2RNTA

Three-dimensional structure of ribonuclease t1 complexed with guanylyl-2(prime),5(prime)-guanosine at 1.8 angstroms resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Three-dimensional structure of ribonuclease T1 complexed with guanylyl-2',5'-guanosine at 1.8 A resolution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1988-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2rntA00
1Q9EA 1LOVA 1RGLA 1BNSA 1C54A 1YGWA 5BU4A 1GMPA 1RLSA 2HOHA 1LNIA 5GSPA 6GSPA 1YNVX 7GSPA 1B2UA 1TRPA 4GSPA 1GOYA 1BIRA 1GMQA 1X1WA 1RHLA 2F56A 3RNTA 2KAAA 3AHWA 1FUSA 1I0VA 1BOXA 4BU4A 1RSNA 1UCJA 3A5EA 3AGOA 1B2ZA 1BRGA 1BGSA 1B2XA 1GMRA 1TTOA 3AGNA 1RCKA 3Q3FA 1T2HA 1RGHA 1DETA 1BRNL 1PYLA 7RNTA 1BNRA 2AADA 1BNJA 2F4YA 1IYYA 9RNTA 1I2FA 2KF5A 1T2IA 1BAOA 1CH0A 1ZGXA 1BNEA 1BRJA 1MGRA 3DGYA 4HOHA 4J5GA 3URPA 1AY7A 1I3IA 3WHOA 1RDSA 3DH2A 1YVSA 1BSBA 1FZUA 1RGEA 1BRKA 1BVIA 3BU4A 2BIRA 1LRAA 1B27A 1UCKA 1BNGA 1RMSA 2RBIA 1I3FA 3BIRA 1LOWA 2ZA4A 1HYFA 2RNTA 1UCIA 1FW7A 1B2MA 4GHOA 2SARA 5RNTA 1RGGA 1GOUA 1LOYA 1FUTA 1RGCA 2KF3A 2AAEA 1I8VA 1G02A 1RGAA 3GSPA 3AHSA 1I70A 1BANA 2F5MA 3SYUA 1B21A 1B3SA 1RGKA 4BIRA 1BUJA 3WR2A 1BRSA 1SARA 3D4AA 1JBTA 1RNTA 1RTUA 1X1YA 2KF6A 1B20A 1AQZA 1RCLA 1BRHA 1GSPA 1RN4A 1A2PA 1UCLA 1X1XA 3KCHA 1JBRA 1FYSA 4J5KA 1I2EA 2GSPA 2F5WA 2BU4A 3D5IA 4RNTA 1RN1A 3D5GA 1TRQA 1I2GA 1BRIA 1MGWA 1BNIA 1BSEA 1RNBA 1JBSA 1BNFA 1DE3A 6RNTA 3HOHA 1X1UA 2C4BA 1B2SA 1BSDA 2KF4A 4HAAA 1BSAA 1I0XA 1PY3A 1GOVA 1BSCA 1HZ1A 5HOHA 1BU4A 1R4YA 5BIRA 1RGFA 8RNTA
chains in the Genus database with same CATH superfamily
1Q9EA 3EC9A 3HIIA 3EHCA 2P38A 2XF3A 4FR9A 1TFKA 1YGWA 1EG9B 2HOHA 5GSPA 1CEWI 1B2UA 1O7PB 1T3BA 1TRPA 4WWUC 3OWUA 5G2GA 4KT3B 2XEPA 4MMZB 4EXRA 3STDA 2Y73A 1Q864 1GMQA 3IMAB 5M19A 1ULJB 3S29A 3BNDA 2LQVA 5HGRA 2QA43 4LSOA 4AKYA 1AVKA 3DGOA 3SXXA 3F14A 1NJI4 4FMDA 1OF5B 1LQGC 3GWRA 3LTCA 4XBYA 1K41A 2XGNA 1US1A 4HVNA 3AGOA 1GMRA 4X2OA 5AIFA 1VQP3 1YJN3 1ROAA 1M1K4 2RFRA 4KFEA 2GBWB 5IENA 1ZS7A 5CLKA 7RNTA 1BNRA 3KZTA 5G1LA 2AADA 4FCMA 2F4YA 3LTAA 1NO3A 5BVBA 3CMA3 1K734 2OQEC 2OOVA 3F7SA 1SJWA 1CH0A 1ZGXA 2B1XB 3GZRA 4EC6A 5IG5A 2P0XA 4J5GA 4O2HA 5LC7A 3T8UA 1N8R4 1AY7A 1QMAA 3S27A 2RSXA 3N54B 3K9MC 3DH2A 3NXJA 2K0MA 1FZUA 2Q07A 3BU4A 3Q2PA 3FZWA 1NU3A 2BIRA 1LRAA 2W04A 1BNGA 4QWTA 3LH4A 4LYLB 2E2TA 5CK6A 1RMSA 3EBTA 2RBIA 1I3FA 3BIRA 3Q1CA 5JPPA 1N5HA 2OQEA 3FF2A 1DMMA 1W00A 8CHOA 1HYFA 2RNTA 3FG1A 1EQKA 4BTYA 3FKAA 4KZ1A 1OCVA 3BB9A 3EX9A 4N6V0 4X2HA 3I553 1VQ73 4OK0A 1GYBA 1LOYA 4XBTA 3ZG5A 3JUQA 2FNQA 3JUNA 1HU9A 1JB4A 2M7OA 1C7HA 3SVAA 1VQK3 3X41A 3FSDA 1PFPA 3DGMA 1K9M4 3SYUA 1RRLA 1JV2B 5EEOA 3I0YA 3B4OA 1RNTA 4CPKA 1RKYA 3CC23 3NUVA 1J2BA 1LXEA 4FMCA 1AQZA 7GSPA 1BRHA 1GSPA 1RN4A 2UUGC 1EKMA 1L5GB 3EBYA 5DRVA 2HMJB 1W5ZA 3LT9A 4FMAA 1A2KA 1FYSA 2P09A 3ER7A 3F9SA 1I2EA 5IERA 2BU4A 3D5IA 3BNBA 4WYKA 1FUWA 1I2GA 1BRIA 1OH0A 2H0IA 3PCRA 3K5TA 1IDPA 3NQYA 1FGMA 1IQXA 2XRXB 3WMDA 1VQ53 1IVWA 2OCTA 1BSEA 4WHAA 3DGLA 3PCSA 3H3HA 2WGQA 1OGXA 4O02B 1ULIB 5KP1A 4BL3A 4NREA 3F7XA 3HOHA 1KC84 3IPTA 1B2SA 2KF4A 4HAAA 1BSAA 1IVUA 2R41A 3G8ZA 1FGTA 3JUOA 3G4S3 2QIYA 1BSCA 1IVXA 1NDOB 4R9KA 2BNGA 3F8XA 3NBRA 4WYKB 3EN1B 1R4YA 2SBLA 3IJEB 4AKZA 1CYUA 5CF1A 2J8XB 1DVDA 3M8CA 3G713 3ZFZA 2RGQA 3PXMA 3E99A 1E97A 3MG2A 5BU4A 1UI7A 4LZIA 1AVLA 4LEHA 3CD63 1W02A 3V99A 4DKIA 1LOXA 3EE1A 3G0KA 4CCVA 1RHLA 3RNTA 3J7Yd 1N5PA 1F8NA 7STDA 1Y4KA 3GZXB 1ASKA 1FUSA 1JKGA 3MG1A 3PS8A 1RSNA 3UNLA 3A76A 2Z76A 2OTJ3 1YIT3 3A5EA 3AGNA 1B2ZA 1BRGA 1BGSA 1VZZA 3HI7A 3HX8A 3Q3FA 3U1WA 4J8TA 3CC43 2O3OA 3DZLA 3KFQC 1JN5B 3BNEA 2P0MA 4N6MA 1PYLA 3D3LA 4ORLA 1BNJA 1UUGB 3NM7A 3NX0A 4HBRA 4HKVB 1EUIC 3B8LA 1VQN3 1T2IA 3MWZA 3CCU3 1KQS2 2CX1A 1SIIA 1N9EA 3LXUX 3URPA 5LC6A 4EW5A 4G1MB 1I3IA 1JKGB 4FCJA 1LQMB 3DM8A 1YVSA 1BSBA 2OOVC 1IV9A 2KXGA 1BVIA 2HMNB 2Y74A 2HMOB 2IA7A 3V98A 2W0QA 1V74A 4L8PA 1RJOA 2PNCA 2QGUA 1LOWA 2ZA4A 4OUQA 3EJVA 3MSOA 1M904 1UCIA 1MWRA 3JUPA 2I9WA 3NBBA 5G1KA 1IQ8A 2CFLA 2W56A 2XH9A 1DMQA 3ZG0A 4N3VA 2KF3A 1VQQA 2XSOB 2CG1A 2F99A 1I8VA 1G02A 1RGAA 3DXOA 1MWSA 3SX1A 1VQ83 1DYUA 3G6E3 2HMKB 5JPUA 4R1KA 4BIRA 1BRSA 1Q814 3HZPA 3FLJA 3V92A 3D4AA 4HJLB 1JBTA 1RTUA 1Q42A 1X1YA 1U8CB 4R4KA 2KF6A 1B20A 3D9RA 4KFFA 1NWWA 4WFOA 1W2ZA 2MF7A 1Q7HA 2P05A 1SQWA 1V57A 3D79A 3CC73 1K8A4 1WMPA 1IVVA 3L0RA 1MWTA 1YIJ3 5IF6A 1O7HB 3UB1A 5IG0A 1JBRA 2W56B 2GSPA 3S28A 1YJ93 2CFDA 2GEYA 5I97A 1IV7A 1MNLA 3O8YA 3SLUA 1VQL3 2IMJA 2CWTA 2E2VA 3X3XA 1MGWA 4EBGA 1KWIA 5AIHA 1Z1SA 3MYTA 4ILFA 3NM2A 1UGIA 3KIIA 1W7CA 1JB5A 5KP4A 3GZYB 1BNIA 2CK3H 3OXAA 3NHXA 1U5OA 2CC3A 1BSDA 1Q40A 3DUKA 4CDLA 5IEPA 1KSIA 1OHOA 2WOFA 1IK3A 1O7MB 2INXA 3Q90A 3S5CA 1GY5A 3K0ZA 4GL6A 3AMOA 3OWYA 1CQSA 1UDII 4J9AA 1RGFA 5BIRA 2JQ5A 2C10A 3MPHA 5IW9A 1VQ43 1TUHA 3SOYA 2W6JH 1RGLA 1BNSA 1C54A 1FGQA 1AR0A 4XM4A 5M1AA 1RLSA 2IUKA 1LNIA 1O7GB 4EV5A 4HM6B 6GSPA 1WTHA 4BL2A 4GB5A 1GOYA 1BIRA 1Q40B 3WOFB 3FGYA 2CIUA 2F56A 2WOHA 5IG3A 2KAAA 1N8QA 3AHWA 1CYVA 2W2CA 1A67A 1MWUA 2IYJA 3HIGA 3AMOB 1UCJA 1B2XA 1OACA 1D6UA 1RCKA 3WA3A 1T2HA 3MKIA 2ZL8A 4WP5A 4K1VA 1M1XB 2JDIH 3BNCA 4N6OB 3MG3A 5CF2A 4MEIA 4EV2A 4MMXB 4TX4A 1JN5A 1RRHA 4LGQA 1TU5A 3K7CA 1TP6A 2HMLB 1BRJA 1MGRA 3DGYA 4HOHA 4L7KA 3VSYA 2B24B 3CCR3 4AEQA 1HKXA 4HZBB 1TFOA 3UL5A 1GS3A 1AV4A 3K63A 1BRKA 2WGOA 4RNZA 3WDGB 1GY6A 1UCKA 1B27A 2H0HA 3CCS3 1NNVA 1QJGA 3KSPA 5AYRB 1UUWB 5TGNA 1JZDA 1VQM3 1Q7Y4 2H0GA 1JJ22 1WMOA 5M18A 3FG4A 1UW1A 1QALA 1M9GA 3KKGA 3VF1A 3VGNA 2GU1A 1Q824 1YJW3 4GHOA 4K61A 2CFGA 1EA2A 3T0UA 2K3DA 1GOUA 2GBXB 1QVG2 1FW7A 1FUTA 2AAEA 1YGEA 1S723 1WNHA 3AHSA 1I70A 5BXQA 4HM8B 2F5MA 1B21A 1BUJA 1JZOA 3OW22 4R80A 3PZWA 1WMNA 2HMMB 1TJDA 1OGZA 1ROVA 1RCLA 4N6TA 4R9LA 2MC8A 3SOAA 1A2PA 1A90A 3CNXA 3EQQB 1G96A 4KFDA 2XR8B 2A15A 3TDGA 3EB8A 4J5KA 2XFTA 2CFKA 2F5WA 1D6ZA 3LTDA 3T8NA 2ZDJA 4FMBA 2BMOB 3LOYA 4HZ9B 1NB5I 1LVNA 2V1LA 1IT8A 3B4PA 5FW5A 4I5QA 1O7WB 2CFWA 5AEUB 3RGRA 3RDEA 3X42A 2OWPA 2O9UX 1BNFA 2BMQB 3QRDA 4K1UA 1NB3I 3CCJ3 1DE3A 1X1UA 2C4BA 2LYXA 3CU3A 3JVCA 3S67A 1SPUA 3CPW2 3CCL3 1OPYA 5AIGA 3ALAA 1I0XA 1STFI 4O8SA 5HOHA 1YI23 2CH9A 3B7CA 3FCSB 3CCE3 2GEXA 2BMRB 1OHPA 2D1WA 4BTXA 5A0OB 4HYZA 1T5YA 3OX9A 5AI1A 4N6LA 3KE7A 1RN7A 2CX0A 1LOVA 3BLZA 1TIJA 3RGAA 5FGOA 1O7NB 1GMPA 2W9PA 1VQ93 1OHSA 2FXTA 1YNVX 4STDA 1FGOA 5AEWB 5D82A 4GSPA 4L8OA 4Q53A 1JB2A 3KN4A 3NBJA 1X1WA 3FF0A 1EEJA 1IQYA 1GD3A 1E3VA 1I0VA 4RZMA 4H3UA 3ECFA 4JF8A 1BOXA 4BU4A 5ELJA 1ZX2A 1STDA 5JBSA 4KVHA 3UJMA 4N6UA 1LNHA 1TTOA 3GAXA 1FGRA 3H51A 3MHEA 2IUJA 1RGHA 1DETA 3LT8A 2CWVA 2F98A 1BRNL 1R4CA 2QEX3 4H61A 4XDVA 5IEOA 1E3RA 2BT3A 2L1SA 1ZO2A 1V58A 2BHMA 3KSED 4HM5B 9RNTA 1IYYA 1I2FA 2KF5A 1A2VA 4OVMA 1BAOA 2F86B 3CPOA 2CWUA 1GD4A 1ISKA 3NV0A 1BNEA 1IU7A 3JUMA 2GXFA 3F8HA 4IT7A 3UL6A 3X3YA 1JNQA 5DREA 1W6GA 2YFLB 3WHOA 1RDSA 3PYJA 3X3ZA 3CXC2 3OV4A 1RGEA 5D81A 2KCDA 3DGNA 3SEDA 4NPBA 4IIAA 2GU3A 4MMYB 4CJNA 5D83A 2RCDA 4XDWA 2YFIB 3PGBA 3F40A 4LMIA 4EYCA 3CME3 1N9JA 3HK4A 3WODG 5EQLA 3WA2X 1VQ63 1G0TA 1GY7A 4HM2B 1JRQA 1OUNA 2ML6A 2C11A 1QAKA 2UGIA 2CKFB 2W9QA 1B2MA 3X40A 3DMCA 2SARA 2XFSA 3NV0B 5RNTA 1RGGA 3CCM3 4HM1B 4FCZA 1RGCA 3ROBA 2CW9A 1D6YA 3LYGA 3FH1A 1FA3A 3NQZA 3DY5A 3QK9A 4JRFA 4K90B 4XBXA 3WOEB 4MJDA 3GSPA 2PZVA 2XSHB 1BANA 1B3SA 1RGKA 2CHCA 4NHFA 3WR2A 1SARA 4HM0B 1W6CA 1YHQ3 4N6NB 1KD14 1BUQA 1DVCA 2Z6BA 1YVBI 3G16A 1S5AA 2ML5A 1UCLA 2UX0A 1UGHI 1X1XA 2D42A 3KCHA 4HM7B 1UUVB 2W03A 5KP3A 4RBNA 1MOLA 2OTL3 1QVF2 4I4KA 4RNTA 3N8BA 2YX9A 1RN1A 5IG4A 3D5GA 1W2B2 1W6YA 1TRQA 1WQLB 3OWSA 1W4NA 3EN8A 2YFJB 2R4IA 5ELUA 3EF8A 5EVHA 2KRTA 2IY2A 2XGLA 1QAFA 4XB5A 3GZBA 2Z77A 2K54A 3LTBA 1SIHA 6STDA 1DMNA 2WO0A 4HM4B 4IPBA 1W01A 4U13A 4BTWA 3I563 3FG3A 5AYSC 1PU4A 5CXOA 3CCQ3 1RNBA 1K28A 3LMLA 1JBSA 2L4VA 6RNTA 2FGTA 2E2UA 3CNMA 5AIIA 2STDA 3LZAA 1UI8A 1PY3A 3CCV3 1IT7A 1GOVA 5STDA 1HZ1A 2ZHXB 3GRDA 4ZM8A 1BU4A 2Z7AA 1OF5A 2CG0A 4HM3B 4O3VA 1VQO3 4PEJA 3N9HA 4RNYA 2BO9B 3U97A 8RNTA
chains in the Genus database with same CATH topology
1Q9EA 1LOVA 1RGLA 1BNSA 1C54A 1YGWA 5BU4A 1GMPA 1RLSA 2HOHA 1LNIA 5GSPA 6GSPA 1YNVX 7GSPA 1B2UA 1TRPA 4GSPA 1GOYA 1BIRA 1GMQA 1X1WA 1RHLA 2F56A 3RNTA 2KAAA 3AHWA 1FUSA 1I0VA 1BOXA 4BU4A 1RSNA 1UCJA 3A5EA 3AGOA 1B2ZA 1BRGA 1BGSA 1B2XA 1GMRA 1TTOA 3AGNA 1RCKA 3Q3FA 1T2HA 1RGHA 1DETA 1BRNL 1PYLA 7RNTA 1BNRA 2AADA 1BNJA 2F4YA 1IYYA 9RNTA 1I2FA 2KF5A 1T2IA 1BAOA 1CH0A 1ZGXA 1BNEA 1BRJA 1MGRA 3DGYA 4HOHA 4J5GA 3URPA 1AY7A 1I3IA 3WHOA 1RDSA 3DH2A 1YVSA 1BSBA 1FZUA 1RGEA 1BRKA 1BVIA 3BU4A 2BIRA 1LRAA 1B27A 1UCKA 1BNGA 1RMSA 2RBIA 1I3FA 3BIRA 1LOWA 2ZA4A 1HYFA 2RNTA 1UCIA 1FW7A 1B2MA 4GHOA 2SARA 5RNTA 1RGGA 1GOUA 1LOYA 1FUTA 1RGCA 2KF3A 2AAEA 1I8VA 1G02A 1RGAA 3GSPA 3AHSA 1I70A 1BANA 2F5MA 3SYUA 1B21A 1B3SA 1RGKA 4BIRA 1BUJA 3WR2A 1BRSA 1SARA 3D4AA 1JBTA 1RNTA 1RTUA 1X1YA 2KF6A 1B20A 1AQZA 1RCLA 1BRHA 1GSPA 1RN4A 1A2PA 1UCLA 1X1XA 3KCHA 1JBRA 1FYSA 4J5KA 1I2EA 2GSPA 2F5WA 2BU4A 3D5IA 4RNTA 1RN1A 3D5GA 1TRQA 1I2GA 1BRIA 1MGWA 1BNIA 1BSEA 1RNBA 1JBSA 1BNFA 1DE3A 6RNTA 3HOHA 1X1UA 2C4BA 1B2SA 1BSDA 2KF4A 4HAAA 1BSAA 1I0XA 1PY3A 1GOVA 1BSCA 1HZ1A 5HOHA 1BU4A 1R4YA 5BIRA 1RGFA 8RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9E A;  1LOV A;  1RGL A;  1BNS A;  1C54 A;  1YGW A;  5BU4 A;  1GMP A;  1RLS A;  2HOH A;  1LNI A;  5GSP A;  6GSP A;  1YNV X;  7GSP A;  1B2U A;  1TRP A;  4GSP A;  1GOY A;  1BIR A;  1GMQ A;  1X1W A;  1RHL A;  2F56 A;  3RNT A;  2KAA A;  3AHW A;  1FUS A;  1I0V A;  1BOX A;  4BU4 A;  1RSN A;  1UCJ A;  3A5E A;  3AGO A;  1B2Z A;  1BRG A;  1BGS A;  1B2X A;  1GMR A;  1TTO A;  3AGN A;  1RCK A;  3Q3F A;  1T2H A;  1RGH A;  1DET A;  1BRN L;  1PYL A;  7RNT A;  1BNR A;  2AAD A;  1BNJ A;  2F4Y A;  1IYY A;  9RNT A;  1I2F A;  2KF5 A;  1T2I A;  1BAO A;  1CH0 A;  1ZGX A;  1BNE A;  1BRJ A;  1MGR A;  3DGY A;  4HOH A;  4J5G A;  3URP A;  1AY7 A;  1I3I A;  3WHO A;  1RDS A;  3DH2 A;  1YVS A;  1BSB A;  1FZU A;  1RGE A;  1BRK A;  1BVI A;  3BU4 A;  2BIR A;  1LRA A;  1B27 A;  1UCK A;  1BNG A;  1RMS A;  2RBI A;  1I3F A;  3BIR A;  1LOW A;  2ZA4 A;  1HYF A;  2RNT A;  1UCI A;  1FW7 A;  1B2M A;  4GHO A;  2SAR A;  5RNT A;  1RGG A;  1GOU A;  1LOY A;  1FUT A;  1RGC A;  2KF3 A;  2AAE A;  1I8V A;  1G02 A;  1RGA A;  3GSP A;  3AHS A;  1I70 A;  1BAN A;  2F5M A;  3SYU A;  1B21 A;  1B3S A;  1RGK A;  4BIR A;  1BUJ A;  3WR2 A;  1BRS A;  1SAR A;  3D4A A;  1JBT A;  1RNT A;  1RTU A;  1X1Y A;  2KF6 A;  1B20 A;  1AQZ A;  1RCL A;  1BRH A;  1GSP A;  1RN4 A;  1A2P A;  1UCL A;  1X1X A;  3KCH A;  1JBR A;  1FYS A;  4J5K A;  1I2E A;  2GSP A;  2F5W A;  2BU4 A;  3D5I A;  4RNT A;  1RN1 A;  3D5G A;  1TRQ A;  1I2G A;  1BRI A;  1MGW A;  1BNI A;  1BSE A;  1RNB A;  1JBS A;  1BNF A;  1DE3 A;  6RNT A;  3HOH A;  1X1U A;  2C4B A;  1B2S A;  1BSD A;  2KF4 A;  4HAA A;  1BSA A;  1I0X A;  1PY3 A;  1GOV A;  1BSC A;  1HZ1 A;  5HOH A;  1BU4 A;  1R4Y A;  5BIR A;  1RGF A;  8RNT A; 
#chains in the Genus database with same CATH topology
 1Q9E A;  3EC9 A;  3HII A;  3EHC A;  2P38 A;  2XF3 A;  4FR9 A;  1TFK A;  1YGW A;  1EG9 B;  2HOH A;  5GSP A;  1CEW I;  1B2U A;  1O7P B;  1T3B A;  1TRP A;  4WWU C;  3OWU A;  5G2G A;  4KT3 B;  2XEP A;  4MMZ B;  4EXR A;  3STD A;  2Y73 A;  1Q86 4;  1GMQ A;  3IMA B;  5M19 A;  1ULJ B;  3S29 A;  3BND A;  2LQV A;  5HGR A;  2QA4 3;  4LSO A;  4AKY A;  1AVK A;  3DGO A;  3SXX A;  3F14 A;  1NJI 4;  4FMD A;  1OF5 B;  1LQG C;  3GWR A;  3LTC A;  4XBY A;  1K41 A;  2XGN A;  1US1 A;  4HVN A;  3AGO A;  1GMR A;  4X2O A;  5AIF A;  1VQP 3;  1YJN 3;  1ROA A;  1M1K 4;  2RFR A;  4KFE A;  2GBW B;  5IEN A;  1ZS7 A;  5CLK A;  7RNT A;  1BNR A;  3KZT A;  5G1L A;  2AAD A;  4FCM A;  2F4Y A;  3LTA A;  1NO3 A;  5BVB A;  3CMA 3;  1K73 4;  2OQE C;  2OOV A;  3F7S A;  1SJW A;  1CH0 A;  1ZGX A;  2B1X B;  3GZR A;  4EC6 A;  5IG5 A;  2P0X A;  4J5G A;  4O2H A;  5LC7 A;  3T8U A;  1N8R 4;  1AY7 A;  1QMA A;  3S27 A;  2RSX A;  3N54 B;  3K9M C;  3DH2 A;  3NXJ A;  2K0M A;  1FZU A;  2Q07 A;  3BU4 A;  3Q2P A;  3FZW A;  1NU3 A;  2BIR A;  1LRA A;  2W04 A;  1BNG A;  4QWT A;  3LH4 A;  4LYL B;  2E2T A;  5CK6 A;  1RMS A;  3EBT A;  2RBI A;  1I3F A;  3BIR A;  3Q1C A;  5JPP A;  1N5H A;  2OQE A;  3FF2 A;  1DMM A;  1W00 A;  8CHO A;  1HYF A;  2RNT A;  3FG1 A;  1EQK A;  4BTY A;  3FKA A;  4KZ1 A;  1OCV A;  3BB9 A;  3EX9 A;  4N6V 0;  4X2H A;  3I55 3;  1VQ7 3;  4OK0 A;  1GYB A;  1LOY A;  4XBT A;  3ZG5 A;  3JUQ A;  2FNQ A;  3JUN A;  1HU9 A;  1JB4 A;  2M7O A;  1C7H A;  3SVA A;  1VQK 3;  3X41 A;  3FSD A;  1PFP A;  3DGM A;  1K9M 4;  3SYU A;  1RRL A;  1JV2 B;  5EEO A;  3I0Y A;  3B4O A;  1RNT A;  4CPK A;  1RKY A;  3CC2 3;  3NUV A;  1J2B A;  1LXE A;  4FMC A;  1AQZ A;  7GSP A;  1BRH A;  1GSP A;  1RN4 A;  2UUG C;  1EKM A;  1L5G B;  3EBY A;  5DRV A;  2HMJ B;  1W5Z A;  3LT9 A;  4FMA A;  1A2K A;  1FYS A;  2P09 A;  3ER7 A;  3F9S A;  1I2E A;  5IER A;  2BU4 A;  3D5I A;  3BNB A;  4WYK A;  1FUW A;  1I2G A;  1BRI A;  1OH0 A;  2H0I A;  3PCR A;  3K5T A;  1IDP A;  3NQY A;  1FGM A;  1IQX A;  2XRX B;  3WMD A;  1VQ5 3;  1IVW A;  2OCT A;  1BSE A;  4WHA A;  3DGL A;  3PCS A;  3H3H A;  2WGQ A;  1OGX A;  4O02 B;  1ULI B;  5KP1 A;  4BL3 A;  4NRE A;  3F7X A;  3HOH A;  1KC8 4;  3IPT A;  1B2S A;  2KF4 A;  4HAA A;  1BSA A;  1IVU A;  2R41 A;  3G8Z A;  1FGT A;  3JUO A;  3G4S 3;  2QIY A;  1BSC A;  1IVX A;  1NDO B;  4R9K A;  2BNG A;  3F8X A;  3NBR A;  4WYK B;  3EN1 B;  1R4Y A;  2SBL A;  3IJE B;  4AKZ A;  1CYU A;  5CF1 A;  2J8X B;  1DVD A;  3M8C A;  3G71 3;  3ZFZ A;  2RGQ A;  3PXM A;  3E99 A;  1E97 A;  3MG2 A;  5BU4 A;  1UI7 A;  4LZI A;  1AVL A;  4LEH A;  3CD6 3;  1W02 A;  3V99 A;  4DKI A;  1LOX A;  3EE1 A;  3G0K A;  4CCV A;  1RHL A;  3RNT A;  3J7Y d;  1N5P A;  1F8N A;  7STD A;  1Y4K A;  3GZX B;  1ASK A;  1FUS A;  1JKG A;  3MG1 A;  3PS8 A;  1RSN A;  3UNL A;  3A76 A;  2Z76 A;  2OTJ 3;  1YIT 3;  3A5E A;  3AGN A;  1B2Z A;  1BRG A;  1BGS A;  1VZZ A;  3HI7 A;  3HX8 A;  3Q3F A;  3U1W A;  4J8T A;  3CC4 3;  2O3O A;  3DZL A;  3KFQ C;  1JN5 B;  3BNE A;  2P0M A;  4N6M A;  1PYL A;  3D3L A;  4ORL A;  1BNJ A;  1UUG B;  3NM7 A;  3NX0 A;  4HBR A;  4HKV B;  1EUI C;  3B8L A;  1VQN 3;  1T2I A;  3MWZ A;  3CCU 3;  1KQS 2;  2CX1 A;  1SII A;  1N9E A;  3LXU X;  3URP A;  5LC6 A;  4EW5 A;  4G1M B;  1I3I A;  1JKG B;  4FCJ A;  1LQM B;  3DM8 A;  1YVS A;  1BSB A;  2OOV C;  1IV9 A;  2KXG A;  1BVI A;  2HMN B;  2Y74 A;  2HMO B;  2IA7 A;  3V98 A;  2W0Q A;  1V74 A;  4L8P A;  1RJO A;  2PNC A;  2QGU A;  1LOW A;  2ZA4 A;  4OUQ A;  3EJV A;  3MSO A;  1M90 4;  1UCI A;  1MWR A;  3JUP A;  2I9W A;  3NBB A;  5G1K A;  1IQ8 A;  2CFL A;  2W56 A;  2XH9 A;  1DMQ A;  3ZG0 A;  4N3V A;  2KF3 A;  1VQQ A;  2XSO B;  2CG1 A;  2F99 A;  1I8V A;  1G02 A;  1RGA A;  3DXO A;  1MWS A;  3SX1 A;  1VQ8 3;  1DYU A;  3G6E 3;  2HMK B;  5JPU A;  4R1K A;  4BIR A;  1BRS A;  1Q81 4;  3HZP A;  3FLJ A;  3V92 A;  3D4A A;  4HJL B;  1JBT A;  1RTU A;  1Q42 A;  1X1Y A;  1U8C B;  4R4K A;  2KF6 A;  1B20 A;  3D9R A;  4KFF A;  1NWW A;  4WFO A;  1W2Z A;  2MF7 A;  1Q7H A;  2P05 A;  1SQW A;  1V57 A;  3D79 A;  3CC7 3;  1K8A 4;  1WMP A;  1IVV A;  3L0R A;  1MWT A;  1YIJ 3;  5IF6 A;  1O7H B;  3UB1 A;  5IG0 A;  1JBR A;  2W56 B;  2GSP A;  3S28 A;  1YJ9 3;  2CFD A;  2GEY A;  5I97 A;  1IV7 A;  1MNL A;  3O8Y A;  3SLU A;  1VQL 3;  2IMJ A;  2CWT A;  2E2V A;  3X3X A;  1MGW A;  4EBG A;  1KWI A;  5AIH A;  1Z1S A;  3MYT A;  4ILF A;  3NM2 A;  1UGI A;  3KII A;  1W7C A;  1JB5 A;  5KP4 A;  3GZY B;  1BNI A;  2CK3 H;  3OXA A;  3NHX A;  1U5O A;  2CC3 A;  1BSD A;  1Q40 A;  3DUK A;  4CDL A;  5IEP A;  1KSI A;  1OHO A;  2WOF A;  1IK3 A;  1O7M B;  2INX A;  3Q90 A;  3S5C A;  1GY5 A;  3K0Z A;  4GL6 A;  3AMO A;  3OWY A;  1CQS A;  1UDI I;  4J9A A;  1RGF A;  5BIR A;  2JQ5 A;  2C10 A;  3MPH A;  5IW9 A;  1VQ4 3;  1TUH A;  3SOY A;  2W6J H;  1RGL A;  1BNS A;  1C54 A;  1FGQ A;  1AR0 A;  4XM4 A;  5M1A A;  1RLS A;  2IUK A;  1LNI A;  1O7G B;  4EV5 A;  4HM6 B;  6GSP A;  1WTH A;  4BL2 A;  4GB5 A;  1GOY A;  1BIR A;  1Q40 B;  3WOF B;  3FGY A;  2CIU A;  2F56 A;  2WOH A;  5IG3 A;  2KAA A;  1N8Q A;  3AHW A;  1CYV A;  2W2C A;  1A67 A;  1MWU A;  2IYJ A;  3HIG A;  3AMO B;  1UCJ A;  1B2X A;  1OAC A;  1D6U A;  1RCK A;  3WA3 A;  1T2H A;  3MKI A;  2ZL8 A;  4WP5 A;  4K1V A;  1M1X B;  2JDI H;  3BNC A;  4N6O B;  3MG3 A;  5CF2 A;  4MEI A;  4EV2 A;  4MMX B;  4TX4 A;  1JN5 A;  1RRH A;  4LGQ A;  1TU5 A;  3K7C A;  1TP6 A;  2HML B;  1BRJ A;  1MGR A;  3DGY A;  4HOH A;  4L7K A;  3VSY A;  2B24 B;  3CCR 3;  4AEQ A;  1HKX A;  4HZB B;  1TFO A;  3UL5 A;  1GS3 A;  1AV4 A;  3K63 A;  1BRK A;  2WGO A;  4RNZ A;  3WDG B;  1GY6 A;  1UCK A;  1B27 A;  2H0H A;  3CCS 3;  1NNV A;  1QJG A;  3KSP A;  5AYR B;  1UUW B;  5TGN A;  1JZD A;  1VQM 3;  1Q7Y 4;  2H0G A;  1JJ2 2;  1WMO A;  5M18 A;  3FG4 A;  1UW1 A;  1QAL A;  1M9G A;  3KKG A;  3VF1 A;  3VGN A;  2GU1 A;  1Q82 4;  1YJW 3;  4GHO A;  4K61 A;  2CFG A;  1EA2 A;  3T0U A;  2K3D A;  1GOU A;  2GBX B;  1QVG 2;  1FW7 A;  1FUT A;  2AAE A;  1YGE A;  1S72 3;  1WNH A;  3AHS A;  1I70 A;  5BXQ A;  4HM8 B;  2F5M A;  1B21 A;  1BUJ A;  1JZO A;  3OW2 2;  4R80 A;  3PZW A;  1WMN A;  2HMM B;  1TJD A;  1OGZ A;  1ROV A;  1RCL A;  4N6T A;  4R9L A;  2MC8 A;  3SOA A;  1A2P A;  1A90 A;  3CNX A;  3EQQ B;  1G96 A;  4KFD A;  2XR8 B;  2A15 A;  3TDG A;  3EB8 A;  4J5K A;  2XFT A;  2CFK A;  2F5W A;  1D6Z A;  3LTD A;  3T8N A;  2ZDJ A;  4FMB A;  2BMO B;  3LOY A;  4HZ9 B;  1NB5 I;  1LVN A;  2V1L A;  1IT8 A;  3B4P A;  5FW5 A;  4I5Q A;  1O7W B;  2CFW A;  5AEU B;  3RGR A;  3RDE A;  3X42 A;  2OWP A;  2O9U X;  1BNF A;  2BMQ B;  3QRD A;  4K1U A;  1NB3 I;  3CCJ 3;  1DE3 A;  1X1U A;  2C4B A;  2LYX A;  3CU3 A;  3JVC A;  3S67 A;  1SPU A;  3CPW 2;  3CCL 3;  1OPY A;  5AIG A;  3ALA A;  1I0X A;  1STF I;  4O8S A;  5HOH A;  1YI2 3;  2CH9 A;  3B7C A;  3FCS B;  3CCE 3;  2GEX A;  2BMR B;  1OHP A;  2D1W A;  4BTX A;  5A0O B;  4HYZ A;  1T5Y A;  3OX9 A;  5AI1 A;  4N6L A;  3KE7 A;  1RN7 A;  2CX0 A;  1LOV A;  3BLZ A;  1TIJ A;  3RGA A;  5FGO A;  1O7N B;  1GMP A;  2W9P A;  1VQ9 3;  1OHS A;  2FXT A;  1YNV X;  4STD A;  1FGO A;  5AEW B;  5D82 A;  4GSP A;  4L8O A;  4Q53 A;  1JB2 A;  3KN4 A;  3NBJ A;  1X1W A;  3FF0 A;  1EEJ A;  1IQY A;  1GD3 A;  1E3V A;  1I0V A;  4RZM A;  4H3U A;  3ECF A;  4JF8 A;  1BOX A;  4BU4 A;  5ELJ A;  1ZX2 A;  1STD A;  5JBS A;  4KVH A;  3UJM A;  4N6U A;  1LNH A;  1TTO A;  3GAX A;  1FGR A;  3H51 A;  3MHE A;  2IUJ A;  1RGH A;  1DET A;  3LT8 A;  2CWV A;  2F98 A;  1BRN L;  1R4C A;  2QEX 3;  4H61 A;  4XDV A;  5IEO A;  1E3R A;  2BT3 A;  2L1S A;  1ZO2 A;  1V58 A;  2BHM A;  3KSE D;  4HM5 B;  9RNT A;  1IYY A;  1I2F A;  2KF5 A;  1A2V A;  4OVM A;  1BAO A;  2F86 B;  3CPO A;  2CWU A;  1GD4 A;  1ISK A;  3NV0 A;  1BNE A;  1IU7 A;  3JUM A;  2GXF A;  3F8H A;  4IT7 A;  3UL6 A;  3X3Y A;  1JNQ A;  5DRE A;  1W6G A;  2YFL B;  3WHO A;  1RDS A;  3PYJ A;  3X3Z A;  3CXC 2;  3OV4 A;  1RGE A;  5D81 A;  2KCD A;  3DGN A;  3SED A;  4NPB A;  4IIA A;  2GU3 A;  4MMY B;  4CJN A;  5D83 A;  2RCD A;  4XDW A;  2YFI B;  3PGB A;  3F40 A;  4LMI A;  4EYC A;  3CME 3;  1N9J A;  3HK4 A;  3WOD G;  5EQL A;  3WA2 X;  1VQ6 3;  1G0T A;  1GY7 A;  4HM2 B;  1JRQ A;  1OUN A;  2ML6 A;  2C11 A;  1QAK A;  2UGI A;  2CKF B;  2W9Q A;  1B2M A;  3X40 A;  3DMC A;  2SAR A;  2XFS A;  3NV0 B;  5RNT A;  1RGG A;  3CCM 3;  4HM1 B;  4FCZ A;  1RGC A;  3ROB A;  2CW9 A;  1D6Y A;  3LYG A;  3FH1 A;  1FA3 A;  3NQZ A;  3DY5 A;  3QK9 A;  4JRF A;  4K90 B;  4XBX A;  3WOE B;  4MJD A;  3GSP A;  2PZV A;  2XSH B;  1BAN A;  1B3S A;  1RGK A;  2CHC A;  4NHF A;  3WR2 A;  1SAR A;  4HM0 B;  1W6C A;  1YHQ 3;  4N6N B;  1KD1 4;  1BUQ A;  1DVC A;  2Z6B A;  1YVB I;  3G16 A;  1S5A A;  2ML5 A;  1UCL A;  2UX0 A;  1UGH I;  1X1X A;  2D42 A;  3KCH A;  4HM7 B;  1UUV B;  2W03 A;  5KP3 A;  4RBN A;  1MOL A;  2OTL 3;  1QVF 2;  4I4K A;  4RNT A;  3N8B A;  2YX9 A;  1RN1 A;  5IG4 A;  3D5G A;  1W2B 2;  1W6Y A;  1TRQ A;  1WQL B;  3OWS A;  1W4N A;  3EN8 A;  2YFJ B;  2R4I A;  5ELU A;  3EF8 A;  5EVH A;  2KRT A;  2IY2 A;  2XGL A;  1QAF A;  4XB5 A;  3GZB A;  2Z77 A;  2K54 A;  3LTB A;  1SIH A;  6STD A;  1DMN A;  2WO0 A;  4HM4 B;  4IPB A;  1W01 A;  4U13 A;  4BTW A;  3I56 3;  3FG3 A;  5AYS C;  1PU4 A;  5CXO A;  3CCQ 3;  1RNB A;  1K28 A;  3LML A;  1JBS A;  2L4V A;  6RNT A;  2FGT A;  2E2U A;  3CNM A;  5AII A;  2STD A;  3LZA A;  1UI8 A;  1PY3 A;  3CCV 3;  1IT7 A;  1GOV A;  5STD A;  1HZ1 A;  2ZHX B;  3GRD A;  4ZM8 A;  1BU4 A;  2Z7A A;  1OF5 A;  2CG0 A;  4HM3 B;  4O3V A;  1VQO 3;  4PEJ A;  3N9H A;  4RNY A;  2BO9 B;  3U97 A;  8RNT A; 
#chains in the Genus database with same CATH homology
 1Q9E A;  1LOV A;  1RGL A;  1BNS A;  1C54 A;  1YGW A;  5BU4 A;  1GMP A;  1RLS A;  2HOH A;  1LNI A;  5GSP A;  6GSP A;  1YNV X;  7GSP A;  1B2U A;  1TRP A;  4GSP A;  1GOY A;  1BIR A;  1GMQ A;  1X1W A;  1RHL A;  2F56 A;  3RNT A;  2KAA A;  3AHW A;  1FUS A;  1I0V A;  1BOX A;  4BU4 A;  1RSN A;  1UCJ A;  3A5E A;  3AGO A;  1B2Z A;  1BRG A;  1BGS A;  1B2X A;  1GMR A;  1TTO A;  3AGN A;  1RCK A;  3Q3F A;  1T2H A;  1RGH A;  1DET A;  1BRN L;  1PYL A;  7RNT A;  1BNR A;  2AAD A;  1BNJ A;  2F4Y A;  1IYY A;  9RNT A;  1I2F A;  2KF5 A;  1T2I A;  1BAO A;  1CH0 A;  1ZGX A;  1BNE A;  1BRJ A;  1MGR A;  3DGY A;  4HOH A;  4J5G A;  3URP A;  1AY7 A;  1I3I A;  3WHO A;  1RDS A;  3DH2 A;  1YVS A;  1BSB A;  1FZU A;  1RGE A;  1BRK A;  1BVI A;  3BU4 A;  2BIR A;  1LRA A;  1B27 A;  1UCK A;  1BNG A;  1RMS A;  2RBI A;  1I3F A;  3BIR A;  1LOW A;  2ZA4 A;  1HYF A;  2RNT A;  1UCI A;  1FW7 A;  1B2M A;  4GHO A;  2SAR A;  5RNT A;  1RGG A;  1GOU A;  1LOY A;  1FUT A;  1RGC A;  2KF3 A;  2AAE A;  1I8V A;  1G02 A;  1RGA A;  3GSP A;  3AHS A;  1I70 A;  1BAN A;  2F5M A;  3SYU A;  1B21 A;  1B3S A;  1RGK A;  4BIR A;  1BUJ A;  3WR2 A;  1BRS A;  1SAR A;  3D4A A;  1JBT A;  1RNT A;  1RTU A;  1X1Y A;  2KF6 A;  1B20 A;  1AQZ A;  1RCL A;  1BRH A;  1GSP A;  1RN4 A;  1A2P A;  1UCL A;  1X1X A;  3KCH A;  1JBR A;  1FYS A;  4J5K A;  1I2E A;  2GSP A;  2F5W A;  2BU4 A;  3D5I A;  4RNT A;  1RN1 A;  3D5G A;  1TRQ A;  1I2G A;  1BRI A;  1MGW A;  1BNI A;  1BSE A;  1RNB A;  1JBS A;  1BNF A;  1DE3 A;  6RNT A;  3HOH A;  1X1U A;  2C4B A;  1B2S A;  1BSD A;  2KF4 A;  4HAA A;  1BSA A;  1I0X A;  1PY3 A;  1GOV A;  1BSC A;  1HZ1 A;  5HOH A;  1BU4 A;  1R4Y A;  5BIR A;  1RGF A;  8RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...