2RNTA

Three-dimensional structure of ribonuclease t1 complexed with guanylyl-2(prime),5(prime)-guanosine at 1.8 angstroms resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of ribonuclease T1 complexed with guanylyl-2',5'-guanosine at 1.8 A resolution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1988-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2rntA00
1LOWA 1RGLA 4GHOA 1BRGA 4J5KA 1UCKA 1RCKA 4J5GA 1BGSA 2GSPA 1UCLA 1BSDA 1BNFA 1BRJA 4GSPA 5GSPA 1RDSA 1X1YA 1RNTA 1BRNL 1I3IA 1BIRA 2KF4A 8RNTA 1B2XA 1PY3A 1YVSA 1B3SA 2KF3A 3AHWA 3SYUA 2AADA 3AHSA 1BANA 1A2PA 1BRHA 1BRIA 1I8VA 4BU4A 7RNTA 2RBIA 5RNTA 1RN4A 1B20A 1BUJA 1T2HA 4HAAA 1MGRA 1RMSA 1RGEA 2BIRA 1BAOA 2AAEA 1BRKA 1BNGA 1B2MA 1CH0A 1PYLA 1JBSA 1BU4A 1JBRA 2KF5A 3URPA 1X1WA 4BIRA 5BIRA 1LOVA 1BSEA 1Q9EA 1SARA 6RNTA 1HYFA 1LOYA 1BNSA 1I0XA 1BSAA 1RGFA 2F5WA 1MGWA 4HOHA 1R4YA 1RHLA 1GMPA 1HZ1A 1GOYA 1B27A 1X1UA 1C54A 1T2IA 1AQZA 1FYSA 3DGYA 3D5GA 1JBTA 1RGKA 1LNIA 1X1XA 1RNBA 1TRQA 1RCLA 1BNIA 3BU4A 5HOHA 3GSPA 3WR2A 1RGHA 1DE3A 2F5MA 4RNTA 3KCHA 3D4AA 1RGCA 1BNRA 1RLSA 1BSCA 1TTOA 1B2SA 2BU4A 3DH2A 1BRSA 1DETA 2SARA 1YNVX 1I2FA 2C4BA 1FUTA 1I0VA 3AGNA 1FZUA 3AGOA 1FW7A 2F56A 1B21A 2RNTA 3D5IA 1YGWA 1LRAA 1B2UA 1B2ZA 3A5EA 3Q3FA 1GMRA 7GSPA 9RNTA 6GSPA 3RNTA 5BU4A 1BNEA 2F4YA 1GMQA 1TRPA 1UCIA 2KF6A 1GOUA 1G02A 1GOVA 1FUSA 1BSBA 2HOHA 1RN1A 1ZGXA 3WHOA 1BOXA 1RGAA 1IYYA 3BIRA 1UCJA 1AY7A 1I2GA 1BNJA 1I3FA 1RSNA 1RTUA 1GSPA 1I2EA 2ZA4A 1RGGA 3HOHA 1I70A 2KAAA 1BVIA
chains in the Genus database with same CATH superfamily
2W03A 2OOVC 5CK6A 4LMIA 4IPBA 4J9AA 3U1WA 1BRGA 1NJI4 3FLJA 3M8CA 3QRDA 1IV9A 1RCKA 4FMDA 3JUMA 3CCJ3 4R80A 2STDA 1UCLA 5AYRB 2CFGA 2CW9A 1BNFA 2CWTA 2YFJB 4G1MB 4GSPA 3I563 4N6OB 1DYUA 2KF4A 1BIRA 1JZDA 2H0HA 4QWTA 4WHAA 3SXXA 3NBJA 2RSXA 1LNHA 1B3SA 1QALA 1YVSA 2CK3H 2KF3A 1PFPA 3AHSA 3AHWA 4LYLB 1G96A 3H51A 4HM4B 2B1XB 3F7SA 1BANA 3CU3A 1N5HA 1A2PA 2Z76A 4EYCA 5KP1A 4XDWA 1N5PA 2QEX3 1VZZA 1TUHA 3CD63 4HZ9B 1WNHA 5AIIA 1BUJA 3EN1B 1SJWA 1MGRA 3E99A 2JQ5A 2CHCA 2YX9A 3VGNA 2KRTA 1VQL3 3UL6A 1BNGA 3B4OA 1EQKA 1JBRA 3KFQC 2K0MA 2OWPA 1Q40A 3L0RA 3HZPA 1FUWA 4BIRA 1LXEA 1JZOA 2C10A 3HX8A 2WO0A 1OF5B 2ZL8A 4ILFA 3GRDA 5AEWB 2YFIB 3NM7A 1W6CA 3CCR3 4WP5A 3NHXA 1OPYA 2R41A 1YVBI 2QGUA 2OOVA 1BSAA 1OGXA 1MGWA 3BNBA 4FR9A 4HOHA 4JF8A 4O2HA 2E2VA 3SOYA 1GOYA 1N9EA 4XBTA 3GWRA 1WMOA 1JB5A 1T2IA 3FF0A 4I4KA 4EXRA 1C54A 3DGYA 3S27A 3B4PA 1SPUA 3DXOA 3Q2PA 3CNMA 2P0XA 1LNIA 2P0MA 3LTDA 1RNBA 1TRQA 3K7CA 6RNTA 1BNIA 3BU4A 4HM3B 3GSPA 2WGOA 1AR0A 1A2KA 1FGRA 4DKIA 3G713 3PZWA 2F5MA 4IIAA 4MMZB 2E2TA 1LOXA 1RGCA 4L7KA 1BNRA 2BMOB 1BSCA 5AYSC 5BXQA 2BU4A 2P38A 4MMXB 2BT3A 3CC23 1BRSA 3D9RA 3G8ZA 3HIGA 4HYZA 2W9QA 4KFEA 4O02B 4R9KA 3OWSA 4XBXA 5AEUB 2CWUA 5IG0A 2P05A 5M18A 1I0VA 3B7CA 1Y4KA 3AGNA 3KN4A 4RBNA 4I5QA 3G16A 3CPW2 1MWTA 1SIIA 3Q90A 1FW7A 2XR8B 4ORLA 3KIIA 3GAXA 2CFLA 1V74A 1D6UA 1B2UA 2W56B 4R1KA 1ZX2A 3BLZA 3OX9A 1UW1A 7GSPA 4X2HA 3SOAA 6GSPA 3RNTA 1J2BA 1IVVA 1GMQA 3ZFZA 2KF6A 1GY5A 3ECFA 1G02A 4HKVB 3F7XA 3EQQB 3K5TA 5D83A 3CME3 5IERA 3MWZA 2HMJB 5FW5A 1BOXA 3EC9A 1VQM3 3FKAA 1ROVA 1UI7A 3LT8A 1AY7A 1I3FA 1BNJA 3H3HA 5STDA 1RTUA 4WWUC 3GZYB 2ZA4A 5IEPA 3KSED 1NB3I 1RGGA 1RKYA 3VSYA 2KAAA 3FH1A 3G4S3 1EUIC 1LOWA 1RGLA 3CCM3 1D6YA 1FGQA 6STDA 3X3ZA 4J5KA 1OHPA 3UJMA 3NV0A 1VQK3 2CX0A 1KC84 1E97A 1O7NB 2QIYA 2GBXB 4J5GA 1IT8A 1BGSA 2GSPA 3DGOA 4LEHA 5HGRA 1BRJA 4N6LA 1IT7A 3B8LA 3K0ZA 1HKXA 2BHMA 3WMDA 1A67A 1PU4A 3IPTA 1I3IA 4AKYA 4JRFA 3WOEB 3T8NA 5KP4A 2W6JH 4HM8B 4OUQA 3K9MC 1ROAA 4N6TA 3SYUA 1GY7A 3CCQ3 1IQ8A 3DY5A 3HI7A 5CF1A 3EX9A 2I9WA 1BRHA 3BNEA 1RN4A 1B20A 1JN5B 1UGIA 2UX0A 7STDA 1YJN3 1G0TA 3MG3A 1VQ43 1BAOA 3ALAA 1B2MA 1IVWA 4TX4A 1ULJB 4NHFA 1OACA 3MHEA 1SQWA 3SX1A 1Q864 4GB5A 1JBSA 2ZHXB 2ZDJA 3KE7A 3LTAA 3URPA 4HM5B 2F86B 1SARA 3FGYA 3CCE3 3ZG5A 2CC3A 3U97A 2GU1A 4J8TA 1RN7A 4BTXA 3S29A 1ZS7A 1N8R4 1W6GA 3EB8A 1OGZA 1TFOA 1VQN3 1D6ZA 1IU7A 1IQXA 1GMPA 2P09A 2B24B 1FGOA 3NBRA 4HM6B 2L4VA 1YHQ3 1GY6A 4KFFA 3STDA 3X3XA 4K1VA 1O7HB 3D5GA 1JBTA 3J7Yd 4H61A 4XM4A 3DGLA 2QA43 1NWWA 3BNCA 4HM0B 1WMNA 5HOHA 2CIUA 1DMNA 3CNXA 3EF8A 1LQMB 3MPHA 4CDLA 3D4AA 2W2CA 2CKFB 2ML5A 2CG0A 1KQS2 2D42A 2XSOB 4FMAA 2M7OA 3QK9A 1UI8A 1A90A 4XDVA 1IV7A 1DETA 2SARA 3NXJA 3CMA3 1VQO3 5IEOA 1WQLB 3G0KA 2BO9B 1I2FA 1LQGC 1KSIA 3SVAA 2OTJ3 4FCMA 1NDOB 1RRHA 2HMOB 3JUNA 4N6MA 3ER7A 1WTHA 1YGWA 3EJVA 3NUVA 3WOFB 3JVCA 4Q53A 1W01A 4EV2A 1QVG2 3X3YA 5EQLA 3WA2X 3Q3FA 9RNTA 3EHCA 4MJDA 1NB5I 3LOYA 4HZBB 1UCIA 1K41A 3I553 1YI23 2CFWA 1MNLA 3CC73 1TP6A 2UUGC 4O3VA 2HOHA 3BNDA 1DMQA 1QJGA 1FGMA 1AVKA 1CEWI 1MWUA 5KP3A 1L5GB 5JPUA 1IYYA 5JBSA 3T8UA 2GBWB 1W2B2 4WFOA 3NBBA 1C7HA 2CFDA 2FGTA 2XGLA 1GSPA 1TJDA 3T0UA 1I2EA 4EBGA 3DGMA 3G6E3 3OWYA 3HOHA 2WGQA 1BVIA 3JUQA 5EVHA 3IMAB 4H3UA 5CXOA 1Q40B 3CXC2 1IK3A 4EV5A 1DMMA 1UCKA 2O9UX 2XH9A 2XRXB 2PZVA 3F14A 1Q824 3S67A 2E2UA 2FNQA 4X2OA 3F40A 3I0YA 4EC6A 4N6UA 4NPBA 1K734 4N6NB 2CH9A 1HU9A 2XEPA 3LZAA 5GSPA 1E3RA 1W00A 1DVDA 1STFI 2Y73A 5M1AA 3FZWA 1BRNL 1VQQA 1O7GB 1S5AA 4K90B 1B2XA 3GZXB 8RNTA 4AKZA 2BNGA 1W7CA 3MG2A 2Z77A 1K8A4 3S28A 4N6V0 4BTWA 1S723 1M904 1UDII 1W4NA 2CX1A 1I8VA 3MYTA 2RCDA 3UB1A 3KSPA 4BU4A 7RNTA 2OTL3 5RNTA 1FA3A 2D1WA 1KD14 5AIHA 1T2HA 4HAAA 1RMSA 2C11A 2AAEA 1WMPA 5ELUA 1PYLA 1NNVA 4FMCA 5IF6A 5G2GA 1BU4A 1NO3A 1E3VA 1X1WA 2CWVA 2IUKA 1YJ93 2ML6A 4FCJA 1MWSA 1TIJA 2O3OA 1JB4A 1A2VA 4K1UA 3BB9A 1T3BA 2F98A 3MSOA 5AIFA 2J8XB 3Q1CA 3RGRA 1O7WB 1BNSA 1OHSA 1I0XA 2BMQB 1YGEA 2IMJA 1RGFA 2F5WA 1STDA 1QAFA 1MOLA 1HZ1A 3NQZA 4KZ1A 1OF5A 3V92A 3LH4A 3NM2A 5EEOA 5G1LA 3FSDA 3FF2A 4OK0A 3FG4A 2Z7AA 1X1XA 4KVHA 1RCLA 2JDIH 5M19A 3PYJA 1R4CA 1YJW3 2KXGA 3WR2A 2RGQA 4HBRA 3CCV3 4KT3B 1LVNA 3FG3A 1K28A 4MEIA 1DE3A 1ASKA 1NU3A 3A76A 1W6YA 2W0QA 3KCHA 2INXA 2WOFA 3EBYA 3FG1A 1VQ73 1V58A 2W9PA 5LC7A 4AEQA 3LXUX 4WYKA 1QVF2 1B2SA 2H0GA 3DH2A 3X40A 1Q814 1Q42A 2F99A 4OVMA 3CPOA 2GEXA 4CCVA 3TDGA 3D79A 4XB5A 2C4BA 4XBYA 1FZUA 1O7MB 1B21A 2RNTA 3OV4A 3OXAA 1W5ZA 4MMYB 3D5IA 1N9JA 1VQ83 1YIJ3 1LRAA 2GEYA 3F9SA 4R9LA 4BTYA 3LT9A 3DMCA 3X42A 4EW5A 1KWIA 5BU4A 2KCDA 4L8PA 2Z6BA 4ZM8A 4HM7B 2H0IA 4IT7A 3V98A 3DM8A 5BVBA 1JB2A 1FUSA 2LQVA 5FGOA 4U13A 2HMKB 3IJEB 1BSBA 1UGHI 1RN1A 1M1XB 3V99A 5D81A 1ISKA 1RGAA 4R4KA 4LZIA 3K63A 2GU3A 1VQ93 1I2GA 3LTBA 1RSNA 3CC43 1OH0A 3SLUA 1QAKA 5A0OB 3DZLA 1I70A 4K61A 5CF2A 1AQZA 1JV2B 1W2ZA 3VF1A 4GHOA 3EBTA 5TGNA 1SIHA 3CCU3 2IA7A 3PCRA 2HMLB 1BSDA 1IDPA 1JN5A 4PEJA 1T5YA 4LSOA 3DUKA 3NX0A 3F8XA 1RDSA 1X1YA 1RNTA 3PGBA 3HIIA 2CFKA 1PY3A 3AMOB 5G1KA 1JKGB 2AADA 3SEDA 4N3VA 1UUWB 2UGIA 1BRIA 1ULIB 2XFSA 3EE1A 2RBIA 3LYGA 5JPPA 3OW22 1ZO2A 2IY2A 1Q7Y4 1CYUA 1AVLA 5IG4A 1OUNA 1EEJA 4HM1B 1RGEA 2BIRA 2OCTA 4RNYA 1CYVA 1BRKA 1N8QA 2SBLA 1CH0A 1RRLA 2HMNB 3PXMA 3ZG0A 4O8SA 3N54B 1JNQA 2KF5A 1GYBA 5BIRA 2K54A 1LOVA 1BSEA 1RJOA 3LMLA 2IUJA 3S5CA 3GZRA 3DGNA 1JRQA 1Q9EA 2MC8A 5D82A 1F8NA 1HYFA 1LOYA 1U8CB 4GL6A 3OWUA 5ELJA 1UUGB 2FXTA 2IYJA 3RGAA 3LTCA 3CCS3 1EKMA 4CJNA 1R4YA 1RHLA 1MWRA 1M9GA 1B27A 1X1UA 3D3LA 3CCL3 1IQYA 1US1A 1FYSA 1W02A 1FGTA 4CPKA 3WODG 1BUQA 2Y74A 3UNLA 1Q7HA 1RGKA 3MKIA 5IW9A 4KFDA 3ROBA 4RZMA 5IG3A 3X41A 3KKGA 3N9HA 1Z1SA 3EN8A 1RGHA 2YFLB 5LC6A 4BL3A 2WOHA 1K9M4 4RNTA 3GZBA 1GD3A 2MF7A 1TFKA 2K3DA 1AV4A 5I97A 4STDA 2LYXA 1RLSA 1TTOA 1DVCA 1IVXA 1YIT3 1JJ22 2A15A 2XFTA 3O8YA 1UUVB 3JUPA 2RFRA 1GS3A 3F8HA 2BMRB 1YNVX 5IENA 2GXFA 3RDEA 5AI1A 1O7PB 1FUTA 2PNCA 2XF3A 3FCSB 3N8BA 2HMMB 2OQEA 2OQEC 3MG1A 3AGOA 2F56A 3WA3A 4WYKB 3JUOA 1OHOA 3PCSA 4FMBA 1QMAA 4BL2A 1VQ53 4NREA 1JKGA 1B2ZA 4LGQA 3A5EA 2V1LA 1GMRA 3AMOA 3PS8A 1OCVA 2W56A 3WDGB 2XGNA 4HJLB 1M1K4 5DREA 1BNEA 2F4YA 8CHOA 4FCZA 1TU5A 1TRPA 1U5OA 1GOUA 3HK4A 1CQSA 1EG9B 3KZTA 1IVUA 1GOVA 5AIGA 1V57A 2Q07A 4HM2B 3UL5A 5IG5A 1VQ63 5DRVA 3NQYA 2R4IA 2XSHB 1ZGXA 2CG1A 3WHOA 2W04A 3BIRA 1UCJA 1GD4A 1VQP3 4HVNA 4RNZA 1EA2A 5CLKA 4L8OA 3NV0B 2L1SA
chains in the Genus database with same CATH topology
1LOWA 1RGLA 4GHOA 1BRGA 4J5KA 1UCKA 1RCKA 4J5GA 1BGSA 2GSPA 1UCLA 1BSDA 1BNFA 1BRJA 4GSPA 5GSPA 1RDSA 1X1YA 1RNTA 1BRNL 1I3IA 1BIRA 2KF4A 8RNTA 1B2XA 1PY3A 1YVSA 1B3SA 2KF3A 3AHWA 3SYUA 2AADA 3AHSA 1BANA 1A2PA 1BRHA 1BRIA 1I8VA 4BU4A 7RNTA 2RBIA 5RNTA 1RN4A 1B20A 1BUJA 1T2HA 4HAAA 1MGRA 1RMSA 1RGEA 2BIRA 1BAOA 2AAEA 1BRKA 1BNGA 1B2MA 1CH0A 1PYLA 1JBSA 1BU4A 1JBRA 2KF5A 3URPA 1X1WA 4BIRA 5BIRA 1LOVA 1BSEA 1Q9EA 1SARA 6RNTA 1HYFA 1LOYA 1BNSA 1I0XA 1BSAA 1RGFA 2F5WA 1MGWA 4HOHA 1R4YA 1RHLA 1GMPA 1HZ1A 1GOYA 1B27A 1X1UA 1C54A 1T2IA 1AQZA 1FYSA 3DGYA 3D5GA 1JBTA 1RGKA 1LNIA 1X1XA 1RNBA 1TRQA 1RCLA 1BNIA 3BU4A 5HOHA 3GSPA 3WR2A 1RGHA 1DE3A 2F5MA 4RNTA 3KCHA 3D4AA 1RGCA 1BNRA 1RLSA 1BSCA 1TTOA 1B2SA 2BU4A 3DH2A 1BRSA 1DETA 2SARA 1YNVX 1I2FA 2C4BA 1FUTA 1I0VA 3AGNA 1FZUA 3AGOA 1FW7A 2F56A 1B21A 2RNTA 3D5IA 1YGWA 1LRAA 1B2UA 1B2ZA 3A5EA 3Q3FA 1GMRA 7GSPA 9RNTA 6GSPA 3RNTA 5BU4A 1BNEA 2F4YA 1GMQA 1TRPA 1UCIA 2KF6A 1GOUA 1G02A 1GOVA 1FUSA 1BSBA 2HOHA 1RN1A 1ZGXA 3WHOA 1BOXA 1RGAA 1IYYA 3BIRA 1UCJA 1AY7A 1I2GA 1BNJA 1I3FA 1RSNA 1RTUA 1GSPA 1I2EA 2ZA4A 1RGGA 3HOHA 1I70A 2KAAA 1BVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LOW A;  1RGL A;  4GHO A;  1BRG A;  4J5K A;  1UCK A;  1RCK A;  4J5G A;  1BGS A;  2GSP A;  1UCL A;  1BSD A;  1BNF A;  1BRJ A;  4GSP A;  5GSP A;  1RDS A;  1X1Y A;  1RNT A;  1BRN L;  1I3I A;  1BIR A;  2KF4 A;  8RNT A;  1B2X A;  1PY3 A;  1YVS A;  1B3S A;  2KF3 A;  3AHW A;  3SYU A;  2AAD A;  3AHS A;  1BAN A;  1A2P A;  1BRH A;  1BRI A;  1I8V A;  4BU4 A;  7RNT A;  2RBI A;  5RNT A;  1RN4 A;  1B20 A;  1BUJ A;  1T2H A;  4HAA A;  1MGR A;  1RMS A;  1RGE A;  2BIR A;  1BAO A;  2AAE A;  1BRK A;  1BNG A;  1B2M A;  1CH0 A;  1PYL A;  1JBS A;  1BU4 A;  1JBR A;  2KF5 A;  3URP A;  1X1W A;  4BIR A;  5BIR A;  1LOV A;  1BSE A;  1Q9E A;  1SAR A;  6RNT A;  1HYF A;  1LOY A;  1BNS A;  1I0X A;  1BSA A;  1RGF A;  2F5W A;  1MGW A;  4HOH A;  1R4Y A;  1RHL A;  1GMP A;  1HZ1 A;  1GOY A;  1B27 A;  1X1U A;  1C54 A;  1T2I A;  1AQZ A;  1FYS A;  3DGY A;  3D5G A;  1JBT A;  1RGK A;  1LNI A;  1X1X A;  1RNB A;  1TRQ A;  1RCL A;  1BNI A;  3BU4 A;  5HOH A;  3GSP A;  3WR2 A;  1RGH A;  1DE3 A;  2F5M A;  4RNT A;  3KCH A;  3D4A A;  1RGC A;  1BNR A;  1RLS A;  1BSC A;  1TTO A;  1B2S A;  2BU4 A;  3DH2 A;  1BRS A;  1DET A;  2SAR A;  1YNV X;  1I2F A;  2C4B A;  1FUT A;  1I0V A;  3AGN A;  1FZU A;  3AGO A;  1FW7 A;  2F56 A;  1B21 A;  2RNT A;  3D5I A;  1YGW A;  1LRA A;  1B2U A;  1B2Z A;  3A5E A;  3Q3F A;  1GMR A;  7GSP A;  9RNT A;  6GSP A;  3RNT A;  5BU4 A;  1BNE A;  2F4Y A;  1GMQ A;  1TRP A;  1UCI A;  2KF6 A;  1GOU A;  1G02 A;  1GOV A;  1FUS A;  1BSB A;  2HOH A;  1RN1 A;  1ZGX A;  3WHO A;  1BOX A;  1RGA A;  1IYY A;  3BIR A;  1UCJ A;  1AY7 A;  1I2G A;  1BNJ A;  1I3F A;  1RSN A;  1RTU A;  1GSP A;  1I2E A;  2ZA4 A;  1RGG A;  3HOH A;  1I70 A;  2KAA A;  1BVI A; 
#chains in the Genus database with same CATH topology
 2W03 A;  2OOV C;  5CK6 A;  4LMI A;  4IPB A;  4J9A A;  3U1W A;  1BRG A;  1NJI 4;  3FLJ A;  3M8C A;  3QRD A;  1IV9 A;  1RCK A;  4FMD A;  3JUM A;  3CCJ 3;  4R80 A;  2STD A;  1UCL A;  5AYR B;  2CFG A;  2CW9 A;  1BNF A;  2CWT A;  2YFJ B;  4G1M B;  4GSP A;  3I56 3;  4N6O B;  1DYU A;  2KF4 A;  1BIR A;  1JZD A;  2H0H A;  4QWT A;  4WHA A;  3SXX A;  3NBJ A;  2RSX A;  1LNH A;  1B3S A;  1QAL A;  1YVS A;  2CK3 H;  2KF3 A;  1PFP A;  3AHS A;  3AHW A;  4LYL B;  1G96 A;  3H51 A;  4HM4 B;  2B1X B;  3F7S A;  1BAN A;  3CU3 A;  1N5H A;  1A2P A;  2Z76 A;  4EYC A;  5KP1 A;  4XDW A;  1N5P A;  2QEX 3;  1VZZ A;  1TUH A;  3CD6 3;  4HZ9 B;  1WNH A;  5AII A;  1BUJ A;  3EN1 B;  1SJW A;  1MGR A;  3E99 A;  2JQ5 A;  2CHC A;  2YX9 A;  3VGN A;  2KRT A;  1VQL 3;  3UL6 A;  1BNG A;  3B4O A;  1EQK A;  1JBR A;  3KFQ C;  2K0M A;  2OWP A;  1Q40 A;  3L0R A;  3HZP A;  1FUW A;  4BIR A;  1LXE A;  1JZO A;  2C10 A;  3HX8 A;  2WO0 A;  1OF5 B;  2ZL8 A;  4ILF A;  3GRD A;  5AEW B;  2YFI B;  3NM7 A;  1W6C A;  3CCR 3;  4WP5 A;  3NHX A;  1OPY A;  2R41 A;  1YVB I;  2QGU A;  2OOV A;  1BSA A;  1OGX A;  1MGW A;  3BNB A;  4FR9 A;  4HOH A;  4JF8 A;  4O2H A;  2E2V A;  3SOY A;  1GOY A;  1N9E A;  4XBT A;  3GWR A;  1WMO A;  1JB5 A;  1T2I A;  3FF0 A;  4I4K A;  4EXR A;  1C54 A;  3DGY A;  3S27 A;  3B4P A;  1SPU A;  3DXO A;  3Q2P A;  3CNM A;  2P0X A;  1LNI A;  2P0M A;  3LTD A;  1RNB A;  1TRQ A;  3K7C A;  6RNT A;  1BNI A;  3BU4 A;  4HM3 B;  3GSP A;  2WGO A;  1AR0 A;  1A2K A;  1FGR A;  4DKI A;  3G71 3;  3PZW A;  2F5M A;  4IIA A;  4MMZ B;  2E2T A;  1LOX A;  1RGC A;  4L7K A;  1BNR A;  2BMO B;  1BSC A;  5AYS C;  5BXQ A;  2BU4 A;  2P38 A;  4MMX B;  2BT3 A;  3CC2 3;  1BRS A;  3D9R A;  3G8Z A;  3HIG A;  4HYZ A;  2W9Q A;  4KFE A;  4O02 B;  4R9K A;  3OWS A;  4XBX A;  5AEU B;  2CWU A;  5IG0 A;  2P05 A;  5M18 A;  1I0V A;  3B7C A;  1Y4K A;  3AGN A;  3KN4 A;  4RBN A;  4I5Q A;  3G16 A;  3CPW 2;  1MWT A;  1SII A;  3Q90 A;  1FW7 A;  2XR8 B;  4ORL A;  3KII A;  3GAX A;  2CFL A;  1V74 A;  1D6U A;  1B2U A;  2W56 B;  4R1K A;  1ZX2 A;  3BLZ A;  3OX9 A;  1UW1 A;  7GSP A;  4X2H A;  3SOA A;  6GSP A;  3RNT A;  1J2B A;  1IVV A;  1GMQ A;  3ZFZ A;  2KF6 A;  1GY5 A;  3ECF A;  1G02 A;  4HKV B;  3F7X A;  3EQQ B;  3K5T A;  5D83 A;  3CME 3;  5IER A;  3MWZ A;  2HMJ B;  5FW5 A;  1BOX A;  3EC9 A;  1VQM 3;  3FKA A;  1ROV A;  1UI7 A;  3LT8 A;  1AY7 A;  1I3F A;  1BNJ A;  3H3H A;  5STD A;  1RTU A;  4WWU C;  3GZY B;  2ZA4 A;  5IEP A;  3KSE D;  1NB3 I;  1RGG A;  1RKY A;  3VSY A;  2KAA A;  3FH1 A;  3G4S 3;  1EUI C;  1LOW A;  1RGL A;  3CCM 3;  1D6Y A;  1FGQ A;  6STD A;  3X3Z A;  4J5K A;  1OHP A;  3UJM A;  3NV0 A;  1VQK 3;  2CX0 A;  1KC8 4;  1E97 A;  1O7N B;  2QIY A;  2GBX B;  4J5G A;  1IT8 A;  1BGS A;  2GSP A;  3DGO A;  4LEH A;  5HGR A;  1BRJ A;  4N6L A;  1IT7 A;  3B8L A;  3K0Z A;  1HKX A;  2BHM A;  3WMD A;  1A67 A;  1PU4 A;  3IPT A;  1I3I A;  4AKY A;  4JRF A;  3WOE B;  3T8N A;  5KP4 A;  2W6J H;  4HM8 B;  4OUQ A;  3K9M C;  1ROA A;  4N6T A;  3SYU A;  1GY7 A;  3CCQ 3;  1IQ8 A;  3DY5 A;  3HI7 A;  5CF1 A;  3EX9 A;  2I9W A;  1BRH A;  3BNE A;  1RN4 A;  1B20 A;  1JN5 B;  1UGI A;  2UX0 A;  7STD A;  1YJN 3;  1G0T A;  3MG3 A;  1VQ4 3;  1BAO A;  3ALA A;  1B2M A;  1IVW A;  4TX4 A;  1ULJ B;  4NHF A;  1OAC A;  3MHE A;  1SQW A;  3SX1 A;  1Q86 4;  4GB5 A;  1JBS A;  2ZHX B;  2ZDJ A;  3KE7 A;  3LTA A;  3URP A;  4HM5 B;  2F86 B;  1SAR A;  3FGY A;  3CCE 3;  3ZG5 A;  2CC3 A;  3U97 A;  2GU1 A;  4J8T A;  1RN7 A;  4BTX A;  3S29 A;  1ZS7 A;  1N8R 4;  1W6G A;  3EB8 A;  1OGZ A;  1TFO A;  1VQN 3;  1D6Z A;  1IU7 A;  1IQX A;  1GMP A;  2P09 A;  2B24 B;  1FGO A;  3NBR A;  4HM6 B;  2L4V A;  1YHQ 3;  1GY6 A;  4KFF A;  3STD A;  3X3X A;  4K1V A;  1O7H B;  3D5G A;  1JBT A;  3J7Y d;  4H61 A;  4XM4 A;  3DGL A;  2QA4 3;  1NWW A;  3BNC A;  4HM0 B;  1WMN A;  5HOH A;  2CIU A;  1DMN A;  3CNX A;  3EF8 A;  1LQM B;  3MPH A;  4CDL A;  3D4A A;  2W2C A;  2CKF B;  2ML5 A;  2CG0 A;  1KQS 2;  2D42 A;  2XSO B;  4FMA A;  2M7O A;  3QK9 A;  1UI8 A;  1A90 A;  4XDV A;  1IV7 A;  1DET A;  2SAR A;  3NXJ A;  3CMA 3;  1VQO 3;  5IEO A;  1WQL B;  3G0K A;  2BO9 B;  1I2F A;  1LQG C;  1KSI A;  3SVA A;  2OTJ 3;  4FCM A;  1NDO B;  1RRH A;  2HMO B;  3JUN A;  4N6M A;  3ER7 A;  1WTH A;  1YGW A;  3EJV A;  3NUV A;  3WOF B;  3JVC A;  4Q53 A;  1W01 A;  4EV2 A;  1QVG 2;  3X3Y A;  5EQL A;  3WA2 X;  3Q3F A;  9RNT A;  3EHC A;  4MJD A;  1NB5 I;  3LOY A;  4HZB B;  1UCI A;  1K41 A;  3I55 3;  1YI2 3;  2CFW A;  1MNL A;  3CC7 3;  1TP6 A;  2UUG C;  4O3V A;  2HOH A;  3BND A;  1DMQ A;  1QJG A;  1FGM A;  1AVK A;  1CEW I;  1MWU A;  5KP3 A;  1L5G B;  5JPU A;  1IYY A;  5JBS A;  3T8U A;  2GBW B;  1W2B 2;  4WFO A;  3NBB A;  1C7H A;  2CFD A;  2FGT A;  2XGL A;  1GSP A;  1TJD A;  3T0U A;  1I2E A;  4EBG A;  3DGM A;  3G6E 3;  3OWY A;  3HOH A;  2WGQ A;  1BVI A;  3JUQ A;  5EVH A;  3IMA B;  4H3U A;  5CXO A;  1Q40 B;  3CXC 2;  1IK3 A;  4EV5 A;  1DMM A;  1UCK A;  2O9U X;  2XH9 A;  2XRX B;  2PZV A;  3F14 A;  1Q82 4;  3S67 A;  2E2U A;  2FNQ A;  4X2O A;  3F40 A;  3I0Y A;  4EC6 A;  4N6U A;  4NPB A;  1K73 4;  4N6N B;  2CH9 A;  1HU9 A;  2XEP A;  3LZA A;  5GSP A;  1E3R A;  1W00 A;  1DVD A;  1STF I;  2Y73 A;  5M1A A;  3FZW A;  1BRN L;  1VQQ A;  1O7G B;  1S5A A;  4K90 B;  1B2X A;  3GZX B;  8RNT A;  4AKZ A;  2BNG A;  1W7C A;  3MG2 A;  2Z77 A;  1K8A 4;  3S28 A;  4N6V 0;  4BTW A;  1S72 3;  1M90 4;  1UDI I;  1W4N A;  2CX1 A;  1I8V A;  3MYT A;  2RCD A;  3UB1 A;  3KSP A;  4BU4 A;  7RNT A;  2OTL 3;  5RNT A;  1FA3 A;  2D1W A;  1KD1 4;  5AIH A;  1T2H A;  4HAA A;  1RMS A;  2C11 A;  2AAE A;  1WMP A;  5ELU A;  1PYL A;  1NNV A;  4FMC A;  5IF6 A;  5G2G A;  1BU4 A;  1NO3 A;  1E3V A;  1X1W A;  2CWV A;  2IUK A;  1YJ9 3;  2ML6 A;  4FCJ A;  1MWS A;  1TIJ A;  2O3O A;  1JB4 A;  1A2V A;  4K1U A;  3BB9 A;  1T3B A;  2F98 A;  3MSO A;  5AIF A;  2J8X B;  3Q1C A;  3RGR A;  1O7W B;  1BNS A;  1OHS A;  1I0X A;  2BMQ B;  1YGE A;  2IMJ A;  1RGF A;  2F5W A;  1STD A;  1QAF A;  1MOL A;  1HZ1 A;  3NQZ A;  4KZ1 A;  1OF5 A;  3V92 A;  3LH4 A;  3NM2 A;  5EEO A;  5G1L A;  3FSD A;  3FF2 A;  4OK0 A;  3FG4 A;  2Z7A A;  1X1X A;  4KVH A;  1RCL A;  2JDI H;  5M19 A;  3PYJ A;  1R4C A;  1YJW 3;  2KXG A;  3WR2 A;  2RGQ A;  4HBR A;  3CCV 3;  4KT3 B;  1LVN A;  3FG3 A;  1K28 A;  4MEI A;  1DE3 A;  1ASK A;  1NU3 A;  3A76 A;  1W6Y A;  2W0Q A;  3KCH A;  2INX A;  2WOF A;  3EBY A;  3FG1 A;  1VQ7 3;  1V58 A;  2W9P A;  5LC7 A;  4AEQ A;  3LXU X;  4WYK A;  1QVF 2;  1B2S A;  2H0G A;  3DH2 A;  3X40 A;  1Q81 4;  1Q42 A;  2F99 A;  4OVM A;  3CPO A;  2GEX A;  4CCV A;  3TDG A;  3D79 A;  4XB5 A;  2C4B A;  4XBY A;  1FZU A;  1O7M B;  1B21 A;  2RNT A;  3OV4 A;  3OXA A;  1W5Z A;  4MMY B;  3D5I A;  1N9J A;  1VQ8 3;  1YIJ 3;  1LRA A;  2GEY A;  3F9S A;  4R9L A;  4BTY A;  3LT9 A;  3DMC A;  3X42 A;  4EW5 A;  1KWI A;  5BU4 A;  2KCD A;  4L8P A;  2Z6B A;  4ZM8 A;  4HM7 B;  2H0I A;  4IT7 A;  3V98 A;  3DM8 A;  5BVB A;  1JB2 A;  1FUS A;  2LQV A;  5FGO A;  4U13 A;  2HMK B;  3IJE B;  1BSB A;  1UGH I;  1RN1 A;  1M1X B;  3V99 A;  5D81 A;  1ISK A;  1RGA A;  4R4K A;  4LZI A;  3K63 A;  2GU3 A;  1VQ9 3;  1I2G A;  3LTB A;  1RSN A;  3CC4 3;  1OH0 A;  3SLU A;  1QAK A;  5A0O B;  3DZL A;  1I70 A;  4K61 A;  5CF2 A;  1AQZ A;  1JV2 B;  1W2Z A;  3VF1 A;  4GHO A;  3EBT A;  5TGN A;  1SIH A;  3CCU 3;  2IA7 A;  3PCR A;  2HML B;  1BSD A;  1IDP A;  1JN5 A;  4PEJ A;  1T5Y A;  4LSO A;  3DUK A;  3NX0 A;  3F8X A;  1RDS A;  1X1Y A;  1RNT A;  3PGB A;  3HII A;  2CFK A;  1PY3 A;  3AMO B;  5G1K A;  1JKG B;  2AAD A;  3SED A;  4N3V A;  1UUW B;  2UGI A;  1BRI A;  1ULI B;  2XFS A;  3EE1 A;  2RBI A;  3LYG A;  5JPP A;  3OW2 2;  1ZO2 A;  2IY2 A;  1Q7Y 4;  1CYU A;  1AVL A;  5IG4 A;  1OUN A;  1EEJ A;  4HM1 B;  1RGE A;  2BIR A;  2OCT A;  4RNY A;  1CYV A;  1BRK A;  1N8Q A;  2SBL A;  1CH0 A;  1RRL A;  2HMN B;  3PXM A;  3ZG0 A;  4O8S A;  3N54 B;  1JNQ A;  2KF5 A;  1GYB A;  5BIR A;  2K54 A;  1LOV A;  1BSE A;  1RJO A;  3LML A;  2IUJ A;  3S5C A;  3GZR A;  3DGN A;  1JRQ A;  1Q9E A;  2MC8 A;  5D82 A;  1F8N A;  1HYF A;  1LOY A;  1U8C B;  4GL6 A;  3OWU A;  5ELJ A;  1UUG B;  2FXT A;  2IYJ A;  3RGA A;  3LTC A;  3CCS 3;  1EKM A;  4CJN A;  1R4Y A;  1RHL A;  1MWR A;  1M9G A;  1B27 A;  1X1U A;  3D3L A;  3CCL 3;  1IQY A;  1US1 A;  1FYS A;  1W02 A;  1FGT A;  4CPK A;  3WOD G;  1BUQ A;  2Y74 A;  3UNL A;  1Q7H A;  1RGK A;  3MKI A;  5IW9 A;  4KFD A;  3ROB A;  4RZM A;  5IG3 A;  3X41 A;  3KKG A;  3N9H A;  1Z1S A;  3EN8 A;  1RGH A;  2YFL B;  5LC6 A;  4BL3 A;  2WOH A;  1K9M 4;  4RNT A;  3GZB A;  1GD3 A;  2MF7 A;  1TFK A;  2K3D A;  1AV4 A;  5I97 A;  4STD A;  2LYX A;  1RLS A;  1TTO A;  1DVC A;  1IVX A;  1YIT 3;  1JJ2 2;  2A15 A;  2XFT A;  3O8Y A;  1UUV B;  3JUP A;  2RFR A;  1GS3 A;  3F8H A;  2BMR B;  1YNV X;  5IEN A;  2GXF A;  3RDE A;  5AI1 A;  1O7P B;  1FUT A;  2PNC A;  2XF3 A;  3FCS B;  3N8B A;  2HMM B;  2OQE A;  2OQE C;  3MG1 A;  3AGO A;  2F56 A;  3WA3 A;  4WYK B;  3JUO A;  1OHO A;  3PCS A;  4FMB A;  1QMA A;  4BL2 A;  1VQ5 3;  4NRE A;  1JKG A;  1B2Z A;  4LGQ A;  3A5E A;  2V1L A;  1GMR A;  3AMO A;  3PS8 A;  1OCV A;  2W56 A;  3WDG B;  2XGN A;  4HJL B;  1M1K 4;  5DRE A;  1BNE A;  2F4Y A;  8CHO A;  4FCZ A;  1TU5 A;  1TRP A;  1U5O A;  1GOU A;  3HK4 A;  1CQS A;  1EG9 B;  3KZT A;  1IVU A;  1GOV A;  5AIG A;  1V57 A;  2Q07 A;  4HM2 B;  3UL5 A;  5IG5 A;  1VQ6 3;  5DRV A;  3NQY A;  2R4I A;  2XSH B;  1ZGX A;  2CG1 A;  3WHO A;  2W04 A;  3BIR A;  1UCJ A;  1GD4 A;  1VQP 3;  4HVN A;  4RNZ A;  1EA2 A;  5CLK A;  4L8O A;  3NV0 B;  2L1S A; 
#chains in the Genus database with same CATH homology
 1LOW A;  1RGL A;  4GHO A;  1BRG A;  4J5K A;  1UCK A;  1RCK A;  4J5G A;  1BGS A;  2GSP A;  1UCL A;  1BSD A;  1BNF A;  1BRJ A;  4GSP A;  5GSP A;  1RDS A;  1X1Y A;  1RNT A;  1BRN L;  1I3I A;  1BIR A;  2KF4 A;  8RNT A;  1B2X A;  1PY3 A;  1YVS A;  1B3S A;  2KF3 A;  3AHW A;  3SYU A;  2AAD A;  3AHS A;  1BAN A;  1A2P A;  1BRH A;  1BRI A;  1I8V A;  4BU4 A;  7RNT A;  2RBI A;  5RNT A;  1RN4 A;  1B20 A;  1BUJ A;  1T2H A;  4HAA A;  1MGR A;  1RMS A;  1RGE A;  2BIR A;  1BAO A;  2AAE A;  1BRK A;  1BNG A;  1B2M A;  1CH0 A;  1PYL A;  1JBS A;  1BU4 A;  1JBR A;  2KF5 A;  3URP A;  1X1W A;  4BIR A;  5BIR A;  1LOV A;  1BSE A;  1Q9E A;  1SAR A;  6RNT A;  1HYF A;  1LOY A;  1BNS A;  1I0X A;  1BSA A;  1RGF A;  2F5W A;  1MGW A;  4HOH A;  1R4Y A;  1RHL A;  1GMP A;  1HZ1 A;  1GOY A;  1B27 A;  1X1U A;  1C54 A;  1T2I A;  1AQZ A;  1FYS A;  3DGY A;  3D5G A;  1JBT A;  1RGK A;  1LNI A;  1X1X A;  1RNB A;  1TRQ A;  1RCL A;  1BNI A;  3BU4 A;  5HOH A;  3GSP A;  3WR2 A;  1RGH A;  1DE3 A;  2F5M A;  4RNT A;  3KCH A;  3D4A A;  1RGC A;  1BNR A;  1RLS A;  1BSC A;  1TTO A;  1B2S A;  2BU4 A;  3DH2 A;  1BRS A;  1DET A;  2SAR A;  1YNV X;  1I2F A;  2C4B A;  1FUT A;  1I0V A;  3AGN A;  1FZU A;  3AGO A;  1FW7 A;  2F56 A;  1B21 A;  2RNT A;  3D5I A;  1YGW A;  1LRA A;  1B2U A;  1B2Z A;  3A5E A;  3Q3F A;  1GMR A;  7GSP A;  9RNT A;  6GSP A;  3RNT A;  5BU4 A;  1BNE A;  2F4Y A;  1GMQ A;  1TRP A;  1UCI A;  2KF6 A;  1GOU A;  1G02 A;  1GOV A;  1FUS A;  1BSB A;  2HOH A;  1RN1 A;  1ZGX A;  3WHO A;  1BOX A;  1RGA A;  1IYY A;  3BIR A;  1UCJ A;  1AY7 A;  1I2G A;  1BNJ A;  1I3F A;  1RSN A;  1RTU A;  1GSP A;  1I2E A;  2ZA4 A;  1RGG A;  3HOH A;  1I70 A;  2KAA A;  1BVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...