQV A;  1WWJ A;  1A2J A;  4BL3 A;  3FG4 A;  5DRV A;  3KEB A;  5CK6 A;  1VQ4 3;  3LGC A;  1S72 3;  3NQZ A;  1KNG A;  4ML6 A;  5IPH A;  1A0R P;  4BTX A;  22GS A;  3DIE A;  2VCQ A;  5ECK B;  2XH9 A;  1XVQ A;  2E0Q A;  1V40 A;  4QL7 A;  2BT3 A;  4IW9 A;  3L0R A;  3ZLP A;  1X9M B;  2XPE A;  1PKZ A;  3X3Y A;  4XCS A;  5FGO A;  1MTC A;  3MNG A;  4BVX B;  1DMM A;  3SOA A;  3CNM A;  4TW5 A;  4X2H A;  1GOV A;  6GSV A;  1K3L A;  2CWU A;  3F9S A;  5AYR B;  5ID2 B;  5CO3 A;  3TCO A;  1N8R 4;  2GZY A;  3CU3 A;  1G6W A;  4HM2 B;  1ZYP A;  2YZH A;  4G0L A;  2YJH A;  4OCF A;  4LA1 A;  1BRJ A;  4O92 A;  1UCI A;  3QOU A;  3GSP A;  3PZW A;  5IMC A;  5LD0 A;  3LML A;  4MZW A;  4WP5 A;  4GQF A;  4MF6 A;  3BJ5 A;  3MSO A;  1GUM A;  1JLV A;  2P5Q A;  5AN1 A;  2WCI A;  1YI2 3;  3CSH A;  1SU9 A;  1YY7 A;  1IYH A;  3EWL A;  2CFK A;  2DJK A;  3GSS A;  1RCL A;  3HY2 A;  1NW2 A;  4AJ6 A;  5C00 A;  2JAC A;  1IV7 A;  2C4J A;  2V6O A;  3A76 A;  4BWQ A;  5GSP A;  2LRT A;  4NPB A;  1OYJ A;  1X1W A;  1X9W B;  2JQ5 A;  1G7O A;  1FGQ A;  5A4V A;  3P7X A;  3DML A;  5I97 A;  2OWP A;  3EBT A;  3CRT A;  1R4Y A;  3FZ5 A;  1J0F A;  1QMV A;  3KMO A;  2W2C A;  5KP3 A;  3F3R A;  1B2X A;  4JRR A;  3X40 A;  4L8E A;  4WXT A;  4XB5 A;  1GTA A;  1SKS B;  1BRG A;  1VQO 3;  2LS5 A;  1JKG A;  4BTY A;  4MA9 A;  1US1 A;  2R4V A;  4YKG A;  3WGD A;  1E3V A;  3A3T A;  4XBY A;  2L6C A;  2FWH A;  3LFL A;  4KE3 A;  2UUG C;  2Y73 A;  5JBS A;  1HNC A;  3NOF A;  4XS4 A;  2FCH A;  1A0F A;  2KCD A;  4JED A;  2CHC A;  2QEX 3;  1NJI 4;  4OO5 A;  1NU3 A;  2FGX A;  4E8E A;  1GMQ A;  1S3R A;  3BNB A;  2RSX A;  1F3A A;  1M2D A;  1ON4 A;  2LKU A;  5IMD A;  4KVH A;  2IPA A;  1DMQ A;  3OX9 A;  3KZT A;  5ECO B;  1JNQ A;  2HSY A;  1TOF A;  1AVK A;  1Q98 A;  1B27 A;  3EF8 A;  4KW6 A;  1BNE A;  4H86 A;  2L59 A;  2KF5 A;  1EEJ A;  1X5E A;  2RII A;  4WF5 A;  1BSC A;  1ULJ B;  4KGI A;  3FZ4 A;  2GST A;  2H0G A;  2CX4 A;  2NTO A;  1VQM 3;  3QDN A;  3D5J A;  1UGI A;  3FK8 A;  3TJG A;  4CCV A;  1Q40 B;  1Q42 A;  3JUQ A;  3UL3 A;  4KDU A;  3BNE A;  5L71 A;  1RNB A;  1T3B A;  3M8C A;  1QAK A;  2IY2 A;  2H6Z A;  4G0I A;  2DML A;  1RN7 A;  4LLR A;  1HU9 A;  3HII A;  2XC2 A;  3I9V 2;  4V1A g;  4FYU A;  1LOV A;  1Z9H A;  2TIR A;  3VPQ A;  1N2A A;  2KLX A;  4O5Q A;  4G9H A;  4IP6 A;  3U5R E;  4KND A;  2AHE A;  6GST A;  4IGJ A;  5ECL B;  1GSE A;  4I8B A;  5DVB A;  1GSQ A;  3OWU A;  2ON7 A;  3KM6 A;  4KDY A;  2VCW A;  2IIY A;  4R9L A;  4L5O A;  1LQM B;  4O3V A;  3EB8 A;  2GBW B;  4YAV A;  4EC6 A;  4N11 A;  3FEU A;  1SK1 A;  1TU5 A;  1U6T A;  3KN4 A;  1TDI A;  2PMT A;  1I2F A;  3ZML A;  5LCZ A;  2CIU A;  2DJ1 A;  3BCI A;  4TR1 A;  4YKF A;  2HSH A;  3KII A;  3NXJ A;  5EVH A;  4NV2 A;  3PR8 A;  3DGN A;  3D9R A;  3EN1 B;  3ME7 A;  4OFM A;  2F51 A;  2XFS A;  2IFQ B;  2C1Y A;  3FH1 A;  5CRW A;  1QFN A;  4NAX A;  4V2N A;  1TRW A;  1D6U A;  4BPY A;  4LL4 B;  3LYK A;  1ZYN A;  4EIQ A;  2HYX A;  1PY3 A;  4EDY A;  4FYC A;  4PGT A;  1JFU A;  3T8U A;  4KT3 B;  3Q18 A;  3LSZ A;  2RFR A;  2C10 A;  4L5L A;  3WHO A;  2WFC A;  1LRA A;  2BIR A;  3X3X A;  3OWS A;  2H01 A;  3SWL A;  4HEA 2;  1SJI A;  1CH0 A;  1G6Y A;  1AR0 A;  3SXX A;  5JWQ B;  1OE8 A;  4KCE A;  3HD5 A;  4FMC A;  3HJO A;  1BRK A;  5CRG A;  2LNS A;  1VZZ A;  4WYK B;  1RKY A;  3LTB A;  3CCJ 3;  3IPZ A;  3LW9 A;  2HMK B;  3SED A;  1MWT A;  4R9K A;  1K0B A;  1R26 A;  4TXV A;  4HUA A;  1SYR A;  4K5R A;  1AY7 A;  5B7C A;  3RBT A;  2IMJ A;  2ZHX B;  1RHL A;  4PTS A;  3FZW A;  3RDE A;  2ZNM A;  3GL3 A;  5G5E A;  3GTU A;  4ECJ A;  3S9F A;  4ECB A;  4JR4 A;  5EQL A;  5G2Z A;  4PNF A;  1IYI A;  1XWB A;  2PUK C;  3FHK A;  4K7O A;  1BRI A;  1RTU A;  2GU1 A;  2XGL A;  1AQZ A;  3FRC A;  2B24 B;  1GY5 A;  2H76 A;  3QAG A;  5HFG A;  3ER7 A;  3IE3 A;  3ZRD A;  1YKC A;  1NHO A;  3RAZ A;  3UVT A;  4BVX A;  4NHZ A;  4LMV A;  4A5P A;  1MDK A;  5ELA A;  1TK8 B;  3SOY A;  3DM8 A;  4AF2 A;  6GSU A;  1TTZ A;  1RQM A;  1MDJ A;  5E4W A;  3D0Z A;  3KH9 A;  1IYY A;  5ID2 A;  4LZI A;  2O89 A;  1BUJ A;  5F05 A;  2W03 A;  1FAA A;  4HDE A;  1W01 A;  3DGL A;  8GSS A;  2W0Q A;  2JZR A;  2GDR A;  1PRX A;  3DUK A;  4EL1 A;  3RNT A;  3QFA C;  2X8H A;  4MMZ B;  5D9V A;  1LQG C;  4LGQ A;  4YQV A;  2GLR A;  2P0G A;  4O32 A;  3IJE B;  1OF5 A;  1UUW B;  3CCQ 3;  2DJ2 A;  1JB2 A;  4HZB B;  1VQL 3;  1GTB A;  2HE3 A;  1JZR A;  1UCK A;  1MGW A;  2DKI A;  2DKH A;  1STD A;  2FXT A;  4GRF A;  4IN0 A;  4K1U A;  4POK A;  1PQN A;  1USB A;  1WP0 A;  2EIR A;  5FW5 A;  5ECM B;  1FA3 A;  5AEU B;  1TU8 A;  3N54 B;  5D8I A;  5IQY A;  1MD3 A;  3B7C A;  4OFT A;  1OC9 A;  2JU5 A;  2MBT A;  1FUS A;  3X41 A;  1ZYQ B;  3APS A;  2F5W A;  4JRF A;  1V57 A;  4WR4 A;  4ZB8 A;  2W56 B;  4BIK A;  1SD8 A;  1STF I;  4HM1 B;  1PSQ A;  5B6M A;  5AGY A;  1LBK A;  3LYG A;  1JLW A;  1IT8 A;  2H70 A;  2QGV A;  3FW2 A;  3HJM A;  4RNT A;  1UA5 A;  1ERT A;  3WT2 A;  3AY8 A;  4NHF A;  2GTU A;  3CTF A;  3BNC A;  3GKX A;  2C3N A;  3HKR A;  2X49 A;  1GNW A;  2N5F A;  3U1W A;  4MMY B;  2C0F A;  4KH7 A;  4BA7 A;  2LEG A;  3G0K A;  1IVU A;  1YF0 A;  2FUG 2;  3CTG A;  1PU4 A;  4FIW A;  4EIP A;  3JUP A;  3E9J B;  1RGA A;  1FW7 A;  2MMN A;  3C8E A;  1CYU A;  5KN3 A;  5CRD A;  1BYE A;  2I4A A;  5ECI B;  1HKX A;  1U8C B;  2DJJ A;  2XPD A;  4CDL A;  4XRA A;  3EE1 A;  5HOH A;  3BIR A;  3GH9 A;  1N8J A;  5BRT A;  1CEW I;  2AJQ B;  5D81 A;  9GSS A;  5E59 A;  3EIN A;  3G4S 3;  4RUV A;  4MEI A;  4MMM A;  3DYR A;  2H0H A;  2HOH A;  3PCR A;  4GSP A;  1EP7 A;  2H6Y A;  4YAP A;  2R3X A;  2RUE A;  4MZC A;  2WRT A;  4O7H A;  5J9B A;  1Q40 A;  1VGL A;  3HK4 A;  5AIH A;  2PER A;  4HZ2 A;  2TRX A;  3DGO A;  5CF2 A;  2HMN B;  3HHV A;  3VSY A;  3SLU A;  3D22 A;  3AMO A;  3LTC A;  1MWU A;  1BQ7 A;  1N5P A;  3C73 A;  2R4I A;  3RHC A;  5KOW A;  3Q3F A;  1N9E A;  4NV5 A;  2HMJ B;  3WD6 A;  4CHS A;  4OUQ A;  4WBR D;  4AEQ A;  4HQS A;  4I6X A;  1KTE A;  1EZK A;  1IQY A;  3CC4 3;  3M8N A;  3GH6 A;  2ML5 A;  1XPV A;  3IK9 A;  4HOH A;  2C4B A;  3OWY A;  4K7N A;  2KP1 A;  4N6N B;  1O8X A;  4HU9 A;  3I0Y A;  2H75 A;  3S67 A;  3F4T A;  2BTO T;  1Q7Y 4;  2VL3 A;  5M19 A;  3I55 3;  4N0V A;  3PH9 A;  4IJI A;  3F9U A;  3GX8 A;  1T2H A;  4KAE A;  3N5O A;  2CA8 A;  5DJM A;  1YJW 3;  1O81 A;  1QUW A;  4HAA A;  3MYD A;  1BNS A;  1ERV A;  3SBC A;  1YEX A;  1K3O A;  1CYV A;  4KFF A;  2YX9 A;  2CV4 A;  3IPT A;  1RGE A;  3W8J A;  2C11 A;  1BRS A;  3UL6 A;  3O8Y A;  3C1R A;  2R0P A;  5IEO A;  4EDZ A;  1HNA A;  1M3I A;  2YN1 A;  4FMD A;  8RNT A;  1VQ9 3;  3GZR A;  1YGE A;  2CG1 A;  3WGE A;  1QMA A;  1S3D A;  2F86 B;  1Q86 4;  1YKA A;  3JUN A;  5F06 A;  2N5A A;  3K9M C;  2JL4 A;  1M9G A;  5B6N A;  2EIO A;  4DEJ A;  3DGM A;  3GFK A;  1XWA A;  3HZ8 A;  4MJD A;  2FNQ A;  3KKG A;  4HM5 B;  3F8U A;  3PGT A;  3IC4 A;  4POB A;  1B4P A;  5IOW A;  3G6E 3;  4I2T A;  2CVK A;  2PN8 A;  4JU5 A;  4G2E A;  2OBK A;  1VF2 A;  1THO A;  3DY5 A;  5DAK B;  2HZE B;  3CXG A;  1FG4 A;  2V2G A;  4V1A p;  2XEP A;  3TOU A;  2K9F A;  5DQS A;  4MPG A;  4WBJ A;  16GS A;  1K0C A;  3GX0 A;  1JV2 B;  4Q5F A;  4ISD A;  4TXO B;  1CQG A;  1LNH A;  3HVN A;  4MLY A;  4I5Q A;  1W00 A;  1BAY A;  5D96 A;  3GAX A;  2OTJ 3;  3NHX A;  1X5D A;  5CF1 A;  1QGV A;  2L4C A;  5JWR B;  1TP9 A;  3MAK A;  2ES7 A;  2OE3 A;  2WO0 A;  1MWR A;  2GEX A;  4Q53 A;  4WEY A;  1RN1 A;  5G31 A;  4G1M B;  4OCE A;  1OC8 A;  3R3E A;  4LYL B;  3RGA A;  1GSF A;  4EUY A;  2JSZ A;  4EXR A;  4OO4 A;  1ZL9 A;  4IP1 A;  2YFL B;  5DBQ A;  3DRN A;  1TK5 B;  3TJF A;  1N8Q A;  2MMA A;  1M9A A;  1RSN A;  1G02 A;  2V41 A;  5IMV A;  1OCV A;  2A2R A;  3KTL A;  1K73 4;  1XZO A;  2AUV A;  1W7C A;  1BRN L;  5A5K A;  1YDK A;  4ACS A;  3CNX A;  1NB5 I;  1UUV B;  2IL3 A;  2W9Q A;  3F40 A;  3CSJ A;  2CW9 A;  3S28 A;  4EYC A;  2OKA A;  3X3Z A;  3NUV A;  3HVS A;  5EPF A;  2PU9 C;  1BNI A;  2R5G A;  1E3R A;  3IK7 A;  5DAL B;  4KSM A;  1Z6N A;  3UVH A;  3Q74 A;  6GSX A;  4R4K A;  5LNK e;  2GSS A;  1WTH A;  2C0E A;  5J4U A;  1SII A;  4POL A;  4BTW A;  3QRD A;  1IVV A;  2Z9S A;  1EKM A;  4ZM8 A;  3QPM A;  3GMF A;  1NNV A;  4KFE A;  1SYX A;  2X4A A;  4L0U A;  1IK3 A;  5AIX A;  2QSI A;  1ACV A;  5H5R A;  1TRQ A;  2B5X A;  3IV4 A;  4ID0 A;  4EF0 A;  3D3L A;  5IEP A;  3CMI A;  2RGQ A;  2O7K A;  3PGB A;  4K90 B;  2W56 A;  4XDW A;  1HQO A;  1YQ1 A;  1ZS7 A;  4DVC A;  1B21 A;  1K0D A;  2YJ7 A;  3HZP A;  3ZFB A;  4XS6 A;  3H4K A;  2R0G A;  2P0X A;  2IA7 A;  1FOH A;  4ZL7 A;  3I43 A;  5AEW B;  3J7Y b;  2K54 A;  1UC7 A;  18GS A;  2XFT A;  1A8Y A;  1AVL A;  1O8W A;  5GSS A;  1G7E A;  2VAF A;  3OV4 A;  4XS1 A;  1A24 A;  2HLS A;  2VCT A;  4DSS B;  1L5G B;  1YIJ 3;  3M9K A;  2LTK A;  2J9H A;  3DMC A;  3P8W A;  5A0O B;  4XHM A;  5J41 A;  4L7K A;  1VF4 A;  1NO3 A;  4PX1 A;  1WOU A;  5H5S A;  1TU7 A;  4K5S A;  1BNF A;  5AIF A;  2H0I A;  2C0G A;  3LXT A;  1IU7 A;  4R1K A;  1SJ6 A;  5G2G A;  3QR6 A;  5HR3 A;  3DGQ A;  1LOW A;  3IR4 A;  1EQK A;  4KSO A;  5ECS A;  2GXF A;  5GAN D;  2YFI B;  1Z7P A;  3BBY A;  3TKS A;  2IME A;  2R6K A;  3GKK A;  3V92 A;  1YVB I;  3FMW A;  3ZMK A;  4BL2 A;  3IDV A;  3Q90 A;  1GOU A;  1GWC A;  1WQL B;  5G1L A;  4DSR A;  3F7S A;  2O8V B;  2KF6 A;  1FVK A;  2I9W A;  3TUE A;  3TDG A;  2P05 A;  3EVI A;  1KWI A;  1FGO A;  3F0I A;  1FGT A;  3ERW A;  1H75 A;  4O5R A;  1RN4 A;  4Z2R A;  1BED A;  3GN3 A;  4RQR A;  3DKS A;  1MGR A;  1UGH I;  2GBX B;  3WOE B;  3QAV A;  2MF7 A;  1NHY A;  2IN3 A;  5KOX A;  2YCD A;  5AIG A;  1BSE A;  1O7U A;  3CC2 3;  1XXU A;  4EW5 A;  1ZO2 A;  6RNT A;  4QQ7 A;  1KD1 4;  6GSY A;  7GSP A;  3TKS C;  1QXH A;  1BGS A;  2WGO A;  4GB5 A;  3IAM 2;  2YNX A;  2UZ8 A;  1K28 A;  4ECI A;  1SEN A;  2LQQ A;  1JRQ A;  1M0U A;  4N6L A;  4G0K A;  3ECF A;  4BU4 A;  1R4W A;  4L8P A;  5G1K A;  3LXZ A;  4RZM A;  4MJA A;  4K1F A;  3E0U A;  3LQ7 A;  1YJN 3;  2D2Z A;  1TJD A;  4ZB6 A;  3IXR A;  1M90 4;  4OD7 A;  4E8H A;  5ELJ A;  4CPK A;  5HR2 A;  4G19 A;  4RI6 A;  4HM8 B;  1W2Z A;  4JF8 A;  2WUL A;  4KFD A;  3KIJ A;  1SL1 B;  2M80 A;  4X1U A;  1GLQ A;  3MDK A;  2HNL A;  1VQ7 3;  2AB6 A;  1RRL A;  2BMR B;  1RLS A;  1SL0 B;  5ECR B;  1BSA A;  2LQO A;  3E99 A;  2RLI A;  3ZG0 A;  1GTU A;  5IMZ A;  4ZB9 A;  2VCV A;  1GSD A;  3O6T A;  1S3A A;  3NV0 A;  1IV9 A;  3GHA A;  3WOD G;  2HFD A;  1A2V A;  4HSC X;  2X99 A;  3WR2 A;  1MOL A;  4GSS A;  3HXS A;  4XBX A;  2H1G A;  3HDC A;  4D73 B;  3GWR A;  2MBS A;  1ST9 A;  1BSB A;  2GVP A;  1TRV A;  2LJK A;  2L5L A;  4HU7 A;  3H8Q A;  4OMV A;  2AAE A;  4J5G A;  4K9Z A;  3AGN A;  5DAK A;  3M9J A;  3MPH A;  5GZZ B;  4QL9 A;  2EIQ A;  5B8A A;  1DUG A;  2Z76 A;  3MWH A;  3O76 A;  1VQ5 3;  3FKA A;  5A4U A;  1FVJ A;  1IVX A;  2STD A;  2IMK A;  4FCM A;  1FO5 A;  1SIH A;  1SK2 A;  1B4Q A;  2YFJ B;  1URM A;  2D1W A;  4ZBD A;  2K3D A;  1VRS D;  3Q2P A;  1EGR A;  2WB9 A;  5ECP B;  4O8S A;  5A4W A;  4HM4 B;  1U5O A;  5HR1 A;  3V99 A;  1BX9 A;  1TRS A;  17GS A;  2GQK A;  3G7J A;  6GSW A;  2CVD A;  1GP1 A;  1I2E A;  2XF3 A;  3U6V A;  7GSS A;  1ZX2 A;  1M1K 4;  2F56 A;  4ZIJ A;  2B5E A;  1F2E A;  3APQ A;  1W2B 2;  2RCD A;  4FO5 A;  5DDL A;  1ROV A;  2G2Q A;  4H3U A;  2H1B A;  1AQW A;  2NDO A;  3F6D A;  5IO0 A;  3BND A;  3E3E A;  1SK0 A;  2HRA A;  1SJZ A;  2KP2 A;  5IF6 A;  3FZ9 A;  2NBS A;  3W6G A;  2PBJ A;  3ZZX A;  1PMT A;  1LNI A;  2GSQ A;  3IRA A;  1B2M A;  2UGI A;  4GST A;  3W8S A;  1PL2 A;  1PKW A;  2L4Q A;  6GSP A;  3JVC A;  4KZ1 A;  4MJE A;  1YNV X;  4X2O A;  3WMD A;  3VFI A;  2CX0 A;  5DAL A;  1XBS A;  4EBG A;  5G30 A;  4LSO A;  1R7H A;  4MAB A;  3BB9 A;  5KEJ A;  3V98 A;  1Y6E A;  3A2X A;  1UVZ A;  1AV4 A;  1MNL A;  1TTO A;  2BMO B;  1GSY A;  2OTL 3;  3IA1 A;  1B8X A;  2FA4 A;  4ZXG A;  2JZT A;  2CWV A;  2LJA A;  3L9S A;  3A5I A;  2Z6B A;  1S3C A;  4Q5N A;  3LG6 A;  1SQW A;  4N6V 0;  1WPI A;  3GL5 A;  4MMX B;  3EU3 A;  5DQY A;  3ZVJ A;  1WIK A;  1GYB A;  4NHW A;  1I70 A;  1A8L A;  1QAF A;  1O73 A;  5DJL A;  3IHG A;  1XW5 A;  2QA1 A;  5J9C A;  4V2L A;  1XIY A;  5COH A;  1IQ8 A;  3FYG A;  1XG8 A;  3HYP A;  2A4H A;  1OHP A;  4I4K A;  1GUH A;  3M3M A;  5F0G A;  1SD9 A;  2JAD A;  3CCM 3;  3ED3 A;  1MD4 A;  2DBC A;  3FZA A;  2XBQ A;  4GF0 A;  1GS3 A;  1THX A;  4DSS A;  1GTI A;  5LC6 A;  3LJR A;  3MYT A;  1XW9 A;  2JZS A;  2LUS A;  4CY8 A;  2IUK A;  1U88 A;  4IBP A;  1S5A A;  3TJB A;  1YF1 A;  3MWZ A;  4MDC A;  1WMP A;  1JZW A;  2H1D A;  3NQY A;  3GIX A;  4J8T A;  1I3I A;  1VQQ A;  1EV4 A;  2B6M A;  3LT8 A;  1XWC A;  1TIJ A;  3G16 A;  2VLV A;  1YIT 3;  2CVB A;  1PD2 1;  2AAD A;  5CLK A;  3N9J A;  3K7C A;  1QQ2 A;  4DSQ A;  3C71 A;  1LJR A;  2DMM A;  2MMO A;  4EE0 A;  2CG0 A;  4PUF C;  4NMU A;  2GZZ A;  1TFK A;  1TP6 A;  2BHM A;  3F63 A;  5IIZ A;  1K0A A;  3DZL A;  3H1N A;  6GSS A;  5BMU A;  5GAP D;  1LVN A;  4HS1 A;  3I6A A;  2PZV A;  2R0C A;  1WMO A;  5IG3 A;  3WGX A;  2VL9 A;  2IWT A;  4F2I A;  4IQA A;  2WOF A;  2H1A A;  4CDO A;  2KAA A;  1TW9 A;  11GS A;  3H3H A;  1PFO A;  2MZC A;  2HSM A;  2BMQ B;  4HZ9 B;  4TRX A;  2PVQ A;  1KEB A;  3OW2 2;  3MG3 A;  1T7P B;  1UI7 A;  4N3V A;  3EU4 A;  2KF3 A;  3IMA B;  3L0H A;  3EQQ B;  4ILF A;  2HI7 A;  2LNT A;  3AHW A;  2QKE A;  1LOY A;  1K3Y A;  2OE1 A;  3C1S A;  3DWV A;  2AYT A;  2Y74 A;  4J9A A;  2PVO C;  3UAP A;  3JUO A;  1EWX A;  4BWS A;  1EOH A;  2X8C A;  1HYF A;  2VD0 A;  5JPP A;  4DKI A;  3F4S A;  5JWO B;  2C3T A;  4K6X A;  2YOI A;  1RRH A;  1A67 A;  3UBL A;  1FW1 A;  4PEJ A;  1X1U A;  2GU3 A;  2LV3 A;  3WA3 A;  1MDI A;  4XBT A;  2CX1 A;  2YV7 A;  2B1K A;  1WNH A;  3HJP A;  3UJ1 A;  1GMR A;  1GY7 A;  3FCS B;  3HVV A;  5EL8 A;  2DIZ A;  1WE0 A;  3S5C A;  3D4A A;  3LOY A;  1ZCP A;  1VQP 3;  3DD3 A;  5GST A;  1B3S A;  1BSD A;  2BO9 B;  5IG0 A;  5FWG A;  1WMJ A;  1Z1S A;  3VF1 A;  1NB3 I;  3KE7 A;  2MC8 A;  3GYK A;  2DJ0 A;  3STD A;  2I9H A;  3VWX A;  1W4V A;  1GMP A;  1Q81 4;  2DJ3 A;  1J08 A;  4TR0 A;  1Q7H A;  5CYY A;  3MKI A;  3J7Y d;  4FYB A;  1VQN 3;  4F0C A;  1PX7 A;  3Q1C A;  4N6M A;  3TKP A;  1ASK A;  2RM5 A;  4RI7 A;  5KN0 A;  4H61 A;  2ZUP A;  1GY6 A;  3CCU 3;  3G71 3;  2E2V A;  3WA2 X;  3FLJ A;  1ERW A;  1DE1 A;  3G7Y A;  2FLS A;  2HMO B;  1Y25 A;  1NWW A;  2CFL A;  8CHO A;  2IUJ A;  1OH0 A;  4WET A;  1NSW A;  4QWT A;  3G9B A;  3UEM A;  3ERF A;  3SVA A;  4PUR A;  3QK9 A;  3CME 3;  2P31 A;  3M0F A;  3GV1 A;  5ELU A;  2WGR A;  2V1L A;  4FMB A;  5HR0 A;  3GRX A;  4HM0 B;  1ZYE A;  4EC0 A;  1QAL A;  2FNO A;  2VUP A;  1WRY A;  3NBJ A;  1W89 A;  2NPB A;  1SPU A;  1JKG B;  2OBI A;  3B4O A;  5J3R A;  1EEM A;  1GUK A;  3CPW 2;  4IJ3 A;  3X42 A;  2C8U A;  4XIH A;  3IC8 A;  4HVN A;  3VK9 A;  2IFQ A;  1GSU A;  1VF3 A;  1AQX A;  3P2A A;  3CRU A;  2OAC A;  2ZL8 A;  5EVO A;  1FZU A;  4KF9 A;  4AGS A;  4YQM A;  1RNT A;  1TFO A;  5D83 A;  1GNE A;  3G8Z A;  2X64 A;  1KC8 4;  2GS3 A;  5BVB A;  2VLU A;  3B4P A;  4N30 A;  1I2G A;  1YEP A;  2ALB A;  4Z2U A;  3L9U A;  3F6F A;  1N9J A;  2QA4 3;  5FHI A;  4F0B A;  1FB0 A;  4LL1 B;  3IAS 2;  3M1G A;  4EO3 A;  3CBU A;  3MSZ A;  1AIU A;  3NZN A;  3CD6 3;  4EV5 A;  3A2W A;  3CMA 3;  3NIV A;  1XCC A;  2X8G A;  1M2B A;  1E97 A;  3QAW A;  1W6G A;  4WYK A;  2OAD A;  4MCU A;  4K2X A;  2HML B;  4ZIL A;  1TRP A;  4YQU A;  1I9D A;  4P3Y B;  4MK3 A;  1RMS A;  1DVC A;  1FUW A;  3CCV 3;  1XFL A;  2MMZ A;  3T8N A;  5CRE A;  3GUS A;  1F9M A;  1EP8 A;  4WR5 A;  2F9S A;  2CWT A;  2ZA4 A;  3D4M A;  2XR8 B;  6STD A;  1XVW A;  2L1S A;  2K0M A;  1BAO A;  4K61 A;  5TGN A;  5AIV A;  3GZX B;  2PGT A;  4RQX A;  4OFN A;  3URP A;  5RNT A;  5H5Q A;  2OOV A;  13GS A;  4G10 A;  1O7W B;  1OGX A;  2K18 A;  3WOF B;  4R80 A;  4X43 A;  2FA8 A;  2WOH A;  4HJL B;  5CRH A;  2Q07 A;  3PYJ A;  1PX6 A;  3PIN A;  1FGR A;  2L6D A;  4HM6 B;  5IG5 A;  2CX3 A;  2B1L A;  4K8M A;  4HM7 B;  3LWA A;  1GD4 A;  1MWS A;  3KP9 A;  1X0R A;  4TR1 B;  4ML1 A;  3TJK A;  4GWR A;  4KX4 A;  3ZL5 A;  1ROA A;  4ICY A;  1X1Y A;  3HIG A;  4MJC A;  4N6O B;  3EC9 A;  4ZBA A;  19GS A;  3MG1 A;  3CCS 3;  5DRE A;  3FR3 A;  2IMD A;  2K6V A;  2OOV C;  2O9U X;  3IHQ A;  4MPF A;  5STD A;  1T8E B;  1DVD A;  5IM9 A;  3UBK A;  4WF4 A;  1J2B A;  3EMX A;  5JCU A;  4MH3 A;  1J9B A;  3LYP A;  3EUR A;  3KGK A;  4BIR A;  4FCZ A;  2O87 A;  3TKS E;  1MEK A;  2VO4 A;  4NWY A;  2A15 A;  4OK0 A;  1K41 A;  3FF0 A;  2D42 A;  3UOM A;  4TKY A;  3F3Q A;  1A2P A;  2A4V A;  1TI1 A;  3VWW A;  1T4Z A;  3NM7 A;  3H93 A;  3FKF A;  4HKV B;  2OJL A;  5HGR A;  1I3F A;  2AV4 A;  5IOX A;  3KSE D;  2BMX A;  3G7I A;  1O7M B;  1JB4 A;  1M9B A;  2V1M A;  3ALA A;  3KJY A;  1O7H B;  3GTU B;  3MIX A;  2ON5 A;  1A23 A;  4U13 A;  3BD2 A;  3F4R A;  2BNG A;  4RBN A;  1DSB A;  2SBL A;  2LJR A;  4MNN A;  20GS A;  2M46 A;  3RHB A;  2KHP A;  2TRC P;  1GSP A;  3EYT A;  4CW9 A;  2E2G A;  1C7H A;  5D82 A;  1E6B A;  1KQS 2;  2FWE A;  1ML6 A;  1F3B A;  3I69 A;  1T2I A;  4MF5 A;  2CFW A;  1V98 A;  2HXK A;  1M3J A;  1IDP A;  1RK4 A;  4TX4 A;  4PUA A;  4TR4 A;  3IOS A;  1T5Y A;  3IBH A;  3UJM A;  3FR9 A;  3N9H A;  1FUT A;  2WZ9 A;  1DE3 A;  3WYW A;  2INX A;  4V2M A;  4KDX A;  2QC7 A;  1K0O A;  4N6U A;  4TR3 A;  5AI1 A;  2Z77 A;  5CXO A;  3CCR 3;  3LH4 A;  1O85 A;  1ZZY A;  4ZL9 A;  1GLP A;  1GSS A;  2OQE A;  1EA2 A;  3LXU X;  3FF2 A;  2GQL A;  1Z7R A;  1X5C A;  4ZL8 A;  2A2P A;  1R4C A;  3DXO A;  3EJV A;  2C80 A;  1TUH A;  4PXO A;  1BAN A;  1OF5 B;  3TKQ A;  2DLX A;  1EOG A;  2KOK A;  1TKD B;  1Z3E A;  5AYS C;  1LXE A;  3DH2 A;  5IPG A;  1UUG B;  1XOA A;  2W9P A;  1M2A A;  4GCI A;  4KCA A;  1PN9 A;  3K0Z A;  1OPY A;  3U97 A;  1OVN A;  3H51 A;  3S27 A;  2B1X B;  4JR6 A;  3NX0 A;  5IER A;  1BJX A;  1D6Y A;  3HZ4 A;  4IVF A;  5CAX A;  4N6T A;  2VM1 A;  3R2Q A;  1ZGX A;  1OC9 B;  2LST A;  3EPT A;  1OC3 A;  4I2U A;  3RDW A;  1K0M A;  1F37 A;  3EN8 A;  3I56 3;  5B8B A;  2A2S A;  1B20 A;  1UCL A;  2DC5 A;  1PYL A;  3F7X A;  1ABA A;  2HT9 A;  2OQE C;  1EV9 A;  3V1W A;  4L8O A;  2H30 A;  1FB6 A;  2ZCT A;  4FH8 A;  2JDI H;  5ENU A;  3EE2 A;  1BU4 A;  4EV2 A;  1N5H A;  4KUN A;  2I1U A;  5BIR A;  1B48 A;  2VCX A;  2H8L A;  1RGG A;  1W4N A;  3OR5 A;  3VGN A;  2E2M A;  3D79 A;  3ZIJ A;  4X0X A;  1XOB A;  2P38 A;  2GSR A;  2LRC A;  3EHC A;  1YJ6 A;  3BU4 A;  3N8B A;  5CNW A;  1RGF A;  2I81 A;  5CP1 A;  1GL8 A;  1I0X A;  4HZ4 A;  1JBR A;  2RM6 A;  3UL5 A;  4LMW A;  2OE0 A;  4HOJ A;  2CZ2 A;  1JBS A;  3FG3 A;  3UB1 A;  2R41 A;  4ECC A;  4XDV A;  3CYN A;  3LEF A;  3HX8 A;  1M99 A;  1RW1 A;  4K0N A;  1BNR A;  4N0Z A;  1U87 A;  3KXO A;  1T00 A;  2PWJ A;  4WWU C;  3OXA A;  4BL7 B;  2IMF A;  5KP1 A;  3J7Y k;  3RPN A;  3SX1 A;  4HQZ A;  2CQ9 A;  3PS8 A;  3LOR A;  3PCS A;  4IS0 A;  1Q82 4;  2GT6 A;  2C3Q A;  4LMI A;  4GHO A;  3C7M A;  4WKW A;  3US3 A;  5JCW A;  3TGZ A;  3AGO A;  1JZD A;  2KF4 A;  5INY A;  2XSH B;  3EC3 A;  5FT3 A;  1GUL A;  1OKT A;  1JN5 B;  3VPT A;  3QFB C;  4WHA A;  1W6Y A;  3AMO B;  2HZE A;  3CQF A;  1XW6 A;  1YVS A;  4F03 A;  3CXC 2;  1EUI C;  3HCZ A;  3LTD A;  1U3I A;  3K8N A;  3DXB A;  2HRF A;  2V6K A;  3VI5 A;  4TXO A;  2IJY A;  4FR9 A;  2AAW A;  2L4V A;  2IYJ A;  2CKF B;  1I8V A;  1W02 A;  1B2S A;  3A2V A;  1B2Z A;  2B3S A;  3HVX A;  2RNT A;  2JSY A;  1KBN A;  4K1V A;  1VF1 A;  2YWO A;  1EG9 B;  1ISK A;  3A5W A;  4IHU A;  5IW9 A;  5HFK A;  5IG4 A;  3GST A;  3GNJ A;  3TOT A;  1OHO A;  1FHE A;  2WJU A;  3TRX A;  3ME8 A;  1T1V A;  1NDO B;  3UMA A;  2XGN A;  4MJB A;  2CH9 A;  1OKD A;  5M1A A;  1QVF 2;  1T4Y A;  3K5T A;  1O7G B;  1ZGN A;  2UX0 A;  2VLT A;  4O2H A;  2R37 A;  2OCT A;  4FQU A;  1PL1 A;  4MZB A;  1ILO A;  1BNJ A;  1K9M 4;  1BUQ A;  2CFD A;  5DCG A;  3ZIT A;  2SAR A;  5JPU A;  4Z2T A;  1Y4K A;  1B2U A;  4K2D A;  4FCJ A;  4IIA A;  4FMA A;  5HQP A;  3LT9 A;  2DSA A;  3QCP A;  5F8B A;  5IO2 A;  14GS A;  1ERU A;  7STD A;  4I97 A;  3KCM A;  1O6J A;  5ECN B;  3A5E A;  1U3A A;  5ECH B;  1DBY A;  1PGT A;  3ZG5 A;  1FYS A;  2FWF A;  1VQ8 3;  2H66 A;  3KFQ C;  1DE2 A;  3RGR A;  4Z7X A;  1B9X C;  2W6J H;  2O3O A;  4YH2 A; 
#chains in the Genus database with same CATH homology
 2F8A A;  3ZVJ D;  1OE7 A;  3GUR A;  3D4T A;  3TB2 A;  1PN0 A;  10GS A;  5D9W A;  2FHE A;  2GQM A;  2K8S A;  2B7J A;  2F8F A;  4MF7 A;  4BVY B;  4AJ8 A;  1EGO A;  5D9X A;  1C72 A;  3L9V A;  4AJ7 A;  1F6M C;  4F82 A;  1A2M A;  2YPM A;  3UIW A;  5D93 A;  3WT1 A;  2OA7 A;  1TXX A;  2E7P A;  1JZO A;  4OWY A;  1NM3 A;  3CSI A;  1JHB A;  4GXZ A;  5IMF A;  1V58 A;  3FR6 A;  3L78 A;  2L57 A;  2YV9 A;  3TRQ A;  2V32 A;  1PA3 A;  5DCH A;  2C0D A;  3VWU A;  2IMI A;  3KH7 A;  2M72 A;  1AXD A;  5HFI A;  3ZYW A;  1V2A A;  2MYG A;  3D21 A;  3DEX A;  1G0T A;  2FD3 A;  3KZQ A;  4KA0 A;  2CZ3 A;  2CAI A;  2HZF A;  2K8V A;  2YAN A;  5ABR A;  4JBB A;  1AQV A;  1Z6M A;  1OAZ A;  4JE1 A;  2N5B A;  3UAR A;  3TJJ A;  2H71 A;  2GGT A;  3D6I A;  2FY6 A;  1ZOF A;  3JCM L;  1AUC A;  4L0W A;  3GA4 A;  2CAQ A;  3HA9 A;  4J56 E;  4XTS A;  1K0N A;  4IEL A;  2BJX A;  2DIY A;  1AC1 A;  1ZMA A;  3O3T A;  5F07 A;  3RPP A;  3GKM A;  3H79 A;  4EVM A;  2PPT A;  3VI7 A;  4EKZ A;  2P5R A;  4BL7 A;  4GQC A;  2NVL A;  4K7I A;  4HJ2 A;  4MP4 A;  2CT6 A;  1H4O A;  2REM A;  2J23 A;  4D73 A;  1V9W A;  2GT5 A;  4IQ1 A;  1TI3 A;  3VUR A;  1HD2 A;  4TN8 A;  2VM2 A;  2GZP A;  1BG5 A;  1E2Y A;  2KUC A;  1WJK A;  2YP6 A;  3GKN A;  3ZIV A;  2G0F A;  2VD1 A;  5KN1 A;  2VL2 A;  2YZU A;  4GSN A;  3VWV A;  2VOC A;  1SKW B;  1AW9 A;  5AIS A;  1AAZ A;  3Q6O A;  1I5G A;  3EMP A;  2H73 A;  5G5F A;  3KMN A;  3TKR A;  4X4J A;  4XS4 B;  2HRN A;  2WDU A;  5EY6 A;  3Q19 A;  4JZQ A;  2B5Y A;  1GRX A;  3L4N A;  5JCG A;  4IKH A;  3TRP A;  1Z5Y E;  1CQH A;  2XBI A;  3KTB A;  2YWI A;  2O85 A;  2I3Y A;  3APO A;  2YWM A;  1R5A A;  3KD0 A;  2VL2 C;  4Q5Q A;  5ELG A;  3PPU A;  3ZRE A;  4TVE A;  3ERG A;  2VCZ A;  1X9S B;  4O5U A;  1XWK A;  3DVX A;  5ECQ B;  4PQI A;  2VIM A;  2YWN A;  3FY7 A;  2XHF A;  1A2L A;  3KP8 A;  3ISO A;  1YZX A;  1HNB A;  4J2F A;  2H19 A;  5KN2 A;  4PNG A;  3ZTL A;  4TOP A;  4PQH A;  5J5N A;  2R2J A;  1HYU A;  2RUF A;  5IMA A;  4Q5R A;  4USS A;  3BOA A;  2F3M A;  4KB3 A;  2B7K A;  2WS2 A;  2FWG A;  4ZBB A;  4GTU A;  3VLN A;  1XWG A;  4N10 A;  3ZFL A;  4J57 E;  1UN2 A;  5C04 A;  3P90 A;  2H6X A;  5D73 A;  2LRN A;  4BVY A;  4NXI A;  2HRK A;  1GH2 A;  3DVW A;  4PQ1 A;  1LU4 A;  2EC4 A;  2H72 A;  2H74 A;  4CY6 A;  1Q4J A;  2L5O A;  1B9Y C;  1SKR B;  12GS A;  2QA2 A;  5D9T A;  1TRU A;  3QD9 A;  1FOV A;  4HI7 A;  1SL2 B;  3QMX A;  4F9Z A;  4XRD A;  4EXJ A;  1TK0 B;  1M7T A;  4MH2 A;  1R5P A;  4GLT A;  4POM A;  3BCK A;  4HJM A;  4ULX A;  4K0G A;  1QK8 A;  1WWJ A;  1A2J A;  3KEB A;  3LGC A;  1KNG A;  4ML6 A;  5IPH A;  1A0R P;  22GS A;  3DIE A;  2VCQ A;  5ECK B;  1XVQ A;  2E0Q A;  1V40 A;  4QL7 A;  4IW9 A;  3ZLP A;  1X9M B;  2XPE A;  1PKZ A;  4XCS A;  1MTC A;  3MNG A;  4BVX B;  4TW5 A;  6GSV A;  1K3L A;  5ID2 B;  5CO3 A;  3TCO A;  2GZY A;  1G6W A;  1ZYP A;  2YZH A;  4G0L A;  2YJH A;  4OCF A;  4LA1 A;  4O92 A;  3QOU A;  5IMC A;  5LD0 A;  4MZW A;  4GQF A;  4MF6 A;  3BJ5 A;  1GUM A;  1JLV A;  2P5Q A;  5AN1 A;  2WCI A;  3CSH A;  1SU9 A;  1YY7 A;  1IYH A;  3EWL A;  2DJK A;  3GSS A;  3HY2 A;  1NW2 A;  4AJ6 A;  5C00 A;  2JAC A;  2V6O A;  2C4J A;  4BWQ A;  2LRT A;  4NPB A;  1OYJ A;  1X9W B;  1G7O A;  5A4V A;  3P7X A;  3DML A;  3CRT A;  3FZ5 A;  1J0F A;  1QMV A;  3KMO A;  3F3R A;  4JRR A;  4L8E A;  4WXT A;  1GTA A;  1SKS B;  2LS5 A;  4MA9 A;  2R4V A;  4YKG A;  3WGD A;  3A3T A;  2L6C A;  2FWH A;  3LFL A;  4KE3 A;  1HNC A;  3NOF A;  4XS4 A;  2FCH A;  1A0F A;  4JED A;  4OO5 A;  2FGX A;  4E8E A;  1F3A A;  1M2D A;  1ON4 A;  2LKU A;  5IMD A;  2IPA A;  5ECO B;  2HSY A;  1TOF A;  1Q98 A;  4KW6 A;  4H86 A;  2L59 A;  1EEJ A;  1X5E A;  2RII A;  4WF5 A;  4KGI A;  3FZ4 A;  2GST A;  2H0G A;  2CX4 A;  2NTO A;  3QDN A;  3D5J A;  3FK8 A;  3TJG A;  3UL3 A;  4KDU A;  5L71 A;  1T3B A;  2IY2 A;  2H6Z A;  4G0I A;  2DML A;  4LLR A;  2XC2 A;  3I9V 2;  4V1A g;  4FYU A;  1Z9H A;  2TIR A;  3VPQ A;  1N2A A;  2KLX A;  4O5Q A;  4G9H A;  4IP6 A;  3U5R E;  4KND A;  2AHE A;  6GST A;  4IGJ A;  5ECL B;  1GSE A;  4I8B A;  5DVB A;  1GSQ A;  2ON7 A;  3KM6 A;  4KDY A;  2VCW A;  2IIY A;  4L5O A;  4YAV A;  4N11 A;  3FEU A;  1SK1 A;  1U6T A;  1TDI A;  2PMT A;  3ZML A;  5LCZ A;  2DJ1 A;  3BCI A;  4TR1 A;  4YKF A;  2HSH A;  4NV2 A;  3PR8 A;  3ME7 A;  4OFM A;  2F51 A;  2IFQ B;  2C1Y A;  5CRW A;  1QFN A;  4NAX A;  4V2N A;  1TRW A;  4BPY A;  4LL4 B;  3LYK A;  1ZYN A;  4EIQ A;  2HYX A;  4EDY A;  4FYC A;  4PGT A;  1JFU A;  3Q18 A;  3LSZ A;  4L5L A;  2WFC A;  2H01 A;  3SWL A;  4HEA 2;  1SJI A;  1G6Y A;  5JWQ B;  1OE8 A;  4KCE A;  3HD5 A;  3HJO A;  5CRG A;  2LNS A;  3IPZ A;  3LW9 A;  1K0B A;  1R26 A;  4TXV A;  4HUA A;  1SYR A;  4K5R A;  5B7C A;  3RBT A;  4PTS A;  3GL3 A;  4ECJ A;  2ZNM A;  5G5E A;  3S9F A;  3GTU A;  4ECB A;  4JR4 A;  5G2Z A;  4PNF A;  1IYI A;  1XWB A;  2PUK C;  3FHK A;  4K7O A;  3FRC A;  2H76 A;  3QAG A;  5HFG A;  3IE3 A;  3ZRD A;  1YKC A;  1NHO A;  3RAZ A;  3UVT A;  4BVX A;  4NHZ A;  4LMV A;  4A5P A;  1MDK A;  5ELA A;  1TK8 B;  4AF2 A;  6GSU A;  1TTZ A;  1RQM A;  1MDJ A;  5E4W A;  3D0Z A;  3KH9 A;  5ID2 A;  2O89 A;  5F05 A;  1FAA A;  4HDE A;  8GSS A;  2JZR A;  2GDR A;  1PRX A;  4EL1 A;  3QFA C;  2X8H A;  5D9V A;  4YQV A;  2GLR A;  2P0G A;  4O32 A;  3TOT A;  2HE3 A;  2DJ2 A;  4X43 A;  1GTB A;  1JZR A;  2DKI A;  2DKH A;  4IN0 A;  4POK A;  4GRF A;  1PQN A;  1USB A;  1WP0 A;  2EIR A;  5ECM B;  1TU8 A;  5D8I A;  5IQY A;  1MD3 A;  4OFT A;  1OC9 A;  2JU5 A;  2MBT A;  1ZYQ B;  3APS A;  1V57 A;  4WR4 A;  4ZB8 A;  1SD8 A;  1PSQ A;  5B6M A;  5AGY A;  1LBK A;  1JLW A;  3FW2 A;  2H70 A;  2QGV A;  3HJM A;  1UA5 A;  1ERT A;  3WT2 A;  3AY8 A;  3CTF A;  3HKR A;  2GTU A;  3GKX A;  2C3N A;  2X49 A;  1GNW A;  2N5F A;  2C0F A;  4KH7 A;  4BA7 A;  2LEG A;  1YF0 A;  2FUG 2;  3CTG A;  4FIW A;  4EIP A;  3E9J B;  2MMN A;  3C8E A;  5KN3 A;  5CRD A;  1BYE A;  2I4A A;  5ECI B;  2DJJ A;  2XPD A;  4XRA A;  3GH9 A;  1N8J A;  5BRT A;  2AJQ B;  9GSS A;  5E59 A;  3EIN A;  4RUV A;  4MMM A;  3DYR A;  2H0H A;  1EP7 A;  2H6Y A;  4YAP A;  2R3X A;  2RUE A;  4MZC A;  2WRT A;  4O7H A;  5J9B A;  1VGL A;  2PER A;  4HZ2 A;  2TRX A;  3HHV A;  3D22 A;  1BQ7 A;  3C73 A;  3RHC A;  5KOW A;  4NV5 A;  3WD6 A;  4CHS A;  4WBR D;  4HQS A;  4I6X A;  1KTE A;  1EZK A;  3M8N A;  3GH6 A;  1XPV A;  3IK9 A;  4K7N A;  2KP1 A;  1O8X A;  4HU9 A;  2H75 A;  3F4T A;  2BTO T;  2VL3 A;  4N0V A;  3PH9 A;  4IJI A;  3F9U A;  3GX8 A;  4KAE A;  3N5O A;  2CA8 A;  5DJM A;  1O81 A;  1QUW A;  3MYD A;  1ERV A;  3SBC A;  1YEX A;  1K3O A;  2CV4 A;  3W8J A;  3C1R A;  2R0P A;  4EDZ A;  1HNA A;  2YN1 A;  3WGE A;  1S3D A;  1YKA A;  5F06 A;  2N5A A;  2JL4 A;  5B6N A;  2EIO A;  4DEJ A;  3GFK A;  1XWA A;  3HZ8 A;  3F8U A;  3PGT A;  3IC4 A;  4POB A;  1B4P A;  5IOW A;  4I2T A;  2CVK A;  2PN8 A;  4JU5 A;  4G2E A;  2OBK A;  1VF2 A;  1THO A;  5DAK B;  2HZE B;  3CXG A;  1FG4 A;  2V2G A;  4V1A p;  3TOU A;  2K9F A;  5DQS A;  4MPG A;  4WBJ A;  16GS A;  1K0C A;  3GX0 A;  4Q5F A;  4ISD A;  4TXO B;  1CQG A;  4MLY A;  4I5Q A;  1BAY A;  5D96 A;  1X5D A;  1QGV A;  2L4C A;  5JWR B;  1TP9 A;  3MAK A;  2ES7 A;  2OE3 A;  4WEY A;  5G31 A;  4OCE A;  1OC8 A;  3R3E A;  1GSF A;  4EUY A;  2JSZ A;  4OO4 A;  1ZL9 A;  4IP1 A;  1TK5 B;  5DBQ A;  3DRN A;  3TJF A;  2MMA A;  1M9A A;  2V41 A;  5IMV A;  2A2R A;  3KTL A;  2AUV A;  1XZO A;  5A5K A;  1YDK A;  4ACS A;  2IL3 A;  3CSJ A;  2OKA A;  5EPF A;  3HVS A;  2PU9 C;  2R5G A;  3IK7 A;  5DAL B;  4KSM A;  1Z6N A;  3UVH A;  3Q74 A;  6GSX A;  5LNK e;  2GSS A;  2C0E A;  5J4U A;  4POL A;  2Z9S A;  3QPM A;  3GMF A;  1SYX A;  2X4A A;  4L0U A;  5AIX A;  2QSI A;  1ACV A;  5H5R A;  2B5X A;  3IV4 A;  4ID0 A;  4EF0 A;  3CMI A;  2O7K A;  1HQO A;  1YQ1 A;  4DVC A;  1K0D A;  2YJ7 A;  3ZFB A;  4XS6 A;  3H4K A;  2R0G A;  4ZL7 A;  1FOH A;  3I43 A;  3J7Y b;  1UC7 A;  1A8Y A;  18GS A;  1O8W A;  5GSS A;  1G7E A;  2VAF A;  4XS1 A;  1A24 A;  2HLS A;  2VCT A;  4DSS B;  3M9K A;  2LTK A;  2J9H A;  3P8W A;  4XHM A;  5J41 A;  1VF4 A;  4PX1 A;  1WOU A;  5H5S A;  1TU7 A;  4K5S A;  2H0I A;  2C0G A;  3LXT A;  1SJ6 A;  3QR6 A;  5HR3 A;  3DGQ A;  3IR4 A;  4KSO A;  5ECS A;  5GAN D;  1Z7P A;  3BBY A;  3TKS A;  2IME A;  2R6K A;  3GKK A;  3FMW A;  3ZMK A;  3IDV A;  1GWC A;  5G1L A;  4DSR A;  2O8V B;  1FVK A;  3TUE A;  3TDG A;  3EVI A;  3F0I A;  3ERW A;  1H75 A;  4O5R A;  4Z2R A;  1BED A;  3GN3 A;  4RQR A;  3DKS A;  3QAV A;  1NHY A;  2IN3 A;  5KOX A;  2YCD A;  1O7U A;  1XXU A;  4QQ7 A;  6GSY A;  3TKS C;  1QXH A;  3IAM 2;  2YNX A;  2UZ8 A;  4ECI A;  1SEN A;  2LQQ A;  1M0U A;  4G0K A;  1R4W A;  5G1K A;  3LXZ A;  4MJA A;  4K1F A;  3E0U A;  3LQ7 A;  2D2Z A;  1TJD A;  4ZB6 A;  3IXR A;  4OD7 A;  4E8H A;  5HR2 A;  4G19 A;  4RI6 A;  2WUL A;  3KIJ A;  1SL1 B;  2M80 A;  4X1U A;  1GLQ A;  3MDK A;  2HNL A;  2AB6 A;  1SL0 B;  5ECR B;  2LQO A;  2RLI A;  1GTU A;  5IMZ A;  4ZB9 A;  2VCV A;  1GSD A;  3O6T A;  1S3A A;  3GHA A;  2HFD A;  2X99 A;  4GSS A;  3HXS A;  2H1G A;  3HDC A;  4D73 B;  2MBS A;  1ST9 A;  2GVP A;  1TRV A;  2LJK A;  2L5L A;  4HU7 A;  3H8Q A;  4OMV A;  4K9Z A;  5DAK A;  3M9J A;  5GZZ B;  4QL9 A;  2EIQ A;  5B8A A;  1DUG A;  3MWH A;  3O76 A;  5A4U A;  1FVJ A;  2IMK A;  1SK2 A;  1B4Q A;  1URM A;  4ZBD A;  1VRS D;  1EGR A;  2WB9 A;  5ECP B;  5A4W A;  5HR1 A;  1BX9 A;  1TRS A;  17GS A;  2GQK A;  3G7J A;  6GSW A;  2CVD A;  1GP1 A;  3U6V A;  7GSS A;  4ZIJ A;  2B5E A;  1F2E A;  3APQ A;  4FO5 A;  5DDL A;  2G2Q A;  2H1B A;  1AQW A;  2NDO A;  3F6D A;  5IO0 A;  3E3E A;  1SK0 A;  2HRA A;  1SJZ A;  2KP2 A;  3FZ9 A;  2NBS A;  3W6G A;  2PBJ A;  3ZZX A;  1PMT A;  2GSQ A;  3IRA A;  4GST A;  3W8S A;  1PL2 A;  1PKW A;  2L4Q A;  4MJE A;  3VFI A;  5DAL A;  1XBS A;  5G30 A;  1R7H A;  4MAB A;  5KEJ A;  1Y6E A;  3A2X A;  1UVZ A;  1GSY A;  3IA1 A;  1B8X A;  2FA4 A;  4ZXG A;  2JZT A;  2LJA A;  3L9S A;  3A5I A;  1S3C A;  4Q5N A;  3LG6 A;  1WPI A;  3GL5 A;  3ZVJ A;  3EU3 A;  5DQY A;  1WIK A;  4NHW A;  1A8L A;  1O73 A;  5DJL A;  3IHG A;  1XW5 A;  2QA1 A;  5J9C A;  4V2L A;  1XIY A;  5COH A;  3FYG A;  3HYP A;  2A4H A;  1GUH A;  3M3M A;  5F0G A;  1SD9 A;  2JAD A;  3ED3 A;  1MD4 A;  2DBC A;  3FZA A;  2XBQ A;  4GF0 A;  1THX A;  4DSS A;  1GTI A;  3LJR A;  5GAP D;  2LUS A;  1XW9 A;  2JZS A;  4CY8 A;  1U88 A;  4IBP A;  3TJB A;  1YF1 A;  4MDC A;  1JZW A;  2H1D A;  3GIX A;  1EV4 A;  2B6M A;  1XWC A;  2VLV A;  2CVB A;  1PD2 1;  3N9J A;  1QQ2 A;  4DSQ A;  3C71 A;  1LJR A;  2DMM A;  2MMO A;  4EE0 A;  4PUF C;  4NMU A;  2GZZ A;  3F63 A;  5IIZ A;  1K0A A;  3H1N A;  6GSS A;  5BMU A;  4HS1 A;  3I6A A;  2R0C A;  3WGX A;  2VL9 A;  2IWT A;  4F2I A;  4IQA A;  4CDO A;  2H1A A;  1TW9 A;  11GS A;  2MZC A;  2HSM A;  4TRX A;  2PVQ A;  1KEB A;  1T7P B;  3EU4 A;  3L0H A;  4ILF A;  2HI7 A;  2LNT A;  2QKE A;  1K3Y A;  2OE1 A;  3C1S A;  3DWV A;  2AYT A;  2PVO C;  3UAP A;  1EWX A;  4BWS A;  1EOH A;  2X8C A;  2VD0 A;  3F4S A;  5JWO B;  2C3T A;  4K6X A;  2YOI A;  3UBL A;  1FW1 A;  2LV3 A;  1MDI A;  2YV7 A;  2B1K A;  3HJP A;  3UJ1 A;  3HVV A;  5EL8 A;  2DIZ A;  1WE0 A;  1ZCP A;  3DD3 A;  5GST A;  5FWG A;  1WMJ A;  3GYK A;  2DJ0 A;  2I9H A;  3VWX A;  1W4V A;  2DJ3 A;  1J08 A;  4TR0 A;  5CYY A;  4FYB A;  4F0C A;  1PX7 A;  3TKP A;  4RI7 A;  2RM5 A;  5KN0 A;  2ZUP A;  1ERW A;  1DE1 A;  3G7Y A;  2FLS A;  1Y25 A;  4WET A;  1NSW A;  3G9B A;  3UEM A;  3ERF A;  4PUR A;  2P31 A;  3M0F A;  3GV1 A;  2WGR A;  5HR0 A;  3GRX A;  1ZYE A;  4EC0 A;  2FNO A;  2VUP A;  1WRY A;  1W89 A;  2NPB A;  2OBI A;  5J3R A;  1EEM A;  1GUK A;  4IJ3 A;  2C8U A;  4XIH A;  3IC8 A;  3VK9 A;  2IFQ A;  1GSU A;  1VF3 A;  1AQX A;  3P2A A;  3CRU A;  2OAC A;  5EVO A;  4KF9 A;  4AGS A;  4YQM A;  1GNE A;  2X64 A;  2GS3 A;  2VLU A;  4N30 A;  2ALB A;  1YEP A;  4Z2U A;  3L9U A;  3F6F A;  5FHI A;  4F0B A;  1FB0 A;  4LL1 B;  3IAS 2;  3M1G A;  4EO3 A;  3CBU A;  3MSZ A;  1AIU A;  3NZN A;  3A2W A;  3NIV A;  1XCC A;  2X8G A;  1M2B A;  3QAW A;  2OAD A;  4MCU A;  4K2X A;  4ZIL A;  4YQU A;  1I9D A;  4P3Y B;  4MK3 A;  1XFL A;  2MMZ A;  5CRE A;  3GUS A;  1F9M A;  1EP8 A;  4WR5 A;  2F9S A;  3D4M A;  1XVW A;  5AIV A;  2PGT A;  4RQX A;  4OFN A;  5H5Q A;  13GS A;  4G10 A;  2K18 A;  2FA8 A;  5CRH A;  1PX6 A;  3PIN A;  2L6D A;  2CX3 A;  2B1L A;  4K8M A;  3LWA A;  3TJK A;  3KP9 A;  1X0R A;  4TR1 B;  4ML1 A;  4GWR A;  4KX4 A;  3ZL5 A;  4ICY A;  4MJC A;  4ZBA A;  19GS A;  3FR3 A;  2IMD A;  2K6V A;  4MPF A;  3IHQ A;  1T8E B;  5IM9 A;  3UBK A;  4WF4 A;  3EMX A;  5JCU A;  4MH3 A;  1J9B A;  3LYP A;  3EUR A;  3KGK A;  3TKS E;  2O87 A;  1MEK A;  2VO4 A;  4NWY A;  3UOM A;  4TKY A;  3F3Q A;  2A4V A;  1TI1 A;  3VWW A;  1T4Z A;  3H93 A;  3FKF A;  2OJL A;  2AV4 A;  5IOX A;  2BMX A;  3G7I A;  2V1M A;  1M9B A;  3KJY A;  3GTU B;  3MIX A;  2ON5 A;  1A23 A;  3BD2 A;  3F4R A;  1DSB A;  2LJR A;  4MNN A;  20GS A;  2M46 A;  3RHB A;  2KHP A;  2TRC P;  3EYT A;  4CW9 A;  2E2G A;  1E6B A;  2FWE A;  1ML6 A;  1F3B A;  3I69 A;  4MF5 A;  1V98 A;  2HXK A;  1RK4 A;  4PUA A;  4TR4 A;  3IOS A;  3IBH A;  3FR9 A;  2WZ9 A;  3WYW A;  4V2M A;  4KDX A;  2QC7 A;  1K0O A;  4TR3 A;  1O85 A;  1ZZY A;  4ZL9 A;  1GLP A;  1GSS A;  2GQL A;  1Z7R A;  1X5C A;  4ZL8 A;  2A2P A;  2C80 A;  4PXO A;  3TKQ A;  2DLX A;  1EOG A;  2KOK A;  1TKD B;  1Z3E A;  5IPG A;  1XOA A;  1M2A A;  4GCI A;  4KCA A;  1PN9 A;  1OVN A;  4JR6 A;  1BJX A;  3HZ4 A;  4IVF A;  5CAX A;  2VM1 A;  3R2Q A;  1OC9 B;  2LST A;  3EPT A;  1OC3 A;  4I2U A;  3RDW A;  1K0M A;  1F37 A;  5B8B A;  2A2S A;  2DC5 A;  1ABA A;  2HT9 A;  1EV9 A;  3V1W A;  2H30 A;  1FB6 A;  2ZCT A;  4FH8 A;  5ENU A;  3EE2 A;  4KUN A;  2I1U A;  1B48 A;  2VCX A;  2H8L A;  3OR5 A;  2E2M A;  3ZIJ A;  4X0X A;  1XOB A;  2GSR A;  2LRC A;  1YJ6 A;  5CNW A;  2I81 A;  5CP1 A;  1GL8 A;  4HZ4 A;  2RM6 A;  4LMW A;  2OE0 A;  4HOJ A;  2CZ2 A;  4ECC A;  3CYN A;  3LEF A;  4K0N A;  1M99 A;  1RW1 A;  4N0Z A;  1U87 A;  3KXO A;  1T00 A;  2PWJ A;  4BL7 B;  2IMF A;  3J7Y k;  3RPN A;  4HQZ A;  2CQ9 A;  3LOR A;  4IS0 A;  2GT6 A;  2C3Q A;  3C7M A;  4WKW A;  3US3 A;  5JCW A;  3TGZ A;  1JZD A;  5INY A;  3EC3 A;  5FT3 A;  1GUL A;  1OKT A;  3VPT A;  3QFB C;  2HZE A;  1XW6 A;  4F03 A;  3HCZ A;  1U3I A;  3K8N A;  3DXB A;  2HRF A;  2V6K A;  3VI5 A;  4TXO A;  2IJY A;  2AAW A;  2IYJ A;  3A2V A;  2B3S A;  3HVX A;  2JSY A;  1KBN A;  1VF1 A;  2YWO A;  3A5W A;  4IHU A;  5HFK A;  3GST A;  3GNJ A;  1FHE A;  2WJU A;  3TRX A;  3ME8 A;  1T1V A;  3UMA A;  4MJB A;  1OKD A;  1T4Y A;  1ZGN A;  2VLT A;  2R37 A;  4FQU A;  1PL1 A;  4MZB A;  1ILO A;  5DCG A;  3ZIT A;  4Z2T A;  4K2D A;  5HQP A;  2DSA A;  3QCP A;  5F8B A;  5IO2 A;  14GS A;  1ERU A;  4I97 A;  3KCM A;  1O6J A;  5ECN B;  1U3A A;  5ECH B;  1DBY A;  1PGT A;  2FWF A;  2H66 A;  1DE2 A;  4Z7X A;  1B9X C;  1FO5 A;  4YH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...