2RNTA

Three-dimensional structure of ribonuclease t1 complexed with guanylyl-2(prime),5(prime)-guanosine at 1.8 angstroms resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title Three-dimensional structure of ribonuclease T1 complexed with guanylyl-2',5'-guanosine at 1.8 A resolution.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1988-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2rntA00
1MGWA 1RMSA 1T2HA 1BU4A 6GSPA 2KF5A 1BNEA 1RGGA 1UCIA 3Q3FA 1LOWA 1GOVA 1JBRA 1IYYA 1JBTA 2BU4A 4GHOA 1HZ1A 7GSPA 1MGRA 2AAEA 1B2SA 2RBIA 1B2ZA 1BRKA 1PY3A 1BRNL 1BNJA 1LOVA 1PYLA 2F5WA 2GSPA 1R4YA 4BIRA 1RDSA 2F56A 1BVIA 4GSPA 9RNTA 1UCKA 1I70A 1RCKA 1X1UA 1RN4A 3DH2A 1BANA 2AADA 1JBSA 1I3FA 1TRQA 1BRJA 1BSCA 1DE3A 1BIRA 1X1XA 1YNVX 1RNBA 2KF3A 1RGCA 7RNTA 1BOXA 1RSNA 1RGLA 1I8VA 1LRAA 4BU4A 1BRGA 1FW7A 1RHLA 1X1WA 2HOHA 1A2PA 1I2FA 1GMRA 2KF4A 3BIRA 5GSPA 1BRIA 1I2GA 2F4YA 1ZGXA 1RCLA 2ZA4A 3AGOA 1BSAA 1CH0A 1FUSA 1YVSA 1GOUA 1B21A 1B27A 1SARA 3AHSA 5BIRA 5RNTA 1RN1A 1DETA 1TTOA 1UCLA 2F5MA 1B2MA 1BNRA 1B20A 3DGYA 3RNTA 3AGNA 1T2IA 1BRSA 1BSDA 1RGHA 1I0VA 8RNTA 1RGAA 1G02A 1BGSA 1RGFA 2C4BA 2SARA 1BUJA 1LOYA 1FZUA 4HOHA 3HOHA 6RNTA 1FYSA 1BNIA 2KF6A 2RNTA 4J5GA 1Q9EA 1BNFA 1I3IA 1I0XA 1FUTA 1AY7A 1GMPA 1RGEA 3BU4A 1BAOA 1AQZA 1C54A 3SYUA 4J5KA 1TRPA 5HOHA 1X1YA 1RNTA 1HYFA 3WHOA 3AHWA 1BRHA 1GSPA 5BU4A 1UCJA 1B2UA 1GOYA 1BNGA 3D5GA 3KCHA 1RLSA 1RTUA 1YGWA 2KAAA 1BSBA 3WR2A 1LNIA 1B2XA 3D4AA 1RGKA 1I2EA 3GSPA 3URPA 2BIRA 3A5EA 4HAAA 4RNTA 1BSEA 3D5IA 1B3SA 1GMQA 1BNSA
chains in the Genus database with same CATH superfamily
3B4OA 4DKIA 1AV4A 1QVF2 1O7GB 2W0QA 3IJEB 4J8TA 1T5YA 1GY7A 2L4VA 3OWYA 2I9WA 4N6OB 4OUQA 4RNYA 3TDGA 2IYJA 1OHOA 2FGTA 3O8YA 3K0ZA 4HM5B 4PEJA 1A90A 1JBTA 2HMJB 1DVDA 1HZ1A 3EF8A 7GSPA 1MGRA 3F8XA 5KP3A 3ZG5A 1SPUA 2XH9A 2RCDA 2CHCA 4EW5A 1Q7Y4 1CYUA 1IQYA 1WMPA 3PXMA 1V58A 4J9AA 1UUVB 1NO3A 3L0RA 1LOVA 1M1XB 2P09A 2RFRA 2YX9A 4HJLB 5TGNA 5IG3A 1M904 3ZG0A 4N3VA 3OWSA 4CPKA 1IDPA 1RN4A 3PCRA 1BANA 1BRJA 4WYKB 1EKMA 1W6CA 3B8LA 2A15A 4RZMA 4KFDA 1VQ53 1RGLA 1I8VA 1JZDA 2E2VA 1LRAA 2W6JH 2R4IA 3F14A 2WGQA 5IG4A 1SQWA 3UNLA 1EA2A 1W01A 2BNGA 3Q1CA 3CPW2 5AIGA 4HZ9B 5DREA 7STDA 1CQSA 1BRIA 1LQGC 5M1AA 6STDA 1I2GA 1WNHA 3CCJ3 2OQEC 5LC6A 3STDA 3KE7A 1VQO3 1TFOA 1UUWB 1JB5A 1GD3A 2B24B 2ZA4A 5AEWB 3JUQA 1YJN3 1BSAA 4I4KA 1MNLA 5IEPA 1KSIA 4H61A 3CCM3 5JBSA 4NREA 2W9PA 1VQN3 5RNTA 3NUVA 4NHFA 5BVBA 1RN1A 1TTOA 2M7OA 2Q07A 5M18A 1B2MA 3DGYA 1UGHI 2KRTA 3AGNA 3Q90A 3T8UA 2FNQA 3X41A 2OCTA 1KWIA 3PYJA 1OGZA 5KP4A 3NQZA 1RGAA 2W04A 1E3RA 3HIGA 3N8BA 2BMRB 4FMDA 1AVKA 3NM2A 2C4BA 3SEDA 5IW9A 2F86B 1GY6A 3KIIA 1ULJB 1BNIA 2OTL3 1STDA 2Y74A 3NM7A 1EEJA 3WA3A 2XRXB 4J5GA 2ZDJA 4BL3A 4FCZA 2F99A 4QWTA 2ZHXB 3MHEA 1GMPA 3T8NA 1YJW3 4G1MB 3B4PA 3S5CA 2UX0A 2Z77A 3SXXA 3WMDA 5IEOA 5BU4A 1B2UA 3D79A 2LYXA 3F9SA 4HYZA 3FG3A 2H0IA 2KAAA 1Q824 1FUWA 1O7NB 4KZ1A 3EN8A 3D9RA 3D4AA 1HU9A 4O2HA 3URPA 2BIRA 3ECFA 4O3VA 3MSOA 2QA43 3FGYA 2BMQB 3DY5A 4LSOA 3FCSB 1FGMA 2HMOB 3DGNA 1DMNA 1B3SA 4X2HA 2XEPA 1GMQA 3GRDA 2XFSA 1US1A 5D82A 4MMXB 1RMSA 4N6V0 1BU4A 1QALA 1BNEA 1RGGA 2KF5A 1UCIA 3KFQC 2WO0A 2BT3A 1JBRA 2GBXB 3HIIA 3MPHA 2BU4A 3FZWA 4KFFA 3LYGA 4RNZA 3A76A 1IV7A 1IT7A 5AI1A 1S723 2GXFA 1JJ22 2YFIB 3SOAA 1BRKA 2MF7A 3FF0A 1PY3A 3H51A 4OK0A 3ER7A 1MOLA 1PYLA 2F5WA 2GSPA 3LT8A 1YVBI 4BIRA 4EBGA 1SJWA 2OWPA 1NJI4 5FW5A 9RNTA 3EQQB 4KFEA 1RCKA 1ROAA 1X1UA 3CC23 4AKYA 3CXC2 1NWWA 2AADA 1BSCA 1SIIA 3DMCA 4LGQA 5CLKA 2C11A 3H3HA 4MJDA 3DGOA 3I0YA 2RGQA 3G713 4R1KA 1A2VA 1TUHA 7RNTA 4R9KA 2CIUA 1J2BA 1F8NA 1WQLB 4XDWA 1JKGA 2V1LA 3B7CA 1W7CA 1V74A 4U13A 4O02B 5DRVA 4IPBA 1RHLA 1OF5A 2LQVA 1X1WA 3BNDA 5LC7A 3S27A 3S29A 1KC84 1Q814 3VF1A 1MWSA 2K0MA 4XBYA 5M19A 1GMRA 1ROVA 2PNCA 2JQ5A 2CWUA 5AIIA 2CFGA 1LQMB 5BXQA 3EHCA 3KSED 1ISKA 3AGOA 2O9UX 1CYVA 1T3BA 2PZVA 1O7HB 3CC43 3V98A 1C7HA 1YGEA 1FUSA 2CX0A 4R9LA 3WDGB 4O8SA 3CCE3 1B27A 1SARA 3GAXA 4STDA 4HZBB 3S67A 1R4CA 1WMNA 3M8CA 3CCQ3 3NV0B 1DETA 4IT7A 1RJOA 1BNRA 1B20A 4HM0B 1T2IA 1BRSA 4LYLB 3G4S3 4HKVB 1I0VA 3F40A 3IPTA 8RNTA 1GD4A 5D81A 2C10A 4EC6A 2WGOA 1A67A 4XBXA 2GU1A 1G02A 1BGSA 1TJDA 3LMLA 2XF3A 2CW9A 4R80A 2STDA 5CXOA 4RBNA 3AMOB 5IG0A 1LOYA 1W6YA 1FZUA 1FGRA 3K9MC 3WOFB 3MG3A 4BL2A 2GBWB 3OV4A 1QMAA 2K54A 4K61A 1TU5A 1HKXA 3N9HA 1NB5I 5HGRA 3JVCA 2BHMA 3RGAA 1Q9EA 4GB5A 3KKGA 1TFKA 2W2CA 1FUTA 3EE1A 3SOYA 3BU4A 2JDIH 3FG4A 3PZWA 1C54A 4J5KA 5CK6A 3I563 5HOHA 5A0OB 4WFOA 3SX1A 1RKYA 3J7Yd 3KSPA 3CNXA 1HYFA 3QK9A 3AHWA 1Q40A 1U8CB 2W9QA 1GSPA 2GU3A 3D5GA 3X42A 3GZBA 1M1K4 1RLSA 1RTUA 4HM4B 1YGWA 3MG2A 3DM8A 5G2GA 1YI23 1DYUA 1RRLA 4XB5A 1K8A4 1LNIA 1B2XA 3GZYB 3CD63 3LXUX 1D6UA 1ZO2A 1FA3A 5JPPA 1RGKA 1PU4A 1I2EA 4CCVA 3CCU3 3A5EA 1W00A 1NDOB 4HAAA 4RNTA 3KN4A 1BSEA 3BNBA 1K734 3JUMA 3VGNA 2IUKA 1BNSA 3V92A 3WA2X 2XSOB 4ORLA 2WOFA 4HVNA 3DGMA 1T2HA 1YJ93 6GSPA 1JZOA 3NBBA 1VQ63 3CCS3 1GOVA 1UDII 4FR9A 3UL6A 1IYYA 3HZPA 3N54B 1D6ZA 1UUGB 1K41A 4K1UA 4EXRA 1W2ZA 4N6TA 2E2UA 2AAEA 5IENA 1B2SA 1QJGA 4OVMA 1B2ZA 1LOXA 3X3ZA 3CU3A 4JRFA 4MMZB 1VQ83 5EEOA 1BRNL 4KT3B 1VQQA 1KD14 1STFI 1PFPA 1R4YA 4N6LA 1RDSA 2F56A 2F98A 1VQ93 1JB2A 3G0KA 2WOHA 1UCKA 1IQXA 1VQK3 1I70A 1W4NA 5CF1A 2R41A 3S28A 3DH2A 5G1KA 1GS3A 1I3FA 4CJNA 2YFJB 1IK3A 2CH9A 1YNVX 4GL6A 1YIJ3 1IVWA 1Q40B 3SLUA 4HM7B 2KF3A 3PS8A 4H3UA 1QAFA 1RGCA 4IIAA 4WHAA 1BOXA 1RSNA 1ZS7A 4EV5A 2GEXA 4BU4A 4I5QA 2GEYA 4L7KA 1FW7A 1MWTA 1I2FA 2OOVC 1Q7HA 4MMYB 4X2OA 2XFTA 3ZFZA 1N5HA 2KF4A 5GSPA 2IMJA 1BUQA 1UI7A 2RSXA 2F4YA 1ZGXA 3PCSA 3NQYA 4N6NB 1VZZA 1IVVA 4EV2A 4HM3B 3CC73 1E3VA 3PGBA 2O3OA 5EQLA 3CPOA 5IF6A 1CH0A 3EJVA 1OPYA 2L1SA 3NXJA 4HM1B 1DMQA 1GOUA 3OW22 5BIRA 2K3DA 3X3YA 1EG9B 3RDEA 2D1WA 2HMMB 1TIJA 3BNCA 2XSHB 3EX9A 3RNTA 1BSDA 3LZAA 1RGHA 2CFWA 2D42A 3ALAA 3CCR3 3G16A 2P05A 3MKIA 1W6GA 2MC8A 3OWUA 2QGUA 2UUGC 1AR0A 1JNQA 4WP5A 1BUJA 1QAKA 3FSDA 4HOHA 6RNTA 3Q2PA 1FYSA 3GZRA 2KXGA 1M9GA 2RNTA 3V99A 2E2TA 1VQL3 1VQP3 2J8XB 3LTBA 1I3IA 2KCDA 4HBRA 2OQEA 1OUNA 3EBTA 3K5TA 1NU3A 3MYTA 2CK3H 2P38A 1Q42A 3SYUA 1TRPA 3OX9A 3MWZA 2Z6BA 2P0XA 2QIYA 1X1YA 3DZLA 1RNTA 1N8R4 1G0TA 1FGOA 1BRHA 1AVLA 1DMMA 2CX1A 1G96A 1UCJA 2IA7A 1BNGA 2UGIA 4FMCA 2B1XB 1BSBA 3WR2A 4AEQA 4MEIA 5G1LA 3LT9A 3K63A 1VQ43 5ELJA 2CFDA 2IY2A 1UGIA 1V57A 3GSPA 1LXEA 2CG1A 2CWTA 2W56A 3EB8A 4N6MA 3I553 3UB1A 4NPBA 3D5IA 1JKGB 1JB4A 2SBLA 1E97A 3FH1A 3JUNA 1MGWA 1OF5B 4ZM8A 3EBYA 3UL5A 5ELUA 1FGTA 1WMOA 1OHSA 3Q3FA 1LOWA 2CC3A 4FCJA 2HMKB 2ML5A 2W03A 2XGLA 3CNMA 4GHOA 4XBTA 2ZL8A 4XM4A 3WOEB 1Y4KA 2CWVA 5EVHA 1VQ73 1OH0A 2RBIA 4XDVA 1CEWI 1BNJA 1OCVA 1IT8A 4GSPA 1BVIA 3G6E3 2CG0A 2CFKA 4LZIA 3BNEA 3DXOA 4L8PA 1OGXA 1TRQA 2CKFB 3GZXB 1DE3A 1BIRA 1W5ZA 1X1XA 4TX4A 1SIHA 3T0UA 2QEX3 2H0HA 1RNBA 1ZX2A 2BO9B 3BLZA 3HK4A 4ILFA 5AYSC 2Y73A 4HM2B 4KVHA 1N9JA 2IUJA 3CCV3 2XGNA 1QVG2 2XR8B 4BTWA 1BRGA 1A2KA 4EYCA 2HOHA 4HM6B 2HMLB 1S5AA 5KP1A 1A2PA 2INXA 2P0MA 1N8QA 1GYBA 1IV9A 1D6YA 3BB9A 3EC9A 4K1VA 5AIFA 2W56B 3G8ZA 3NBJA 1OACA 4LMIA 1ASKA 5AIHA 3BIRA 3MG1A 3U97A 1JN5A 3KZTA 4FMBA 4BTYA 1LVNA 3NBRA 1GY5A 1RCLA 3FG1A 3LTAA 1NB3I 2H0GA 3OXAA 1O7MB 2OOVA 2ML6A 3D3LA 2OTJ3 4AKZA 3HI7A 4R4KA 3QRDA 1YVSA 1UW1A 1B21A 3X40A 3AHSA 2CFLA 3JUPA 3LH4A 4Q53A 3WODG 1Q864 3LTDA 1UCLA 3GWRA 1K28A 2F5MA 3NHXA 1RN7A 3FKAA 1MWUA 4L8OA 4JF8A 1O7PB 3K7CA 1FGQA 5AYRB 1K9M4 1N5PA 5JPUA 1NNVA 3ROBA 3HX8A 3CCL3 4FMAA 3JUOA 4K90B 4LEHA 4WWUC 1RGFA 1ULIB 3E99A 4BTXA 1IVXA 5AEUB 2BMOB 1RRHA 2SARA 3EN1B 3DUKA 3NX0A 3HOHA 8CHOA 1IQ8A 3RGRA 3IMAB 1YHQ3 1JRQA 2HMNB 2KF6A 5IERA 1OHPA 5D83A 3F7SA 3FLJA 1BNFA 1I0XA 1W2B2 3X3XA 1TP6A 5STDA 3CME3 1KQS2 1AY7A 1RGEA 1W02A 3DGLA 1MWRA 1BAOA 1AQZA 2Z76A 3F8HA 4FCMA 1L5GB 3SVAA 4N6UA 1JN5B 4WYKA 1IVUA 1JV2B 3WHOA 3NV0A 3VSYA 3CMA3 2FXTA 1U5OA 4HM8B 1GOYA 1EUIC 3KCHA 1O7WB 1YIT3 2YFLB 3LOYA 5I97A 3F7XA 1DVCA 1IU7A 5IG5A 1Z1SA 5CF2A 3UJMA 4CDLA 2Z7AA 1N9EA 1WTHA 3U1WA 3FF2A 1LNHA 5FGOA 1UI8A 3AMOA 1VQM3 3LTCA 1EQKA 1JBSA
chains in the Genus database with same CATH topology
1MGWA 1RMSA 1T2HA 1BU4A 6GSPA 2KF5A 1BNEA 1RGGA 1UCIA 3Q3FA 1LOWA 1GOVA 1JBRA 1IYYA 1JBTA 2BU4A 4GHOA 1HZ1A 7GSPA 1MGRA 2AAEA 1B2SA 2RBIA 1B2ZA 1BRKA 1PY3A 1BRNL 1BNJA 1LOVA 1PYLA 2F5WA 2GSPA 1R4YA 4BIRA 1RDSA 2F56A 1BVIA 4GSPA 9RNTA 1UCKA 1I70A 1RCKA 1X1UA 1RN4A 3DH2A 1BANA 2AADA 1JBSA 1I3FA 1TRQA 1BRJA 1BSCA 1DE3A 1BIRA 1X1XA 1YNVX 1RNBA 2KF3A 1RGCA 7RNTA 1BOXA 1RSNA 1RGLA 1I8VA 1LRAA 4BU4A 1BRGA 1FW7A 1RHLA 1X1WA 2HOHA 1A2PA 1I2FA 1GMRA 2KF4A 3BIRA 5GSPA 1BRIA 1I2GA 2F4YA 1ZGXA 1RCLA 2ZA4A 3AGOA 1BSAA 1CH0A 1FUSA 1YVSA 1GOUA 1B21A 1B27A 1SARA 3AHSA 5BIRA 5RNTA 1RN1A 1DETA 1TTOA 1UCLA 2F5MA 1B2MA 1BNRA 1B20A 3DGYA 3RNTA 3AGNA 1T2IA 1BRSA 1BSDA 1RGHA 1I0VA 8RNTA 1RGAA 1G02A 1BGSA 1RGFA 2C4BA 2SARA 1BUJA 1LOYA 1FZUA 4HOHA 3HOHA 6RNTA 1FYSA 1BNIA 2KF6A 2RNTA 4J5GA 1Q9EA 1BNFA 1I3IA 1I0XA 1FUTA 1AY7A 1GMPA 1RGEA 3BU4A 1BAOA 1AQZA 1C54A 3SYUA 4J5KA 1TRPA 5HOHA 1X1YA 1RNTA 1HYFA 3WHOA 3AHWA 1BRHA 1GSPA 5BU4A 1UCJA 1B2UA 1GOYA 1BNGA 3D5GA 3KCHA 1RLSA 1RTUA 1YGWA 2KAAA 1BSBA 3WR2A 1LNIA 1B2XA 3D4AA 1RGKA 1I2EA 3GSPA 3URPA 2BIRA 3A5EA 4HAAA 4RNTA 1BSEA 3D5IA 1B3SA 1GMQA 1BNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGW A;  1RMS A;  1T2H A;  1BU4 A;  6GSP A;  2KF5 A;  1BNE A;  1RGG A;  1UCI A;  3Q3F A;  1LOW A;  1GOV A;  1JBR A;  1IYY A;  1JBT A;  2BU4 A;  4GHO A;  1HZ1 A;  7GSP A;  1MGR A;  2AAE A;  1B2S A;  2RBI A;  1B2Z A;  1BRK A;  1PY3 A;  1BRN L;  1BNJ A;  1LOV A;  1PYL A;  2F5W A;  2GSP A;  1R4Y A;  4BIR A;  1RDS A;  2F56 A;  1BVI A;  4GSP A;  9RNT A;  1UCK A;  1I70 A;  1RCK A;  1X1U A;  1RN4 A;  3DH2 A;  1BAN A;  2AAD A;  1JBS A;  1I3F A;  1TRQ A;  1BRJ A;  1BSC A;  1DE3 A;  1BIR A;  1X1X A;  1YNV X;  1RNB A;  2KF3 A;  1RGC A;  7RNT A;  1BOX A;  1RSN A;  1RGL A;  1I8V A;  1LRA A;  4BU4 A;  1BRG A;  1FW7 A;  1RHL A;  1X1W A;  2HOH A;  1A2P A;  1I2F A;  1GMR A;  2KF4 A;  3BIR A;  5GSP A;  1BRI A;  1I2G A;  2F4Y A;  1ZGX A;  1RCL A;  2ZA4 A;  3AGO A;  1BSA A;  1CH0 A;  1FUS A;  1YVS A;  1GOU A;  1B21 A;  1B27 A;  1SAR A;  3AHS A;  5BIR A;  5RNT A;  1RN1 A;  1DET A;  1TTO A;  1UCL A;  2F5M A;  1B2M A;  1BNR A;  1B20 A;  3DGY A;  3RNT A;  3AGN A;  1T2I A;  1BRS A;  1BSD A;  1RGH A;  1I0V A;  8RNT A;  1RGA A;  1G02 A;  1BGS A;  1RGF A;  2C4B A;  2SAR A;  1BUJ A;  1LOY A;  1FZU A;  4HOH A;  3HOH A;  6RNT A;  1FYS A;  1BNI A;  2KF6 A;  2RNT A;  4J5G A;  1Q9E A;  1BNF A;  1I3I A;  1I0X A;  1FUT A;  1AY7 A;  1GMP A;  1RGE A;  3BU4 A;  1BAO A;  1AQZ A;  1C54 A;  3SYU A;  4J5K A;  1TRP A;  5HOH A;  1X1Y A;  1RNT A;  1HYF A;  3WHO A;  3AHW A;  1BRH A;  1GSP A;  5BU4 A;  1UCJ A;  1B2U A;  1GOY A;  1BNG A;  3D5G A;  3KCH A;  1RLS A;  1RTU A;  1YGW A;  2KAA A;  1BSB A;  3WR2 A;  1LNI A;  1B2X A;  3D4A A;  1RGK A;  1I2E A;  3GSP A;  3URP A;  2BIR A;  3A5E A;  4HAA A;  4RNT A;  1BSE A;  3D5I A;  1B3S A;  1GMQ A;  1BNS A; 
#chains in the Genus database with same CATH topology
 3B4O A;  4DKI A;  1AV4 A;  1QVF 2;  1O7G B;  2W0Q A;  3IJE B;  4J8T A;  1T5Y A;  1GY7 A;  2L4V A;  3OWY A;  2I9W A;  4N6O B;  4OUQ A;  4RNY A;  3TDG A;  2IYJ A;  1OHO A;  2FGT A;  3O8Y A;  3K0Z A;  4HM5 B;  4PEJ A;  1A90 A;  1JBT A;  2HMJ B;  1DVD A;  1HZ1 A;  3EF8 A;  7GSP A;  1MGR A;  3F8X A;  5KP3 A;  3ZG5 A;  1SPU A;  2XH9 A;  2RCD A;  2CHC A;  4EW5 A;  1Q7Y 4;  1CYU A;  1IQY A;  1WMP A;  3PXM A;  1V58 A;  4J9A A;  1UUV B;  1NO3 A;  3L0R A;  1LOV A;  1M1X B;  2P09 A;  2RFR A;  2YX9 A;  4HJL B;  5TGN A;  5IG3 A;  1M90 4;  3ZG0 A;  4N3V A;  3OWS A;  4CPK A;  1IDP A;  1RN4 A;  3PCR A;  1BAN A;  1BRJ A;  4WYK B;  1EKM A;  1W6C A;  3B8L A;  2A15 A;  4RZM A;  4KFD A;  1VQ5 3;  1RGL A;  1I8V A;  1JZD A;  2E2V A;  1LRA A;  2W6J H;  2R4I A;  3F14 A;  2WGQ A;  5IG4 A;  1SQW A;  3UNL A;  1EA2 A;  1W01 A;  2BNG A;  3Q1C A;  3CPW 2;  5AIG A;  4HZ9 B;  5DRE A;  7STD A;  1CQS A;  1BRI A;  1LQG C;  5M1A A;  6STD A;  1I2G A;  1WNH A;  3CCJ 3;  2OQE C;  5LC6 A;  3STD A;  3KE7 A;  1VQO 3;  1TFO A;  1UUW B;  1JB5 A;  1GD3 A;  2B24 B;  2ZA4 A;  5AEW B;  3JUQ A;  1YJN 3;  1BSA A;  4I4K A;  1MNL A;  5IEP A;  1KSI A;  4H61 A;  3CCM 3;  5JBS A;  4NRE A;  2W9P A;  1VQN 3;  5RNT A;  3NUV A;  4NHF A;  5BVB A;  1RN1 A;  1TTO A;  2M7O A;  2Q07 A;  5M18 A;  1B2M A;  3DGY A;  1UGH I;  2KRT A;  3AGN A;  3Q90 A;  3T8U A;  2FNQ A;  3X41 A;  2OCT A;  1KWI A;  3PYJ A;  1OGZ A;  5KP4 A;  3NQZ A;  1RGA A;  2W04 A;  1E3R A;  3HIG A;  3N8B A;  2BMR B;  4FMD A;  1AVK A;  3NM2 A;  2C4B A;  3SED A;  5IW9 A;  2F86 B;  1GY6 A;  3KII A;  1ULJ B;  1BNI A;  2OTL 3;  1STD A;  2Y74 A;  3NM7 A;  1EEJ A;  3WA3 A;  2XRX B;  4J5G A;  2ZDJ A;  4BL3 A;  4FCZ A;  2F99 A;  4QWT A;  2ZHX B;  3MHE A;  1GMP A;  3T8N A;  1YJW 3;  4G1M B;  3B4P A;  3S5C A;  2UX0 A;  2Z77 A;  3SXX A;  3WMD A;  5IEO A;  5BU4 A;  1B2U A;  3D79 A;  2LYX A;  3F9S A;  4HYZ A;  3FG3 A;  2H0I A;  2KAA A;  1Q82 4;  1FUW A;  1O7N B;  4KZ1 A;  3EN8 A;  3D9R A;  3D4A A;  1HU9 A;  4O2H A;  3URP A;  2BIR A;  3ECF A;  4O3V A;  3MSO A;  2QA4 3;  3FGY A;  2BMQ B;  3DY5 A;  4LSO A;  3FCS B;  1FGM A;  2HMO B;  3DGN A;  1DMN A;  1B3S A;  4X2H A;  2XEP A;  1GMQ A;  3GRD A;  2XFS A;  1US1 A;  5D82 A;  4MMX B;  1RMS A;  4N6V 0;  1BU4 A;  1QAL A;  1BNE A;  1RGG A;  2KF5 A;  1UCI A;  3KFQ C;  2WO0 A;  2BT3 A;  1JBR A;  2GBX B;  3HII A;  3MPH A;  2BU4 A;  3FZW A;  4KFF A;  3LYG A;  4RNZ A;  3A76 A;  1IV7 A;  1IT7 A;  5AI1 A;  1S72 3;  2GXF A;  1JJ2 2;  2YFI B;  3SOA A;  1BRK A;  2MF7 A;  3FF0 A;  1PY3 A;  3H51 A;  4OK0 A;  3ER7 A;  1MOL A;  1PYL A;  2F5W A;  2GSP A;  3LT8 A;  1YVB I;  4BIR A;  4EBG A;  1SJW A;  2OWP A;  1NJI 4;  5FW5 A;  9RNT A;  3EQQ B;  4KFE A;  1RCK A;  1ROA A;  1X1U A;  3CC2 3;  4AKY A;  3CXC 2;  1NWW A;  2AAD A;  1BSC A;  1SII A;  3DMC A;  4LGQ A;  5CLK A;  2C11 A;  3H3H A;  4MJD A;  3DGO A;  3I0Y A;  2RGQ A;  3G71 3;  4R1K A;  1A2V A;  1TUH A;  7RNT A;  4R9K A;  2CIU A;  1J2B A;  1F8N A;  1WQL B;  4XDW A;  1JKG A;  2V1L A;  3B7C A;  1W7C A;  1V74 A;  4U13 A;  4O02 B;  5DRV A;  4IPB A;  1RHL A;  1OF5 A;  2LQV A;  1X1W A;  3BND A;  5LC7 A;  3S27 A;  3S29 A;  1KC8 4;  1Q81 4;  3VF1 A;  1MWS A;  2K0M A;  4XBY A;  5M19 A;  1GMR A;  1ROV A;  2PNC A;  2JQ5 A;  2CWU A;  5AII A;  2CFG A;  1LQM B;  5BXQ A;  3EHC A;  3KSE D;  1ISK A;  3AGO A;  2O9U X;  1CYV A;  1T3B A;  2PZV A;  1O7H B;  3CC4 3;  3V98 A;  1C7H A;  1YGE A;  1FUS A;  2CX0 A;  4R9L A;  3WDG B;  4O8S A;  3CCE 3;  1B27 A;  1SAR A;  3GAX A;  4STD A;  4HZB B;  3S67 A;  1R4C A;  1WMN A;  3M8C A;  3CCQ 3;  3NV0 B;  1DET A;  4IT7 A;  1RJO A;  1BNR A;  1B20 A;  4HM0 B;  1T2I A;  1BRS A;  4LYL B;  3G4S 3;  4HKV B;  1I0V A;  3F40 A;  3IPT A;  8RNT A;  1GD4 A;  5D81 A;  2C10 A;  4EC6 A;  2WGO A;  1A67 A;  4XBX A;  2GU1 A;  1G02 A;  1BGS A;  1TJD A;  3LML A;  2XF3 A;  2CW9 A;  4R80 A;  2STD A;  5CXO A;  4RBN A;  3AMO B;  5IG0 A;  1LOY A;  1W6Y A;  1FZU A;  1FGR A;  3K9M C;  3WOF B;  3MG3 A;  4BL2 A;  2GBW B;  3OV4 A;  1QMA A;  2K54 A;  4K61 A;  1TU5 A;  1HKX A;  3N9H A;  1NB5 I;  5HGR A;  3JVC A;  2BHM A;  3RGA A;  1Q9E A;  4GB5 A;  3KKG A;  1TFK A;  2W2C A;  1FUT A;  3EE1 A;  3SOY A;  3BU4 A;  2JDI H;  3FG4 A;  3PZW A;  1C54 A;  4J5K A;  5CK6 A;  3I56 3;  5HOH A;  5A0O B;  4WFO A;  3SX1 A;  1RKY A;  3J7Y d;  3KSP A;  3CNX A;  1HYF A;  3QK9 A;  3AHW A;  1Q40 A;  1U8C B;  2W9Q A;  1GSP A;  2GU3 A;  3D5G A;  3X42 A;  3GZB A;  1M1K 4;  1RLS A;  1RTU A;  4HM4 B;  1YGW A;  3MG2 A;  3DM8 A;  5G2G A;  1YI2 3;  1DYU A;  1RRL A;  4XB5 A;  1K8A 4;  1LNI A;  1B2X A;  3GZY B;  3CD6 3;  3LXU X;  1D6U A;  1ZO2 A;  1FA3 A;  5JPP A;  1RGK A;  1PU4 A;  1I2E A;  4CCV A;  3CCU 3;  3A5E A;  1W00 A;  1NDO B;  4HAA A;  4RNT A;  3KN4 A;  1BSE A;  3BNB A;  1K73 4;  3JUM A;  3VGN A;  2IUK A;  1BNS A;  3V92 A;  3WA2 X;  2XSO B;  4ORL A;  2WOF A;  4HVN A;  3DGM A;  1T2H A;  1YJ9 3;  6GSP A;  1JZO A;  3NBB A;  1VQ6 3;  3CCS 3;  1GOV A;  1UDI I;  4FR9 A;  3UL6 A;  1IYY A;  3HZP A;  3N54 B;  1D6Z A;  1UUG B;  1K41 A;  4K1U A;  4EXR A;  1W2Z A;  4N6T A;  2E2U A;  2AAE A;  5IEN A;  1B2S A;  1QJG A;  4OVM A;  1B2Z A;  1LOX A;  3X3Z A;  3CU3 A;  4JRF A;  4MMZ B;  1VQ8 3;  5EEO A;  1BRN L;  4KT3 B;  1VQQ A;  1KD1 4;  1STF I;  1PFP A;  1R4Y A;  4N6L A;  1RDS A;  2F56 A;  2F98 A;  1VQ9 3;  1JB2 A;  3G0K A;  2WOH A;  1UCK A;  1IQX A;  1VQK 3;  1I70 A;  1W4N A;  5CF1 A;  2R41 A;  3S28 A;  3DH2 A;  5G1K A;  1GS3 A;  1I3F A;  4CJN A;  2YFJ B;  1IK3 A;  2CH9 A;  1YNV X;  4GL6 A;  1YIJ 3;  1IVW A;  1Q40 B;  3SLU A;  4HM7 B;  2KF3 A;  3PS8 A;  4H3U A;  1QAF A;  1RGC A;  4IIA A;  4WHA A;  1BOX A;  1RSN A;  1ZS7 A;  4EV5 A;  2GEX A;  4BU4 A;  4I5Q A;  2GEY A;  4L7K A;  1FW7 A;  1MWT A;  1I2F A;  2OOV C;  1Q7H A;  4MMY B;  4X2O A;  2XFT A;  3ZFZ A;  1N5H A;  2KF4 A;  5GSP A;  2IMJ A;  1BUQ A;  1UI7 A;  2RSX A;  2F4Y A;  1ZGX A;  3PCS A;  3NQY A;  4N6N B;  1VZZ A;  1IVV A;  4EV2 A;  4HM3 B;  3CC7 3;  1E3V A;  3PGB A;  2O3O A;  5EQL A;  3CPO A;  5IF6 A;  1CH0 A;  3EJV A;  1OPY A;  2L1S A;  3NXJ A;  4HM1 B;  1DMQ A;  1GOU A;  3OW2 2;  5BIR A;  2K3D A;  3X3Y A;  1EG9 B;  3RDE A;  2D1W A;  2HMM B;  1TIJ A;  3BNC A;  2XSH B;  3EX9 A;  3RNT A;  1BSD A;  3LZA A;  1RGH A;  2CFW A;  2D42 A;  3ALA A;  3CCR 3;  3G16 A;  2P05 A;  3MKI A;  1W6G A;  2MC8 A;  3OWU A;  2QGU A;  2UUG C;  1AR0 A;  1JNQ A;  4WP5 A;  1BUJ A;  1QAK A;  3FSD A;  4HOH A;  6RNT A;  3Q2P A;  1FYS A;  3GZR A;  2KXG A;  1M9G A;  2RNT A;  3V99 A;  2E2T A;  1VQL 3;  1VQP 3;  2J8X B;  3LTB A;  1I3I A;  2KCD A;  4HBR A;  2OQE A;  1OUN A;  3EBT A;  3K5T A;  1NU3 A;  3MYT A;  2CK3 H;  2P38 A;  1Q42 A;  3SYU A;  1TRP A;  3OX9 A;  3MWZ A;  2Z6B A;  2P0X A;  2QIY A;  1X1Y A;  3DZL A;  1RNT A;  1N8R 4;  1G0T A;  1FGO A;  1BRH A;  1AVL A;  1DMM A;  2CX1 A;  1G96 A;  1UCJ A;  2IA7 A;  1BNG A;  2UGI A;  4FMC A;  2B1X B;  1BSB A;  3WR2 A;  4AEQ A;  4MEI A;  5G1L A;  3LT9 A;  3K63 A;  1VQ4 3;  5ELJ A;  2CFD A;  2IY2 A;  1UGI A;  1V57 A;  3GSP A;  1LXE A;  2CG1 A;  2CWT A;  2W56 A;  3EB8 A;  4N6M A;  3I55 3;  3UB1 A;  4NPB A;  3D5I A;  1JKG B;  1JB4 A;  2SBL A;  1E97 A;  3FH1 A;  3JUN A;  1MGW A;  1OF5 B;  4ZM8 A;  3EBY A;  3UL5 A;  5ELU A;  1FGT A;  1WMO A;  1OHS A;  3Q3F A;  1LOW A;  2CC3 A;  4FCJ A;  2HMK B;  2ML5 A;  2W03 A;  2XGL A;  3CNM A;  4GHO A;  4XBT A;  2ZL8 A;  4XM4 A;  3WOE B;  1Y4K A;  2CWV A;  5EVH A;  1VQ7 3;  1OH0 A;  2RBI A;  4XDV A;  1CEW I;  1BNJ A;  1OCV A;  1IT8 A;  4GSP A;  1BVI A;  3G6E 3;  2CG0 A;  2CFK A;  4LZI A;  3BNE A;  3DXO A;  4L8P A;  1OGX A;  1TRQ A;  2CKF B;  3GZX B;  1DE3 A;  1BIR A;  1W5Z A;  1X1X A;  4TX4 A;  1SIH A;  3T0U A;  2QEX 3;  2H0H A;  1RNB A;  1ZX2 A;  2BO9 B;  3BLZ A;  3HK4 A;  4ILF A;  5AYS C;  2Y73 A;  4HM2 B;  4KVH A;  1N9J A;  2IUJ A;  3CCV 3;  2XGN A;  1QVG 2;  2XR8 B;  4BTW A;  1BRG A;  1A2K A;  4EYC A;  2HOH A;  4HM6 B;  2HML B;  1S5A A;  5KP1 A;  1A2P A;  2INX A;  2P0M A;  1N8Q A;  1GYB A;  1IV9 A;  1D6Y A;  3BB9 A;  3EC9 A;  4K1V A;  5AIF A;  2W56 B;  3G8Z A;  3NBJ A;  1OAC A;  4LMI A;  1ASK A;  5AIH A;  3BIR A;  3MG1 A;  3U97 A;  1JN5 A;  3KZT A;  4FMB A;  4BTY A;  1LVN A;  3NBR A;  1GY5 A;  1RCL A;  3FG1 A;  3LTA A;  1NB3 I;  2H0G A;  3OXA A;  1O7M B;  2OOV A;  2ML6 A;  3D3L A;  2OTJ 3;  4AKZ A;  3HI7 A;  4R4K A;  3QRD A;  1YVS A;  1UW1 A;  1B21 A;  3X40 A;  3AHS A;  2CFL A;  3JUP A;  3LH4 A;  4Q53 A;  3WOD G;  1Q86 4;  3LTD A;  1UCL A;  3GWR A;  1K28 A;  2F5M A;  3NHX A;  1RN7 A;  3FKA A;  1MWU A;  4L8O A;  4JF8 A;  1O7P B;  3K7C A;  1FGQ A;  5AYR B;  1K9M 4;  1N5P A;  5JPU A;  1NNV A;  3ROB A;  3HX8 A;  3CCL 3;  4FMA A;  3JUO A;  4K90 B;  4LEH A;  4WWU C;  1RGF A;  1ULI B;  3E99 A;  4BTX A;  1IVX A;  5AEU B;  2BMO B;  1RRH A;  2SAR A;  3EN1 B;  3DUK A;  3NX0 A;  3HOH A;  8CHO A;  1IQ8 A;  3RGR A;  3IMA B;  1YHQ 3;  1JRQ A;  2HMN B;  2KF6 A;  5IER A;  1OHP A;  5D83 A;  3F7S A;  3FLJ A;  1BNF A;  1I0X A;  1W2B 2;  3X3X A;  1TP6 A;  5STD A;  3CME 3;  1KQS 2;  1AY7 A;  1RGE A;  1W02 A;  3DGL A;  1MWR A;  1BAO A;  1AQZ A;  2Z76 A;  3F8H A;  4FCM A;  1L5G B;  3SVA A;  4N6U A;  1JN5 B;  4WYK A;  1IVU A;  1JV2 B;  3WHO A;  3NV0 A;  3VSY A;  3CMA 3;  2FXT A;  1U5O A;  4HM8 B;  1GOY A;  1EUI C;  3KCH A;  1O7W B;  1YIT 3;  2YFL B;  3LOY A;  5I97 A;  3F7X A;  1DVC A;  1IU7 A;  5IG5 A;  1Z1S A;  5CF2 A;  3UJM A;  4CDL A;  2Z7A A;  1N9E A;  1WTH A;  3U1W A;  3FF2 A;  1LNH A;  5FGO A;  1UI8 A;  3AMO A;  1VQM 3;  3LTC A;  1EQK A;  1JBS A; 
#chains in the Genus database with same CATH homology
 1MGW A;  1RMS A;  1T2H A;  1BU4 A;  6GSP A;  2KF5 A;  1BNE A;  1RGG A;  1UCI A;  3Q3F A;  1LOW A;  1GOV A;  1JBR A;  1IYY A;  1JBT A;  2BU4 A;  4GHO A;  1HZ1 A;  7GSP A;  1MGR A;  2AAE A;  1B2S A;  2RBI A;  1B2Z A;  1BRK A;  1PY3 A;  1BRN L;  1BNJ A;  1LOV A;  1PYL A;  2F5W A;  2GSP A;  1R4Y A;  4BIR A;  1RDS A;  2F56 A;  1BVI A;  4GSP A;  9RNT A;  1UCK A;  1I70 A;  1RCK A;  1X1U A;  1RN4 A;  3DH2 A;  1BAN A;  2AAD A;  1JBS A;  1I3F A;  1TRQ A;  1BRJ A;  1BSC A;  1DE3 A;  1BIR A;  1X1X A;  1YNV X;  1RNB A;  2KF3 A;  1RGC A;  7RNT A;  1BOX A;  1RSN A;  1RGL A;  1I8V A;  1LRA A;  4BU4 A;  1BRG A;  1FW7 A;  1RHL A;  1X1W A;  2HOH A;  1A2P A;  1I2F A;  1GMR A;  2KF4 A;  3BIR A;  5GSP A;  1BRI A;  1I2G A;  2F4Y A;  1ZGX A;  1RCL A;  2ZA4 A;  3AGO A;  1BSA A;  1CH0 A;  1FUS A;  1YVS A;  1GOU A;  1B21 A;  1B27 A;  1SAR A;  3AHS A;  5BIR A;  5RNT A;  1RN1 A;  1DET A;  1TTO A;  1UCL A;  2F5M A;  1B2M A;  1BNR A;  1B20 A;  3DGY A;  3RNT A;  3AGN A;  1T2I A;  1BRS A;  1BSD A;  1RGH A;  1I0V A;  8RNT A;  1RGA A;  1G02 A;  1BGS A;  1RGF A;  2C4B A;  2SAR A;  1BUJ A;  1LOY A;  1FZU A;  4HOH A;  3HOH A;  6RNT A;  1FYS A;  1BNI A;  2KF6 A;  2RNT A;  4J5G A;  1Q9E A;  1BNF A;  1I3I A;  1I0X A;  1FUT A;  1AY7 A;  1GMP A;  1RGE A;  3BU4 A;  1BAO A;  1AQZ A;  1C54 A;  3SYU A;  4J5K A;  1TRP A;  5HOH A;  1X1Y A;  1RNT A;  1HYF A;  3WHO A;  3AHW A;  1BRH A;  1GSP A;  5BU4 A;  1UCJ A;  1B2U A;  1GOY A;  1BNG A;  3D5G A;  3KCH A;  1RLS A;  1RTU A;  1YGW A;  2KAA A;  1BSB A;  3WR2 A;  1LNI A;  1B2X A;  3D4A A;  1RGK A;  1I2E A;  3GSP A;  3URP A;  2BIR A;  3A5E A;  4HAA A;  4RNT A;  1BSE A;  3D5I A;  1B3S A;  1GMQ A;  1BNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...