1T3BA

X-ray structure of dsbc from haemophilus influenzae
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
209
structure length
209
Chain Sequence
DAAIKRKLQSFNISNIVIKSSPISGIKTAVTDQGILYVSEDGKYLFEGKLYELTNNGPVDVAGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDITCHYCHLLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTAKDPVFALNEAEKGNLPKEVKTPNIVKKHYELGIQFGVRGTPSIVTSTGELIGGYLKPADLLRALEETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of DsbC from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbC
total genus 53
structure length 209
sequence length 209
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2004-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1t3bA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1t3bA02
2EIQA 1LU4A 4TN8A 5LCZA 1M9BA 4HZ4A 5DAKB 1GTIA 1RW1A 4MH3A 3IPZA 2MMZA 2IIYA 2VD1A 1XWGA 1YQ1A 2OACA 5CYYA 2EIOA 2VM2A 2L4CA 3L9UA 5KN0A 2HZEB 1XWAA 3KP8A 3PGTA 1ERTA 2JADA 4TOPA 2B7KA 1PSQA 5HFKA 2L5LA 1EP7A 3LWAA 1FB0A 3UBLA 1TU7A 3G9BA 5J9BA 3DMLA 2R3XA 2VLTA 4I97A 5DBQA 4D73A 5CP1A 3LXZA 1NSWA 3FEUA 6GSUA 2D2ZA 2GSSA 3GSTA 2AV4A 4HQSA 3ERGA 3EMPA 3KMNA 1YY7A 4N0VA 1GSQA 2FA8A 1SU9A 2F51A 2H8LA 3I43A 5L71A 1EGRA 1YJ6A 2ON5A 2JU5A 5F8BA 3ERFA 3CSJA 3APOA 2CVDA 3SBCA 4HZ2A 4BVYA 5IPHA 3VPQA 2YNXA 3D22A 3ZFBA 3D0ZA 5B7CA 4DSSB 1V57A 2DJKA 1WMJA 2HNLA 2YPMA 2YWMA 4L8EA 4RQXA 1FW1A 2DJ2A 3IK9A 3TB2A 4HQZA 5CO3A 5ECIB 3ZZXA 3APQA 3VWWA 1GSSA 2B3SA 5E59A 2GZPA 4OO5A 1FHEA 2DJJA 3MSZA 3CBUA 2VL3A 2F8AA 4O32A 4PUAA 1XW5A 1ERUA 3TCOA 1IYHA 3H4KA 3TJKA 4MCUA 2GGTA 2V32A 2B7JA 2YP6A 3HVVA 1V98A 1O8XA 2CAQA 3H79A 18GSA 2C0EA 1CQHA 2XPEA 1XZOA 3QAVA 2GZYA 2RIIA 2WDUA 2ZNMA 3KIJA 5J4UA 3GH9A 3I9V2 2ON7A 4PGTA 3LEFA 3HZ4A 2YJ7A 4KH7A 4AGSA 2OE0A 2DIZA 1QMVA 1HQOA 5ECRB 4JRRA 1XFLA 5ECSA 5DQSA 1H4OA 1QQ2A 1TI3A 3VLNA 1KTEA 2KP1A 2FY6A 3FZ4A 3WYWA 3DVXA 3A2VA 3VURA 2G2QA 1EOHA 3F4RA 1JZDA 5H5SA 3UL3A 1YF1A 1VF3A 1DE1A 3G7IA 3J7Yb 1W89A 2YJHA 1F3AA 3HZ8A 2QC7A 2H0GA 2WCIA 1GP1A 1C72A 2DC5A 2VOCA 3ZMLA 2IYJA 1JZWA 4ZB6A 4BVXA 2F9SA 2MMAA 2L6CA 1BX9A 3RPNA 4QL7A 1GTBA 1B48A 4ZL7A 1GNEA 1IYIA 2LS5A 1G6WA 1ZOFA 4KDXA 1A0RP 2L59A 2AAWA 2GLRA 3TJFA 4I8BA 2GVPA 2BJXA 2LQOA 1HNCA 4I2TA 2IMDA 3DRNA 3M3MA 1SK2A 1EV4A 4WBRD 1SK0A 5CAXA 4YQVA 4WEYA 1SYRA 5CREA 3LXTA 2C8UA 1PKWA 4ZILA 2C0GA 2LRNA 4HUAA 1N2AA 3F4TA 1Z6NA 4XS1A 2YANA 1ILOA 2KUCA 4IS0A 3FY7A 2GQMA 2IWTA 3EYTA 4MLYA 4BA7A 5IM9A 2C3NA 3CSIA 1X9WB 1XWKA 1EZKA 4IHUA 1V2AA 4CHSA 4EXJA 2IMIA 3F6FA 2WRTA 1X5EA 1JLVA 4LL4B 4MF5A 2FWEA 4AJ7A 3VK9A 3ZRDA 2HI7A 1B8XA 2JZTA 6GSTA 1SD8A 19GSA 1G7EA 3VI5A 1PQNA 5CRDA 1K0MA 1FB6A 1F37A 2RUFA 2CT6A 3FW2A 3IC4A 4TW5A 4NXIA 2H1GA 2WJUA 4GSTA 4HEA2 1T4YA 4MF6A 4HU7A 2YWNA 2H73A 2L6DA 2K9FA 2FWHA 3A2WA 4TR1B 3HJOA 4GWRA 3KD0A 5HR2A 1GL8A 2DMMA 3HVSA 3TJJA 2IN3A 4WBJA 3N9JA 2GSRA 4ZB8A 5D96A 1EGOA 1M0UA 4WF5A 3DGQA 1ST9A 1K3OA 4K0NA 3W6GA 3ZITA 3RAZA 4PQHA 5DCHA 3GKXA 4K1FA 5EY6A 3O76A 4MZBA 5HFIA 2WZ9A 4KX4A 4KNDA 1ACVA 20GSA 4QQ7A 4MZCA 4K2DA 3H1NA 2FWGA 5DCGA 3DWVA 5J9CA 2GS3A 1B4QA 2IJYA 3GSSA 4ECBA 3RHBA 4HS1A 4WXTA 1PA3A 3M1GA 4TVEA 2RLIA 1Z7PA 1Z9HA 3P2AA 2V6KA 1A8YA 1PX6A 3KH9A 4PQIA 2CVBA 4ZBDA 1NW2A 3D4TA 1LBKA 1Q98A 4OWYA 1M7TA 5ID2B 2HFDA 5ECNB 2CQ9A 5B6MA 2L4QA 2ES7A 5ELAA 1N8JA 2V2GA 5IOWA 1T4ZA 4DVCA 5D9WA 4PNGA 4FIWA 2H6XA 4HOJA 2ALBA 1QUWA 2FLSA 3E0UA 3TRQA 2V6OA 1KEBA 3ZMKA 1SKSB 2OA7A 5D93A 4YAVA 1R7HA 3F4SA 4TKYA 2FUG2 4V2NA 5DDLA 4POMA 4WKWA 5G1LA 5B6NA 2L57A 3EVIA 6GSSA 3P90A 1TRUA 1AQWA 1HYUA 2OKAA 2JZRA 1WRYA 2TRXA 3GHAA 2H1BA 4KW6A 3F3RA 2OBKA 3L4NA 2LRCA 2VD0A 3FZ9A 1ERWA 2N5BA 1O73A 3H8QA 4YAPA 4N11A 2DJ3A 4ZBAA 2VLUA 2KHPA 2DJ0A 3ISOA 3ZVJD 1Z5YE 1NHOA 4ZB9A 1HNBA 1ZZYA 4ZL8A 6GSYA 3ZYWA 4POKA 2H19A 3GRXA 5G1KA 3GUSA 4MP4A 2GZZA 3LQ7A 3UJ1A 3ZIVA 4CW9A 1B9XC 1R5AA 1F9MA 1QXHA 1SJ6A 3ZTLA 2VCZA 1GULA 3GNJA 5IMAA 1GTAA 4Z7XA 4P3YB 5DVBA 1DE2A 1VF1A 1BEDA 1A0FA 4JE1A 3FR9A 3RPPA 5DALB 4EKZA 2C80A 4KGIA 4NMUA 3ME7A 4GQFA 2H6YA 3UVTA 1O7UA 3UEMA 5INYA 3QMXA 4EF0A 1JHBA 4HJMA 14GSA 2C0DA 3WGXA 2WULA 3L0HA 1GSEA 2FNOA 2H75A 5F06A 3C73A 2FCHA 2F3MA 4TXOA 5AIXA 2MMOA 3ZREA 1M2BA 4TR0A 5CRGA 2AHEA 3QFBC 1TRVA 3FYGA 1VRSD 3HHVA 3HXSA 2H74A 4L5OA 1WWJA 2CVKA 2YWIA 3TKSC 3GTUB 4WR4A 4J2FA 4DSSA 1ABAA 5KN2A 3HA9A 2H66A 2O7KA 4EDYA 2CZ3A 4Q5RA 1PMTA 3GFKA 1JZRA 3IR4A 3ED3A 2LJKA 4PX1A 5F05A 5IIZA 1J08A 3NIVA 2PERA 4EUYA 8GSSA 2CZ2A 3BBYA 5EPFA 3TUEA 3GL5A 4O7HA 5ECKB 1ZCPA 1TTZA 2HXKA 1PX7A 1GSYA 1QGVA 3C7MA 2NPBA 2AB6A 4IKHA 1GSUA 1PN9A 3I69A 4KCAA 4BL7A 4J56E 3WGEA 2EIRA 2QGVA 3C1SA 2M46A 1GSDA 2RM5A 4Q5FA 2GQLA 3CSHA 2RUEA 1R5PA 4F0CA 3VWUA 17GSA 2C3QA 2HZFA 3F3QA 4QL9A 4I5QA 1TRSA 1USBA 4ZBBA 4GXZA 2P5QA 1XBSA 3Q6OA 4JEDA 1M2DA 3IAM2 4J57E 1G6YA 5FWGA 3VFIA 1PL2A 1PD21 2V1MA 3IK7A 2FD3A 3FR6A 3L9SA 4DSRA 3LJRA 5A4WA 1SL2B 5ENUA 4XS6A 5ECHB 4IELA 2C3TA 3L78A 5JCGA 2VCVA 3MWHA 3LGCA 3Q19A 1GNWA 3D6IA 4HI7A 4YH2A 5JWRB 3BD2A 4HU9A 2I9HA 1GUKA 4X43A 1T00A 4N0ZA 3DVWA 4WR5A 4XTSA 1O6JA 2XHFA 4JZQA 1X9SB 2V41A 2J9HA 1ZGNA 1Z3EA 4IBPA 1K0OA 4ECCA 1X5CA 1J9BA 2H0IA 1K0BA 2I1UA 3F9UA 2LUSA 2CAIA 3LG6A 3GH6A 3WT2A 4XCSA 3HKRA 2K8VA 5LD0A 3OR5A 3FHKA 1FVKA 3BCIA 1W4VA 2P5RA 3TKSA 1Y6EA 2GT6A 4YQUA 5COHA 3IOSA 2LKUA 2LV3A 4OFTA 1ON4A 4G10A 2A2RA 2FGXA 2VCXA 2GSTA 1OE8A 1WJKA 4IVFA 1U87A 4PXOA 1AUCA 1MD4A 2HZEA 3RHCA 3HJPA 3TOTA 4K7OA 3TRPA 12GSA 1TJDA 2B6MA 2PN8A 2VM1A 2VCWA 3DKSA 2A4VA 3HVXA 1HNAA 5D73A 3KTBA 5DJMA 4ZL9A 1B9YC 2LRTA 1FAAA 4POBA 3M9KA 3O3TA 3EU4A 1T8EB 1FO5A 2WGRA 3QAGA 2B1LA 1F3BA 1OC8A 2R6KA 4KUNA 5KEJA 4RUVA 5IOXA 3HY2A 1THOA 3UMAA 5IMDA 3IDVA 3V1WA 2E2GA 1K0DA 2QSIA 4K6XA 3QD9A 4ILFA 4XS4A 5E4WA 2LNTA 4NPBA 1XPVA 1T3BA 2DJ1A 3G7JA 1RQMA 3MDKA 4RQRA 1J0FA 2IL3A 4TXVA 2KLXA 3GL3A 1ZYEA 2N5FA 4MZWA 3F63A 3FR3A 2R37A 4HJ2A 3Q74A 2DSAA 4ML1A 2M72A 4JR4A 1A23A 2VIMA 2MZCA 2AUVA 3HCZA 4OCEA 3S9FA 4E8HA 3IRAA 2YZHA 4MDCA 4IP1A 1GLQA 1GWCA 3VPTA 4OO4A 4X1UA 3PINA 2VLVA 3RDWA 1XWCA 4GTUA 6GSXA 2PVOC 3TKPA 1Z7RA 1SL0B 1GH2A 3ZFLA 1AW9A 2WB9A 2K8SA 4MMMA 4XHMA 4ID0A 5G31A 4ML6A 3LYPA 1MDJA 2VL9A 3UBKA 3BCKA 2H30A 3DXBA 3LORA 2GT5A 4OMVA 4F0BA 1THXA 1PL1A 3TKSE 2E2MA 1XOBA 3FZ5A 2LTKA 3ME8A 4NV2A 1FVJA 1QFNA 3QFAC 5C00A 2PUKC 3QOUA 4IQ1A 2N5AA 4DEJA 3GN3A 2IFQA 3QAWA 4I6XA 1WPIA 5ECMB 3KZQA 2HSHA 6GSWA 5GAPD 2H70A 3CRTA 4G2EA 4BPYA 4GCIA 2P31A 2IY2A 1K3LA 3QDNA 4GQCA 2H72A 2HRNA 4MJCA 1XIYA 1EEJA 4O92A 22GSA 4PURA 1M9AA 2DLXA 1RK4A 2F8FA 10GSA 3LYKA 1WOUA 4NHZA 1AC1A 2HE3A 4L0WA 4JBBA 3GKMA 4ULXA 2JL4A 2X8HA 3O6TA 2XBQA 2LNSA 2O89A 3UAPA 1BJXA 3EC3A 2MYGA 1KNGA 3GYKA 3TKRA 5HR1A 1AQVA 3JCML 1ZMAA 2O87A 1Y25A 4FYUA 2YCDA 5ECLB 1SD9A 1UVZA 1GRXA 3NOFA 2FHEA 5AISA 4F82A 1MDIA 1SKRB 3QR6A 2DMLA 3FKFA 3A5WA 4FYCA 3M8NA 3M9JA 2GSQA 1YKAA 2E7PA 2IFQB 1V40A 4OFMA 5ECOB 5IO2A 1WIKA 3U6VA 2NDOA 5J41A 1S3CA 1JLWA 4KSMA 1NM3A 1CQGA 2HRFA 1M2AA 3CXGA 4K7IA 4H86A 4E8EA 4NV5A 5A4VA 3E3EA 1PGTA 3I6AA 4LMVA 4LL1B 3ZL5A 4KDUA 3A3TA 3HDCA 5HFGA 4IJIA 2E0QA 4D73B 1WP0A 1M99A 16GSA 5FT3A 1U6TA 4YQMA 4POLA 4L0UA 4NHWA 2XPDA 3L9VA 3R2QA 1URMA 4XRAA 5D9XA 3CMIA 5F0GA 5D9TA 4OD7A 4GF0A 5GSTA 3A2XA 4TR4A 4KCEA 4IP6A 2IMKA 2HSYA 1UN2A 1S3DA 2DBCA 4MJEA 1PKZA 4N10A 2I4AA 2REMA 3BJ5A 3IA1A 1ZYQB 1MTCA 4OFNA 1BAYA 2A2SA 4NAXA 4MPFA 3DIEA 3ERWA 1I5GA 1NHYA 3W8JA 5C04A 3IBHA 4MA9A 3CTGA 1TW9A 4CDOA 4PNFA 2YN1A 2HLSA 4ACSA 2LQQA 2PGTA 4X0XA 5A4UA 5IMZA 5DAKA 1MEKA 1QK8A 3WT1A 4NWYA 4LA1A 4RI6A 2JSZA 13GSA 3GX0A 1Z6MA 4F2IA 3UOMA 5EVOA 1A24A 2MMNA 4Q5NA 2X8GA 1E2YA 1GUMA 1OE7A 3EINA 1V9WA 3TOUA 5H5RA 4PQ1A 4K8MA 4DSQA 5D8IA 2R4VA 4EO3A 5AIVA 3UVHA 3KXOA 4L5LA 2LJRA 3LFLA 1OKTA 5G30A 2OADA 3H93A 4GLTA 2AJQB 4MPGA 4KDYA 4BWSA 5J5NA 4K0GA 1TI1A 4IGJA 5JCWA 4ISDA 4GRFA 2HYXA 1VF2A 1SJIA 4EL1A 2WFCA 3EWLA 2B5YA 3QCPA 4OCFA 1OYJA 3ZLPA 1OAZA 2O85A 2KP2A 1G0TA 3KP9A 4V2LA 3LSZA 2IMFA 3EURA 1VF4A 4XRDA 3PR8A 1T1VA 3C8EA 2TIRA 4KSOA 5G2ZA 3IE3A 1TU8A 4IW9A 3CYNA 2I3YA 4KAEA 5H5QA 5CNWA 2H76A 1XVQA 2PMTA 5F07A 4G19A 2H71A 1R26A 1LJRA 4JU5A 3C1RA 2I81A 2FA4A 2YOIA 1U3IA 2OE3A 3KEBA 3E9JB 2VAFA 3CRUA 1AXDA 5CRHA 1X0RA 1A2MA 3TDGA 3P7XA 4AJ6A 5GAND 1XW6A 2IMEA 1BG5A 1BQ7A 3Q18A 1YEXA 3ZIJA 1GLPA 2GTUA 3WD6A 7GSSA 5CRWA 1PRXA 1ZL9A 1AIUA 3M0FA 2LSTA 3EMXA 2NVLA 1BYEA 5DQYA 2JSYA 3UIWA 4K9ZA 2TRCP 1H75A 2MBSA 1GSFA 2X64A 4MK3A 2GDRA 3US3A 4IJ3A 5GSSA 1AAZA 4JR6A 1I9DA 2CX3A 5LNKe 2IPAA 3TGZA 5JWQB 1EV9A 5JCUA 3D5JA 3HD5A 1S3AA 5HR0A 2BTOT 1K3YA 6GSVA 5IPGA 1O8WA 1KBNA 1DBYA 2P0GA 4EE0A 2VCQA 1K0AA 3TJGA 3VWXA 5KN3A 3IHQA 1V58A 4ECJA 3N5OA 2PU9C 1YF0A 3F6DA 2B5XA 1X5DA 3EE2A 1A8LA 3UARA 5AN1A 2C1YA 2H1AA 2LJAA 2PWJA 3KTLA 2VL2A 2VO4A 1HD2A 1X9MB 2YWOA 2YZUA 4F9ZA 2JACA 1K0NA 2FWFA 1SYXA 2K6VA 2VL2C 2LEGA 3FK8A 1YZXA 5G5FA 2H6ZA 1XCCA 1T7PB 2OBIA 1GTUA 3GX8A 3EU3A 3IV4A 4WF4A 2AYTA 4V1Ap 3MAKA 4MJBA 1XXUA 2WS2A 4GSNA 1UC7A 1YEPA 2ZCTA 1G7OA 5ABRA 5ID2A 4V2MA 3IAS2 4EVMA 1FOVA 1SENA 2G0FA 1TK0B 2PVQA 2YV9A 2YV7A 1OKDA 1MD3A 2C4JA 2B5EA 1F6MC 2K18A 1OC3A 5JWOB 3HYPA 5IMCA 4IQAA 4G9HA 5KN1A 4KB3A 5IQYA 4O5RA 1TRWA 1OC9A 1JFUA 4MJAA 2HT9A 2NBSA 1TK8B 2PBJA 2H1DA 4PUFC 3GURA 3TKQA 1XOAA 2ZUPA 2JZSA 3NZNA 3SWLA 4MF7A 3KGKA 1E6BA 1A2LA 2O8VB 9GSSA 1OC9B 2CV4A 4ZXGA 5GZZB 4LMWA 1A2JA 1UA5A 5DALA 3KCMA 4KA0A 3PH9A 2NTOA 4KE3A 1AQXA 4ZIJA 1EWXA 2BMXA 5B8AA 3KMOA 5FHIA 2MBTA 2Z9SA 4F03A 3GKKA 3KJYA 3F0IA 4LLRA 2R2JA 5ELGA 3G7YA 3BOAA 2CX4A 1OVNA 3D21A 1DSBA 5ECQB 1SL1B 2EC4A 3GA4A 4FYBA 5G5EA 1U3AA 4TR3A 1TDIA 4EDZA 4RI7A 1TOFA 1MDKA 1Q4JA 3VI7A 5B8BA 3DYRA 2C0FA 4FH8A 4TR1A 5HR3A 1ML6A 3ZVJA 4V1Ag 2OE1A 1GUHA 11GSA 2X99A 4IN0A 4XIHA 3RBTA 5HQPA 3GKNA 5DJLA 5A5KA 5EL8A 3DEXA 1VGLA 1JZOA 5ECPB 1R4WA 1EP8A 3J7Yk 4ECIA 4I2UA 3FRCA 1TKDB 1YKCA 4BWQA 3K8NA 1TP9A 5IMVA 1EOGA 1EEMA 4N30A 1ERVA 2H01A 4TXOB 3MNGA 3P8WA 1YDKA 1XW9A 5J3RA 3D4MA 3TRXA 4TRXA 3C71A 2CA8A 5IO0A 3KM6A 4MH2A 1XWBA 3APSA 1DUGA 1TXXA 3IXRA 3QPMA 1U88A 3U5RE 4K7NA 4Q5QA 2L5OA 4WETA 2XC2A 3GTUA 4FO5A 3AY8A 2GQKA 2H0HA 5D9VA 4AF2A 1TK5B 3WGDA 2QKEA 1O81A 2M80A 3GMFA 1SJZA 5AGYA 3FZAA 1XVWA 1FG4A 2KOKA 4XS4B 2VCTA 2R5GA 2DIYA 3W8SA 1K0CA 3KH7A 3GV1A 3VWVA 3HJMA 1SK1A 3CTFA 3TJBA 3F8UA 1WE0A 4EC0A 4AJ8A 5IMFA 1F2EA 2OJLA 2XBIA 2B1KA 3DD3A 3GIXA 2X8CA 1B4PA 4HDEA 2J23A 1SKWB 2PPTA 2RM6A 4MABA 1O85A 4GSSA 2VUPA
chains in the Genus database with same CATH superfamily
2EIQA 3GZBA 1LU4A 4TN8A 1YGWA 1YJ93 5LCZA 3GSPA 1RN4A 3ECFA 1M9BA 1MGWA 2J8XB 4HZ4A 5DAKB 4K90B 1GTIA 2FXTA 1BSAA 4WHAA 1UCJA 1RW1A 4MH3A 1IU7A 1MWSA 3IPZA 2MMZA 2IIYA 2VD1A 1XWGA 1RN7A 1YQ1A 2OACA 7RNTA 3CD63 5CYYA 2CG0A 2W2CA 2EIOA 2VM2A 1NWWA 2L4CA 3L9UA 5KN0A 2CWVA 3UB1A 2HZEB 4KFFA 1XWAA 3KP8A 3PGTA 1ERTA 2JADA 1BIRA 3LTBA 4TOPA 2B7KA 1PSQA 5HFKA 2SARA 3F14A 2L5LA 1EP7A 3HVNA 4R80A 3V92A 3LWAA 1FB0A 3UBLA 1TU7A 4BL7B 5ELJA 3G9BA 5J9BA 3DMLA 2R3XA 2VLTA 4I97A 1DVCA 5DBQA 4D73A 5CP1A 3KIIA 3LXZA 1SQWA 1NSWA 1LXEA 2JQ5A 3FEUA 1EKMA 6GSUA 2D2ZA 2GSSA 2A4HA 3GSTA 1RHLA 2AV4A 4HQSA 3ERGA 3EMPA 3KMNA 3HK4A 1YY7A 1CEWI 5CXOA 4CY6A 1G96A 4N0VA 1GSQA 2FA8A 1SU9A 2F51A 2H8LA 3I43A 1A2KA 1BNEA 2R0PA 4OK0A 2R0CA 1Q814 5L71A 2XEPA 1EGRA 3N9HA 7GSPA 1YJ6A 2ON5A 2L4VA 1U5OA 2JU5A 1W02A 5F8BA 4IT7A 1A2VA 1GMQA 3ERFA 1NNVA 3CSJA 3APOA 1FGRA 2CVDA 4NHFA 4HZ2A 3SBCA 1UGHI 4BVYA 4BVXB 2CFLA 5IPHA 3VPQA 1M9GA 2YNXA 1PU4A 3FLJA 3D22A 3EB8A 1TTOA 1JKGA 3ZFBA 3D0ZA 5B7CA 4DSSB 2HMNB 1PYLA 1V57A 1BSBA 2DJKA 1WMJA 2HNLA 2YPMA 2Z77A 2YWMA 4L8EA 4RQXA 4USSA 1WNHA 1FW1A 1EUIC 2DJ2A 3IK9A 3GWRA 3TB2A 1OGXA 4HQZA 5CO3A 3NHXA 2STDA 5ECIB 3FKAA 3ZZXA 3APQA 3VWWA 1W4NA 1GSSA 2B3SA 5AIHA 2QA43 5E59A 4MJDA 2GZPA 1DMQA 3O8YA 4OO5A 2PZVA 1FHEA 3E99A 2DJJA 3MSZA 3CBUA 1FGTA 2VL3A 1KSIA 1VQM3 2F8AA 3H3HA 4O32A 4KFDA 3F40A 4PUAA 1XW5A 1ERUA 3TCOA 1IYHA 3H4KA 3TJKA 4MCUA 2GGTA 4LSOA 1RSNA 2V32A 2YX9A 1SJWA 2CX1A 2B7JA 2YP6A 1JV2B 3HVVA 1O8XA 1V98A 2CAQA 1SIIA 4BL2A 18GSA 2BMQB 2C0EA 1CQHA 3H79A 3KSED 2XPEA 1TRPA 1FW7A 1XZOA 3QAVA 4MMYB 2GZYA 4KVHA 4XB5A 3DGLA 2RIIA 2RSXA 2WDUA 4HM3B 2ZNMA 3KIJA 5AIFA 4EV5A 1Q864 1VQ63 5J4UA 3GH9A 3I9V2 2ON7A 4PGTA 3LEFA 1RCKA 1W7CA 3HZ4A 4OUQA 2YJ7A 1LVNA 4KH7A 3IC8A 2OTJ3 3FG3A 4AGSA 4FMAA 2OE0A 4K1UA 1RDSA 2DIZA 1QMVA 1HQOA 1DE3A 5ECRB 4JRRA 1XFLA 5ECSA 5DQSA 1H4OA 1QQ2A 1TI3A 3VLNA 1KTEA 1TU5A 2FY6A 2KP1A 3B4OA 3FZ4A 3WYWA 3DVXA 3A2VA 3OW22 3D5GA 1YGEA 2G2QA 3VURA 1EOHA 4XDVA 2RGQA 5IEPA 4R4KA 3F4RA 1JZDA 5H5SA 3UL3A 1B2SA 2ML5A 1YF1A 2F99A 1VF3A 3DZLA 1DE1A 1J2BA 1YJN3 3G7IA 3J7Yb 1W89A 2YJHA 1F3AA 3HZ8A 2QC7A 4CJNA 3MHEA 3DGNA 2H0GA 2WCIA 1GP1A 1C72A 1JBTA 1BNGA 3CPOA 1G02A 2DC5A 2VOCA 3A5IA 3AHSA 4G0IA 3ZMLA 2IYJA 1JZWA 1OHPA 3CCQ3 4ZB6A 4XBYA 4BVXA 2F9SA 2MMAA 3DY5A 2L6CA 1BX9A 3NXJA 2QIYA 3RPNA 4QL7A 1GTBA 3D5IA 1CYUA 1E3VA 5KP3A 1B48A 3RDEA 4ZL7A 1GNEA 1IYIA 2LS5A 1G6WA 1ZOFA 4KDXA 3WHOA 1RGCA 2XF3A 1A0RP 2L59A 2AAWA 2GLRA 3TJFA 4I8BA 1UCIA 1X1UA 3EX9A 1Z1SA 2HMJB 2GVPA 2OOVA 1TUHA 2BJXA 1FYSA 3IPTA 3Q90A 2LQOA 3X3YA 1VQP3 1HNCA 4I2TA 2IMDA 2P0MA 4BU4A 3DRNA 3M3MA 1SK2A 1EV4A 4NREA 4WBRD 2F5WA 1SK0A 5CAXA 4YQVA 1BAOA 1IQ8A 2C4BA 4WEYA 3AHWA 1SYRA 3OV4A 5CREA 3LXTA 2C8UA 1M3JA 1GY5A 1PKWA 1GD3A 4ZILA 2C0GA 3K0ZA 2LRNA 4HUAA 4N6UA 1N2AA 1FOHA 2A2PA 1YI23 3F4TA 2MF7A 4HBRA 1Z6NA 4XS1A 3EC9A 2YANA 1ILOA 2KUCA 4IS0A 3FY7A 3MYDA 2D1WA 2GQMA 2IWTA 3EYTA 4MLYA 1T2HA 4BA7A 5IM9A 1ZYNA 2C3NA 2BT3A 3CSIA 3VGNA 1X9WB 1D6UA 1XWKA 1EZKA 3PGBA 4IHUA 1V2AA 1SIHA 4CHSA 3NQZA 1ZO2A 1ZX2A 3VSYA 4EXJA 1RRLA 2IMIA 3STDA 3F6FA 2WRTA 1VQ43 1X5EA 1JLVA 4LL4B 4MF5A 2FWEA 4AJ7A 3VK9A 1YJW3 3ZRDA 2HI7A 4O02B 1B8XA 3WOEB 2JZTA 3GZXB 3X3ZA 6GSTA 5JPPA 1SD8A 4KF9A 3BNCA 3Q3FA 1EG9B 1Q7Y4 1IT8A 19GSA 1G7EA 3VI5A 1PQNA 5CRDA 4AEQA 1ROVA 1K0MA 1RGEA 4RNZA 3V99A 1FB6A 1F37A 2RUFA 2F86B 2CT6A 3FW2A 3IC4A 4TW5A 4NXIA 2GEXA 2H1GA 2WJUA 4GSTA 4HEA2 1T4YA 3BNBA 4MF6A 4HU7A 5EEOA 2YWNA 3UNLA 2H73A 2L6DA 1B2UA 2K9FA 1NO3A 4N6NB 2FWHA 3Q1CA 1HU9A 3A2WA 4TR1B 1RGHA 3HJOA 4J8TA 4GWRA 3KD0A 5HR2A 2DKIA 1GL8A 2DMMA 3HVSA 3PPUA 3TJJA 2IN3A 4WBJA 3WA3A 3N9JA 2GSRA 4ZB8A 5D96A 2BMRB 1EGOA 1M0UA 4X4JA 2W03A 3CMA3 4WF5A 3DGQA 1ST9A 1K3OA 4K0NA 3LTDA 5DRVA 3W6GA 3ZITA 3DH2A 3RAZA 4PQHA 5DCHA 3GKXA 4K1FA 5EY6A 3PCSA 3PYJA 3O76A 4MZBA 5HFIA 2WZ9A 4KX4A 4KNDA 1O7WB 1ACVA 4HJLB 20GSA 4XDWA 1A67A 4QQ7A 4MZCA 4LMIA 1GS3A 4K2DA 1JB4A 3H1NA 3IJEB 1Q42A 2FWGA 5DCGA 2W04A 3DWVA 3NBBA 5J9CA 1BUQA 2GS3A 1B4QA 1K8A4 1OUNA 4U13A 4EV2A 2IJYA 3GSSA 4ECBA 3RHBA 4HS1A 3URPA 4WXTA 1PA3A 3M1GA 3NUVA 4EBGA 4TVEA 2RLIA 3DGYA 1Z9HA 1Z7PA 1IVXA 3P2AA 2V6KA 1A8YA 1D6ZA 4HZ9B 4N6LA 3WOFB 1PX6A 3KH9A 4PQIA 4RBNA 2CVBA 4ZBDA 1NW2A 3D4TA 4BTYA 1LBKA 1Q98A 1M7TA 4OWYA 2HFDA 5ID2B 5ECNB 3JUNA 2CQ9A 5B6MA 2L4QA 2ES7A 2KCDA 5ELAA 1GMPA 1OHOA 3RNTA 2X49A 1N8JA 2V2GA 5BRTA 1IYYA 5IOWA 1T4ZA 1GOVA 2R41A 4DVCA 5D9WA 1LQGC 3LOYA 4HKVB 4PNGA 4FIWA 2H6XA 4HOJA 1AV4A 2ALBA 1QUWA 2CFGA 2FLSA 4GL6A 3E0UA 3TRQA 4BVYB 2V6OA 1CH0A 2BNGA 4J5GA 1KEBA 3ZMKA 1SKSB 2OA7A 1JB2A 5D93A 4YAVA 1R7HA 4CY8A 3F4SA 4TKYA 3EHCA 1I70A 1HYFA 2QEX3 5D81A 2FUG2 4V2NA 5DDLA 4POMA 4WKWA 4I4KA 5G1LA 2P05A 5B6NA 2L57A 3EVIA 6GSSA 3UL6A 3P90A 2CFWA 1TRUA 1AQWA 1HYUA 2YFIB 2OKAA 4BTXA 1E97A 2JZRA 1STDA 1WRYA 5A0OB 2TRXA 3GHAA 1BUJA 2QGUA 2H1BA 3NV0A 3KE7A 1Q9EA 4KW6A 3F3RA 2OBKA 3IMAB 3L4NA 2LRCA 2RCDA 2VD0A 5M18A 3FZ9A 1ERWA 2N5BA 3WODG 2FNQA 1O73A 3H8QA 4YAPA 4N11A 3EN1B 2DJ3A 4ZBAA 4XBTA 4RNYA 1M904 2VLUA 4K1VA 2KHPA 4XBXA 1K734 2DJ0A 3GRDA 3ISOA 3ZVJD 1Z5YE 1NHOA 4ZB9A 3MYTA 1HNBA 1GMRA 1N8QA 1ZZYA 2WOHA 4ZL8A 3OWUA 6GSYA 2WOFA 3ZYWA 2Y73A 4POKA 2H19A 3GRXA 4N6MA 5G1KA 2CHCA 3GUSA 5BU4A 3S27A 4MP4A 4XM4A 1LOWA 3AGNA 2GZZA 3LQ7A 2HRKA 3GZRA 4L7KA 3UJ1A 5AYSC 3ZIVA 4CW9A 1B9XC 1R5AA 1F9MA 1QXHA 1SJ6A 3MIXA 3ZTLA 2VCZA 2I9WA 1FGOA 3PXMA 2CH9A 2K54A 2LQVA 1GULA 4HM6B 2E2VA 3GNJA 5IMAA 2W0QA 1GTAA 4Z7XA 4P3YB 5DVBA 1DE2A 1KWIA 1CYVA 3G0KA 1VF1A 1BEDA 1A0FA 3UJMA 4JE1A 3FR9A 1OPYA 3RPPA 5DALB 4EKZA 3CCL3 2C80A 3BNDA 4KGIA 4LEHA 4NMUA 3ME7A 4MMZB 2KRTA 1LOYA 1JB5A 3KSPA 4GQFA 2H6YA 3UVTA 1O7UA 3S67A 3UEMA 3MG1A 3R3EA 3QMXA 2OCTA 5INYA 4EF0A 1JHBA 4HJMA 3EPTA 2C0DA 14GSA 3WGXA 2WULA 3L0HA 4HM8B 1GSEA 2HMOB 2KAAA 2FNOA 1PFPA 2H75A 8CHOA 3CCV3 3CPW2 5F06A 3C73A 2FCHA 2F3MA 4TXOA 5AIXA 2MMOA 3ZREA 1QMAA 3MWZA 4RZMA 1M2BA 1BOXA 4TR0A 5CRGA 2AHEA 3QFBC 5ELUA 1TRVA 1VZZA 3FYGA 1VRSD 1ZGXA 4LZIA 3HHVA 3HXSA 2H74A 4L5OA 2CK3H 5FW5A 1DMMA 1WWJA 2CVKA 2YWIA 3TKSC 3GTUB 6STDA 3F8HA 4WR4A 4J2FA 4G0KA 3FF2A 4DSSA 1DYUA 1GD4A 1ABAA 5KN2A 3HA9A 2H66A 2O7KA 4EDYA 2CZ3A 4Q5RA 1PMTA 3GFKA 1GOUA 1JZRA 3IR4A 3ED3A 3BU4A 2LJKA 4PX1A 2CG1A 5F05A 5IIZA 5G2GA 1J08A 2GBWB 2YFJB 3NIVA 2PERA 4EUYA 8GSSA 3FG4A 2CZ2A 3BBYA 3S29A 5EPFA 4N6OB 3TUEA 4OVMA 4K2XA 1B2MA 5I97A 1W00A 3G713 3GL5A 2Z7AA 1X1XA 4O7HA 5ECKB 1ZCPA 3F9SA 1TTZA 2HXKA 3F8XA 1PX7A 1GSYA 1QGVA 3C7MA 4L8PA 1TIJA 2NPBA 4HM5B 2AB6A 4IKHA 1GSUA 3AGOA 1PN9A 3I69A 4GHOA 1TP6A 4KCAA 3HIGA 4BL7A 4EW5A 4J56E 1QAFA 3WGEA 4Z2UA 2EIRA 2QGVA 3C1SA 3FMWA 2P0XA 1GSDA 4PEJA 2M46A 1B2ZA 2RM5A 2WO0A 4Q5FA 2GQLA 1NDOB 3CSHA 1HKXA 2RUEA 1R5PA 4CCVA 4F0CA 3VWUA 5FGOA 17GSA 2X4AA 3EN8A 2C3QA 2HZFA 3F3QA 4STDA 4HM1B 4QL9A 4I5QA 3X41A 1USBA 1TRSA 1RGLA 1WTHA 1VQO3 1JBRA 3X42A 4ZBBA 4GXZA 2P5QA 1XBSA 3Q6OA 4JEDA 1M2DA 3IAM2 4J57E 1G6YA 5CF1A 5FWGA 4WYKA 3VFIA 1PL2A 1PD21 2V1MA 4FMCA 2CWUA 3IK7A 3CNMA 1TRQA 2SBLA 2FD3A 3MG3A 2V1LA 1T5YA 3FR6A 3L9SA 3LJRA 4DSRA 5A4WA 3NM2A 1SL2B 5ENUA 4XS6A 5ECHB 4IELA 2C3TA 3L78A 5JCGA 2VCVA 3MWHA 3LGCA 3Q19A 1GNWA 3D6IA 4HI7A 4YH2A 5JWRB 2W56B 3BD2A 4HU9A 2I9HA 4X2OA 1GUKA 4HAAA 3Q2PA 4X43A 1T00A 3BNEA 4N0ZA 3DVWA 3D4AA 4WR5A 2OQEA 3SLUA 4XTSA 1O6JA 1X1WA 2XHFA 4JZQA 1X9SB 3CQFA 4H3UA 2V41A 2J9HA 1ZGNA 2CKFB 1I2GA 1A2PA 1Z3EA 4IBPA 3PZWA 2WGQA 1K0OA 2HMMB 1X5CA 4ECCA 1J9BA 1NJI4 2H0IA 1K0BA 2W9PA 3NBJA 1BRJA 1MWUA 2XH9A 1FA3A 2R4IA 2I1UA 3B7CA 3F9UA 1B2XA 2LUSA 2CAIA 5IEOA 1FUSA 1BRGA 3LG6A 2DKHA 3GH6A 3WT2A 3CCS3 3HKRA 4XCSA 2K8VA 5LD0A 3LMLA 3OR5A 3FHKA 1FVKA 3BCIA 1W4VA 2P5RA 3TKSA 1Y6EA 2GT6A 4YQUA 3IOSA 5COHA 3X40A 2LKUA 2LV3A 5IF6A 4OFTA 1ON4A 4G10A 2A2RA 2FGXA 4YKGA 2VCXA 2UZ8A 5IG0A 2GSTA 3JUPA 6GSPA 1WMOA 2GBXB 1OE8A 1WJKA 1UW1A 1YIJ3 2Z6BA 4IVFA 2RNTA 4G1MB 3DMCA 1JJ22 1UUVB 1U87A 1DMNA 3ER7A 4PXOA 1AUCA 1MD4A 2HZEA 4HM4B 3RHCA 3HJPA 1S5AA 2C10A 1I3FA 3IHGA 3TOTA 4K7OA 3KFQC 3TRPA 12GSA 4LYLB 3GZYB 1TJDA 1BVIA 2B6MA 2PN8A 2VM1A 5EVHA 5M1AA 2VCWA 3DKSA 2A4VA 3HVXA 1HNAA 5D73A 3KTBA 1JNQA 5DJMA 1QALA 4ZL9A 1B9YC 2XSOB 3CNXA 3V98A 2LRTA 4DKIA 1FAAA 4POBA 1FGMA 3MKIA 2BMOB 3M9KA 3O3TA 3EU4A 1T8EB 4IPBA 9RNTA 1FO5A 2R0GA 2WGRA 3QAGA 2B1LA 1O7NB 1F3BA 5BXQA 2XGLA 1OC8A 2R6KA 4MEIA 4KUNA 5KEJA 4RUVA 5KP4A 5IOXA 1IT7A 3HY2A 3MG2A 1THOA 3T8NA 4ICYA 3UMAA 5IMDA 1US1A 1R4CA 3IDVA 3V1WA 4HSCX 2F4YA 2E2GA 1K0DA 5AIGA 1RTUA 2QSIA 4K6XA 1V74A 3QD9A 4ILFA 5IG3A 4XS4A 1MOLA 5E4WA 4R9LA 2LNTA 4NPBA 1XPVA 1O7HB 1T3BA 2DJ1A 3CC73 3B8LA 3G7JA 1N8R4 1RQMA 3MDKA 1O7MB 1AVLA 4HM7B 2RFRA 4RQRA 1J0FA 2IL3A 3CME3 4TXVA 1RGAA 2KLXA 3GL3A 2JDIH 1ZYEA 3KN4A 3AMOA 2N5FA 1BNRA 5RNTA 2KF3A 4MZWA 1EQKA 3F63A 3FR3A 1JKGB 2R37A 1LOXA 3FCSB 3MPHA 3SVAA 5KP1A 2DSAA 3Q74A 4HJ2A 4ML1A 2M72A 2HRAA 5AI1A 4JR4A 1QVF2 4GSPA 3D3LA 1A23A 2VIMA 2MZCA 2AUVA 3HCZA 4OCEA 3S9FA 3DGOA 4E8HA 3IRAA 3K5TA 2YZHA 4MDCA 2F5MA 4IP1A 3NBRA 1GLQA 1GWCA 3VPTA 3EF8A 4OO4A 3DM8A 4GB5A 4X1UA 2CFKA 1M1XB 3FZWA 1SPUA 1RMSA 5KOXA 1RKYA 1BU4A 3WA2X 3PINA 2VLVA 3RDWA 1XWCA 4GTUA 3FG1A 1UI8A 6GSXA 2PVOC 3TKPA 1Z7RA 1SL0B 1GH2A 1KQS2 3ZFLA 1AW9A 4H61A 2WB9A 1LNIA 2K8SA 4MMMA 3K7CA 4XHMA 4FQUA 1BRSA 4ID0A 5G31A 3LTAA 4ML6A 3LYPA 1MDJA 2VL9A 3UBKA 3BCKA 2H30A 1BNIA 3DXBA 3LORA 1JN5A 2GT5A 4OMVA 4F0BA 1THXA 1PL1A 3TKSE 2IMJA 2M7OA 2E2MA 1XOBA 1FZUA 2AADA 4O3VA 3WR2A 3FZ5A 2LTKA 1BRHA 3ME8A 4NV2A 1FVJA 1QFNA 3OXAA 3QFAC 5C00A 2PUKC 3QOUA 4IQ1A 1BANA 2N5AA 1VQ73 3GN3A 4DEJA 5CLKA 2IFQA 3QAWA 4I6XA 1WPIA 2ZA4A 1W6YA 5ECMB 2WGOA 3SX1A 3KZQA 2HSHA 1VQ53 6GSWA 5GAPD 1VQ83 2H70A 4KZ1A 3CRTA 2OOVC 4G2EA 3LZAA 4BPYA 4ORLA 4GCIA 1NU3A 1RGFA 2XFTA 4WFOA 2OQEC 2IY2A 1K3LA 2P31A 3QDNA 4GQCA 4MNNA 2H72A 2HRNA 5D83A 4MJCA 1XIYA 1EEJA 2XFSA 2OTL3 4L8OA 4Q53A 4O92A 22GSA 3ZG0A 4PURA 1M9AA 2C11A 1Q40B 1AY7A 1RK4A 2DLXA 3BIRA 2F8FA 3LYKA 10GSA 1WOUA 4NHZA 1AC1A 3N8BA 2HE3A 4L0WA 2XSHB 4JBBA 3GKMA 4ULXA 2JL4A 2KF5A 1K9M4 1WMPA 2X8HA 3O6TA 1BSDA 2XBQA 2LNSA 3LYGA 2O89A 4G0LA 1TFKA 3UAPA 1BJXA 5BMUA 3EC3A 4AKZA 3EE1A 2MYGA 1KNGA 2QA1A 2ZL8A 3GYKA 1B20A 3TKRA 5IG4A 2B1XB 5HR1A 1AQVA 3JCML 1ZMAA 3EJVA 5BIRA 1Y25A 2O87A 4FYUA 2YCDA 5ECLB 1SD9A 1LNHA 1UVZA 1GRXA 2HSMA 4BIKA 1OH0A 1VQN3 3NOFA 3J7Yd 2FHEA 5AISA 1W6GA 4F82A 2RBIA 1MDIA 1SKRB 3QR6A 1KD14 2DMLA 3FKFA 1W2B2 3A5WA 4FYCA 3HIIA 3M8NA 4X2HA 3M9JA 2GSQA 1PN0A 4O8SA 1YKAA 2E7PA 2IFQB 4K5RA 3GAXA 3CCM3 1V40A 4OFMA 5ECOB 3NQYA 1IV7A 5IO2A 1WIKA 1IVVA 3U6VA 1LOVA 1JN5B 2NDOA 5J41A 1S3CA 1JLWA 4KSMA 2ZHXB 1NM3A 1CQGA 1I0XA 2HRFA 1M2AA 1OCVA 1IQYA 3CXGA 4K7IA 3LT9A 4BIRA 1NB3I 5IW9A 4H86A 2F56A 4E8EA 3RGRA 1I0VA 4NV5A 5A4VA 3E3EA 4FCJA 1PGTA 3I6AA 4LMVA 4LL1B 3EBTA 1YIT3 1N5HA 4KDUA 3ZL5A 3A3TA 3HDCA 5HFGA 3U1WA 1N9JA 4IJIA 2E0QA 4D73B 4KFEA 1IK3A 1RRHA 1M99A 3CXC2 16GSA 1WP0A 5FT3A 3EBYA 1U6TA 4YQMA 4POLA 1YHQ3 4L0UA 4NHWA 1N9EA 1QVG2 2XPDA 4J9AA 3CCU3 1FUWA 3L9VA 4EC6A 3R2QA 4FR9A 1URMA 4XRAA 3ALAA 5D9XA 4Z2RA 1A90A 3CMIA 5F0GA 4HM0B 3FSDA 2ZDJA 3DUKA 5D9TA 4OD7A 4GF0A 5GSTA 3A2XA 4TR4A 4KCEA 4IP6A 2IMKA 1FGQA 2HSYA 5IENA 1UN2A 1S3DA 2DBCA 4WWUC 4MJEA 1O7GB 5HGRA 1I2EA 1PKZA 4N10A 2AAEA 2I4AA 4EIPA 2REMA 3BJ5A 3IA1A 1ZYQB 1MTCA 4OFNA 1BAYA 2A2SA 2O3OA 1RGGA 4BTWA 4NAXA 2GEYA 4MPFA 3DIEA 3ERWA 1I5GA 1NHYA 3BB9A 1OGZA 3W8JA 5C04A 3IBHA 4MA9A 3CTGA 1OHSA 3SOAA 5BVBA 3QRDA 2A15A 3AMOB 3F7XA 1TW9A 3OWSA 4CDOA 4PNFA 2YN1A 1ULJB 2HLSA 4ACSA 1ROAA 2LQQA 2PGTA 4X0XA 4N6V0 5A4UA 1S3RA 5IMZA 5DAKA 2CIUA 3N54B 2P09A 1MEKA 1I3IA 1QK8A 3S28A 3WDGB 4WP5A 3WT1A 4NWYA 4LA1A 2Y74A 4RI6A 2JSZA 4FMDA 13GSA 3GX0A 2KXGA 1UUWB 1Z6MA 1OACA 3UOMA 4F2IA 5EVOA 1A24A 2MMNA 3JUMA 2BHMA 4Q5NA 2X8GA 1VQK3 3X3XA 1E2YA 1GUMA 1OE7A 4FMBA 2MC8A 1AVKA 3EINA 1JBSA 5DREA 1V9WA 4PQ1A 5H5RA 4BL3A 3TOUA 2XRXB 4K8MA 4DSQA 5D8IA 2R4VA 4EO3A 5AIVA 3UVHA 2UX0A 3KXOA 4L5LA 2LJRA 3LFLA 1UI7A 1OKTA 5G30A 2OADA 3H93A 4GLTA 2AJQB 2INXA 4KDYA 4MPGA 4BWSA 1BRKA 5J5NA 5TGNA 1QAKA 1ASKA 4K0GA 5STDA 1TI1A 4IGJA 5JCWA 4ISDA 5AYRB 1NB5I 1KC84 4GRFA 2HYXA 1QJGA 1VF2A 3FF0A 2O9UX 1SJIA 1W5ZA 3FGYA 3I553 4EL1A 3A76A 2WFCA 3EWLA 4N6TA 2B5YA 2KF6A 3QCPA 4OCFA 1OYJA 3ZLPA 1OAZA 2O85A 1IQXA 2KP2A 1G0TA 1I2FA 1Q40A 3PCRA 3KP9A 4V2LA 3LSZA 3ROBA 2IMFA 3EURA 1UUGB 3NV0B 7STDA 1RGKA 1VF4A 4PTSA 2HOHA 4XRDA 3PR8A 2XGNA 1YVBI 4HVNA 1T1VA 4FCZA 3T8UA 3C8EA 3G16A 2TIRA 4KSOA 4JF8A 1W6CA 5G2ZA 3F7SA 3IE3A 4YKFA 2E2TA 1TU8A 2IA7A 4IW9A 3EQQB 2K0MA 2XR8B 3CYNA 2I3YA 4KAEA 5H5QA 2H76A 1XVQA 2PMTA 5CNWA 5F07A 4G19A 2H71A 1R26A 3G6E3 1LJRA 4JU5A 3C1RA 1VQQA 1S723 2I81A 2FA4A 4O2HA 1U3IA 2YOIA 2OE3A 3KEBA 3I563 3E9JB 2VAFA 3CRUA 2CX0A 1AXDA 5CRHA 3TDGA 1A2MA 1X0RA 4EYCA 4EIQA 5AIIA 3P7XA 4AJ6A 3G4S3 1BNJA 5JPUA 5GAND 1BNSA 1XW6A 2IMEA 1BG5A 1B21A 1F8NA 1BQ7A 3WMDA 3Q18A 1YEXA 1FUTA 1ZS7A 4AKYA 3LW9A 5CK6A 3ZIJA 1GLPA 4RNTA 1BGSA 2GTUA 3CC43 3WD6A 7GSSA 5CRWA 1PRXA 1ZL9A 1AIUA 3M0FA 2LSTA 3EMXA 1B27A 1BSCA 2NVLA 1BYEA 1B3SA 5DQYA 2JSYA 3UIWA 4K9ZA 2CFDA 2TRCP 1H75A 4O5UA 2MBSA 4WYKB 1GSFA 2X64A 4MK3A 2GDRA 3US3A 4IJ3A 5GSSA 1GOYA 1AAZA 1BRIA 4JR6A 2P38A 1DETA 2F98A 1I9DA 2CX3A 3HX8A 5LNKe 3KZTA 2IPAA 3TGZA 1L5GB 5JWQB 4FCMA 1EV9A 5LC7A 4R9KA 5JCUA 1CQSA 1EA2A 3D5JA 3HD5A 1X1YA 1S3AA 5HR0A 2KF4A 2BTOT 1K3YA 1GYBA 6GSVA 5IPGA 1O8WA 3SYUA 1ULIB 1KBNA 3H51A 1UGIA 1DBYA 1RNBA 2W6JH 2P0GA 2OWPA 4EE0A 2VCQA 1K0AA 1RN1A 5AEWB 3TJGA 3VWXA 5KN3A 3IHQA 3LH4A 1V58A 4ECJA 3N5OA 2PU9C 1YF0A 2E2UA 3F6DA 1M1K4 2K3DA 1M3IA 2B5XA 1X5DA 1GY7A 1A8LA 3EE2A 1BSEA 3UARA 3D79A 1VQL3 5AN1A 2C1YA 2H1AA 3SXXA 1YNVX 2LJAA 3LT8A 2PWJA 1OF5B 1K28A 3KTLA 2VL2A 2IUKA 3T0UA 2VO4A 1HD2A 2CC3A 1X9MB 3B4PA 2UGIA 2HMKB 2YWOA 2YZUA 4F9ZA 2JACA 1K0NA 2FWFA 1SYXA 2K6VA 2VL2C 2LEGA 3FK8A 1YZXA 5G5FA 3UL5A 2H6ZA 1XCCA 1IVUA 3HOHA 1T7PB 2OBIA 3S5CA 1OF5A 1GTUA 3GX8A 3EU3A 2FGTA 2L1SA 4IIAA 2CWTA 3IV4A 3NX0A 1PFOA 1STFI 1WQLB 4WF4A 1GSPA 2AYTA 4V1Ap 3MAKA 3CCE3 4MJBA 1XXUA 1ZYPA 1RCLA 2GXFA 2WS2A 4GSNA 1UC7A 1YEPA 3RGAA 2ZCTA 1G7OA 5ABRA 5ID2A 4V2MA 3IAS2 4EVMA 1MNLA 1FOVA 1SENA 3DGMA 2G0FA 1TK0B 2PVQA 5D82A 2YV9A 1I8VA 2YV7A 1OKDA 1MD3A 5M19A 2C4JA 2B5EA 1F6MC 3U97A 2K18A 1RNTA 1OC3A 5JWOB 3HYPA 3ZG5A 1ISKA 5KOWA 1HZ1A 1AR0A 5IMCA 4IQAA 4G9HA 5KN1A 4KB3A 1RLSA 5EQLA 1Q824 5IQYA 5GSPA 3OX9A 4O5RA 3KCHA 1TRWA 1OC9A 1JFUA 2W56A 4MJAA 2HT9A 2B24B 2NBSA 1TK8B 2PBJA 3HI7A 4EXRA 2H1DA 4PUFC 3CU3A 1RJOA 3GURA 1UCLA 3TKQA 1XOAA 2ZUPA 1TFOA 2JZSA 2BIRA 3NZNA 3SWLA 4MF7A 3KGKA 1E6BA 1A2LA 2O8VB 3SEDA 9GSSA 1OC9B 2CV4A 4ZXGA 1O7PB 3MSOA 5GZZB 4LMWA 1A2JA 1UA5A 5DALA 3CC23 4R1KA 3PS8A 3KCMA 4KA0A 3PH9A 1N5PA 2NTOA 4HOHA 4KE3A 1AQXA 1MGRA 4ZIJA 1K41A 1EWXA 2BMXA 5B8AA 3KMOA 5FHIA 2MBTA 2Z9SA 4F03A 3GKKA 3KJYA 3BLZA 3F0IA 4LLRA 2R2JA 3G7YA 5ELGA 3BOAA 1MWRA 2CX4A 4LGQA 1OVNA 3D21A 1DSBA 5ECQB 1SL1B 2EC4A 3GA4A 4CDLA 1C54A 4FYBA 5G5EA 1U3AA 4TR3A 1TDIA 1T2IA 4EDZA 1IV9A 3JUQA 4RI7A 1TOFA 1MDKA 3K9MC 1Q4JA 3VI7A 5B8BA 3DYRA 1LQMB 2C0FA 4FH8A 3VF1A 4TR1A 2CW9A 5HR3A 1ML6A 3ZVJA 4V1Ag 2GSPA 2PNCA 2OE1A 1GUHA 11GSA 2X99A 4IN0A 4XIHA 4KT3B 3RBTA 5HQPA 3GKNA 2Q07A 5DJLA 1PY3A 4K61A 5A5KA 3A5EA 1WMNA 4HM2B 5EL8A 6RNTA 3DEXA 1XG8A 4HYZA 2UUGC 1IDPA 3LTCA 4CPKA 1VGLA 1JZOA 2HMLB 5LC6A 5ECPB 1R4WA 1EP8A 3J7Yk 4ECIA 3SOYA 4I2UA 4J5KA 3FRCA 1TKDB 1U8CB 1R4YA 1YKCA 3G8ZA 3KKGA 4BWQA 3K63A 3K8NA 1TP9A 5IMVA 1EOGA 1EEMA 2W9QA 2GU1A 4N30A 1ERVA 3CCR3 3QK9A 3ZFZA 1BRNL 2H01A 4TXOB 3HZPA 3MNGA 3D9RA 3P8WA 4HZBB 1YDKA 1XW9A 4ZM8A 5J3RA 2IUJA 3D4MA 3TRXA 4TRXA 3C71A 3LXUX 3OWYA 2CA8A 5IO0A 2YFLB 4JRFA 4TX4A 3KM6A 1UCKA 4MH2A 4A5PA 1XWBA 3APSA 8RNTA 1DVDA 1DUGA 1TXXA 3IXRA 4Z2TA 1W01A 3QPMA 1Q7HA 1U88A 3U5RE 2L5OA 4K7NA 4Q5QA 1D6YA 2BU4A 2XC2A 3GTUA 3AY8A 2GQKA 4FO5A 3CCJ3 2H0HA 4WETA 5D9VA 4AF2A 1TK5B 3WGDA 2QKEA 1O81A 4O5QA 2M80A 3GMFA 1SJZA 3L0RA 5AGYA 3FZAA 3FH1A 1IVWA 1XVWA 1FG4A 2KOKA 4XS4B 2VCTA 2R5GA 2DIYA 1JRQA 3W8SA 3NM7A 1K0CA 2BO9B 1LRAA 3KH7A 3GV1A 3VWVA 3HJMA 2D42A 1SK1A 4QWTA 3CTFA 3TJBA 1BNFA 5HOHA 5IG5A 3F8UA 1WE0A 4EC0A 4AJ8A 3M8CA 5IMFA 1VQ93 2QA2A 1F2EA 5CF2A 3JUOA 1YVSA 3I0YA 5JBSA 2OJLA 2XBIA 1GY6A 2ML6A 2B1KA 2LYXA 3DD3A 5IERA 1UDII 4MMXB 1C7HA 1MWTA 3GIXA 2X8CA 1B4PA 3JVCA 4N3VA 1SARA 4HDEA 3DXOA 1E3RA 1AQZA 2J23A 4K5SA 5AEUB 2Z76A 1SKWB 2PPTA 1W2ZA 2RM6A 4MABA 1O85A 1Y4KA 2GU3A 4GSSA 2VUPA
chains in the Genus database with same CATH topology
2EIQA 1LU4A 4TN8A 5LCZA 1M9BA 4HZ4A 5DAKB 1GTIA 1RW1A 4MH3A 3IPZA 2MMZA 2IIYA 2VD1A 1XWGA 1YQ1A 2OACA 5CYYA 2EIOA 2VM2A 2L4CA 3L9UA 5KN0A 2HZEB 1XWAA 3KP8A 3PGTA 1ERTA 2JADA 4TOPA 2B7KA 1PSQA 5HFKA 2L5LA 1EP7A 3LWAA 1FB0A 3UBLA 1TU7A 4BL7B 3G9BA 5J9BA 3DMLA 2R3XA 2VLTA 4I97A 5DBQA 4D73A 5CP1A 3LXZA 1NSWA 3FEUA 6GSUA 2D2ZA 2GSSA 2A4HA 3GSTA 2AV4A 4HQSA 3ERGA 3EMPA 3KMNA 1YY7A 4CY6A 4N0VA 1GSQA 2FA8A 1SU9A 2F51A 2H8LA 3I43A 2R0PA 2R0CA 5L71A 1EGRA 1YJ6A 2ON5A 2JU5A 5F8BA 3ERFA 3CSJA 3APOA 2CVDA 3SBCA 4HZ2A 4BVYA 4BVXB 5IPHA 3VPQA 2YNXA 3D22A 3ZFBA 3D0ZA 5B7CA 4DSSB 1V57A 2DJKA 1WMJA 2HNLA 2YPMA 2YWMA 4L8EA 4RQXA 4USSA 1FW1A 2DJ2A 3IK9A 3TB2A 4HQZA 5CO3A 5ECIB 3ZZXA 3APQA 3VWWA 1GSSA 2B3SA 5E59A 2GZPA 4OO5A 1FHEA 2DJJA 3MSZA 3CBUA 2VL3A 2F8AA 4O32A 4PUAA 1XW5A 1ERUA 3TCOA 1IYHA 3H4KA 3TJKA 4MCUA 2GGTA 2V32A 2B7JA 2YP6A 3HVVA 1V98A 1O8XA 2CAQA 3H79A 18GSA 2C0EA 1CQHA 2XPEA 1XZOA 3QAVA 2GZYA 2RIIA 2WDUA 2ZNMA 3KIJA 5J4UA 3GH9A 3I9V2 2ON7A 4PGTA 3LEFA 3HZ4A 2YJ7A 4KH7A 3IC8A 4AGSA 2OE0A 2DIZA 1QMVA 1HQOA 5ECRB 4JRRA 1XFLA 5ECSA 5DQSA 1H4OA 1QQ2A 1TI3A 3VLNA 1KTEA 2KP1A 2FY6A 3FZ4A 3WYWA 3DVXA 3A2VA 2G2QA 3VURA 1EOHA 3F4RA 1JZDA 5H5SA 3UL3A 1YF1A 1VF3A 1DE1A 3G7IA 3J7Yb 1W89A 2YJHA 1F3AA 3HZ8A 2QC7A 2H0GA 2WCIA 1GP1A 1C72A 2DC5A 2VOCA 3A5IA 4G0IA 3ZMLA 2IYJA 1JZWA 4ZB6A 4BVXA 2F9SA 2MMAA 2L6CA 1BX9A 3RPNA 4QL7A 1GTBA 1B48A 4ZL7A 1GNEA 1IYIA 2LS5A 1G6WA 1ZOFA 4KDXA 1A0RP 2L59A 2AAWA 2GLRA 3TJFA 4I8BA 2GVPA 2BJXA 2LQOA 1HNCA 4I2TA 2IMDA 3DRNA 3M3MA 1SK2A 1EV4A 4WBRD 1SK0A 5CAXA 4YQVA 4WEYA 1SYRA 5CREA 3LXTA 2C8UA 1PKWA 4ZILA 2C0GA 2LRNA 4HUAA 1N2AA 2A2PA 1FOHA 3F4TA 1Z6NA 4XS1A 2YANA 1ILOA 2KUCA 4IS0A 3FY7A 3MYDA 2GQMA 2IWTA 3EYTA 4MLYA 4BA7A 5IM9A 1ZYNA 2C3NA 3CSIA 1X9WB 1XWKA 1EZKA 4IHUA 1V2AA 4CHSA 4EXJA 2IMIA 3F6FA 2WRTA 1X5EA 1JLVA 4LL4B 4MF5A 2FWEA 4AJ7A 3VK9A 3ZRDA 2HI7A 1B8XA 2JZTA 6GSTA 1SD8A 4KF9A 19GSA 1G7EA 3VI5A 1PQNA 5CRDA 1K0MA 1FB6A 1F37A 2RUFA 2CT6A 3FW2A 3IC4A 4TW5A 4NXIA 2H1GA 2WJUA 4GSTA 4HEA2 1T4YA 4MF6A 4HU7A 2YWNA 2H73A 2L6DA 2K9FA 2FWHA 3A2WA 4TR1B 3HJOA 4GWRA 3KD0A 5HR2A 2DKIA 1GL8A 2DMMA 3HVSA 3PPUA 3TJJA 2IN3A 4WBJA 3N9JA 2GSRA 4ZB8A 5D96A 1EGOA 1M0UA 4X4JA 4WF5A 3DGQA 1ST9A 1K3OA 4K0NA 3W6GA 3ZITA 3RAZA 4PQHA 5DCHA 3GKXA 4K1FA 5EY6A 3O76A 4MZBA 5HFIA 2WZ9A 4KX4A 4KNDA 1ACVA 20GSA 4QQ7A 4MZCA 4K2DA 3H1NA 2FWGA 5DCGA 3DWVA 5J9CA 2GS3A 1B4QA 2IJYA 3GSSA 4ECBA 3RHBA 4HS1A 4WXTA 1PA3A 3M1GA 4TVEA 2RLIA 1Z7PA 1Z9HA 3P2AA 2V6KA 1A8YA 1PX6A 3KH9A 4PQIA 2CVBA 4ZBDA 1NW2A 3D4TA 1LBKA 1Q98A 4OWYA 1M7TA 5ID2B 2HFDA 5ECNB 2CQ9A 5B6MA 2L4QA 2ES7A 5ELAA 2X49A 1N8JA 2V2GA 5BRTA 5IOWA 1T4ZA 4DVCA 5D9WA 4PNGA 4FIWA 2H6XA 4HOJA 2ALBA 1QUWA 2FLSA 3E0UA 3TRQA 4BVYB 2V6OA 1KEBA 3ZMKA 1SKSB 2OA7A 5D93A 4YAVA 1R7HA 4CY8A 3F4SA 4TKYA 2FUG2 4V2NA 5DDLA 4POMA 4WKWA 5G1LA 5B6NA 2L57A 3EVIA 6GSSA 3P90A 1TRUA 1AQWA 1HYUA 2OKAA 2JZRA 1WRYA 2TRXA 3GHAA 2H1BA 4KW6A 3F3RA 2OBKA 3L4NA 2LRCA 2VD0A 3FZ9A 1ERWA 2N5BA 1O73A 3H8QA 4YAPA 4N11A 2DJ3A 4ZBAA 2VLUA 2KHPA 2DJ0A 3ISOA 3ZVJD 1Z5YE 1NHOA 4ZB9A 1HNBA 1ZZYA 4ZL8A 6GSYA 3ZYWA 4POKA 2H19A 3GRXA 5G1KA 3GUSA 4MP4A 2GZZA 3LQ7A 2HRKA 3UJ1A 3ZIVA 4CW9A 1B9XC 1R5AA 1F9MA 1QXHA 1SJ6A 3MIXA 3ZTLA 2VCZA 1GULA 3GNJA 5IMAA 1GTAA 4Z7XA 4P3YB 5DVBA 1DE2A 1VF1A 1BEDA 1A0FA 4JE1A 3FR9A 3RPPA 5DALB 4EKZA 2C80A 4KGIA 4NMUA 3ME7A 4GQFA 2H6YA 3UVTA 1O7UA 3UEMA 5INYA 3R3EA 3QMXA 4EF0A 1JHBA 4HJMA 3EPTA 2C0DA 14GSA 3WGXA 2WULA 3L0HA 1GSEA 2FNOA 2H75A 5F06A 3C73A 2FCHA 2F3MA 4TXOA 5AIXA 2MMOA 3ZREA 1M2BA 4TR0A 5CRGA 2AHEA 3QFBC 1TRVA 3FYGA 1VRSD 3HHVA 3HXSA 2H74A 4L5OA 1WWJA 2CVKA 2YWIA 3TKSC 3GTUB 4WR4A 4J2FA 4G0KA 4DSSA 1ABAA 5KN2A 3HA9A 2H66A 2O7KA 4EDYA 2CZ3A 4Q5RA 1PMTA 3GFKA 1JZRA 3IR4A 3ED3A 2LJKA 4PX1A 5F05A 5IIZA 1J08A 3NIVA 2PERA 4EUYA 8GSSA 2CZ2A 3BBYA 5EPFA 3TUEA 4K2XA 3GL5A 4O7HA 5ECKB 1ZCPA 1TTZA 2HXKA 1PX7A 1GSYA 1QGVA 3C7MA 2NPBA 2AB6A 4IKHA 1GSUA 1PN9A 3I69A 4KCAA 4BL7A 4J56E 3WGEA 4Z2UA 2EIRA 2QGVA 3FMWA 3C1SA 2M46A 1GSDA 2RM5A 4Q5FA 2GQLA 3CSHA 2RUEA 1R5PA 4F0CA 3VWUA 17GSA 2X4AA 2C3QA 2HZFA 3F3QA 4QL9A 4I5QA 1TRSA 1USBA 4ZBBA 4GXZA 2P5QA 1XBSA 3Q6OA 4JEDA 1M2DA 3IAM2 4J57E 1G6YA 5FWGA 3VFIA 1PL2A 1PD21 2V1MA 3IK7A 2FD3A 3FR6A 3L9SA 4DSRA 3LJRA 5A4WA 1SL2B 5ENUA 4XS6A 5ECHB 4IELA 2C3TA 3L78A 5JCGA 2VCVA 3MWHA 3LGCA 3Q19A 1GNWA 3D6IA 4HI7A 4YH2A 5JWRB 3BD2A 4HU9A 2I9HA 1GUKA 4X43A 1T00A 4N0ZA 3DVWA 4WR5A 4XTSA 1O6JA 2XHFA 4JZQA 1X9SB 2V41A 2J9HA 1ZGNA 1Z3EA 4IBPA 1K0OA 4ECCA 1X5CA 1J9BA 2H0IA 1K0BA 2I1UA 3F9UA 2LUSA 2CAIA 3LG6A 2DKHA 3GH6A 3WT2A 4XCSA 3HKRA 2K8VA 5LD0A 3OR5A 3FHKA 1FVKA 3BCIA 1W4VA 3TKSA 2P5RA 1Y6EA 2GT6A 4YQUA 5COHA 3IOSA 2LKUA 2LV3A 4OFTA 1ON4A 4G10A 2A2RA 2FGXA 4YKGA 2VCXA 2UZ8A 2GSTA 1OE8A 1WJKA 4IVFA 1U87A 4PXOA 1AUCA 1MD4A 2HZEA 3RHCA 3HJPA 3IHGA 3TOTA 4K7OA 3TRPA 12GSA 1TJDA 2B6MA 2PN8A 2VM1A 2VCWA 3DKSA 2A4VA 3HVXA 1HNAA 5D73A 3KTBA 5DJMA 4ZL9A 1B9YC 2LRTA 1FAAA 4POBA 3M9KA 3O3TA 3EU4A 1T8EB 1FO5A 2R0GA 2WGRA 3QAGA 2B1LA 1F3BA 1OC8A 2R6KA 4KUNA 5KEJA 4RUVA 5IOXA 3HY2A 1THOA 4ICYA 3UMAA 5IMDA 3IDVA 3V1WA 2E2GA 1K0DA 2QSIA 4K6XA 3QD9A 4ILFA 4XS4A 5E4WA 2LNTA 4NPBA 1XPVA 1T3BA 2DJ1A 3G7JA 1RQMA 3MDKA 4RQRA 1J0FA 2IL3A 4TXVA 2KLXA 3GL3A 1ZYEA 2N5FA 4MZWA 3F63A 3FR3A 2R37A 4HJ2A 3Q74A 2DSAA 4ML1A 2M72A 2HRAA 4JR4A 1A23A 2VIMA 2MZCA 2AUVA 3HCZA 4OCEA 3S9FA 4E8HA 3IRAA 2YZHA 4MDCA 4IP1A 1GLQA 1GWCA 3VPTA 4OO4A 4X1UA 5KOXA 3PINA 2VLVA 3RDWA 1XWCA 4GTUA 6GSXA 2PVOC 3TKPA 1Z7RA 1SL0B 1GH2A 3ZFLA 1AW9A 2WB9A 2K8SA 4MMMA 4XHMA 4FQUA 4ID0A 5G31A 4ML6A 3LYPA 1MDJA 2VL9A 3UBKA 3BCKA 2H30A 3DXBA 3LORA 2GT5A 4OMVA 4F0BA 1THXA 1PL1A 3TKSE 2E2MA 1XOBA 3FZ5A 2LTKA 3ME8A 4NV2A 1FVJA 1QFNA 3QFAC 5C00A 2PUKC 3QOUA 4IQ1A 2N5AA 4DEJA 3GN3A 2IFQA 3QAWA 4I6XA 1WPIA 5ECMB 3KZQA 2HSHA 6GSWA 5GAPD 2H70A 3CRTA 4G2EA 4BPYA 4GCIA 2P31A 2IY2A 1K3LA 3QDNA 4GQCA 4MNNA 2H72A 2HRNA 4MJCA 1XIYA 1EEJA 4O92A 22GSA 4PURA 1M9AA 2DLXA 1RK4A 2F8FA 10GSA 3LYKA 1WOUA 4NHZA 1AC1A 2HE3A 4L0WA 4JBBA 3GKMA 4ULXA 2JL4A 2X8HA 3O6TA 2XBQA 2LNSA 2O89A 3UAPA 4G0LA 1BJXA 5BMUA 3EC3A 2MYGA 1KNGA 2QA1A 3GYKA 3TKRA 5HR1A 1AQVA 3JCML 1ZMAA 2O87A 1Y25A 4FYUA 2YCDA 5ECLB 1SD9A 1UVZA 1GRXA 2HSMA 3NOFA 2FHEA 5AISA 4F82A 1MDIA 1SKRB 3QR6A 2DMLA 3FKFA 3A5WA 4FYCA 3M8NA 3M9JA 2GSQA 1PN0A 1YKAA 2E7PA 2IFQB 4K5RA 1V40A 4OFMA 5ECOB 5IO2A 1WIKA 3U6VA 2NDOA 5J41A 1S3CA 1JLWA 4KSMA 1NM3A 1CQGA 2HRFA 1M2AA 3CXGA 4K7IA 4H86A 4E8EA 4NV5A 5A4VA 3E3EA 1PGTA 3I6AA 4LMVA 4LL1B 3ZL5A 4KDUA 3A3TA 3HDCA 5HFGA 4IJIA 2E0QA 4D73B 1WP0A 1M99A 16GSA 5FT3A 1U6TA 4YQMA 4POLA 4L0UA 4NHWA 2XPDA 3L9VA 3R2QA 1URMA 4XRAA 5D9XA 4Z2RA 3CMIA 5F0GA 5D9TA 4OD7A 4GF0A 5GSTA 3A2XA 4TR4A 4KCEA 4IP6A 2IMKA 2HSYA 1UN2A 1S3DA 2DBCA 4MJEA 1PKZA 4N10A 2I4AA 4EIPA 2REMA 3BJ5A 3IA1A 1ZYQB 1MTCA 4OFNA 1BAYA 2A2SA 4NAXA 4MPFA 3DIEA 3ERWA 1I5GA 1NHYA 3W8JA 5C04A 3IBHA 4MA9A 3CTGA 1TW9A 4CDOA 4PNFA 2YN1A 2HLSA 4ACSA 2LQQA 2PGTA 4X0XA 5A4UA 5IMZA 5DAKA 1MEKA 1QK8A 3WT1A 4NWYA 4LA1A 4RI6A 2JSZA 13GSA 3GX0A 1Z6MA 4F2IA 3UOMA 5EVOA 1A24A 2MMNA 4Q5NA 2X8GA 1E2YA 1GUMA 1OE7A 3EINA 1V9WA 3TOUA 5H5RA 4PQ1A 4K8MA 4DSQA 5D8IA 2R4VA 4EO3A 5AIVA 3UVHA 3KXOA 4L5LA 2LJRA 3LFLA 1OKTA 5G30A 2OADA 3H93A 4GLTA 2AJQB 4MPGA 4KDYA 4BWSA 5J5NA 4K0GA 1TI1A 4IGJA 5JCWA 4ISDA 4GRFA 2HYXA 1VF2A 1SJIA 4EL1A 2WFCA 3EWLA 2B5YA 3QCPA 4OCFA 1OYJA 3ZLPA 1OAZA 2O85A 2KP2A 1G0TA 3KP9A 4V2LA 3LSZA 2IMFA 3EURA 1VF4A 4PTSA 4XRDA 3PR8A 1T1VA 3C8EA 2TIRA 4KSOA 5G2ZA 3IE3A 4YKFA 1TU8A 4IW9A 3CYNA 2I3YA 4KAEA 5H5QA 5CNWA 2H76A 1XVQA 2PMTA 5F07A 4G19A 2H71A 1R26A 1LJRA 4JU5A 3C1RA 2I81A 2FA4A 2YOIA 1U3IA 2OE3A 3KEBA 3E9JB 2VAFA 3CRUA 1AXDA 5CRHA 1X0RA 1A2MA 3TDGA 4EIQA 3P7XA 4AJ6A 5GAND 1XW6A 2IMEA 1BG5A 1BQ7A 3Q18A 1YEXA 3LW9A 3ZIJA 1GLPA 2GTUA 3WD6A 7GSSA 5CRWA 1PRXA 1ZL9A 1AIUA 3M0FA 2LSTA 3EMXA 2NVLA 1BYEA 5DQYA 2JSYA 3UIWA 4K9ZA 2TRCP 1H75A 4O5UA 2MBSA 1GSFA 2X64A 4MK3A 2GDRA 3US3A 4IJ3A 5GSSA 1AAZA 4JR6A 1I9DA 2CX3A 5LNKe 2IPAA 3TGZA 5JWQB 1EV9A 5JCUA 3D5JA 3HD5A 1S3AA 5HR0A 2BTOT 1K3YA 6GSVA 5IPGA 1O8WA 1KBNA 1DBYA 2P0GA 4EE0A 2VCQA 1K0AA 3TJGA 3VWXA 5KN3A 3IHQA 1V58A 4ECJA 3N5OA 2PU9C 1YF0A 3F6DA 2B5XA 1X5DA 3EE2A 1A8LA 3UARA 5AN1A 2C1YA 2H1AA 2LJAA 2PWJA 3KTLA 2VL2A 2VO4A 1HD2A 1X9MB 2YWOA 2YZUA 4F9ZA 2JACA 1K0NA 2FWFA 1SYXA 2K6VA 2VL2C 2LEGA 3FK8A 1YZXA 5G5FA 2H6ZA 1XCCA 1T7PB 2OBIA 1GTUA 3GX8A 3EU3A 3IV4A 4WF4A 2AYTA 4V1Ap 3MAKA 4MJBA 1XXUA 1ZYPA 2WS2A 4GSNA 1UC7A 1YEPA 2ZCTA 1G7OA 5ABRA 5ID2A 4V2MA 3IAS2 4EVMA 1FOVA 1SENA 2G0FA 1TK0B 2PVQA 2YV9A 2YV7A 1OKDA 1MD3A 2C4JA 2B5EA 1F6MC 2K18A 1OC3A 5JWOB 3HYPA 5KOWA 5IMCA 4IQAA 4G9HA 5KN1A 4KB3A 5IQYA 4O5RA 1TRWA 1OC9A 1JFUA 4MJAA 2HT9A 2NBSA 1TK8B 2PBJA 2H1DA 4PUFC 3GURA 3TKQA 1XOAA 2ZUPA 2JZSA 3NZNA 3SWLA 4MF7A 3KGKA 1E6BA 1A2LA 2O8VB 9GSSA 1OC9B 2CV4A 4ZXGA 5GZZB 4LMWA 1A2JA 1UA5A 5DALA 3KCMA 4KA0A 3PH9A 2NTOA 4KE3A 1AQXA 4ZIJA 1EWXA 2BMXA 5B8AA 3KMOA 5FHIA 2MBTA 2Z9SA 4F03A 3GKKA 3KJYA 3F0IA 4LLRA 2R2JA 5ELGA 3G7YA 3BOAA 2CX4A 1OVNA 3D21A 1DSBA 5ECQB 1SL1B 2EC4A 3GA4A 4FYBA 5G5EA 1U3AA 4TR3A 1TDIA 4EDZA 4RI7A 1TOFA 1MDKA 1Q4JA 3VI7A 5B8BA 3DYRA 2C0FA 4FH8A 4TR1A 5HR3A 1ML6A 3ZVJA 4V1Ag 2OE1A 1GUHA 11GSA 2X99A 4IN0A 4XIHA 3RBTA 5HQPA 3GKNA 5DJLA 5A5KA 5EL8A 3DEXA 1VGLA 1JZOA 5ECPB 1R4WA 1EP8A 3J7Yk 4ECIA 4I2UA 3FRCA 1TKDB 1YKCA 4BWQA 3K8NA 1TP9A 5IMVA 1EOGA 1EEMA 4N30A 1ERVA 2H01A 4TXOB 3MNGA 3P8WA 1YDKA 1XW9A 5J3RA 3D4MA 3TRXA 4TRXA 3C71A 2CA8A 5IO0A 3KM6A 4MH2A 4A5PA 1XWBA 3APSA 1DUGA 1TXXA 3IXRA 4Z2TA 3QPMA 1U88A 3U5RE 4K7NA 4Q5QA 2L5OA 4WETA 2XC2A 3GTUA 4FO5A 3AY8A 2GQKA 2H0HA 5D9VA 4AF2A 1TK5B 3WGDA 2QKEA 1O81A 4O5QA 2M80A 3GMFA 1SJZA 5AGYA 3FZAA 1XVWA 1FG4A 2KOKA 4XS4B 2VCTA 2R5GA 2DIYA 3W8SA 1K0CA 3KH7A 3GV1A 3VWVA 3HJMA 1SK1A 3CTFA 3TJBA 3F8UA 1WE0A 4EC0A 4AJ8A 5IMFA 2QA2A 1F2EA 2OJLA 2XBIA 2B1KA 3DD3A 3GIXA 2X8CA 1B4PA 4HDEA 2J23A 4K5SA 1SKWB 2PPTA 2RM6A 4MABA 1O85A 4GSSA 2VUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIQ A;  1LU4 A;  4TN8 A;  5LCZ A;  1M9B A;  4HZ4 A;  5DAK B;  1GTI A;  1RW1 A;  4MH3 A;  3IPZ A;  2MMZ A;  2IIY A;  2VD1 A;  1XWG A;  1YQ1 A;  2OAC A;  5CYY A;  2EIO A;  2VM2 A;  2L4C A;  3L9U A;  5KN0 A;  2HZE B;  1XWA A;  3KP8 A;  3PGT A;  1ERT A;  2JAD A;  4TOP A;  2B7K A;  1PSQ A;  5HFK A;  2L5L A;  1EP7 A;  3LWA A;  1FB0 A;  3UBL A;  1TU7 A;  3G9B A;  5J9B A;  3DML A;  2R3X A;  2VLT A;  4I97 A;  5DBQ A;  4D73 A;  5CP1 A;  3LXZ A;  1NSW A;  3FEU A;  6GSU A;  2D2Z A;  2GSS A;  3GST A;  2AV4 A;  4HQS A;  3ERG A;  3EMP A;  3KMN A;  1YY7 A;  4N0V A;  1GSQ A;  2FA8 A;  1SU9 A;  2F51 A;  2H8L A;  3I43 A;  5L71 A;  1EGR A;  1YJ6 A;  2ON5 A;  2JU5 A;  5F8B A;  3ERF A;  3CSJ A;  3APO A;  2CVD A;  3SBC A;  4HZ2 A;  4BVY A;  5IPH A;  3VPQ A;  2YNX A;  3D22 A;  3ZFB A;  3D0Z A;  5B7C A;  4DSS B;  1V57 A;  2DJK A;  1WMJ A;  2HNL A;  2YPM A;  2YWM A;  4L8E A;  4RQX A;  1FW1 A;  2DJ2 A;  3IK9 A;  3TB2 A;  4HQZ A;  5CO3 A;  5ECI B;  3ZZX A;  3APQ A;  3VWW A;  1GSS A;  2B3S A;  5E59 A;  2GZP A;  4OO5 A;  1FHE A;  2DJJ A;  3MSZ A;  3CBU A;  2VL3 A;  2F8A A;  4O32 A;  4PUA A;  1XW5 A;  1ERU A;  3TCO A;  1IYH A;  3H4K A;  3TJK A;  4MCU A;  2GGT A;  2V32 A;  2B7J A;  2YP6 A;  3HVV A;  1V98 A;  1O8X A;  2CAQ A;  3H79 A;  18GS A;  2C0E A;  1CQH A;  2XPE A;  1XZO A;  3QAV A;  2GZY A;  2RII A;  2WDU A;  2ZNM A;  3KIJ A;  5J4U A;  3GH9 A;  3I9V 2;  2ON7 A;  4PGT A;  3LEF A;  3HZ4 A;  2YJ7 A;  4KH7 A;  4AGS A;  2OE0 A;  2DIZ A;  1QMV A;  1HQO A;  5ECR B;  4JRR A;  1XFL A;  5ECS A;  5DQS A;  1H4O A;  1QQ2 A;  1TI3 A;  3VLN A;  1KTE A;  2KP1 A;  2FY6 A;  3FZ4 A;  3WYW A;  3DVX A;  3A2V A;  3VUR A;  2G2Q A;  1EOH A;  3F4R A;  1JZD A;  5H5S A;  3UL3 A;  1YF1 A;  1VF3 A;  1DE1 A;  3G7I A;  3J7Y b;  1W89 A;  2YJH A;  1F3A A;  3HZ8 A;  2QC7 A;  2H0G A;  2WCI A;  1GP1 A;  1C72 A;  2DC5 A;  2VOC A;  3ZML A;  2IYJ A;  1JZW A;  4ZB6 A;  4BVX A;  2F9S A;  2MMA A;  2L6C A;  1BX9 A;  3RPN A;  4QL7 A;  1GTB A;  1B48 A;  4ZL7 A;  1GNE A;  1IYI A;  2LS5 A;  1G6W A;  1ZOF A;  4KDX A;  1A0R P;  2L59 A;  2AAW A;  2GLR A;  3TJF A;  4I8B A;  2GVP A;  2BJX A;  2LQO A;  1HNC A;  4I2T A;  2IMD A;  3DRN A;  3M3M A;  1SK2 A;  1EV4 A;  4WBR D;  1SK0 A;  5CAX A;  4YQV A;  4WEY A;  1SYR A;  5CRE A;  3LXT A;  2C8U A;  1PKW A;  4ZIL A;  2C0G A;  2LRN A;  4HUA A;  1N2A A;  3F4T A;  1Z6N A;  4XS1 A;  2YAN A;  1ILO A;  2KUC A;  4IS0 A;  3FY7 A;  2GQM A;  2IWT A;  3EYT A;  4MLY A;  4BA7 A;  5IM9 A;  2C3N A;  3CSI A;  1X9W B;  1XWK A;  1EZK A;  4IHU A;  1V2A A;  4CHS A;  4EXJ A;  2IMI A;  3F6F A;  2WRT A;  1X5E A;  1JLV A;  4LL4 B;  4MF5 A;  2FWE A;  4AJ7 A;  3VK9 A;  3ZRD A;  2HI7 A;  1B8X A;  2JZT A;  6GST A;  1SD8 A;  19GS A;  1G7E A;  3VI5 A;  1PQN A;  5CRD A;  1K0M A;  1FB6 A;  1F37 A;  2RUF A;  2CT6 A;  3FW2 A;  3IC4 A;  4TW5 A;  4NXI A;  2H1G A;  2WJU A;  4GST A;  4HEA 2;  1T4Y A;  4MF6 A;  4HU7 A;  2YWN A;  2H73 A;  2L6D A;  2K9F A;  2FWH A;  3A2W A;  4TR1 B;  3HJO A;  4GWR A;  3KD0 A;  5HR2 A;  1GL8 A;  2DMM A;  3HVS A;  3TJJ A;  2IN3 A;  4WBJ A;  3N9J A;  2GSR A;  4ZB8 A;  5D96 A;  1EGO A;  1M0U A;  4WF5 A;  3DGQ A;  1ST9 A;  1K3O A;  4K0N A;  3W6G A;  3ZIT A;  3RAZ A;  4PQH A;  5DCH A;  3GKX A;  4K1F A;  5EY6 A;  3O76 A;  4MZB A;  5HFI A;  2WZ9 A;  4KX4 A;  4KND A;  1ACV A;  20GS A;  4QQ7 A;  4MZC A;  4K2D A;  3H1N A;  2FWG A;  5DCG A;  3DWV A;  5J9C A;  2GS3 A;  1B4Q A;  2IJY A;  3GSS A;  4ECB A;  3RHB A;  4HS1 A;  4WXT A;  1PA3 A;  3M1G A;  4TVE A;  2RLI A;  1Z7P A;  1Z9H A;  3P2A A;  2V6K A;  1A8Y A;  1PX6 A;  3KH9 A;  4PQI A;  2CVB A;  4ZBD A;  1NW2 A;  3D4T A;  1LBK A;  1Q98 A;  4OWY A;  1M7T A;  5ID2 B;  2HFD A;  5ECN B;  2CQ9 A;  5B6M A;  2L4Q A;  2ES7 A;  5ELA A;  1N8J A;  2V2G A;  5IOW A;  1T4Z A;  4DVC A;  5D9W A;  4PNG A;  4FIW A;  2H6X A;  4HOJ A;  2ALB A;  1QUW A;  2FLS A;  3E0U A;  3TRQ A;  2V6O A;  1KEB A;  3ZMK A;  1SKS B;  2OA7 A;  5D93 A;  4YAV A;  1R7H A;  3F4S A;  4TKY A;  2FUG 2;  4V2N A;  5DDL A;  4POM A;  4WKW A;  5G1L A;  5B6N A;  2L57 A;  3EVI A;  6GSS A;  3P90 A;  1TRU A;  1AQW A;  1HYU A;  2OKA A;  2JZR A;  1WRY A;  2TRX A;  3GHA A;  2H1B A;  4KW6 A;  3F3R A;  2OBK A;  3L4N A;  2LRC A;  2VD0 A;  3FZ9 A;  1ERW A;  2N5B A;  1O73 A;  3H8Q A;  4YAP A;  4N11 A;  2DJ3 A;  4ZBA A;  2VLU A;  2KHP A;  2DJ0 A;  3ISO A;  3ZVJ D;  1Z5Y E;  1NHO A;  4ZB9 A;  1HNB A;  1ZZY A;  4ZL8 A;  6GSY A;  3ZYW A;  4POK A;  2H19 A;  3GRX A;  5G1K A;  3GUS A;  4MP4 A;  2GZZ A;  3LQ7 A;  3UJ1 A;  3ZIV A;  4CW9 A;  1B9X C;  1R5A A;  1F9M A;  1QXH A;  1SJ6 A;  3ZTL A;  2VCZ A;  1GUL A;  3GNJ A;  5IMA A;  1GTA A;  4Z7X A;  4P3Y B;  5DVB A;  1DE2 A;  1VF1 A;  1BED A;  1A0F A;  4JE1 A;  3FR9 A;  3RPP A;  5DAL B;  4EKZ A;  2C80 A;  4KGI A;  4NMU A;  3ME7 A;  4GQF A;  2H6Y A;  3UVT A;  1O7U A;  3UEM A;  5INY A;  3QMX A;  4EF0 A;  1JHB A;  4HJM A;  14GS A;  2C0D A;  3WGX A;  2WUL A;  3L0H A;  1GSE A;  2FNO A;  2H75 A;  5F06 A;  3C73 A;  2FCH A;  2F3M A;  4TXO A;  5AIX A;  2MMO A;  3ZRE A;  1M2B A;  4TR0 A;  5CRG A;  2AHE A;  3QFB C;  1TRV A;  3FYG A;  1VRS D;  3HHV A;  3HXS A;  2H74 A;  4L5O A;  1WWJ A;  2CVK A;  2YWI A;  3TKS C;  3GTU B;  4WR4 A;  4J2F A;  4DSS A;  1ABA A;  5KN2 A;  3HA9 A;  2H66 A;  2O7K A;  4EDY A;  2CZ3 A;  4Q5R A;  1PMT A;  3GFK A;  1JZR A;  3IR4 A;  3ED3 A;  2LJK A;  4PX1 A;  5F05 A;  5IIZ A;  1J08 A;  3NIV A;  2PER A;  4EUY A;  8GSS A;  2CZ2 A;  3BBY A;  5EPF A;  3TUE A;  3GL5 A;  4O7H A;  5ECK B;  1ZCP A;  1TTZ A;  2HXK A;  1PX7 A;  1GSY A;  1QGV A;  3C7M A;  2NPB A;  2AB6 A;  4IKH A;  1GSU A;  1PN9 A;  3I69 A;  4KCA A;  4BL7 A;  4J56 E;  3WGE A;  2EIR A;  2QGV A;  3C1S A;  2M46 A;  1GSD A;  2RM5 A;  4Q5F A;  2GQL A;  3CSH A;  2RUE A;  1R5P A;  4F0C A;  3VWU A;  17GS A;  2C3Q A;  2HZF A;  3F3Q A;  4QL9 A;  4I5Q A;  1TRS A;  1USB A;  4ZBB A;  4GXZ A;  2P5Q A;  1XBS A;  3Q6O A;  4JED A;  1M2D A;  3IAM 2;  4J57 E;  1G6Y A;  5FWG A;  3VFI A;  1PL2 A;  1PD2 1;  2V1M A;  3IK7 A;  2FD3 A;  3FR6 A;  3L9S A;  4DSR A;  3LJR A;  5A4W A;  1SL2 B;  5ENU A;  4XS6 A;  5ECH B;  4IEL A;  2C3T A;  3L78 A;  5JCG A;  2VCV A;  3MWH A;  3LGC A;  3Q19 A;  1GNW A;  3D6I A;  4HI7 A;  4YH2 A;  5JWR B;  3BD2 A;  4HU9 A;  2I9H A;  1GUK A;  4X43 A;  1T00 A;  4N0Z A;  3DVW A;  4WR5 A;  4XTS A;  1O6J A;  2XHF A;  4JZQ A;  1X9S B;  2V41 A;  2J9H A;  1ZGN A;  1Z3E A;  4IBP A;  1K0O A;  4ECC A;  1X5C A;  1J9B A;  2H0I A;  1K0B A;  2I1U A;  3F9U A;  2LUS A;  2CAI A;  3LG6 A;  3GH6 A;  3WT2 A;  4XCS A;  3HKR A;  2K8V A;  5LD0 A;  3OR5 A;  3FHK A;  1FVK A;  3BCI A;  1W4V A;  2P5R A;  3TKS A;  1Y6E A;  2GT6 A;  4YQU A;  5COH A;  3IOS A;  2LKU A;  2LV3 A;  4OFT A;  1ON4 A;  4G10 A;  2A2R A;  2FGX A;  2VCX A;  2GST A;  1OE8 A;  1WJK A;  4IVF A;  1U87 A;  4PXO A;  1AUC A;  1MD4 A;  2HZE A;  3RHC A;  3HJP A;  3TOT A;  4K7O A;  3TRP A;  12GS A;  1TJD A;  2B6M A;  2PN8 A;  2VM1 A;  2VCW A;  3DKS A;  2A4V A;  3HVX A;  1HNA A;  5D73 A;  3KTB A;  5DJM A;  4ZL9 A;  1B9Y C;  2LRT A;  1FAA A;  4POB A;  3M9K A;  3O3T A;  3EU4 A;  1T8E B;  1FO5 A;  2WGR A;  3QAG A;  2B1L A;  1F3B A;  1OC8 A;  2R6K A;  4KUN A;  5KEJ A;  4RUV A;  5IOX A;  3HY2 A;  1THO A;  3UMA A;  5IMD A;  3IDV A;  3V1W A;  2E2G A;  1K0D A;  2QSI A;  4K6X A;  3QD9 A;  4ILF A;  4XS4 A;  5E4W A;  2LNT A;  4NPB A;  1XPV A;  1T3B A;  2DJ1 A;  3G7J A;  1RQM A;  3MDK A;  4RQR A;  1J0F A;  2IL3 A;  4TXV A;  2KLX A;  3GL3 A;  1ZYE A;  2N5F A;  4MZW A;  3F63 A;  3FR3 A;  2R37 A;  4HJ2 A;  3Q74 A;  2DSA A;  4ML1 A;  2M72 A;  4JR4 A;  1A23 A;  2VIM A;  2MZC A;  2AUV A;  3HCZ A;  4OCE A;  3S9F A;  4E8H A;  3IRA A;  2YZH A;  4MDC A;  4IP1 A;  1GLQ A;  1GWC A;  3VPT A;  4OO4 A;  4X1U A;  3PIN A;  2VLV A;  3RDW A;  1XWC A;  4GTU A;  6GSX A;  2PVO C;  3TKP A;  1Z7R A;  1SL0 B;  1GH2 A;  3ZFL A;  1AW9 A;  2WB9 A;  2K8S A;  4MMM A;  4XHM A;  4ID0 A;  5G31 A;  4ML6 A;  3LYP A;  1MDJ A;  2VL9 A;  3UBK A;  3BCK A;  2H30 A;  3DXB A;  3LOR A;  2GT5 A;  4OMV A;  4F0B A;  1THX A;  1PL1 A;  3TKS E;  2E2M A;  1XOB A;  3FZ5 A;  2LTK A;  3ME8 A;  4NV2 A;  1FVJ A;  1QFN A;  3QFA C;  5C00 A;  2PUK C;  3QOU A;  4IQ1 A;  2N5A A;  4DEJ A;  3GN3 A;  2IFQ A;  3QAW A;  4I6X A;  1WPI A;  5ECM B;  3KZQ A;  2HSH A;  6GSW A;  5GAP D;  2H70 A;  3CRT A;  4G2E A;  4BPY A;  4GCI A;  2P31 A;  2IY2 A;  1K3L A;  3QDN A;  4GQC A;  2H72 A;  2HRN A;  4MJC A;  1XIY A;  1EEJ A;  4O92 A;  22GS A;  4PUR A;  1M9A A;  2DLX A;  1RK4 A;  2F8F A;  10GS A;  3LYK A;  1WOU A;  4NHZ A;  1AC1 A;  2HE3 A;  4L0W A;  4JBB A;  3GKM A;  4ULX A;  2JL4 A;  2X8H A;  3O6T A;  2XBQ A;  2LNS A;  2O89 A;  3UAP A;  1BJX A;  3EC3 A;  2MYG A;  1KNG A;  3GYK A;  3TKR A;  5HR1 A;  1AQV A;  3JCM L;  1ZMA A;  2O87 A;  1Y25 A;  4FYU A;  2YCD A;  5ECL B;  1SD9 A;  1UVZ A;  1GRX A;  3NOF A;  2FHE A;  5AIS A;  4F82 A;  1MDI A;  1SKR B;  3QR6 A;  2DML A;  3FKF A;  3A5W A;  4FYC A;  3M8N A;  3M9J A;  2GSQ A;  1YKA A;  2E7P A;  2IFQ B;  1V40 A;  4OFM A;  5ECO B;  5IO2 A;  1WIK A;  3U6V A;  2NDO A;  5J41 A;  1S3C A;  1JLW A;  4KSM A;  1NM3 A;  1CQG A;  2HRF A;  1M2A A;  3CXG A;  4K7I A;  4H86 A;  4E8E A;  4NV5 A;  5A4V A;  3E3E A;  1PGT A;  3I6A A;  4LMV A;  4LL1 B;  3ZL5 A;  4KDU A;  3A3T A;  3HDC A;  5HFG A;  4IJI A;  2E0Q A;  4D73 B;  1WP0 A;  1M99 A;  16GS A;  5FT3 A;  1U6T A;  4YQM A;  4POL A;  4L0U A;  4NHW A;  2XPD A;  3L9V A;  3R2Q A;  1URM A;  4XRA A;  5D9X A;  3CMI A;  5F0G A;  5D9T A;  4OD7 A;  4GF0 A;  5GST A;  3A2X A;  4TR4 A;  4KCE A;  4IP6 A;  2IMK A;  2HSY A;  1UN2 A;  1S3D A;  2DBC A;  4MJE A;  1PKZ A;  4N10 A;  2I4A A;  2REM A;  3BJ5 A;  3IA1 A;  1ZYQ B;  1MTC A;  4OFN A;  1BAY A;  2A2S A;  4NAX A;  4MPF A;  3DIE A;  3ERW A;  1I5G A;  1NHY A;  3W8J A;  5C04 A;  3IBH A;  4MA9 A;  3CTG A;  1TW9 A;  4CDO A;  4PNF A;  2YN1 A;  2HLS A;  4ACS A;  2LQQ A;  2PGT A;  4X0X A;  5A4U A;  5IMZ A;  5DAK A;  1MEK A;  1QK8 A;  3WT1 A;  4NWY A;  4LA1 A;  4RI6 A;  2JSZ A;  13GS A;  3GX0 A;  1Z6M A;  4F2I A;  3UOM A;  5EVO A;  1A24 A;  2MMN A;  4Q5N A;  2X8G A;  1E2Y A;  1GUM A;  1OE7 A;  3EIN A;  1V9W A;  3TOU A;  5H5R A;  4PQ1 A;  4K8M A;  4DSQ A;  5D8I A;  2R4V A;  4EO3 A;  5AIV A;  3UVH A;  3KXO A;  4L5L A;  2LJR A;  3LFL A;  1OKT A;  5G30 A;  2OAD A;  3H93 A;  4GLT A;  2AJQ B;  4MPG A;  4KDY A;  4BWS A;  5J5N A;  4K0G A;  1TI1 A;  4IGJ A;  5JCW A;  4ISD A;  4GRF A;  2HYX A;  1VF2 A;  1SJI A;  4EL1 A;  2WFC A;  3EWL A;  2B5Y A;  3QCP A;  4OCF A;  1OYJ A;  3ZLP A;  1OAZ A;  2O85 A;  2KP2 A;  1G0T A;  3KP9 A;  4V2L A;  3LSZ A;  2IMF A;  3EUR A;  1VF4 A;  4XRD A;  3PR8 A;  1T1V A;  3C8E A;  2TIR A;  4KSO A;  5G2Z A;  3IE3 A;  1TU8 A;  4IW9 A;  3CYN A;  2I3Y A;  4KAE A;  5H5Q A;  5CNW A;  2H76 A;  1XVQ A;  2PMT A;  5F07 A;  4G19 A;  2H71 A;  1R26 A;  1LJR A;  4JU5 A;  3C1R A;  2I81 A;  2FA4 A;  2YOI A;  1U3I A;  2OE3 A;  3KEB A;  3E9J B;  2VAF A;  3CRU A;  1AXD A;  5CRH A;  1X0R A;  1A2M A;  3TDG A;  3P7X A;  4AJ6 A;  5GAN D;  1XW6 A;  2IME A;  1BG5 A;  1BQ7 A;  3Q18 A;  1YEX A;  3ZIJ A;  1GLP A;  2GTU A;  3WD6 A;  7GSS A;  5CRW A;  1PRX A;  1ZL9 A;  1AIU A;  3M0F A;  2LST A;  3EMX A;  2NVL A;  1BYE A;  5DQY A;  2JSY A;  3UIW A;  4K9Z A;  2TRC P;  1H75 A;  2MBS A;  1GSF A;  2X64 A;  4MK3 A;  2GDR A;  3US3 A;  4IJ3 A;  5GSS A;  1AAZ A;  4JR6 A;  1I9D A;  2CX3 A;  5LNK e;  2IPA A;  3TGZ A;  5JWQ B;  1EV9 A;  5JCU A;  3D5J A;  3HD5 A;  1S3A A;  5HR0 A;  2BTO T;  1K3Y A;  6GSV A;  5IPG A;  1O8W A;  1KBN A;  1DBY A;  2P0G A;  4EE0 A;  2VCQ A;  1K0A A;  3TJG A;  3VWX A;  5KN3 A;  3IHQ A;  1V58 A;  4ECJ A;  3N5O A;  2PU9 C;  1YF0 A;  3F6D A;  2B5X A;  1X5D A;  3EE2 A;  1A8L A;  3UAR A;  5AN1 A;  2C1Y A;  2H1A A;  2LJA A;  2PWJ A;  3KTL A;  2VL2 A;  2VO4 A;  1HD2 A;  1X9M B;  2YWO A;  2YZU A;  4F9Z A;  2JAC A;  1K0N A;  2FWF A;  1SYX A;  2K6V A;  2VL2 C;  2LEG A;  3FK8 A;  1YZX A;  5G5F A;  2H6Z A;  1XCC A;  1T7P B;  2OBI A;  1GTU A;  3GX8 A;  3EU3 A;  3IV4 A;  4WF4 A;  2AYT A;  4V1A p;  3MAK A;  4MJB A;  1XXU A;  2WS2 A;  4GSN A;  1UC7 A;  1YEP A;  2ZCT A;  1G7O A;  5ABR A;  5ID2 A;  4V2M A;  3IAS 2;  4EVM A;  1FOV A;  1SEN A;  2G0F A;  1TK0 B;  2PVQ A;  2YV9 A;  2YV7 A;  1OKD A;  1MD3 A;  2C4J A;  2B5E A;  1F6M C;  2K18 A;  1OC3 A;  5JWO B;  3HYP A;  5IMC A;  4IQA A;  4G9H A;  5KN1 A;  4KB3 A;  5IQY A;  4O5R A;  1TRW A;  1OC9 A;  1JFU A;  4MJA A;  2HT9 A;  2NBS A;  1TK8 B;  2PBJ A;  2H1D A;  4PUF C;  3GUR A;  3TKQ A;  1XOA A;  2ZUP A;  2JZS A;  3NZN A;  3SWL A;  4MF7 A;  3KGK A;  1E6B A;  1A2L A;  2O8V B;  9GSS A;  1OC9 B;  2CV4 A;  4ZXG A;  5GZZ B;  4LMW A;  1A2J A;  1UA5 A;  5DAL A;  3KCM A;  4KA0 A;  3PH9 A;  2NTO A;  4KE3 A;  1AQX A;  4ZIJ A;  1EWX A;  2BMX A;  5B8A A;  3KMO A;  5FHI A;  2MBT A;  2Z9S A;  4F03 A;  3GKK A;  3KJY A;  3F0I A;  4LLR A;  2R2J A;  5ELG A;  3G7Y A;  3BOA A;  2CX4 A;  1OVN A;  3D21 A;  1DSB A;  5ECQ B;  1SL1 B;  2EC4 A;  3GA4 A;  4FYB A;  5G5E A;  1U3A A;  4TR3 A;  1TDI A;  4EDZ A;  4RI7 A;  1TOF A;  1MDK A;  1Q4J A;  3VI7 A;  5B8B A;  3DYR A;  2C0F A;  4FH8 A;  4TR1 A;  5HR3 A;  1ML6 A;  3ZVJ A;  4V1A g;  2OE1 A;  1GUH A;  11GS A;  2X99 A;  4IN0 A;  4XIH A;  3RBT A;  5HQP A;  3GKN A;  5DJL A;  5A5K A;  5EL8 A;  3DEX A;  1VGL A;  1JZO A;  5ECP B;  1R4W A;  1EP8 A;  3J7Y k;  4ECI A;  4I2U A;  3FRC A;  1TKD B;  1YKC A;  4BWQ A;  3K8N A;  1TP9 A;  5IMV A;  1EOG A;  1EEM A;  4N30 A;  1ERV A;  2H01 A;  4TXO B;  3MNG A;  3P8W A;  1YDK A;  1XW9 A;  5J3R A;  3D4M A;  3TRX A;  4TRX A;  3C71 A;  2CA8 A;  5IO0 A;  3KM6 A;  4MH2 A;  1XWB A;  3APS A;  1DUG A;  1TXX A;  3IXR A;  3QPM A;  1U88 A;  3U5R E;  4K7N A;  4Q5Q A;  2L5O A;  4WET A;  2XC2 A;  3GTU A;  4FO5 A;  3AY8 A;  2GQK A;  2H0H A;  5D9V A;  4AF2 A;  1TK5 B;  3WGD A;  2QKE A;  1O81 A;  2M80 A;  3GMF A;  1SJZ A;  5AGY A;  3FZA A;  1XVW A;  1FG4 A;  2KOK A;  4XS4 B;  2VCT A;  2R5G A;  2DIY A;  3W8S A;  1K0C A;  3KH7 A;  3GV1 A;  3VWV A;  3HJM A;  1SK1 A;  3CTF A;  3TJB A;  3F8U A;  1WE0 A;  4EC0 A;  4AJ8 A;  5IMF A;  1F2E A;  2OJL A;  2XBI A;  2B1K A;  3DD3 A;  3GIX A;  2X8C A;  1B4P A;  4HDE A;  2J23 A;  1SKW B;  2PPT A;  2RM6 A;  4MAB A;  1O85 A;  4GSS A;  2VUP A; 
#chains in the Genus database with same CATH topology
 2EIQ A;  3GZB A;  1LU4 A;  4TN8 A;  1YGW A;  1YJ9 3;  5LCZ A;  3GSP A;  1RN4 A;  3ECF A;  1M9B A;  1MGW A;  2J8X B;  4HZ4 A;  5DAK B;  4K90 B;  1GTI A;  2FXT A;  1BSA A;  4WHA A;  1UCJ A;  1RW1 A;  4MH3 A;  1IU7 A;  1MWS A;  3IPZ A;  2MMZ A;  2IIY A;  2VD1 A;  1XWG A;  1RN7 A;  1YQ1 A;  2OAC A;  7RNT A;  3CD6 3;  5CYY A;  2CG0 A;  2W2C A;  2EIO A;  2VM2 A;  1NWW A;  2L4C A;  3L9U A;  5KN0 A;  2CWV A;  3UB1 A;  2HZE B;  4KFF A;  1XWA A;  3KP8 A;  3PGT A;  1ERT A;  2JAD A;  1BIR A;  3LTB A;  4TOP A;  2B7K A;  1PSQ A;  5HFK A;  2SAR A;  3F14 A;  2L5L A;  1EP7 A;  3HVN A;  4R80 A;  3V92 A;  3LWA A;  1FB0 A;  3UBL A;  1TU7 A;  4BL7 B;  5ELJ A;  3G9B A;  5J9B A;  3DML A;  2R3X A;  2VLT A;  4I97 A;  1DVC A;  5DBQ A;  4D73 A;  5CP1 A;  3KII A;  3LXZ A;  1SQW A;  1NSW A;  1LXE A;  2JQ5 A;  3FEU A;  1EKM A;  6GSU A;  2D2Z A;  2GSS A;  2A4H A;  3GST A;  1RHL A;  2AV4 A;  4HQS A;  3ERG A;  3EMP A;  3KMN A;  3HK4 A;  1YY7 A;  1CEW I;  5CXO A;  4CY6 A;  1G96 A;  4N0V A;  1GSQ A;  2FA8 A;  1SU9 A;  2F51 A;  2H8L A;  3I43 A;  1A2K A;  1BNE A;  2R0P A;  4OK0 A;  2R0C A;  1Q81 4;  5L71 A;  2XEP A;  1EGR A;  3N9H A;  7GSP A;  1YJ6 A;  2ON5 A;  2L4V A;  1U5O A;  2JU5 A;  1W02 A;  5F8B A;  4IT7 A;  1A2V A;  1GMQ A;  3ERF A;  1NNV A;  3CSJ A;  3APO A;  1FGR A;  2CVD A;  4NHF A;  4HZ2 A;  3SBC A;  1UGH I;  4BVY A;  4BVX B;  2CFL A;  5IPH A;  3VPQ A;  1M9G A;  2YNX A;  1PU4 A;  3FLJ A;  3D22 A;  3EB8 A;  1TTO A;  1JKG A;  3ZFB A;  3D0Z A;  5B7C A;  4DSS B;  2HMN B;  1PYL A;  1V57 A;  1BSB A;  2DJK A;  1WMJ A;  2HNL A;  2YPM A;  2Z77 A;  2YWM A;  4L8E A;  4RQX A;  4USS A;  1WNH A;  1FW1 A;  1EUI C;  2DJ2 A;  3IK9 A;  3GWR A;  3TB2 A;  1OGX A;  4HQZ A;  5CO3 A;  3NHX A;  2STD A;  5ECI B;  3FKA A;  3ZZX A;  3APQ A;  3VWW A;  1W4N A;  1GSS A;  2B3S A;  5AIH A;  2QA4 3;  5E59 A;  4MJD A;  2GZP A;  1DMQ A;  3O8Y A;  4OO5 A;  2PZV A;  1FHE A;  3E99 A;  2DJJ A;  3MSZ A;  3CBU A;  1FGT A;  2VL3 A;  1KSI A;  1VQM 3;  2F8A A;  3H3H A;  4O32 A;  4KFD A;  3F40 A;  4PUA A;  1XW5 A;  1ERU A;  3TCO A;  1IYH A;  3H4K A;  3TJK A;  4MCU A;  2GGT A;  4LSO A;  1RSN A;  2V32 A;  2YX9 A;  1SJW A;  2CX1 A;  2B7J A;  2YP6 A;  1JV2 B;  3HVV A;  1O8X A;  1V98 A;  2CAQ A;  1SII A;  4BL2 A;  18GS A;  2BMQ B;  2C0E A;  1CQH A;  3H79 A;  3KSE D;  2XPE A;  1TRP A;  1FW7 A;  1XZO A;  3QAV A;  4MMY B;  2GZY A;  4KVH A;  4XB5 A;  3DGL A;  2RII A;  2RSX A;  2WDU A;  4HM3 B;  2ZNM A;  3KIJ A;  5AIF A;  4EV5 A;  1Q86 4;  1VQ6 3;  5J4U A;  3GH9 A;  3I9V 2;  2ON7 A;  4PGT A;  3LEF A;  1RCK A;  1W7C A;  3HZ4 A;  4OUQ A;  2YJ7 A;  1LVN A;  4KH7 A;  3IC8 A;  2OTJ 3;  3FG3 A;  4AGS A;  4FMA A;  2OE0 A;  4K1U A;  1RDS A;  2DIZ A;  1QMV A;  1HQO A;  1DE3 A;  5ECR B;  4JRR A;  1XFL A;  5ECS A;  5DQS A;  1H4O A;  1QQ2 A;  1TI3 A;  3VLN A;  1KTE A;  1TU5 A;  2FY6 A;  2KP1 A;  3B4O A;  3FZ4 A;  3WYW A;  3DVX A;  3A2V A;  3OW2 2;  3D5G A;  1YGE A;  2G2Q A;  3VUR A;  1EOH A;  4XDV A;  2RGQ A;  5IEP A;  4R4K A;  3F4R A;  1JZD A;  5H5S A;  3UL3 A;  1B2S A;  2ML5 A;  1YF1 A;  2F99 A;  1VF3 A;  3DZL A;  1DE1 A;  1J2B A;  1YJN 3;  3G7I A;  3J7Y b;  1W89 A;  2YJH A;  1F3A A;  3HZ8 A;  2QC7 A;  4CJN A;  3MHE A;  3DGN A;  2H0G A;  2WCI A;  1GP1 A;  1C72 A;  1JBT A;  1BNG A;  3CPO A;  1G02 A;  2DC5 A;  2VOC A;  3A5I A;  3AHS A;  4G0I A;  3ZML A;  2IYJ A;  1JZW A;  1OHP A;  3CCQ 3;  4ZB6 A;  4XBY A;  4BVX A;  2F9S A;  2MMA A;  3DY5 A;  2L6C A;  1BX9 A;  3NXJ A;  2QIY A;  3RPN A;  4QL7 A;  1GTB A;  3D5I A;  1CYU A;  1E3V A;  5KP3 A;  1B48 A;  3RDE A;  4ZL7 A;  1GNE A;  1IYI A;  2LS5 A;  1G6W A;  1ZOF A;  4KDX A;  3WHO A;  1RGC A;  2XF3 A;  1A0R P;  2L59 A;  2AAW A;  2GLR A;  3TJF A;  4I8B A;  1UCI A;  1X1U A;  3EX9 A;  1Z1S A;  2HMJ B;  2GVP A;  2OOV A;  1TUH A;  2BJX A;  1FYS A;  3IPT A;  3Q90 A;  2LQO A;  3X3Y A;  1VQP 3;  1HNC A;  4I2T A;  2IMD A;  2P0M A;  4BU4 A;  3DRN A;  3M3M A;  1SK2 A;  1EV4 A;  4NRE A;  4WBR D;  2F5W A;  1SK0 A;  5CAX A;  4YQV A;  1BAO A;  1IQ8 A;  2C4B A;  4WEY A;  3AHW A;  1SYR A;  3OV4 A;  5CRE A;  3LXT A;  2C8U A;  1M3J A;  1GY5 A;  1PKW A;  1GD3 A;  4ZIL A;  2C0G A;  3K0Z A;  2LRN A;  4HUA A;  4N6U A;  1N2A A;  1FOH A;  2A2P A;  1YI2 3;  3F4T A;  2MF7 A;  4HBR A;  1Z6N A;  4XS1 A;  3EC9 A;  2YAN A;  1ILO A;  2KUC A;  4IS0 A;  3FY7 A;  3MYD A;  2D1W A;  2GQM A;  2IWT A;  3EYT A;  4MLY A;  1T2H A;  4BA7 A;  5IM9 A;  1ZYN A;  2C3N A;  2BT3 A;  3CSI A;  3VGN A;  1X9W B;  1D6U A;  1XWK A;  1EZK A;  3PGB A;  4IHU A;  1V2A A;  1SIH A;  4CHS A;  3NQZ A;  1ZO2 A;  1ZX2 A;  3VSY A;  4EXJ A;  1RRL A;  2IMI A;  3STD A;  3F6F A;  2WRT A;  1VQ4 3;  1X5E A;  1JLV A;  4LL4 B;  4MF5 A;  2FWE A;  4AJ7 A;  3VK9 A;  1YJW 3;  3ZRD A;  2HI7 A;  4O02 B;  1B8X A;  3WOE B;  2JZT A;  3GZX B;  3X3Z A;  6GST A;  5JPP A;  1SD8 A;  4KF9 A;  3BNC A;  3Q3F A;  1EG9 B;  1Q7Y 4;  1IT8 A;  19GS A;  1G7E A;  3VI5 A;  1PQN A;  5CRD A;  4AEQ A;  1ROV A;  1K0M A;  1RGE A;  4RNZ A;  3V99 A;  1FB6 A;  1F37 A;  2RUF A;  2F86 B;  2CT6 A;  3FW2 A;  3IC4 A;  4TW5 A;  4NXI A;  2GEX A;  2H1G A;  2WJU A;  4GST A;  4HEA 2;  1T4Y A;  3BNB A;  4MF6 A;  4HU7 A;  5EEO A;  2YWN A;  3UNL A;  2H73 A;  2L6D A;  1B2U A;  2K9F A;  1NO3 A;  4N6N B;  2FWH A;  3Q1C A;  1HU9 A;  3A2W A;  4TR1 B;  1RGH A;  3HJO A;  4J8T A;  4GWR A;  3KD0 A;  5HR2 A;  2DKI A;  1GL8 A;  2DMM A;  3HVS A;  3PPU A;  3TJJ A;  2IN3 A;  4WBJ A;  3WA3 A;  3N9J A;  2GSR A;  4ZB8 A;  5D96 A;  2BMR B;  1EGO A;  1M0U A;  4X4J A;  2W03 A;  3CMA 3;  4WF5 A;  3DGQ A;  1ST9 A;  1K3O A;  4K0N A;  3LTD A;  5DRV A;  3W6G A;  3ZIT A;  3DH2 A;  3RAZ A;  4PQH A;  5DCH A;  3GKX A;  4K1F A;  5EY6 A;  3PCS A;  3PYJ A;  3O76 A;  4MZB A;  5HFI A;  2WZ9 A;  4KX4 A;  4KND A;  1O7W B;  1ACV A;  4HJL B;  20GS A;  4XDW A;  1A67 A;  4QQ7 A;  4MZC A;  4LMI A;  1GS3 A;  4K2D A;  1JB4 A;  3H1N A;  3IJE B;  1Q42 A;  2FWG A;  5DCG A;  2W04 A;  3DWV A;  3NBB A;  5J9C A;  1BUQ A;  2GS3 A;  1B4Q A;  1K8A 4;  1OUN A;  4U13 A;  4EV2 A;  2IJY A;  3GSS A;  4ECB A;  3RHB A;  4HS1 A;  3URP A;  4WXT A;  1PA3 A;  3M1G A;  3NUV A;  4EBG A;  4TVE A;  2RLI A;  3DGY A;  1Z9H A;  1Z7P A;  1IVX A;  3P2A A;  2V6K A;  1A8Y A;  1D6Z A;  4HZ9 B;  4N6L A;  3WOF B;  1PX6 A;  3KH9 A;  4PQI A;  4RBN A;  2CVB A;  4ZBD A;  1NW2 A;  3D4T A;  4BTY A;  1LBK A;  1Q98 A;  1M7T A;  4OWY A;  2HFD A;  5ID2 B;  5ECN B;  3JUN A;  2CQ9 A;  5B6M A;  2L4Q A;  2ES7 A;  2KCD A;  5ELA A;  1GMP A;  1OHO A;  3RNT A;  2X49 A;  1N8J A;  2V2G A;  5BRT A;  1IYY A;  5IOW A;  1T4Z A;  1GOV A;  2R41 A;  4DVC A;  5D9W A;  1LQG C;  3LOY A;  4HKV B;  4PNG A;  4FIW A;  2H6X A;  4HOJ A;  1AV4 A;  2ALB A;  1QUW A;  2CFG A;  2FLS A;  4GL6 A;  3E0U A;  3TRQ A;  4BVY B;  2V6O A;  1CH0 A;  2BNG A;  4J5G A;  1KEB A;  3ZMK A;  1SKS B;  2OA7 A;  1JB2 A;  5D93 A;  4YAV A;  1R7H A;  4CY8 A;  3F4S A;  4TKY A;  3EHC A;  1I70 A;  1HYF A;  2QEX 3;  5D81 A;  2FUG 2;  4V2N A;  5DDL A;  4POM A;  4WKW A;  4I4K A;  5G1L A;  2P05 A;  5B6N A;  2L57 A;  3EVI A;  6GSS A;  3UL6 A;  3P90 A;  2CFW A;  1TRU A;  1AQW A;  1HYU A;  2YFI B;  2OKA A;  4BTX A;  1E97 A;  2JZR A;  1STD A;  1WRY A;  5A0O B;  2TRX A;  3GHA A;  1BUJ A;  2QGU A;  2H1B A;  3NV0 A;  3KE7 A;  1Q9E A;  4KW6 A;  3F3R A;  2OBK A;  3IMA B;  3L4N A;  2LRC A;  2RCD A;  2VD0 A;  5M18 A;  3FZ9 A;  1ERW A;  2N5B A;  3WOD G;  2FNQ A;  1O73 A;  3H8Q A;  4YAP A;  4N11 A;  3EN1 B;  2DJ3 A;  4ZBA A;  4XBT A;  4RNY A;  1M90 4;  2VLU A;  4K1V A;  2KHP A;  4XBX A;  1K73 4;  2DJ0 A;  3GRD A;  3ISO A;  3ZVJ D;  1Z5Y E;  1NHO A;  4ZB9 A;  3MYT A;  1HNB A;  1GMR A;  1N8Q A;  1ZZY A;  2WOH A;  4ZL8 A;  3OWU A;  6GSY A;  2WOF A;  3ZYW A;  2Y73 A;  4POK A;  2H19 A;  3GRX A;  4N6M A;  5G1K A;  2CHC A;  3GUS A;  5BU4 A;  3S27 A;  4MP4 A;  4XM4 A;  1LOW A;  3AGN A;  2GZZ A;  3LQ7 A;  2HRK A;  3GZR A;  4L7K A;  3UJ1 A;  5AYS C;  3ZIV A;  4CW9 A;  1B9X C;  1R5A A;  1F9M A;  1QXH A;  1SJ6 A;  3MIX A;  3ZTL A;  2VCZ A;  2I9W A;  1FGO A;  3PXM A;  2CH9 A;  2K54 A;  2LQV A;  1GUL A;  4HM6 B;  2E2V A;  3GNJ A;  5IMA A;  2W0Q A;  1GTA A;  4Z7X A;  4P3Y B;  5DVB A;  1DE2 A;  1KWI A;  1CYV A;  3G0K A;  1VF1 A;  1BED A;  1A0F A;  3UJM A;  4JE1 A;  3FR9 A;  1OPY A;  3RPP A;  5DAL B;  4EKZ A;  3CCL 3;  2C80 A;  3BND A;  4KGI A;  4LEH A;  4NMU A;  3ME7 A;  4MMZ B;  2KRT A;  1LOY A;  1JB5 A;  3KSP A;  4GQF A;  2H6Y A;  3UVT A;  1O7U A;  3S67 A;  3UEM A;  3MG1 A;  3R3E A;  3QMX A;  2OCT A;  5INY A;  4EF0 A;  1JHB A;  4HJM A;  3EPT A;  2C0D A;  14GS A;  3WGX A;  2WUL A;  3L0H A;  4HM8 B;  1GSE A;  2HMO B;  2KAA A;  2FNO A;  1PFP A;  2H75 A;  8CHO A;  3CCV 3;  3CPW 2;  5F06 A;  3C73 A;  2FCH A;  2F3M A;  4TXO A;  5AIX A;  2MMO A;  3ZRE A;  1QMA A;  3MWZ A;  4RZM A;  1M2B A;  1BOX A;  4TR0 A;  5CRG A;  2AHE A;  3QFB C;  5ELU A;  1TRV A;  1VZZ A;  3FYG A;  1VRS D;  1ZGX A;  4LZI A;  3HHV A;  3HXS A;  2H74 A;  4L5O A;  2CK3 H;  5FW5 A;  1DMM A;  1WWJ A;  2CVK A;  2YWI A;  3TKS C;  3GTU B;  6STD A;  3F8H A;  4WR4 A;  4J2F A;  4G0K A;  3FF2 A;  4DSS A;  1DYU A;  1GD4 A;  1ABA A;  5KN2 A;  3HA9 A;  2H66 A;  2O7K A;  4EDY A;  2CZ3 A;  4Q5R A;  1PMT A;  3GFK A;  1GOU A;  1JZR A;  3IR4 A;  3ED3 A;  3BU4 A;  2LJK A;  4PX1 A;  2CG1 A;  5F05 A;  5IIZ A;  5G2G A;  1J08 A;  2GBW B;  2YFJ B;  3NIV A;  2PER A;  4EUY A;  8GSS A;  3FG4 A;  2CZ2 A;  3BBY A;  3S29 A;  5EPF A;  4N6O B;  3TUE A;  4OVM A;  4K2X A;  1B2M A;  5I97 A;  1W00 A;  3G71 3;  3GL5 A;  2Z7A A;  1X1X A;  4O7H A;  5ECK B;  1ZCP A;  3F9S A;  1TTZ A;  2HXK A;  3F8X A;  1PX7 A;  1GSY A;  1QGV A;  3C7M A;  4L8P A;  1TIJ A;  2NPB A;  4HM5 B;  2AB6 A;  4IKH A;  1GSU A;  3AGO A;  1PN9 A;  3I69 A;  4GHO A;  1TP6 A;  4KCA A;  3HIG A;  4BL7 A;  4EW5 A;  4J56 E;  1QAF A;  3WGE A;  4Z2U A;  2EIR A;  2QGV A;  3C1S A;  3FMW A;  2P0X A;  1GSD A;  4PEJ A;  2M46 A;  1B2Z A;  2RM5 A;  2WO0 A;  4Q5F A;  2GQL A;  1NDO B;  3CSH A;  1HKX A;  2RUE A;  1R5P A;  4CCV A;  4F0C A;  3VWU A;  5FGO A;  17GS A;  2X4A A;  3EN8 A;  2C3Q A;  2HZF A;  3F3Q A;  4STD A;  4HM1 B;  4QL9 A;  4I5Q A;  3X41 A;  1USB A;  1TRS A;  1RGL A;  1WTH A;  1VQO 3;  1JBR A;  3X42 A;  4ZBB A;  4GXZ A;  2P5Q A;  1XBS A;  3Q6O A;  4JED A;  1M2D A;  3IAM 2;  4J57 E;  1G6Y A;  5CF1 A;  5FWG A;  4WYK A;  3VFI A;  1PL2 A;  1PD2 1;  2V1M A;  4FMC A;  2CWU A;  3IK7 A;  3CNM A;  1TRQ A;  2SBL A;  2FD3 A;  3MG3 A;  2V1L A;  1T5Y A;  3FR6 A;  3L9S A;  3LJR A;  4DSR A;  5A4W A;  3NM2 A;  1SL2 B;  5ENU A;  4XS6 A;  5ECH B;  4IEL A;  2C3T A;  3L78 A;  5JCG A;  2VCV A;  3MWH A;  3LGC A;  3Q19 A;  1GNW A;  3D6I A;  4HI7 A;  4YH2 A;  5JWR B;  2W56 B;  3BD2 A;  4HU9 A;  2I9H A;  4X2O A;  1GUK A;  4HAA A;  3Q2P A;  4X43 A;  1T00 A;  3BNE A;  4N0Z A;  3DVW A;  3D4A A;  4WR5 A;  2OQE A;  3SLU A;  4XTS A;  1O6J A;  1X1W A;  2XHF A;  4JZQ A;  1X9S B;  3CQF A;  4H3U A;  2V41 A;  2J9H A;  1ZGN A;  2CKF B;  1I2G A;  1A2P A;  1Z3E A;  4IBP A;  3PZW A;  2WGQ A;  1K0O A;  2HMM B;  1X5C A;  4ECC A;  1J9B A;  1NJI 4;  2H0I A;  1K0B A;  2W9P A;  3NBJ A;  1BRJ A;  1MWU A;  2XH9 A;  1FA3 A;  2R4I A;  2I1U A;  3B7C A;  3F9U A;  1B2X A;  2LUS A;  2CAI A;  5IEO A;  1FUS A;  1BRG A;  3LG6 A;  2DKH A;  3GH6 A;  3WT2 A;  3CCS 3;  3HKR A;  4XCS A;  2K8V A;  5LD0 A;  3LML A;  3OR5 A;  3FHK A;  1FVK A;  3BCI A;  1W4V A;  2P5R A;  3TKS A;  1Y6E A;  2GT6 A;  4YQU A;  3IOS A;  5COH A;  3X40 A;  2LKU A;  2LV3 A;  5IF6 A;  4OFT A;  1ON4 A;  4G10 A;  2A2R A;  2FGX A;  4YKG A;  2VCX A;  2UZ8 A;  5IG0 A;  2GST A;  3JUP A;  6GSP A;  1WMO A;  2GBX B;  1OE8 A;  1WJK A;  1UW1 A;  1YIJ 3;  2Z6B A;  4IVF A;  2RNT A;  4G1M B;  3DMC A;  1JJ2 2;  1UUV B;  1U87 A;  1DMN A;  3ER7 A;  4PXO A;  1AUC A;  1MD4 A;  2HZE A;  4HM4 B;  3RHC A;  3HJP A;  1S5A A;  2C10 A;  1I3F A;  3IHG A;  3TOT A;  4K7O A;  3KFQ C;  3TRP A;  12GS A;  4LYL B;  3GZY B;  1TJD A;  1BVI A;  2B6M A;  2PN8 A;  2VM1 A;  5EVH A;  5M1A A;  2VCW A;  3DKS A;  2A4V A;  3HVX A;  1HNA A;  5D73 A;  3KTB A;  1JNQ A;  5DJM A;  1QAL A;  4ZL9 A;  1B9Y C;  2XSO B;  3CNX A;  3V98 A;  2LRT A;  4DKI A;  1FAA A;  4POB A;  1FGM A;  3MKI A;  2BMO B;  3M9K A;  3O3T A;  3EU4 A;  1T8E B;  4IPB A;  9RNT A;  1FO5 A;  2R0G A;  2WGR A;  3QAG A;  2B1L A;  1O7N B;  1F3B A;  5BXQ A;  2XGL A;  1OC8 A;  2R6K A;  4MEI A;  4KUN A;  5KEJ A;  4RUV A;  5KP4 A;  5IOX A;  1IT7 A;  3HY2 A;  3MG2 A;  1THO A;  3T8N A;  4ICY A;  3UMA A;  5IMD A;  1US1 A;  1R4C A;  3IDV A;  3V1W A;  4HSC X;  2F4Y A;  2E2G A;  1K0D A;  5AIG A;  1RTU A;  2QSI A;  4K6X A;  1V74 A;  3QD9 A;  4ILF A;  5IG3 A;  4XS4 A;  1MOL A;  5E4W A;  4R9L A;  2LNT A;  4NPB A;  1XPV A;  1O7H B;  1T3B A;  2DJ1 A;  3CC7 3;  3B8L A;  3G7J A;  1N8R 4;  1RQM A;  3MDK A;  1O7M B;  1AVL A;  4HM7 B;  2RFR A;  4RQR A;  1J0F A;  2IL3 A;  3CME 3;  4TXV A;  1RGA A;  2KLX A;  3GL3 A;  2JDI H;  1ZYE A;  3KN4 A;  3AMO A;  2N5F A;  1BNR A;  5RNT A;  2KF3 A;  4MZW A;  1EQK A;  3F63 A;  3FR3 A;  1JKG B;  2R37 A;  1LOX A;  3FCS B;  3MPH A;  3SVA A;  5KP1 A;  2DSA A;  3Q74 A;  4HJ2 A;  4ML1 A;  2M72 A;  2HRA A;  5AI1 A;  4JR4 A;  1QVF 2;  4GSP A;  3D3L A;  1A23 A;  2VIM A;  2MZC A;  2AUV A;  3HCZ A;  4OCE A;  3S9F A;  3DGO A;  4E8H A;  3IRA A;  3K5T A;  2YZH A;  4MDC A;  2F5M A;  4IP1 A;  3NBR A;  1GLQ A;  1GWC A;  3VPT A;  3EF8 A;  4OO4 A;  3DM8 A;  4GB5 A;  4X1U A;  2CFK A;  1M1X B;  3FZW A;  1SPU A;  1RMS A;  5KOX A;  1RKY A;  1BU4 A;  3WA2 X;  3PIN A;  2VLV A;  3RDW A;  1XWC A;  4GTU A;  3FG1 A;  1UI8 A;  6GSX A;  2PVO C;  3TKP A;  1Z7R A;  1SL0 B;  1GH2 A;  1KQS 2;  3ZFL A;  1AW9 A;  4H61 A;  2WB9 A;  1LNI A;  2K8S A;  4MMM A;  3K7C A;  4XHM A;  4FQU A;  1BRS A;  4ID0 A;  5G31 A;  3LTA A;  4ML6 A;  3LYP A;  1MDJ A;  2VL9 A;  3UBK A;  3BCK A;  2H30 A;  1BNI A;  3DXB A;  3LOR A;  1JN5 A;  2GT5 A;  4OMV A;  4F0B A;  1THX A;  1PL1 A;  3TKS E;  2IMJ A;  2M7O A;  2E2M A;  1XOB A;  1FZU A;  2AAD A;  4O3V A;  3WR2 A;  3FZ5 A;  2LTK A;  1BRH A;  3ME8 A;  4NV2 A;  1FVJ A;  1QFN A;  3OXA A;  3QFA C;  5C00 A;  2PUK C;  3QOU A;  4IQ1 A;  1BAN A;  2N5A A;  1VQ7 3;  3GN3 A;  4DEJ A;  5CLK A;  2IFQ A;  3QAW A;  4I6X A;  1WPI A;  2ZA4 A;  1W6Y A;  5ECM B;  2WGO A;  3SX1 A;  3KZQ A;  2HSH A;  1VQ5 3;  6GSW A;  5GAP D;  1VQ8 3;  2H70 A;  4KZ1 A;  3CRT A;  2OOV C;  4G2E A;  3LZA A;  4BPY A;  4ORL A;  4GCI A;  1NU3 A;  1RGF A;  2XFT A;  4WFO A;  2OQE C;  2IY2 A;  1K3L A;  2P31 A;  3QDN A;  4GQC A;  4MNN A;  2H72 A;  2HRN A;  5D83 A;  4MJC A;  1XIY A;  1EEJ A;  2XFS A;  2OTL 3;  4L8O A;  4Q53 A;  4O92 A;  22GS A;  3ZG0 A;  4PUR A;  1M9A A;  2C11 A;  1Q40 B;  1AY7 A;  1RK4 A;  2DLX A;  3BIR A;  2F8F A;  3LYK A;  10GS A;  1WOU A;  4NHZ A;  1AC1 A;  3N8B A;  2HE3 A;  4L0W A;  2XSH B;  4JBB A;  3GKM A;  4ULX A;  2JL4 A;  2KF5 A;  1K9M 4;  1WMP A;  2X8H A;  3O6T A;  1BSD A;  2XBQ A;  2LNS A;  3LYG A;  2O89 A;  4G0L A;  1TFK A;  3UAP A;  1BJX A;  5BMU A;  3EC3 A;  4AKZ A;  3EE1 A;  2MYG A;  1KNG A;  2QA1 A;  2ZL8 A;  3GYK A;  1B20 A;  3TKR A;  5IG4 A;  2B1X B;  5HR1 A;  1AQV A;  3JCM L;  1ZMA A;  3EJV A;  5BIR A;  1Y25 A;  2O87 A;  4FYU A;  2YCD A;  5ECL B;  1SD9 A;  1LNH A;  1UVZ A;  1GRX A;  2HSM A;  4BIK A;  1OH0 A;  1VQN 3;  3NOF A;  3J7Y d;  2FHE A;  5AIS A;  1W6G A;  4F82 A;  2RBI A;  1MDI A;  1SKR B;  3QR6 A;  1KD1 4;  2DML A;  3FKF A;  1W2B 2;  3A5W A;  4FYC A;  3HII A;  3M8N A;  4X2H A;  3M9J A;  2GSQ A;  1PN0 A;  4O8S A;  1YKA A;  2E7P A;  2IFQ B;  4K5R A;  3GAX A;  3CCM 3;  1V40 A;  4OFM A;  5ECO B;  3NQY A;  1IV7 A;  5IO2 A;  1WIK A;  1IVV A;  3U6V A;  1LOV A;  1JN5 B;  2NDO A;  5J41 A;  1S3C A;  1JLW A;  4KSM A;  2ZHX B;  1NM3 A;  1CQG A;  1I0X A;  2HRF A;  1M2A A;  1OCV A;  1IQY A;  3CXG A;  4K7I A;  3LT9 A;  4BIR A;  1NB3 I;  5IW9 A;  4H86 A;  2F56 A;  4E8E A;  3RGR A;  1I0V A;  4NV5 A;  5A4V A;  3E3E A;  4FCJ A;  1PGT A;  3I6A A;  4LMV A;  4LL1 B;  3EBT A;  1YIT 3;  1N5H A;  4KDU A;  3ZL5 A;  3A3T A;  3HDC A;  5HFG A;  3U1W A;  1N9J A;  4IJI A;  2E0Q A;  4D73 B;  4KFE A;  1IK3 A;  1RRH A;  1M99 A;  3CXC 2;  16GS A;  1WP0 A;  5FT3 A;  3EBY A;  1U6T A;  4YQM A;  4POL A;  1YHQ 3;  4L0U A;  4NHW A;  1N9E A;  1QVG 2;  2XPD A;  4J9A A;  3CCU 3;  1FUW A;  3L9V A;  4EC6 A;  3R2Q A;  4FR9 A;  1URM A;  4XRA A;  3ALA A;  5D9X A;  4Z2R A;  1A90 A;  3CMI A;  5F0G A;  4HM0 B;  3FSD A;  2ZDJ A;  3DUK A;  5D9T A;  4OD7 A;  4GF0 A;  5GST A;  3A2X A;  4TR4 A;  4KCE A;  4IP6 A;  2IMK A;  1FGQ A;  2HSY A;  5IEN A;  1UN2 A;  1S3D A;  2DBC A;  4WWU C;  4MJE A;  1O7G B;  5HGR A;  1I2E A;  1PKZ A;  4N10 A;  2AAE A;  2I4A A;  4EIP A;  2REM A;  3BJ5 A;  3IA1 A;  1ZYQ B;  1MTC A;  4OFN A;  1BAY A;  2A2S A;  2O3O A;  1RGG A;  4BTW A;  4NAX A;  2GEY A;  4MPF A;  3DIE A;  3ERW A;  1I5G A;  1NHY A;  3BB9 A;  1OGZ A;  3W8J A;  5C04 A;  3IBH A;  4MA9 A;  3CTG A;  1OHS A;  3SOA A;  5BVB A;  3QRD A;  2A15 A;  3AMO B;  3F7X A;  1TW9 A;  3OWS A;  4CDO A;  4PNF A;  2YN1 A;  1ULJ B;  2HLS A;  4ACS A;  1ROA A;  2LQQ A;  2PGT A;  4X0X A;  4N6V 0;  5A4U A;  1S3R A;  5IMZ A;  5DAK A;  2CIU A;  3N54 B;  2P09 A;  1MEK A;  1I3I A;  1QK8 A;  3S28 A;  3WDG B;  4WP5 A;  3WT1 A;  4NWY A;  4LA1 A;  2Y74 A;  4RI6 A;  2JSZ A;  4FMD A;  13GS A;  3GX0 A;  2KXG A;  1UUW B;  1Z6M A;  1OAC A;  3UOM A;  4F2I A;  5EVO A;  1A24 A;  2MMN A;  3JUM A;  2BHM A;  4Q5N A;  2X8G A;  1VQK 3;  3X3X A;  1E2Y A;  1GUM A;  1OE7 A;  4FMB A;  2MC8 A;  1AVK A;  3EIN A;  1JBS A;  5DRE A;  1V9W A;  4PQ1 A;  5H5R A;  4BL3 A;  3TOU A;  2XRX B;  4K8M A;  4DSQ A;  5D8I A;  2R4V A;  4EO3 A;  5AIV A;  3UVH A;  2UX0 A;  3KXO A;  4L5L A;  2LJR A;  3LFL A;  1UI7 A;  1OKT A;  5G30 A;  2OAD A;  3H93 A;  4GLT A;  2AJQ B;  2INX A;  4KDY A;  4MPG A;  4BWS A;  1BRK A;  5J5N A;  5TGN A;  1QAK A;  1ASK A;  4K0G A;  5STD A;  1TI1 A;  4IGJ A;  5JCW A;  4ISD A;  5AYR B;  1NB5 I;  1KC8 4;  4GRF A;  2HYX A;  1QJG A;  1VF2 A;  3FF0 A;  2O9U X;  1SJI A;  1W5Z A;  3FGY A;  3I55 3;  4EL1 A;  3A76 A;  2WFC A;  3EWL A;  4N6T A;  2B5Y A;  2KF6 A;  3QCP A;  4OCF A;  1OYJ A;  3ZLP A;  1OAZ A;  2O85 A;  1IQX A;  2KP2 A;  1G0T A;  1I2F A;  1Q40 A;  3PCR A;  3KP9 A;  4V2L A;  3LSZ A;  3ROB A;  2IMF A;  3EUR A;  1UUG B;  3NV0 B;  7STD A;  1RGK A;  1VF4 A;  4PTS A;  2HOH A;  4XRD A;  3PR8 A;  2XGN A;  1YVB I;  4HVN A;  1T1V A;  4FCZ A;  3T8U A;  3C8E A;  3G16 A;  2TIR A;  4KSO A;  4JF8 A;  1W6C A;  5G2Z A;  3F7S A;  3IE3 A;  4YKF A;  2E2T A;  1TU8 A;  2IA7 A;  4IW9 A;  3EQQ B;  2K0M A;  2XR8 B;  3CYN A;  2I3Y A;  4KAE A;  5H5Q A;  2H76 A;  1XVQ A;  2PMT A;  5CNW A;  5F07 A;  4G19 A;  2H71 A;  1R26 A;  3G6E 3;  1LJR A;  4JU5 A;  3C1R A;  1VQQ A;  1S72 3;  2I81 A;  2FA4 A;  4O2H A;  1U3I A;  2YOI A;  2OE3 A;  3KEB A;  3I56 3;  3E9J B;  2VAF A;  3CRU A;  2CX0 A;  1AXD A;  5CRH A;  3TDG A;  1A2M A;  1X0R A;  4EYC A;  4EIQ A;  5AII A;  3P7X A;  4AJ6 A;  3G4S 3;  1BNJ A;  5JPU A;  5GAN D;  1BNS A;  1XW6 A;  2IME A;  1BG5 A;  1B21 A;  1F8N A;  1BQ7 A;  3WMD A;  3Q18 A;  1YEX A;  1FUT A;  1ZS7 A;  4AKY A;  3LW9 A;  5CK6 A;  3ZIJ A;  1GLP A;  4RNT A;  1BGS A;  2GTU A;  3CC4 3;  3WD6 A;  7GSS A;  5CRW A;  1PRX A;  1ZL9 A;  1AIU A;  3M0F A;  2LST A;  3EMX A;  1B27 A;  1BSC A;  2NVL A;  1BYE A;  1B3S A;  5DQY A;  2JSY A;  3UIW A;  4K9Z A;  2CFD A;  2TRC P;  1H75 A;  4O5U A;  2MBS A;  4WYK B;  1GSF A;  2X64 A;  4MK3 A;  2GDR A;  3US3 A;  4IJ3 A;  5GSS A;  1GOY A;  1AAZ A;  1BRI A;  4JR6 A;  2P38 A;  1DET A;  2F98 A;  1I9D A;  2CX3 A;  3HX8 A;  5LNK e;  3KZT A;  2IPA A;  3TGZ A;  1L5G B;  5JWQ B;  4FCM A;  1EV9 A;  5LC7 A;  4R9K A;  5JCU A;  1CQS A;  1EA2 A;  3D5J A;  3HD5 A;  1X1Y A;  1S3A A;  5HR0 A;  2KF4 A;  2BTO T;  1K3Y A;  1GYB A;  6GSV A;  5IPG A;  1O8W A;  3SYU A;  1ULI B;  1KBN A;  3H51 A;  1UGI A;  1DBY A;  1RNB A;  2W6J H;  2P0G A;  2OWP A;  4EE0 A;  2VCQ A;  1K0A A;  1RN1 A;  5AEW B;  3TJG A;  3VWX A;  5KN3 A;  3IHQ A;  3LH4 A;  1V58 A;  4ECJ A;  3N5O A;  2PU9 C;  1YF0 A;  2E2U A;  3F6D A;  1M1K 4;  2K3D A;  1M3I A;  2B5X A;  1X5D A;  1GY7 A;  1A8L A;  3EE2 A;  1BSE A;  3UAR A;  3D79 A;  1VQL 3;  5AN1 A;  2C1Y A;  2H1A A;  3SXX A;  1YNV X;  2LJA A;  3LT8 A;  2PWJ A;  1OF5 B;  1K28 A;  3KTL A;  2VL2 A;  2IUK A;  3T0U A;  2VO4 A;  1HD2 A;  2CC3 A;  1X9M B;  3B4P A;  2UGI A;  2HMK B;  2YWO A;  2YZU A;  4F9Z A;  2JAC A;  1K0N A;  2FWF A;  1SYX A;  2K6V A;  2VL2 C;  2LEG A;  3FK8 A;  1YZX A;  5G5F A;  3UL5 A;  2H6Z A;  1XCC A;  1IVU A;  3HOH A;  1T7P B;  2OBI A;  3S5C A;  1OF5 A;  1GTU A;  3GX8 A;  3EU3 A;  2FGT A;  2L1S A;  4IIA A;  2CWT A;  3IV4 A;  3NX0 A;  1PFO A;  1STF I;  1WQL B;  4WF4 A;  1GSP A;  2AYT A;  4V1A p;  3MAK A;  3CCE 3;  4MJB A;  1XXU A;  1ZYP A;  1RCL A;  2GXF A;  2WS2 A;  4GSN A;  1UC7 A;  1YEP A;  3RGA A;  2ZCT A;  1G7O A;  5ABR A;  5ID2 A;  4V2M A;  3IAS 2;  4EVM A;  1MNL A;  1FOV A;  1SEN A;  3DGM A;  2G0F A;  1TK0 B;  2PVQ A;  5D82 A;  2YV9 A;  1I8V A;  2YV7 A;  1OKD A;  1MD3 A;  5M19 A;  2C4J A;  2B5E A;  1F6M C;  3U97 A;  2K18 A;  1RNT A;  1OC3 A;  5JWO B;  3HYP A;  3ZG5 A;  1ISK A;  5KOW A;  1HZ1 A;  1AR0 A;  5IMC A;  4IQA A;  4G9H A;  5KN1 A;  4KB3 A;  1RLS A;  5EQL A;  1Q82 4;  5IQY A;  5GSP A;  3OX9 A;  4O5R A;  3KCH A;  1TRW A;  1OC9 A;  1JFU A;  2W56 A;  4MJA A;  2HT9 A;  2B24 B;  2NBS A;  1TK8 B;  2PBJ A;  3HI7 A;  4EXR A;  2H1D A;  4PUF C;  3CU3 A;  1RJO A;  3GUR A;  1UCL A;  3TKQ A;  1XOA A;  2ZUP A;  1TFO A;  2JZS A;  2BIR A;  3NZN A;  3SWL A;  4MF7 A;  3KGK A;  1E6B A;  1A2L A;  2O8V B;  3SED A;  9GSS A;  1OC9 B;  2CV4 A;  4ZXG A;  1O7P B;  3MSO A;  5GZZ B;  4LMW A;  1A2J A;  1UA5 A;  5DAL A;  3CC2 3;  4R1K A;  3PS8 A;  3KCM A;  4KA0 A;  3PH9 A;  1N5P A;  2NTO A;  4HOH A;  4KE3 A;  1AQX A;  1MGR A;  4ZIJ A;  1K41 A;  1EWX A;  2BMX A;  5B8A A;  3KMO A;  5FHI A;  2MBT A;  2Z9S A;  4F03 A;  3GKK A;  3KJY A;  3BLZ A;  3F0I A;  4LLR A;  2R2J A;  3G7Y A;  5ELG A;  3BOA A;  1MWR A;  2CX4 A;  4LGQ A;  1OVN A;  3D21 A;  1DSB A;  5ECQ B;  1SL1 B;  2EC4 A;  3GA4 A;  4CDL A;  1C54 A;  4FYB A;  5G5E A;  1U3A A;  4TR3 A;  1TDI A;  1T2I A;  4EDZ A;  1IV9 A;  3JUQ A;  4RI7 A;  1TOF A;  1MDK A;  3K9M C;  1Q4J A;  3VI7 A;  5B8B A;  3DYR A;  1LQM B;  2C0F A;  4FH8 A;  3VF1 A;  4TR1 A;  2CW9 A;  5HR3 A;  1ML6 A;  3ZVJ A;  4V1A g;  2GSP A;  2PNC A;  2OE1 A;  1GUH A;  11GS A;  2X99 A;  4IN0 A;  4XIH A;  4KT3 B;  3RBT A;  5HQP A;  3GKN A;  2Q07 A;  5DJL A;  1PY3 A;  4K61 A;  5A5K A;  3A5E A;  1WMN A;  4HM2 B;  5EL8 A;  6RNT A;  3DEX A;  1XG8 A;  4HYZ A;  2UUG C;  1IDP A;  3LTC A;  4CPK A;  1VGL A;  1JZO A;  2HML B;  5LC6 A;  5ECP B;  1R4W A;  1EP8 A;  3J7Y k;  4ECI A;  3SOY A;  4I2U A;  4J5K A;  3FRC A;  1TKD B;  1U8C B;  1R4Y A;  1YKC A;  3G8Z A;  3KKG A;  4BWQ A;  3K63 A;  3K8N A;  1TP9 A;  5IMV A;  1EOG A;  1EEM A;  2W9Q A;  2GU1 A;  4N30 A;  1ERV A;  3CCR 3;  3QK9 A;  3ZFZ A;  1BRN L;  2H01 A;  4TXO B;  3HZP A;  3MNG A;  3D9R A;  3P8W A;  4HZB B;  1YDK A;  1XW9 A;  4ZM8 A;  5J3R A;  2IUJ A;  3D4M A;  3TRX A;  4TRX A;  3C71 A;  3LXU X;  3OWY A;  2CA8 A;  5IO0 A;  2YFL B;  4JRF A;  4TX4 A;  3KM6 A;  1UCK A;  4MH2 A;  4A5P A;  1XWB A;  3APS A;  8RNT A;  1DVD A;  1DUG A;  1TXX A;  3IXR A;  4Z2T A;  1W01 A;  3QPM A;  1Q7H A;  1U88 A;  3U5R E;  2L5O A;  4K7N A;  4Q5Q A;  1D6Y A;  2BU4 A;  2XC2 A;  3GTU A;  3AY8 A;  2GQK A;  4FO5 A;  3CCJ 3;  2H0H A;  4WET A;  5D9V A;  4AF2 A;  1TK5 B;  3WGD A;  2QKE A;  1O81 A;  4O5Q A;  2M80 A;  3GMF A;  1SJZ A;  3L0R A;  5AGY A;  3FZA A;  3FH1 A;  1IVW A;  1XVW A;  1FG4 A;  2KOK A;  4XS4 B;  2VCT A;  2R5G A;  2DIY A;  1JRQ A;  3W8S A;  3NM7 A;  1K0C A;  2BO9 B;  1LRA A;  3KH7 A;  3GV1 A;  3VWV A;  3HJM A;  2D42 A;  1SK1 A;  4QWT A;  3CTF A;  3TJB A;  1BNF A;  5HOH A;  5IG5 A;  3F8U A;  1WE0 A;  4EC0 A;  4AJ8 A;  3M8C A;  5IMF A;  1VQ9 3;  2QA2 A;  1F2E A;  5CF2 A;  3JUO A;  1YVS A;  3I0Y A;  5JBS A;  2OJL A;  2XBI A;  1GY6 A;  2ML6 A;  2B1K A;  2LYX A;  3DD3 A;  5IER A;  1UDI I;  4MMX B;  1C7H A;  1MWT A;  3GIX A;  2X8C A;  1B4P A;  3JVC A;  4N3V A;  1SAR A;  4HDE A;  3DXO A;  1E3R A;  1AQZ A;  2J23 A;  4K5S A;  5AEU B;  2Z76 A;  1SKW B;  2PPT A;  1W2Z A;  2RM6 A;  4MAB A;  1O85 A;  1Y4K A;  2GU3 A;  4GSS A;  2VUP A; 
#chains in the Genus database with same CATH homology
 2EIQ A;  1LU4 A;  4TN8 A;  5LCZ A;  1M9B A;  4HZ4 A;  5DAK B;  1GTI A;  1RW1 A;  4MH3 A;  3IPZ A;  2MMZ A;  2IIY A;  2VD1 A;  1XWG A;  1YQ1 A;  2OAC A;  5CYY A;  2EIO A;  2VM2 A;  2L4C A;  3L9U A;  5KN0 A;  2HZE B;  1XWA A;  3KP8 A;  3PGT A;  1ERT A;  2JAD A;  4TOP A;  2B7K A;  1PSQ A;  5HFK A;  2L5L A;  1EP7 A;  3LWA A;  1FB0 A;  3UBL A;  1TU7 A;  4BL7 B;  3G9B A;  5J9B A;  3DML A;  2R3X A;  2VLT A;  4I97 A;  5DBQ A;  4D73 A;  5CP1 A;  3LXZ A;  1NSW A;  3FEU A;  6GSU A;  2D2Z A;  2GSS A;  2A4H A;  3GST A;  2AV4 A;  4HQS A;  3ERG A;  3EMP A;  3KMN A;  1YY7 A;  4CY6 A;  4N0V A;  1GSQ A;  2FA8 A;  1SU9 A;  2F51 A;  2H8L A;  3I43 A;  2R0P A;  2R0C A;  5L71 A;  1EGR A;  1YJ6 A;  2ON5 A;  2JU5 A;  5F8B A;  3ERF A;  3CSJ A;  3APO A;  2CVD A;  3SBC A;  4HZ2 A;  4BVY A;  4BVX B;  5IPH A;  3VPQ A;  2YNX A;  3D22 A;  3ZFB A;  3D0Z A;  5B7C A;  4DSS B;  1V57 A;  2DJK A;  1WMJ A;  2HNL A;  2YPM A;  2YWM A;  4L8E A;  4RQX A;  4USS A;  1FW1 A;  2DJ2 A;  3IK9 A;  3TB2 A;  4HQZ A;  5CO3 A;  5ECI B;  3ZZX A;  3APQ A;  3VWW A;  1GSS A;  2B3S A;  5E59 A;  2GZP A;  4OO5 A;  1FHE A;  2DJJ A;  3MSZ A;  3CBU A;  2VL3 A;  2F8A A;  4O32 A;  4PUA A;  1XW5 A;  1ERU A;  3TCO A;  1IYH A;  3H4K A;  3TJK A;  4MCU A;  2GGT A;  2V32 A;  2B7J A;  2YP6 A;  3HVV A;  1V98 A;  1O8X A;  2CAQ A;  3H79 A;  18GS A;  2C0E A;  1CQH A;  2XPE A;  1XZO A;  3QAV A;  2GZY A;  2RII A;  2WDU A;  2ZNM A;  3KIJ A;  5J4U A;  3GH9 A;  3I9V 2;  2ON7 A;  4PGT A;  3LEF A;  3HZ4 A;  2YJ7 A;  4KH7 A;  3IC8 A;  4AGS A;  2OE0 A;  2DIZ A;  1QMV A;  1HQO A;  5ECR B;  4JRR A;  1XFL A;  5ECS A;  5DQS A;  1H4O A;  1QQ2 A;  1TI3 A;  3VLN A;  1KTE A;  2KP1 A;  2FY6 A;  3FZ4 A;  3WYW A;  3DVX A;  3A2V A;  2G2Q A;  3VUR A;  1EOH A;  3F4R A;  1JZD A;  5H5S A;  3UL3 A;  1YF1 A;  1VF3 A;  1DE1 A;  3G7I A;  3J7Y b;  1W89 A;  2YJH A;  1F3A A;  3HZ8 A;  2QC7 A;  2H0G A;  2WCI A;  1GP1 A;  1C72 A;  2DC5 A;  2VOC A;  3A5I A;  4G0I A;  3ZML A;  2IYJ A;  1JZW A;  4ZB6 A;  4BVX A;  2F9S A;  2MMA A;  2L6C A;  1BX9 A;  3RPN A;  4QL7 A;  1GTB A;  1B48 A;  4ZL7 A;  1GNE A;  1IYI A;  2LS5 A;  1G6W A;  1ZOF A;  4KDX A;  1A0R P;  2L59 A;  2AAW A;  2GLR A;  3TJF A;  4I8B A;  2GVP A;  2BJX A;  2LQO A;  1HNC A;  4I2T A;  2IMD A;  3DRN A;  3M3M A;  1SK2 A;  1EV4 A;  4WBR D;  1SK0 A;  5CAX A;  4YQV A;  4WEY A;  1SYR A;  5CRE A;  3LXT A;  2C8U A;  1PKW A;  4ZIL A;  2C0G A;  2LRN A;  4HUA A;  1N2A A;  2A2P A;  1FOH A;  3F4T A;  1Z6N A;  4XS1 A;  2YAN A;  1ILO A;  2KUC A;  4IS0 A;  3FY7 A;  3MYD A;  2GQM A;  2IWT A;  3EYT A;  4MLY A;  4BA7 A;  5IM9 A;  1ZYN A;  2C3N A;  3CSI A;  1X9W B;  1XWK A;  1EZK A;  4IHU A;  1V2A A;  4CHS A;  4EXJ A;  2IMI A;  3F6F A;  2WRT A;  1X5E A;  1JLV A;  4LL4 B;  4MF5 A;  2FWE A;  4AJ7 A;  3VK9 A;  3ZRD A;  2HI7 A;  1B8X A;  2JZT A;  6GST A;  1SD8 A;  4KF9 A;  19GS A;  1G7E A;  3VI5 A;  1PQN A;  5CRD A;  1K0M A;  1FB6 A;  1F37 A;  2RUF A;  2CT6 A;  3FW2 A;  3IC4 A;  4TW5 A;  4NXI A;  2H1G A;  2WJU A;  4GST A;  4HEA 2;  1T4Y A;  4MF6 A;  4HU7 A;  2YWN A;  2H73 A;  2L6D A;  2K9F A;  2FWH A;  3A2W A;  4TR1 B;  3HJO A;  4GWR A;  3KD0 A;  5HR2 A;  2DKI A;  1GL8 A;  2DMM A;  3HVS A;  3PPU A;  3TJJ A;  2IN3 A;  4WBJ A;  3N9J A;  2GSR A;  4ZB8 A;  5D96 A;  1EGO A;  1M0U A;  4X4J A;  4WF5 A;  3DGQ A;  1ST9 A;  1K3O A;  4K0N A;  3W6G A;  3ZIT A;  3RAZ A;  4PQH A;  5DCH A;  3GKX A;  4K1F A;  5EY6 A;  3O76 A;  4MZB A;  5HFI A;  2WZ9 A;  4KX4 A;  4KND A;  1ACV A;  20GS A;  4QQ7 A;  4MZC A;  4K2D A;  3H1N A;  2FWG A;  5DCG A;  3DWV A;  5J9C A;  2GS3 A;  1B4Q A;  2IJY A;  3GSS A;  4ECB A;  3RHB A;  4HS1 A;  4WXT A;  1PA3 A;  3M1G A;  4TVE A;  2RLI A;  1Z7P A;  1Z9H A;  3P2A A;  2V6K A;  1A8Y A;  1PX6 A;  3KH9 A;  4PQI A;  2CVB A;  4ZBD A;  1NW2 A;  3D4T A;  1LBK A;  1Q98 A;  4OWY A;  1M7T A;  5ID2 B;  2HFD A;  5ECN B;  2CQ9 A;  5B6M A;  2L4Q A;  2ES7 A;  5ELA A;  2X49 A;  1N8J A;  2V2G A;  5BRT A;  5IOW A;  1T4Z A;  4DVC A;  5D9W A;  4PNG A;  4FIW A;  2H6X A;  4HOJ A;  2ALB A;  1QUW A;  2FLS A;  3E0U A;  3TRQ A;  4BVY B;  2V6O A;  1KEB A;  3ZMK A;  1SKS B;  2OA7 A;  5D93 A;  4YAV A;  1R7H A;  4CY8 A;  3F4S A;  4TKY A;  2FUG 2;  4V2N A;  5DDL A;  4POM A;  4WKW A;  5G1L A;  5B6N A;  2L57 A;  3EVI A;  6GSS A;  3P90 A;  1TRU A;  1AQW A;  1HYU A;  2OKA A;  2JZR A;  1WRY A;  2TRX A;  3GHA A;  2H1B A;  4KW6 A;  3F3R A;  2OBK A;  3L4N A;  2LRC A;  2VD0 A;  3FZ9 A;  1ERW A;  2N5B A;  1O73 A;  3H8Q A;  4YAP A;  4N11 A;  2DJ3 A;  4ZBA A;  2VLU A;  2KHP A;  2DJ0 A;  3ISO A;  3ZVJ D;  1Z5Y E;  1NHO A;  4ZB9 A;  1HNB A;  1ZZY A;  4ZL8 A;  6GSY A;  3ZYW A;  4POK A;  2H19 A;  3GRX A;  5G1K A;  3GUS A;  4MP4 A;  2GZZ A;  3LQ7 A;  2HRK A;  3UJ1 A;  3ZIV A;  4CW9 A;  1B9X C;  1R5A A;  1F9M A;  1QXH A;  1SJ6 A;  3MIX A;  3ZTL A;  2VCZ A;  1GUL A;  3GNJ A;  5IMA A;  1GTA A;  4Z7X A;  4P3Y B;  5DVB A;  1DE2 A;  1VF1 A;  1BED A;  1A0F A;  4JE1 A;  3FR9 A;  3RPP A;  5DAL B;  4EKZ A;  2C80 A;  4KGI A;  4NMU A;  3ME7 A;  4GQF A;  2H6Y A;  3UVT A;  1O7U A;  3UEM A;  5INY A;  3R3E A;  3QMX A;  4EF0 A;  1JHB A;  4HJM A;  3EPT A;  2C0D A;  14GS A;  3WGX A;  2WUL A;  3L0H A;  1GSE A;  2FNO A;  2H75 A;  5F06 A;  3C73 A;  2FCH A;  2F3M A;  4TXO A;  5AIX A;  2MMO A;  3ZRE A;  1M2B A;  4TR0 A;  5CRG A;  2AHE A;  3QFB C;  1TRV A;  3FYG A;  1VRS D;  3HHV A;  3HXS A;  2H74 A;  4L5O A;  1WWJ A;  2CVK A;  2YWI A;  3TKS C;  3GTU B;  4WR4 A;  4J2F A;  4G0K A;  4DSS A;  1ABA A;  5KN2 A;  3HA9 A;  2H66 A;  2O7K A;  4EDY A;  2CZ3 A;  4Q5R A;  1PMT A;  3GFK A;  1JZR A;  3IR4 A;  3ED3 A;  2LJK A;  4PX1 A;  5F05 A;  5IIZ A;  1J08 A;  3NIV A;  2PER A;  4EUY A;  8GSS A;  2CZ2 A;  3BBY A;  5EPF A;  3TUE A;  4K2X A;  3GL5 A;  4O7H A;  5ECK B;  1ZCP A;  1TTZ A;  2HXK A;  1PX7 A;  1GSY A;  1QGV A;  3C7M A;  2NPB A;  2AB6 A;  4IKH A;  1GSU A;  1PN9 A;  3I69 A;  4KCA A;  4BL7 A;  4J56 E;  3WGE A;  4Z2U A;  2EIR A;  2QGV A;  3FMW A;  3C1S A;  2M46 A;  1GSD A;  2RM5 A;  4Q5F A;  2GQL A;  3CSH A;  2RUE A;  1R5P A;  4F0C A;  3VWU A;  17GS A;  2X4A A;  2C3Q A;  2HZF A;  3F3Q A;  4QL9 A;  4I5Q A;  1TRS A;  1USB A;  4ZBB A;  4GXZ A;  2P5Q A;  1XBS A;  3Q6O A;  4JED A;  1M2D A;  3IAM 2;  4J57 E;  1G6Y A;  5FWG A;  3VFI A;  1PL2 A;  1PD2 1;  2V1M A;  3IK7 A;  2FD3 A;  3FR6 A;  3L9S A;  4DSR A;  3LJR A;  5A4W A;  1SL2 B;  5ENU A;  4XS6 A;  5ECH B;  4IEL A;  2C3T A;  3L78 A;  5JCG A;  2VCV A;  3MWH A;  3LGC A;  3Q19 A;  1GNW A;  3D6I A;  4HI7 A;  4YH2 A;  5JWR B;  3BD2 A;  4HU9 A;  2I9H A;  1GUK A;  4X43 A;  1T00 A;  4N0Z A;  3DVW A;  4WR5 A;  4XTS A;  1O6J A;  2XHF A;  4JZQ A;  1X9S B;  2V41 A;  2J9H A;  1ZGN A;  1Z3E A;  4IBP A;  1K0O A;  4ECC A;  1X5C A;  1J9B A;  2H0I A;  1K0B A;  2I1U A;  3F9U A;  2LUS A;  2CAI A;  3LG6 A;  2DKH A;  3GH6 A;  3WT2 A;  4XCS A;  3HKR A;  2K8V A;  5LD0 A;  3OR5 A;  3FHK A;  1FVK A;  3BCI A;  1W4V A;  3TKS A;  2P5R A;  1Y6E A;  2GT6 A;  4YQU A;  5COH A;  3IOS A;  2LKU A;  2LV3 A;  4OFT A;  1ON4 A;  4G10 A;  2A2R A;  2FGX A;  4YKG A;  2VCX A;  2UZ8 A;  2GST A;  1OE8 A;  1WJK A;  4IVF A;  1U87 A;  4PXO A;  1AUC A;  1MD4 A;  2HZE A;  3RHC A;  3HJP A;  3IHG A;  3TOT A;  4K7O A;  3TRP A;  12GS A;  1TJD A;  2B6M A;  2PN8 A;  2VM1 A;  2VCW A;  3DKS A;  2A4V A;  3HVX A;  1HNA A;  5D73 A;  3KTB A;  5DJM A;  4ZL9 A;  1B9Y C;  2LRT A;  1FAA A;  4POB A;  3M9K A;  3O3T A;  3EU4 A;  1T8E B;  1FO5 A;  2R0G A;  2WGR A;  3QAG A;  2B1L A;  1F3B A;  1OC8 A;  2R6K A;  4KUN A;  5KEJ A;  4RUV A;  5IOX A;  3HY2 A;  1THO A;  4ICY A;  3UMA A;  5IMD A;  3IDV A;  3V1W A;  2E2G A;  1K0D A;  2QSI A;  4K6X A;  3QD9 A;  4ILF A;  4XS4 A;  5E4W A;  2LNT A;  4NPB A;  1XPV A;  1T3B A;  2DJ1 A;  3G7J A;  1RQM A;  3MDK A;  4RQR A;  1J0F A;  2IL3 A;  4TXV A;  2KLX A;  3GL3 A;  1ZYE A;  2N5F A;  4MZW A;  3F63 A;  3FR3 A;  2R37 A;  4HJ2 A;  3Q74 A;  2DSA A;  4ML1 A;  2M72 A;  2HRA A;  4JR4 A;  1A23 A;  2VIM A;  2MZC A;  2AUV A;  3HCZ A;  4OCE A;  3S9F A;  4E8H A;  3IRA A;  2YZH A;  4MDC A;  4IP1 A;  1GLQ A;  1GWC A;  3VPT A;  4OO4 A;  4X1U A;  5KOX A;  3PIN A;  2VLV A;  3RDW A;  1XWC A;  4GTU A;  6GSX A;  2PVO C;  3TKP A;  1Z7R A;  1SL0 B;  1GH2 A;  3ZFL A;  1AW9 A;  2WB9 A;  2K8S A;  4MMM A;  4XHM A;  4FQU A;  4ID0 A;  5G31 A;  4ML6 A;  3LYP A;  1MDJ A;  2VL9 A;  3UBK A;  3BCK A;  2H30 A;  3DXB A;  3LOR A;  2GT5 A;  4OMV A;  4F0B A;  1THX A;  1PL1 A;  3TKS E;  2E2M A;  1XOB A;  3FZ5 A;  2LTK A;  3ME8 A;  4NV2 A;  1FVJ A;  1QFN A;  3QFA C;  5C00 A;  2PUK C;  3QOU A;  4IQ1 A;  2N5A A;  4DEJ A;  3GN3 A;  2IFQ A;  3QAW A;  4I6X A;  1WPI A;  5ECM B;  3KZQ A;  2HSH A;  6GSW A;  5GAP D;  2H70 A;  3CRT A;  4G2E A;  4BPY A;  4GCI A;  2P31 A;  2IY2 A;  1K3L A;  3QDN A;  4GQC A;  4MNN A;  2H72 A;  2HRN A;  4MJC A;  1XIY A;  1EEJ A;  4O92 A;  22GS A;  4PUR A;  1M9A A;  2DLX A;  1RK4 A;  2F8F A;  10GS A;  3LYK A;  1WOU A;  4NHZ A;  1AC1 A;  2HE3 A;  4L0W A;  4JBB A;  3GKM A;  4ULX A;  2JL4 A;  2X8H A;  3O6T A;  2XBQ A;  2LNS A;  2O89 A;  3UAP A;  4G0L A;  1BJX A;  5BMU A;  3EC3 A;  2MYG A;  1KNG A;  2QA1 A;  3GYK A;  3TKR A;  5HR1 A;  1AQV A;  3JCM L;  1ZMA A;  2O87 A;  1Y25 A;  4FYU A;  2YCD A;  5ECL B;  1SD9 A;  1UVZ A;  1GRX A;  2HSM A;  3NOF A;  2FHE A;  5AIS A;  4F82 A;  1MDI A;  1SKR B;  3QR6 A;  2DML A;  3FKF A;  3A5W A;  4FYC A;  3M8N A;  3M9J A;  2GSQ A;  1PN0 A;  1YKA A;  2E7P A;  2IFQ B;  4K5R A;  1V40 A;  4OFM A;  5ECO B;  5IO2 A;  1WIK A;  3U6V A;  2NDO A;  5J41 A;  1S3C A;  1JLW A;  4KSM A;  1NM3 A;  1CQG A;  2HRF A;  1M2A A;  3CXG A;  4K7I A;  4H86 A;  4E8E A;  4NV5 A;  5A4V A;  3E3E A;  1PGT A;  3I6A A;  4LMV A;  4LL1 B;  3ZL5 A;  4KDU A;  3A3T A;  3HDC A;  5HFG A;  4IJI A;  2E0Q A;  4D73 B;  1WP0 A;  1M99 A;  16GS A;  5FT3 A;  1U6T A;  4YQM A;  4POL A;  4L0U A;  4NHW A;  2XPD A;  3L9V A;  3R2Q A;  1URM A;  4XRA A;  5D9X A;  4Z2R A;  3CMI A;  5F0G A;  5D9T A;  4OD7 A;  4GF0 A;  5GST A;  3A2X A;  4TR4 A;  4KCE A;  4IP6 A;  2IMK A;  2HSY A;  1UN2 A;  1S3D A;  2DBC A;  4MJE A;  1PKZ A;  4N10 A;  2I4A A;  4EIP A;  2REM A;  3BJ5 A;  3IA1 A;  1ZYQ B;  1MTC A;  4OFN A;  1BAY A;  2A2S A;  4NAX A;  4MPF A;  3DIE A;  3ERW A;  1I5G A;  1NHY A;  3W8J A;  5C04 A;  3IBH A;  4MA9 A;  3CTG A;  1TW9 A;  4CDO A;  4PNF A;  2YN1 A;  2HLS A;  4ACS A;  2LQQ A;  2PGT A;  4X0X A;  5A4U A;  5IMZ A;  5DAK A;  1MEK A;  1QK8 A;  3WT1 A;  4NWY A;  4LA1 A;  4RI6 A;  2JSZ A;  13GS A;  3GX0 A;  1Z6M A;  4F2I A;  3UOM A;  5EVO A;  1A24 A;  2MMN A;  4Q5N A;  2X8G A;  1E2Y A;  1GUM A;  1OE7 A;  3EIN A;  1V9W A;  3TOU A;  5H5R A;  4PQ1 A;  4K8M A;  4DSQ A;  5D8I A;  2R4V A;  4EO3 A;  5AIV A;  3UVH A;  3KXO A;  4L5L A;  2LJR A;  3LFL A;  1OKT A;  5G30 A;  2OAD A;  3H93 A;  4GLT A;  2AJQ B;  4MPG A;  4KDY A;  4BWS A;  5J5N A;  4K0G A;  1TI1 A;  4IGJ A;  5JCW A;  4ISD A;  4GRF A;  2HYX A;  1VF2 A;  1SJI A;  4EL1 A;  2WFC A;  3EWL A;  2B5Y A;  3QCP A;  4OCF A;  1OYJ A;  3ZLP A;  1OAZ A;  2O85 A;  2KP2 A;  1G0T A;  3KP9 A;  4V2L A;  3LSZ A;  2IMF A;  3EUR A;  1VF4 A;  4PTS A;  4XRD A;  3PR8 A;  1T1V A;  3C8E A;  2TIR A;  4KSO A;  5G2Z A;  3IE3 A;  4YKF A;  1TU8 A;  4IW9 A;  3CYN A;  2I3Y A;  4KAE A;  5H5Q A;  5CNW A;  2H76 A;  1XVQ A;  2PMT A;  5F07 A;  4G19 A;  2H71 A;  1R26 A;  1LJR A;  4JU5 A;  3C1R A;  2I81 A;  2FA4 A;  2YOI A;  1U3I A;  2OE3 A;  3KEB A;  3E9J B;  2VAF A;  3CRU A;  1AXD A;  5CRH A;  1X0R A;  1A2M A;  3TDG A;  4EIQ A;  3P7X A;  4AJ6 A;  5GAN D;  1XW6 A;  2IME A;  1BG5 A;  1BQ7 A;  3Q18 A;  1YEX A;  3LW9 A;  3ZIJ A;  1GLP A;  2GTU A;  3WD6 A;  7GSS A;  5CRW A;  1PRX A;  1ZL9 A;  1AIU A;  3M0F A;  2LST A;  3EMX A;  2NVL A;  1BYE A;  5DQY A;  2JSY A;  3UIW A;  4K9Z A;  2TRC P;  1H75 A;  4O5U A;  2MBS A;  1GSF A;  2X64 A;  4MK3 A;  2GDR A;  3US3 A;  4IJ3 A;  5GSS A;  1AAZ A;  4JR6 A;  1I9D A;  2CX3 A;  5LNK e;  2IPA A;  3TGZ A;  5JWQ B;  1EV9 A;  5JCU A;  3D5J A;  3HD5 A;  1S3A A;  5HR0 A;  2BTO T;  1K3Y A;  6GSV A;  5IPG A;  1O8W A;  1KBN A;  1DBY A;  2P0G A;  4EE0 A;  2VCQ A;  1K0A A;  3TJG A;  3VWX A;  5KN3 A;  3IHQ A;  1V58 A;  4ECJ A;  3N5O A;  2PU9 C;  1YF0 A;  3F6D A;  2B5X A;  1X5D A;  3EE2 A;  1A8L A;  3UAR A;  5AN1 A;  2C1Y A;  2H1A A;  2LJA A;  2PWJ A;  3KTL A;  2VL2 A;  2VO4 A;  1HD2 A;  1X9M B;  2YWO A;  2YZU A;  4F9Z A;  2JAC A;  1K0N A;  2FWF A;  1SYX A;  2K6V A;  2VL2 C;  2LEG A;  3FK8 A;  1YZX A;  5G5F A;  2H6Z A;  1XCC A;  1T7P B;  2OBI A;  1GTU A;  3GX8 A;  3EU3 A;  3IV4 A;  4WF4 A;  2AYT A;  4V1A p;  3MAK A;  4MJB A;  1XXU A;  1ZYP A;  2WS2 A;  4GSN A;  1UC7 A;  1YEP A;  2ZCT A;  1G7O A;  5ABR A;  5ID2 A;  4V2M A;  3IAS 2;  4EVM A;  1FOV A;  1SEN A;  2G0F A;  1TK0 B;  2PVQ A;  2YV9 A;  2YV7 A;  1OKD A;  1MD3 A;  2C4J A;  2B5E A;  1F6M C;  2K18 A;  1OC3 A;  5JWO B;  3HYP A;  5KOW A;  5IMC A;  4IQA A;  4G9H A;  5KN1 A;  4KB3 A;  5IQY A;  4O5R A;  1TRW A;  1OC9 A;  1JFU A;  4MJA A;  2HT9 A;  2NBS A;  1TK8 B;  2PBJ A;  2H1D A;  4PUF C;  3GUR A;  3TKQ A;  1XOA A;  2ZUP A;  2JZS A;  3NZN A;  3SWL A;  4MF7 A;  3KGK A;  1E6B A;  1A2L A;  2O8V B;  9GSS A;  1OC9 B;  2CV4 A;  4ZXG A;  5GZZ B;  4LMW A;  1A2J A;  1UA5 A;  5DAL A;  3KCM A;  4KA0 A;  3PH9 A;  2NTO A;  4KE3 A;  1AQX A;  4ZIJ A;  1EWX A;  2BMX A;  5B8A A;  3KMO A;  5FHI A;  2MBT A;  2Z9S A;  4F03 A;  3GKK A;  3KJY A;  3F0I A;  4LLR A;  2R2J A;  5ELG A;  3G7Y A;  3BOA A;  2CX4 A;  1OVN A;  3D21 A;  1DSB A;  5ECQ B;  1SL1 B;  2EC4 A;  3GA4 A;  4FYB A;  5G5E A;  1U3A A;  4TR3 A;  1TDI A;  4EDZ A;  4RI7 A;  1TOF A;  1MDK A;  1Q4J A;  3VI7 A;  5B8B A;  3DYR A;  2C0F A;  4FH8 A;  4TR1 A;  5HR3 A;  1ML6 A;  3ZVJ A;  4V1A g;  2OE1 A;  1GUH A;  11GS A;  2X99 A;  4IN0 A;  4XIH A;  3RBT A;  5HQP A;  3GKN A;  5DJL A;  5A5K A;  5EL8 A;  3DEX A;  1VGL A;  1JZO A;  5ECP B;  1R4W A;  1EP8 A;  3J7Y k;  4ECI A;  4I2U A;  3FRC A;  1TKD B;  1YKC A;  4BWQ A;  3K8N A;  1TP9 A;  5IMV A;  1EOG A;  1EEM A;  4N30 A;  1ERV A;  2H01 A;  4TXO B;  3MNG A;  3P8W A;  1YDK A;  1XW9 A;  5J3R A;  3D4M A;  3TRX A;  4TRX A;  3C71 A;  2CA8 A;  5IO0 A;  3KM6 A;  4MH2 A;  4A5P A;  1XWB A;  3APS A;  1DUG A;  1TXX A;  3IXR A;  4Z2T A;  3QPM A;  1U88 A;  3U5R E;  4K7N A;  4Q5Q A;  2L5O A;  4WET A;  2XC2 A;  3GTU A;  4FO5 A;  3AY8 A;  2GQK A;  2H0H A;  5D9V A;  4AF2 A;  1TK5 B;  3WGD A;  2QKE A;  1O81 A;  4O5Q A;  2M80 A;  3GMF A;  1SJZ A;  5AGY A;  3FZA A;  1XVW A;  1FG4 A;  2KOK A;  4XS4 B;  2VCT A;  2R5G A;  2DIY A;  3W8S A;  1K0C A;  3KH7 A;  3GV1 A;  3VWV A;  3HJM A;  1SK1 A;  3CTF A;  3TJB A;  3F8U A;  1WE0 A;  4EC0 A;  4AJ8 A;  5IMF A;  2QA2 A;  1F2E A;  2OJL A;  2XBI A;  2B1K A;  3DD3 A;  3GIX A;  2X8C A;  1B4P A;  4HDE A;  2J23 A;  4K5S A;  1SKW B;  2PPT A;  2RM6 A;  4MAB A;  1O85 A;  4GSS A;  2VUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...