4RNTA

His 92 ala mutation in ribonuclease t1 induces segmental flexibility. an x-ray study
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITATGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title His92Ala mutation in ribonuclease T1 induces segmental flexibility. An X-ray study.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1990-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4rntA00
1TTOA 8RNTA 1LOVA 1TRQA 4GSPA 4RNTA 1FUTA 4HOHA 1BUJA 1BOXA 3AGOA 1I3IA 1I8VA 2F5MA 1HYFA 1BNFA 3D5IA 1I70A 1BSAA 1UCJA 1MGWA 1GMRA 1B2SA 1ZGXA 2AAEA 3BU4A 2KAAA 1BNIA 1IYYA 1BRJA 1X1UA 1B21A 1BU4A 2GSPA 7RNTA 1BNEA 4J5KA 1LNIA 1A2PA 1BNGA 1HZ1A 1UCLA 1BNRA 1RLSA 1C54A 1B2XA 1BRSA 1RHLA 1RSNA 1B2MA 1I2GA 1T2HA 3Q3FA 5BIRA 1JBTA 1I0XA 1B20A 1RGFA 2F5WA 3DH2A 1BSCA 1RGAA 4GHOA 1BIRA 1I2FA 7GSPA 1BANA 1I2EA 1TRPA 1G02A 1DE3A 1FUSA 1FZUA 1LOWA 1X1YA 1RN4A 1RNTA 2F4YA 1JBSA 2ZA4A 2SARA 1BNJA 9RNTA 1YGWA 1X1XA 3D4AA 1B2ZA 1BRGA 1AY7A 4BIRA 1RGHA 1YVSA 1Q9EA 1JBRA 3BIRA 1B3SA 3WHOA 1RTUA 1BAOA 1RN1A 1BSBA 1RMSA 1YNVX 3SYUA 1RGGA 1RGKA 1GOVA 2KF5A 1BNSA 1LOYA 3A5EA 3AHSA 1BRHA 1R4YA 1PYLA 2AADA 1GMPA 1BVIA 3URPA 1AQZA 1GOYA 1UCIA 1BSDA 2BU4A 1MGRA 3AGNA 1PY3A 1I0VA 3HOHA 1RGEA 2KF6A 6RNTA 1GOUA 3KCHA 2HOHA 1B2UA 1RDSA 1BGSA 1SARA 1BRKA 1BRNL 2KF4A 3AHWA 5HOHA 1GMQA 4J5GA 1CH0A 4BU4A 1BSEA 1FW7A 1B27A 1DETA 3D5GA 3DGYA 1GSPA 1I3FA 2F56A 1X1WA 1RGLA 2RBIA 2C4BA 1FYSA 5GSPA 1RCKA 1RCLA 5RNTA 1T2IA 1UCKA 3GSPA 1RGCA 3RNTA 2RNTA 3WR2A 6GSPA 1RNBA 5BU4A 2BIRA 2KF3A 4HAAA 1LRAA 1BRIA
chains in the Genus database with same CATH superfamily
2GBXB 2BMQB 2GEXA 2QA43 1K28A 3T8NA 3MG3A 1UI7A 3B4OA 2IUJA 3CCU3 3FCSB 4KVHA 1BUQA 1B2SA 2BNGA 4CCVA 1YHQ3 3EB8A 2KAAA 1N5PA 3LH4A 5ELJA 1BRJA 4H3UA 1BU4A 7RNTA 4J5KA 1DVDA 1NB5I 3ZG5A 1RN7A 4KFFA 1RLSA 1UGIA 1VQ83 2CG1A 2V1LA 2OTJ3 4O8SA 1W5ZA 5M1AA 1YGEA 4WYKB 1ROAA 4FR9A 3OX9A 2UUGC 1LQMB 2H0HA 2WOHA 3Q3FA 5IF6A 2WOFA 3G16A 3UL6A 1RGFA 3F7SA 3NQYA 2H0GA 3G0KA 1RGAA 4GHOA 2CC3A 1O7PB 1IT7A 4FCMA 5AEUB 5IEOA 1LXEA 5CF1A 1F8NA 4R80A 1FUSA 1FZUA 5EQLA 1RRLA 2CFKA 4EXRA 1O7GB 2D42A 1UW1A 4HM4B 4ORLA 3G6E3 4HYZA 1JZDA 4HJLB 3A76A 3LOYA 1RNTA 2STDA 4XM4A 4N6V0 2ZA4A 3KZTA 1BNJA 3DY5A 3PCRA 2PZVA 4X2OA 1GY5A 3ZG0A 1YGWA 2Y73A 1X1XA 4WP5A 1VQM3 1YI23 4HM6B 3EBYA 3MYTA 3F7XA 4K90B 1BRGA 4XBTA 1AY7A 2M7OA 1PU4A 1FGMA 3IMAB 3SLUA 1VQL3 2W03A 5G2GA 1ROVA 2CFGA 3X3YA 2C10A 1S5AA 2P05A 4N3VA 4CJNA 4J8TA 3FF0A 3K0ZA 1ZO2A 3SYUA 1TIJA 4O02B 1UGHI 1W2ZA 3FSDA 4WWUC 3FKAA 2PNCA 3UB1A 3X3XA 2XSHB 1MWSA 3A5EA 1R4YA 2OOVA 3WOEB 1OGXA 1S723 3OW22 4GB5A 3U1WA 1STDA 2K0MA 3FH1A 3MSOA 3QK9A 1BSDA 2BU4A 5I97A 1MGRA 3FZWA 3HOHA 3SXXA 4X2HA 2XFSA 2GU1A 2ML5A 4XBXA 1V58A 5IG0A 2CFLA 2R41A 1BGSA 2ZDJA 1G96A 3NUVA 1L5GB 3ZFZA 5IG3A 3SEDA 5IG5A 5D83A 1UI8A 4J5GA 3GRDA 2W6JH 3JUNA 1FW7A 1NB3I 3DGOA 2MF7A 3JVCA 2W56A 2F56A 2B1XB 3G8ZA 4R9LA 4RNYA 1O7MB 1NDOB 3UNLA 2IYJA 5RNTA 1T2IA 1K41A 2QIYA 1W4NA 1ULIB 1RGCA 3RNTA 3CCS3 1QAFA 1EKMA 1OUNA 4N6LA 3WR2A 1IVXA 2BMRB 4K61A 4EBGA 1TFKA 1BRIA 1TP6A 4HM3B 3KIIA 1FUTA 1Y4KA 1E3VA 1I3IA 2CWVA 4FCZA 2F5MA 1YIJ3 2OQEC 4AKZA 1IVUA 1HYFA 1JKGA 1I70A 1G0TA 1US1A 2BO9B 1LQGC 1A2KA 1ZGXA 1GYBA 3ALAA 3NBRA 3JUPA 1IYYA 3V92A 1VQ63 1NJI4 2GSPA 1J2BA 3AMOB 3HI7A 3KKGA 1HZ1A 1UCLA 3JUQA 4EV2A 1C54A 1B2XA 1BRSA 5JPUA 2OOVC 5TGNA 3EJVA 4FCJA 1FGTA 5EEOA 1JB4A 2HMJB 3I553 2GXFA 3KSPA 3PZWA 3UJMA 2P38A 2XEPA 1IU7A 1B20A 3LXUX 3J7Yd 2HMOB 2Y74A 1D6UA 1ZX2A 4J9AA 1BSCA 3OXAA 1EG9B 1BIRA 3H3HA 1I2FA 7GSPA 1LOXA 1OGZA 1W02A 3EHCA 1TRPA 3NV0A 3FG1A 5CLKA 1WQLB 3QRDA 1DE3A 3NBBA 1EA2A 1JJ22 1GY7A 2KCDA 1DMQA 5STDA 2RFRA 4R4KA 4HM2B 1JBSA 4HM5B 1N5HA 3LT9A 4HM8B 1OPYA 3GAXA 3L0RA 1ZS7A 3FG4A 2RCDA 1IQ8A 3F40A 5HGRA 1VQK3 4WFOA 1WTHA 1KQS2 1JNQA 3Q2PA 3S29A 2IMJA 1VQ93 2CX1A 4O3VA 3BIRA 1E3RA 3SVAA 3VGNA 1DMNA 1RN1A 8CHOA 1MWUA 5IG4A 1BSBA 1RMSA 3CD63 5FGOA 3NM7A 3S27A 1UUGB 2CX0A 1RGGA 3OV4A 2RGQA 2HMMB 2CK3H 1GOVA 2FGTA 1NNVA 1VQQA 1LOYA 3ER7A 3VSYA 3OWUA 3CNMA 2CKFB 2K54A 3URPA 5AIFA 5M19A 3FGYA 4MMYB 5IW9A 3KSED 5DREA 1GOYA 1UCIA 3KFQC 3G713 3GZYB 3HZPA 1W6CA 4IT7A 1N8QA 2IY2A 1WMNA 4O2HA 3SOAA 4DKIA 1A67A 1YIT3 4HBRA 1RKYA 2FNQA 5D82A 2W56B 6RNTA 1GOUA 2YFIB 1Q814 4TX4A 1B2UA 3Q90A 7STDA 1TJDA 3MG2A 3F14A 3WDGB 3F8XA 4LZIA 1O7HB 3T8UA 5HOHA 3GZXB 4OUQA 1CH0A 1QALA 1K8A4 3F8HA 2WO0A 1BSEA 3CCV3 1DETA 2QEX3 3D5GA 1OF5B 3Q1CA 1I3FA 4LSOA 4N6MA 2RBIA 2XSOB 3DGLA 4LMIA 1JRQA 4LGQA 3RGRA 1YVBI 1DVCA 4PEJA 1EEJA 4CDLA 1SPUA 3BNBA 1FGQA 2H0IA 3V98A 2RSXA 3BNEA 2CH9A 3GSPA 1NU3A 1ASKA 2RNTA 3NM2A 1MOLA 3LTBA 1OACA 4NHFA 1IVVA 3EBTA 3D3LA 1TTOA 1AV4A 1IVWA 5KP1A 4RNTA 3STDA 5FW5A 2BT3A 1WMOA 4AKYA 1W7CA 1BNFA 5M18A 1BSAA 1IT8A 1UCJA 5JBSA 4WYKA 1MGWA 1JV2B 3V99A 4QWTA 3BU4A 3WMDA 1BNIA 2XR8B 4BL2A 1YJN3 1X1UA 1N8R4 3G4S3 4JRFA 3X42A 1LVNA 1BNEA 1ISKA 1LNIA 2C11A 4KFEA 1BNGA 1BNRA 3GWRA 2L4VA 3PGBA 4MJDA 2Z6BA 2OTL3 4HZBB 5BVBA 3EC9A 2XGLA 2CFDA 4RBNA 3X40A 2A15A 2B24B 4HZ9B 4AEQA 1QVG2 3BLZA 1QAKA 4BL3A 1U5OA 2WGOA 3EN1B 3DGNA 2IUKA 3B8LA 5DRVA 1U8CB 1FUWA 3EF8A 3WOFB 4L8PA 1Q7Y4 1W2B2 3B4PA 3GZRA 4STDA 4FMAA 2E2TA 2P09A 6STDA 1X1YA 3U97A 1K734 1MWTA 1NO3A 2W9PA 2XFTA 4L8OA 2F98A 3S67A 1RN4A 1V74A 2O9UX 2W2CA 4R1KA 1N9EA 4MEIA 3MWZA 4EYCA 2F86B 1W6GA 1D6ZA 3D4AA 2J8XB 1BUJA 1A2VA 1B2ZA 1TFOA 3E99A 5CK6A 1W01A 4BIRA 2UGIA 1IV7A 1AR0A 4NREA 3I563 2JDIH 3S28A 1Q9EA 1LNHA 2IA7A 1JBRA 2BMOB 1B3SA 2HMKB 1RTUA 3EN8A 3WHOA 3CC73 3CCM3 2KF3A 4EW5A 3D9RA 1QJGA 2Z76A 2ML6A 4WHAA 5EVHA 5G1LA 4HVNA 1Q42A 1MNLA 2KF5A 2HMNB 1AVKA 1BRHA 5ELUA 1PYLA 1GMPA 3O8YA 5KP3A 1AVLA 3CCQ3 1CEWI 3NXJA 3PS8A 3AGNA 3DGMA 1PY3A 1I0VA 2E2VA 2LYXA 4IPBA 4LEHA 4XB5A 1KD14 1NWWA 3CXC2 1VQN3 1A90A 1EUIC 2YX9A 4N6NB 1YJ93 1SIHA 2HOHA 1GY6A 1RDSA 1SARA 4JF8A 2JQ5A 1T5YA 5JPPA 3BB9A 1K9M4 5BXQA 3TDGA 1OHOA 2KF4A 1UUVB 3N8BA 1VQP3 1JN5A 3HX8A 4BTXA 2GU3A 1JB2A 3UL5A 3F9SA 3K5TA 2QGUA 3SX1A 3WA2X 3EE1A 3MHEA 5AI1A 1M904 1SQWA 3DGYA 3I0YA 1GSPA 5A0OB 3WA3A 1D6YA 3H51A 1RGLA 4ZM8A 5AEWB 4EC6A 2D1WA 2C4BA 4HM0B 1IQXA 4N6UA 1V57A 1VQ43 1ULJB 3IJEB 3K7CA 4HKVB 1IQYA 2Q07A 1IK3A 1KC84 3FG3A 3NQZA 2CFWA 2I9WA 3MG1A 3HIGA 3VF1A 1MWRA 3K9MC 1LRAA 1YJW3 1Q40A 1QMAA 1LOVA 1TRQA 3AMOA 4GSPA 5G1KA 4HOHA 3T0UA 8RNTA 1SJWA 1BOXA 1VQ73 1GD3A 1M9GA 3AGOA 4XBYA 1I8VA 5KP4A 3D5IA 3HK4A 4G1MB 3CCE3 3X41A 1Q824 3CCJ3 2LQVA 1GMRA 2R4IA 3NX0A 1C7HA 2AAEA 4LYLB 4XDWA 5IEPA 1E97A 4K1UA 1IV9A 5AYRB 1R4CA 1T3BA 1VQO3 1IDPA 1B21A 1O7WB 3GZBA 2GBWB 1A2PA 2INXA 1RHLA 3NHXA 1Z1SA 1RSNA 2OWPA 1B2MA 1FA3A 1JKGB 1CYUA 1PFPA 3EQQB 1I2GA 1GD4A 1T2HA 5BIRA 1JBTA 1Q864 4FMDA 1M1K4 1I0XA 1OHPA 2OQEA 3N54B 2F5WA 2ZHXB 3KN4A 3DH2A 1JB5A 5CF2A 3NBJA 2W04A 1O7NB 3JUOA 3CME3 1KWIA 2FXTA 1BANA 1I2EA 2XGNA 3CCL3 1G02A 1FGRA 2OCTA 1Q7HA 2XH9A 5D81A 3MKIA 1HKXA 2W0QA 1UUWB 1LOWA 1RRHA 3LTDA 4HM1B 3CPW2 3ECFA 3D79A 4I4KA 1OHSA 3CNXA 3KE7A 3LT8A 2F4YA 3DUKA 4H61A 3LYGA 1KSIA 5IENA 4HM7B 2YFJB 2SARA 4OVMA 1CQSA 1WNHA 1CYVA 2F99A 2XRXB 4L7KA 2BHMA 1RJOA 3LTAA 9RNTA 3CPOA 3NV0B 4I5QA 4N6TA 1N9JA 3LTCA 4GL6A 2P0MA 1RGHA 3DXOA 5LC7A 3EX9A 1YVSA 2CIUA 4K1VA 1W6YA 4R9KA 1OCVA 2CWUA 4KFDA 1BAOA 4NPBA 1STFI 2Z77A 1GS3A 4RZMA 1M1XB 2MC8A 1DYUA 1YNVX 4CPKA 3CC23 3CC43 1FGOA 1QVF2 2GEYA 2Z7AA 2WGQA 2ZL8A 1RGKA 2W9QA 2P0XA 1BNSA 3OWYA 3AHSA 5CXOA 5IERA 2XF3A 3FLJA 2AADA 1JZOA 5AIIA 4FMCA 3RGAA 3HIIA 1BVIA 2E2UA 3ROBA 3PCSA 3LZAA 1SIIA 1JN5B 1AQZA 5AIGA 4KT3B 3PXMA 3M8CA 3B7CA 3WODG 4N6OB 3IPTA 3K63A 1OF5A 1RGEA 2KF6A 3JUMA 1DMMA 4MMXB 3KCHA 1UDII 3SOYA 4KZ1A 3MPHA 4MMZB 1BRKA 4U13A 5AIHA 1BRNL 2K3DA 3PYJA 1TU5A 3AHWA 4RNZA 3DMCA 4BTWA 1GMQA 1VQ53 3CU3A 1OH0A 4IIAA 4BU4A 4XDVA 2O3OA 1B27A 2UX0A 1VZZA 3BNDA 5LC6A 3LMLA 1W00A 1X1WA 2CWTA 2HMLB 3FF2A 2CW9A 4FMBA 4OK0A 3S5CA 4BTYA 2L1SA 4EV5A 1Q40B 3OWSA 3RDEA 3CCR3 1FYSA 5GSPA 2YFLB 2CG0A 3DM8A 3X3ZA 1RCKA 3CMA3 1RCLA 1TUHA 3BNCA 1UCKA 5AYSC 1EQKA 1HU9A 2KXGA 1RNBA 6GSPA 2CHCA 2KRTA 3DZLA 3N9HA 2SBLA 2BIRA 1WMPA 4HAAA 4ILFA 4Q53A 5BU4A
chains in the Genus database with same CATH topology
1TTOA 8RNTA 1LOVA 1TRQA 4GSPA 4RNTA 1FUTA 4HOHA 1BUJA 1BOXA 3AGOA 1I3IA 1I8VA 2F5MA 1HYFA 1BNFA 3D5IA 1I70A 1BSAA 1UCJA 1MGWA 1GMRA 1B2SA 1ZGXA 2AAEA 3BU4A 2KAAA 1BNIA 1IYYA 1BRJA 1X1UA 1B21A 1BU4A 2GSPA 7RNTA 1BNEA 4J5KA 1LNIA 1A2PA 1BNGA 1HZ1A 1UCLA 1BNRA 1RLSA 1C54A 1B2XA 1BRSA 1RHLA 1RSNA 1B2MA 1I2GA 1T2HA 3Q3FA 5BIRA 1JBTA 1I0XA 1B20A 1RGFA 2F5WA 3DH2A 1BSCA 1RGAA 4GHOA 1BIRA 1I2FA 7GSPA 1BANA 1I2EA 1TRPA 1G02A 1DE3A 1FUSA 1FZUA 1LOWA 1X1YA 1RN4A 1RNTA 2F4YA 1JBSA 2ZA4A 2SARA 1BNJA 9RNTA 1YGWA 1X1XA 3D4AA 1B2ZA 1BRGA 1AY7A 4BIRA 1RGHA 1YVSA 1Q9EA 1JBRA 3BIRA 1B3SA 3WHOA 1RTUA 1BAOA 1RN1A 1BSBA 1RMSA 1YNVX 3SYUA 1RGGA 1RGKA 1GOVA 2KF5A 1BNSA 1LOYA 3A5EA 3AHSA 1BRHA 1R4YA 1PYLA 2AADA 1GMPA 1BVIA 3URPA 1AQZA 1GOYA 1UCIA 1BSDA 2BU4A 1MGRA 3AGNA 1PY3A 1I0VA 3HOHA 1RGEA 2KF6A 6RNTA 1GOUA 3KCHA 2HOHA 1B2UA 1RDSA 1BGSA 1SARA 1BRKA 1BRNL 2KF4A 3AHWA 5HOHA 1GMQA 4J5GA 1CH0A 4BU4A 1BSEA 1FW7A 1B27A 1DETA 3D5GA 3DGYA 1GSPA 1I3FA 2F56A 1X1WA 1RGLA 2RBIA 2C4BA 1FYSA 5GSPA 1RCKA 1RCLA 5RNTA 1T2IA 1UCKA 3GSPA 1RGCA 3RNTA 2RNTA 3WR2A 6GSPA 1RNBA 5BU4A 2BIRA 2KF3A 4HAAA 1LRAA 1BRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TTO A;  8RNT A;  1LOV A;  1TRQ A;  4GSP A;  4RNT A;  1FUT A;  4HOH A;  1BUJ A;  1BOX A;  3AGO A;  1I3I A;  1I8V A;  2F5M A;  1HYF A;  1BNF A;  3D5I A;  1I70 A;  1BSA A;  1UCJ A;  1MGW A;  1GMR A;  1B2S A;  1ZGX A;  2AAE A;  3BU4 A;  2KAA A;  1BNI A;  1IYY A;  1BRJ A;  1X1U A;  1B21 A;  1BU4 A;  2GSP A;  7RNT A;  1BNE A;  4J5K A;  1LNI A;  1A2P A;  1BNG A;  1HZ1 A;  1UCL A;  1BNR A;  1RLS A;  1C54 A;  1B2X A;  1BRS A;  1RHL A;  1RSN A;  1B2M A;  1I2G A;  1T2H A;  3Q3F A;  5BIR A;  1JBT A;  1I0X A;  1B20 A;  1RGF A;  2F5W A;  3DH2 A;  1BSC A;  1RGA A;  4GHO A;  1BIR A;  1I2F A;  7GSP A;  1BAN A;  1I2E A;  1TRP A;  1G02 A;  1DE3 A;  1FUS A;  1FZU A;  1LOW A;  1X1Y A;  1RN4 A;  1RNT A;  2F4Y A;  1JBS A;  2ZA4 A;  2SAR A;  1BNJ A;  9RNT A;  1YGW A;  1X1X A;  3D4A A;  1B2Z A;  1BRG A;  1AY7 A;  4BIR A;  1RGH A;  1YVS A;  1Q9E A;  1JBR A;  3BIR A;  1B3S A;  3WHO A;  1RTU A;  1BAO A;  1RN1 A;  1BSB A;  1RMS A;  1YNV X;  3SYU A;  1RGG A;  1RGK A;  1GOV A;  2KF5 A;  1BNS A;  1LOY A;  3A5E A;  3AHS A;  1BRH A;  1R4Y A;  1PYL A;  2AAD A;  1GMP A;  1BVI A;  3URP A;  1AQZ A;  1GOY A;  1UCI A;  1BSD A;  2BU4 A;  1MGR A;  3AGN A;  1PY3 A;  1I0V A;  3HOH A;  1RGE A;  2KF6 A;  6RNT A;  1GOU A;  3KCH A;  2HOH A;  1B2U A;  1RDS A;  1BGS A;  1SAR A;  1BRK A;  1BRN L;  2KF4 A;  3AHW A;  5HOH A;  1GMQ A;  4J5G A;  1CH0 A;  4BU4 A;  1BSE A;  1FW7 A;  1B27 A;  1DET A;  3D5G A;  3DGY A;  1GSP A;  1I3F A;  2F56 A;  1X1W A;  1RGL A;  2RBI A;  2C4B A;  1FYS A;  5GSP A;  1RCK A;  1RCL A;  5RNT A;  1T2I A;  1UCK A;  3GSP A;  1RGC A;  3RNT A;  2RNT A;  3WR2 A;  6GSP A;  1RNB A;  5BU4 A;  2BIR A;  2KF3 A;  4HAA A;  1LRA A;  1BRI A; 
#chains in the Genus database with same CATH topology
 2GBX B;  2BMQ B;  2GEX A;  2QA4 3;  1K28 A;  3T8N A;  3MG3 A;  1UI7 A;  3B4O A;  2IUJ A;  3CCU 3;  3FCS B;  4KVH A;  1BUQ A;  1B2S A;  2BNG A;  4CCV A;  1YHQ 3;  3EB8 A;  2KAA A;  1N5P A;  3LH4 A;  5ELJ A;  1BRJ A;  4H3U A;  1BU4 A;  7RNT A;  4J5K A;  1DVD A;  1NB5 I;  3ZG5 A;  1RN7 A;  4KFF A;  1RLS A;  1UGI A;  1VQ8 3;  2CG1 A;  2V1L A;  2OTJ 3;  4O8S A;  1W5Z A;  5M1A A;  1YGE A;  4WYK B;  1ROA A;  4FR9 A;  3OX9 A;  2UUG C;  1LQM B;  2H0H A;  2WOH A;  3Q3F A;  5IF6 A;  2WOF A;  3G16 A;  3UL6 A;  1RGF A;  3F7S A;  3NQY A;  2H0G A;  3G0K A;  1RGA A;  4GHO A;  2CC3 A;  1O7P B;  1IT7 A;  4FCM A;  5AEU B;  5IEO A;  1LXE A;  5CF1 A;  1F8N A;  4R80 A;  1FUS A;  1FZU A;  5EQL A;  1RRL A;  2CFK A;  4EXR A;  1O7G B;  2D42 A;  1UW1 A;  4HM4 B;  4ORL A;  3G6E 3;  4HYZ A;  1JZD A;  4HJL B;  3A76 A;  3LOY A;  1RNT A;  2STD A;  4XM4 A;  4N6V 0;  2ZA4 A;  3KZT A;  1BNJ A;  3DY5 A;  3PCR A;  2PZV A;  4X2O A;  1GY5 A;  3ZG0 A;  1YGW A;  2Y73 A;  1X1X A;  4WP5 A;  1VQM 3;  1YI2 3;  4HM6 B;  3EBY A;  3MYT A;  3F7X A;  4K90 B;  1BRG A;  4XBT A;  1AY7 A;  2M7O A;  1PU4 A;  1FGM A;  3IMA B;  3SLU A;  1VQL 3;  2W03 A;  5G2G A;  1ROV A;  2CFG A;  3X3Y A;  2C10 A;  1S5A A;  2P05 A;  4N3V A;  4CJN A;  4J8T A;  3FF0 A;  3K0Z A;  1ZO2 A;  3SYU A;  1TIJ A;  4O02 B;  1UGH I;  1W2Z A;  3FSD A;  4WWU C;  3FKA A;  2PNC A;  3UB1 A;  3X3X A;  2XSH B;  1MWS A;  3A5E A;  1R4Y A;  2OOV A;  3WOE B;  1OGX A;  1S72 3;  3OW2 2;  4GB5 A;  3U1W A;  1STD A;  2K0M A;  3FH1 A;  3MSO A;  3QK9 A;  1BSD A;  2BU4 A;  5I97 A;  1MGR A;  3FZW A;  3HOH A;  3SXX A;  4X2H A;  2XFS A;  2GU1 A;  2ML5 A;  4XBX A;  1V58 A;  5IG0 A;  2CFL A;  2R41 A;  1BGS A;  2ZDJ A;  1G96 A;  3NUV A;  1L5G B;  3ZFZ A;  5IG3 A;  3SED A;  5IG5 A;  5D83 A;  1UI8 A;  4J5G A;  3GRD A;  2W6J H;  3JUN A;  1FW7 A;  1NB3 I;  3DGO A;  2MF7 A;  3JVC A;  2W56 A;  2F56 A;  2B1X B;  3G8Z A;  4R9L A;  4RNY A;  1O7M B;  1NDO B;  3UNL A;  2IYJ A;  5RNT A;  1T2I A;  1K41 A;  2QIY A;  1W4N A;  1ULI B;  1RGC A;  3RNT A;  3CCS 3;  1QAF A;  1EKM A;  1OUN A;  4N6L A;  3WR2 A;  1IVX A;  2BMR B;  4K61 A;  4EBG A;  1TFK A;  1BRI A;  1TP6 A;  4HM3 B;  3KII A;  1FUT A;  1Y4K A;  1E3V A;  1I3I A;  2CWV A;  4FCZ A;  2F5M A;  1YIJ 3;  2OQE C;  4AKZ A;  1IVU A;  1HYF A;  1JKG A;  1I70 A;  1G0T A;  1US1 A;  2BO9 B;  1LQG C;  1A2K A;  1ZGX A;  1GYB A;  3ALA A;  3NBR A;  3JUP A;  1IYY A;  3V92 A;  1VQ6 3;  1NJI 4;  2GSP A;  1J2B A;  3AMO B;  3HI7 A;  3KKG A;  1HZ1 A;  1UCL A;  3JUQ A;  4EV2 A;  1C54 A;  1B2X A;  1BRS A;  5JPU A;  2OOV C;  5TGN A;  3EJV A;  4FCJ A;  1FGT A;  5EEO A;  1JB4 A;  2HMJ B;  3I55 3;  2GXF A;  3KSP A;  3PZW A;  3UJM A;  2P38 A;  2XEP A;  1IU7 A;  1B20 A;  3LXU X;  3J7Y d;  2HMO B;  2Y74 A;  1D6U A;  1ZX2 A;  4J9A A;  1BSC A;  3OXA A;  1EG9 B;  1BIR A;  3H3H A;  1I2F A;  7GSP A;  1LOX A;  1OGZ A;  1W02 A;  3EHC A;  1TRP A;  3NV0 A;  3FG1 A;  5CLK A;  1WQL B;  3QRD A;  1DE3 A;  3NBB A;  1EA2 A;  1JJ2 2;  1GY7 A;  2KCD A;  1DMQ A;  5STD A;  2RFR A;  4R4K A;  4HM2 B;  1JBS A;  4HM5 B;  1N5H A;  3LT9 A;  4HM8 B;  1OPY A;  3GAX A;  3L0R A;  1ZS7 A;  3FG4 A;  2RCD A;  1IQ8 A;  3F40 A;  5HGR A;  1VQK 3;  4WFO A;  1WTH A;  1KQS 2;  1JNQ A;  3Q2P A;  3S29 A;  2IMJ A;  1VQ9 3;  2CX1 A;  4O3V A;  3BIR A;  1E3R A;  3SVA A;  3VGN A;  1DMN A;  1RN1 A;  8CHO A;  1MWU A;  5IG4 A;  1BSB A;  1RMS A;  3CD6 3;  5FGO A;  3NM7 A;  3S27 A;  1UUG B;  2CX0 A;  1RGG A;  3OV4 A;  2RGQ A;  2HMM B;  2CK3 H;  1GOV A;  2FGT A;  1NNV A;  1VQQ A;  1LOY A;  3ER7 A;  3VSY A;  3OWU A;  3CNM A;  2CKF B;  2K54 A;  3URP A;  5AIF A;  5M19 A;  3FGY A;  4MMY B;  5IW9 A;  3KSE D;  5DRE A;  1GOY A;  1UCI A;  3KFQ C;  3G71 3;  3GZY B;  3HZP A;  1W6C A;  4IT7 A;  1N8Q A;  2IY2 A;  1WMN A;  4O2H A;  3SOA A;  4DKI A;  1A67 A;  1YIT 3;  4HBR A;  1RKY A;  2FNQ A;  5D82 A;  2W56 B;  6RNT A;  1GOU A;  2YFI B;  1Q81 4;  4TX4 A;  1B2U A;  3Q90 A;  7STD A;  1TJD A;  3MG2 A;  3F14 A;  3WDG B;  3F8X A;  4LZI A;  1O7H B;  3T8U A;  5HOH A;  3GZX B;  4OUQ A;  1CH0 A;  1QAL A;  1K8A 4;  3F8H A;  2WO0 A;  1BSE A;  3CCV 3;  1DET A;  2QEX 3;  3D5G A;  1OF5 B;  3Q1C A;  1I3F A;  4LSO A;  4N6M A;  2RBI A;  2XSO B;  3DGL A;  4LMI A;  1JRQ A;  4LGQ A;  3RGR A;  1YVB I;  1DVC A;  4PEJ A;  1EEJ A;  4CDL A;  1SPU A;  3BNB A;  1FGQ A;  2H0I A;  3V98 A;  2RSX A;  3BNE A;  2CH9 A;  3GSP A;  1NU3 A;  1ASK A;  2RNT A;  3NM2 A;  1MOL A;  3LTB A;  1OAC A;  4NHF A;  1IVV A;  3EBT A;  3D3L A;  1TTO A;  1AV4 A;  1IVW A;  5KP1 A;  4RNT A;  3STD A;  5FW5 A;  2BT3 A;  1WMO A;  4AKY A;  1W7C A;  1BNF A;  5M18 A;  1BSA A;  1IT8 A;  1UCJ A;  5JBS A;  4WYK A;  1MGW A;  1JV2 B;  3V99 A;  4QWT A;  3BU4 A;  3WMD A;  1BNI A;  2XR8 B;  4BL2 A;  1YJN 3;  1X1U A;  1N8R 4;  3G4S 3;  4JRF A;  3X42 A;  1LVN A;  1BNE A;  1ISK A;  1LNI A;  2C11 A;  4KFE A;  1BNG A;  1BNR A;  3GWR A;  2L4V A;  3PGB A;  4MJD A;  2Z6B A;  2OTL 3;  4HZB B;  5BVB A;  3EC9 A;  2XGL A;  2CFD A;  4RBN A;  3X40 A;  2A15 A;  2B24 B;  4HZ9 B;  4AEQ A;  1QVG 2;  3BLZ A;  1QAK A;  4BL3 A;  1U5O A;  2WGO A;  3EN1 B;  3DGN A;  2IUK A;  3B8L A;  5DRV A;  1U8C B;  1FUW A;  3EF8 A;  3WOF B;  4L8P A;  1Q7Y 4;  1W2B 2;  3B4P A;  3GZR A;  4STD A;  4FMA A;  2E2T A;  2P09 A;  6STD A;  1X1Y A;  3U97 A;  1K73 4;  1MWT A;  1NO3 A;  2W9P A;  2XFT A;  4L8O A;  2F98 A;  3S67 A;  1RN4 A;  1V74 A;  2O9U X;  2W2C A;  4R1K A;  1N9E A;  4MEI A;  3MWZ A;  4EYC A;  2F86 B;  1W6G A;  1D6Z A;  3D4A A;  2J8X B;  1BUJ A;  1A2V A;  1B2Z A;  1TFO A;  3E99 A;  5CK6 A;  1W01 A;  4BIR A;  2UGI A;  1IV7 A;  1AR0 A;  4NRE A;  3I56 3;  2JDI H;  3S28 A;  1Q9E A;  1LNH A;  2IA7 A;  1JBR A;  2BMO B;  1B3S A;  2HMK B;  1RTU A;  3EN8 A;  3WHO A;  3CC7 3;  3CCM 3;  2KF3 A;  4EW5 A;  3D9R A;  1QJG A;  2Z76 A;  2ML6 A;  4WHA A;  5EVH A;  5G1L A;  4HVN A;  1Q42 A;  1MNL A;  2KF5 A;  2HMN B;  1AVK A;  1BRH A;  5ELU A;  1PYL A;  1GMP A;  3O8Y A;  5KP3 A;  1AVL A;  3CCQ 3;  1CEW I;  3NXJ A;  3PS8 A;  3AGN A;  3DGM A;  1PY3 A;  1I0V A;  2E2V A;  2LYX A;  4IPB A;  4LEH A;  4XB5 A;  1KD1 4;  1NWW A;  3CXC 2;  1VQN 3;  1A90 A;  1EUI C;  2YX9 A;  4N6N B;  1YJ9 3;  1SIH A;  2HOH A;  1GY6 A;  1RDS A;  1SAR A;  4JF8 A;  2JQ5 A;  1T5Y A;  5JPP A;  3BB9 A;  1K9M 4;  5BXQ A;  3TDG A;  1OHO A;  2KF4 A;  1UUV B;  3N8B A;  1VQP 3;  1JN5 A;  3HX8 A;  4BTX A;  2GU3 A;  1JB2 A;  3UL5 A;  3F9S A;  3K5T A;  2QGU A;  3SX1 A;  3WA2 X;  3EE1 A;  3MHE A;  5AI1 A;  1M90 4;  1SQW A;  3DGY A;  3I0Y A;  1GSP A;  5A0O B;  3WA3 A;  1D6Y A;  3H51 A;  1RGL A;  4ZM8 A;  5AEW B;  4EC6 A;  2D1W A;  2C4B A;  4HM0 B;  1IQX A;  4N6U A;  1V57 A;  1VQ4 3;  1ULJ B;  3IJE B;  3K7C A;  4HKV B;  1IQY A;  2Q07 A;  1IK3 A;  1KC8 4;  3FG3 A;  3NQZ A;  2CFW A;  2I9W A;  3MG1 A;  3HIG A;  3VF1 A;  1MWR A;  3K9M C;  1LRA A;  1YJW 3;  1Q40 A;  1QMA A;  1LOV A;  1TRQ A;  3AMO A;  4GSP A;  5G1K A;  4HOH A;  3T0U A;  8RNT A;  1SJW A;  1BOX A;  1VQ7 3;  1GD3 A;  1M9G A;  3AGO A;  4XBY A;  1I8V A;  5KP4 A;  3D5I A;  3HK4 A;  4G1M B;  3CCE 3;  3X41 A;  1Q82 4;  3CCJ 3;  2LQV A;  1GMR A;  2R4I A;  3NX0 A;  1C7H A;  2AAE A;  4LYL B;  4XDW A;  5IEP A;  1E97 A;  4K1U A;  1IV9 A;  5AYR B;  1R4C A;  1T3B A;  1VQO 3;  1IDP A;  1B21 A;  1O7W B;  3GZB A;  2GBW B;  1A2P A;  2INX A;  1RHL A;  3NHX A;  1Z1S A;  1RSN A;  2OWP A;  1B2M A;  1FA3 A;  1JKG B;  1CYU A;  1PFP A;  3EQQ B;  1I2G A;  1GD4 A;  1T2H A;  5BIR A;  1JBT A;  1Q86 4;  4FMD A;  1M1K 4;  1I0X A;  1OHP A;  2OQE A;  3N54 B;  2F5W A;  2ZHX B;  3KN4 A;  3DH2 A;  1JB5 A;  5CF2 A;  3NBJ A;  2W04 A;  1O7N B;  3JUO A;  3CME 3;  1KWI A;  2FXT A;  1BAN A;  1I2E A;  2XGN A;  3CCL 3;  1G02 A;  1FGR A;  2OCT A;  1Q7H A;  2XH9 A;  5D81 A;  3MKI A;  1HKX A;  2W0Q A;  1UUW B;  1LOW A;  1RRH A;  3LTD A;  4HM1 B;  3CPW 2;  3ECF A;  3D79 A;  4I4K A;  1OHS A;  3CNX A;  3KE7 A;  3LT8 A;  2F4Y A;  3DUK A;  4H61 A;  3LYG A;  1KSI A;  5IEN A;  4HM7 B;  2YFJ B;  2SAR A;  4OVM A;  1CQS A;  1WNH A;  1CYV A;  2F99 A;  2XRX B;  4L7K A;  2BHM A;  1RJO A;  3LTA A;  9RNT A;  3CPO A;  3NV0 B;  4I5Q A;  4N6T A;  1N9J A;  3LTC A;  4GL6 A;  2P0M A;  1RGH A;  3DXO A;  5LC7 A;  3EX9 A;  1YVS A;  2CIU A;  4K1V A;  1W6Y A;  4R9K A;  1OCV A;  2CWU A;  4KFD A;  1BAO A;  4NPB A;  1STF I;  2Z77 A;  1GS3 A;  4RZM A;  1M1X B;  2MC8 A;  1DYU A;  1YNV X;  4CPK A;  3CC2 3;  3CC4 3;  1FGO A;  1QVF 2;  2GEY A;  2Z7A A;  2WGQ A;  2ZL8 A;  1RGK A;  2W9Q A;  2P0X A;  1BNS A;  3OWY A;  3AHS A;  5CXO A;  5IER A;  2XF3 A;  3FLJ A;  2AAD A;  1JZO A;  5AII A;  4FMC A;  3RGA A;  3HII A;  1BVI A;  2E2U A;  3ROB A;  3PCS A;  3LZA A;  1SII A;  1JN5 B;  1AQZ A;  5AIG A;  4KT3 B;  3PXM A;  3M8C A;  3B7C A;  3WOD G;  4N6O B;  3IPT A;  3K63 A;  1OF5 A;  1RGE A;  2KF6 A;  3JUM A;  1DMM A;  4MMX B;  3KCH A;  1UDI I;  3SOY A;  4KZ1 A;  3MPH A;  4MMZ B;  1BRK A;  4U13 A;  5AIH A;  1BRN L;  2K3D A;  3PYJ A;  1TU5 A;  3AHW A;  4RNZ A;  3DMC A;  4BTW A;  1GMQ A;  1VQ5 3;  3CU3 A;  1OH0 A;  4IIA A;  4BU4 A;  4XDV A;  2O3O A;  1B27 A;  2UX0 A;  1VZZ A;  3BND A;  5LC6 A;  3LML A;  1W00 A;  1X1W A;  2CWT A;  2HML B;  3FF2 A;  2CW9 A;  4FMB A;  4OK0 A;  3S5C A;  4BTY A;  2L1S A;  4EV5 A;  1Q40 B;  3OWS A;  3RDE A;  3CCR 3;  1FYS A;  5GSP A;  2YFL B;  2CG0 A;  3DM8 A;  3X3Z A;  1RCK A;  3CMA 3;  1RCL A;  1TUH A;  3BNC A;  1UCK A;  5AYS C;  1EQK A;  1HU9 A;  2KXG A;  1RNB A;  6GSP A;  2CHC A;  2KRT A;  3DZL A;  3N9H A;  2SBL A;  2BIR A;  1WMP A;  4HAA A;  4ILF A;  4Q53 A;  5BU4 A; 
#chains in the Genus database with same CATH homology
 1TTO A;  8RNT A;  1LOV A;  1TRQ A;  4GSP A;  4RNT A;  1FUT A;  4HOH A;  1BUJ A;  1BOX A;  3AGO A;  1I3I A;  1I8V A;  2F5M A;  1HYF A;  1BNF A;  3D5I A;  1I70 A;  1BSA A;  1UCJ A;  1MGW A;  1GMR A;  1B2S A;  1ZGX A;  2AAE A;  3BU4 A;  2KAA A;  1BNI A;  1IYY A;  1BRJ A;  1X1U A;  1B21 A;  1BU4 A;  2GSP A;  7RNT A;  1BNE A;  4J5K A;  1LNI A;  1A2P A;  1BNG A;  1HZ1 A;  1UCL A;  1BNR A;  1RLS A;  1C54 A;  1B2X A;  1BRS A;  1RHL A;  1RSN A;  1B2M A;  1I2G A;  1T2H A;  3Q3F A;  5BIR A;  1JBT A;  1I0X A;  1B20 A;  1RGF A;  2F5W A;  3DH2 A;  1BSC A;  1RGA A;  4GHO A;  1BIR A;  1I2F A;  7GSP A;  1BAN A;  1I2E A;  1TRP A;  1G02 A;  1DE3 A;  1FUS A;  1FZU A;  1LOW A;  1X1Y A;  1RN4 A;  1RNT A;  2F4Y A;  1JBS A;  2ZA4 A;  2SAR A;  1BNJ A;  9RNT A;  1YGW A;  1X1X A;  3D4A A;  1B2Z A;  1BRG A;  1AY7 A;  4BIR A;  1RGH A;  1YVS A;  1Q9E A;  1JBR A;  3BIR A;  1B3S A;  3WHO A;  1RTU A;  1BAO A;  1RN1 A;  1BSB A;  1RMS A;  1YNV X;  3SYU A;  1RGG A;  1RGK A;  1GOV A;  2KF5 A;  1BNS A;  1LOY A;  3A5E A;  3AHS A;  1BRH A;  1R4Y A;  1PYL A;  2AAD A;  1GMP A;  1BVI A;  3URP A;  1AQZ A;  1GOY A;  1UCI A;  1BSD A;  2BU4 A;  1MGR A;  3AGN A;  1PY3 A;  1I0V A;  3HOH A;  1RGE A;  2KF6 A;  6RNT A;  1GOU A;  3KCH A;  2HOH A;  1B2U A;  1RDS A;  1BGS A;  1SAR A;  1BRK A;  1BRN L;  2KF4 A;  3AHW A;  5HOH A;  1GMQ A;  4J5G A;  1CH0 A;  4BU4 A;  1BSE A;  1FW7 A;  1B27 A;  1DET A;  3D5G A;  3DGY A;  1GSP A;  1I3F A;  2F56 A;  1X1W A;  1RGL A;  2RBI A;  2C4B A;  1FYS A;  5GSP A;  1RCK A;  1RCL A;  5RNT A;  1T2I A;  1UCK A;  3GSP A;  1RGC A;  3RNT A;  2RNT A;  3WR2 A;  6GSP A;  1RNB A;  5BU4 A;  2BIR A;  2KF3 A;  4HAA A;  1LRA A;  1BRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...