2RNTA

Three-dimensional structure of ribonuclease t1 complexed with guanylyl-2(prime),5(prime)-guanosine at 1.8 angstroms resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Three-dimensional structure of ribonuclease T1 complexed with guanylyl-2',5'-guanosine at 1.8 A resolution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1988-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2rntA00
1BNIA 1RNBA 1RN4A 1B2UA 4GHOA 1RCKA 1T2IA 1LOVA 1Q9EA 4BU4A 1BRJA 3SYUA 1AY7A 1RLSA 3D5IA 1X1WA 2AAEA 6RNTA 1DE3A 1BRKA 2GSPA 3BU4A 7GSPA 1AQZA 1A2PA 1HYFA 1RHLA 1YVSA 4J5KA 1BNJA 2F4YA 1X1XA 1BVIA 1BRGA 4HAAA 1BOXA 1BSEA 1BRSA 1I2GA 1I3FA 1UCJA 3RNTA 3WR2A 1LRAA 1SARA 5RNTA 1YGWA 1PYLA 1BNEA 4RNTA 1CH0A 3DH2A 3AHSA 1B2MA 2KF4A 2F5MA 1PY3A 1B20A 1HZ1A 5BIRA 5BU4A 1GOYA 1JBSA 1GMPA 2AADA 1IYYA 1BU4A 1BRHA 1FUSA 1GSPA 2RNTA 1GOVA 1B2SA 1I2FA 2ZA4A 1LOWA 5GSPA 1TRPA 3KCHA 1R4YA 1BSAA 1I2EA 3HOHA 1RGHA 3BIRA 1UCKA 1JBTA 1BNRA 1RGGA 2RBIA 1I0VA 1BRIA 1T2HA 3AGNA 1LOYA 1RGKA 3A5EA 1BNGA 2HOHA 1JBRA 1C54A 1BNSA 1B3SA 1FUTA 1TRQA 1RNTA 1BIRA 8RNTA 1B27A 4GSPA 1RGFA 1BSDA 2F56A 1B2XA 3AGOA 1BSBA 7RNTA 1X1YA 2KF6A 1G02A 1MGRA 9RNTA 4J5GA 1B2ZA 1RMSA 2BU4A 2SARA 1I3IA 3AHWA 1BUJA 1RSNA 2C4BA 1B21A 1I8VA 1BRNL 1I0XA 3DGYA 2BIRA 5HOHA 6GSPA 1BNFA 1ZGXA 1GMQA 1RGCA 3URPA 1X1UA 3WHOA 1UCIA 2KF5A 3Q3FA 2F5WA 1GMRA 3D5GA 4HOHA 1I70A 1RCLA 1RDSA 1RGLA 1GOUA 2KAAA 1RGEA 1RTUA 1MGWA 1DETA 1RGAA 1BANA 1FW7A 1FYSA 1BGSA 1UCLA 1YNVX 1RN1A 1TTOA 4BIRA 1BAOA 3D4AA 2KF3A 1BSCA 1FZUA 3GSPA 1LNIA
chains in the Genus database with same CATH superfamily
1BNIA 1RNBA 4OUQA 4WYKB 1B2UA 1W6YA 3EHCA 3BNEA 4K1VA 3UL5A 1VQ73 2P09A 2K54A 2L1SA 1BRJA 2O9UX 3RGRA 1Q824 5IENA 1K28A 2AAEA 1DE3A 2CX1A 2GSPA 4QWTA 2D1WA 4R1KA 1JRQA 2OOVC 1VQK3 1YIT3 3DGNA 1HU9A 1WMPA 1WMNA 1RHLA 1NWWA 1YVSA 1Q42A 4RZMA 1CYUA 3CC43 2WGOA 2A15A 1UI8A 2FGTA 4HAAA 1I3FA 1I2GA 1JZOA 4AKZA 3K5TA 3RNTA 5AEWB 3VGNA 5EQLA 2H0HA 3WR2A 3H3HA 4KFFA 4AEQA 5RNTA 1K8A4 3S27A 5LC7A 1YGWA 3NQZA 1AR0A 2GU3A 2IY2A 3WA3A 1PYLA 4RNTA 1EUIC 3I0YA 1OF5A 1CH0A 3DH2A 2YFJB 3GZRA 2KF4A 4O3VA 2BMRB 2V1LA 2L4VA 4EYCA 2P0MA 1N5HA 5BIRA 4XBTA 4HM7B 1W7CA 1BU4A 4O2HA 4LEHA 3WDGB 3UL6A 1BRHA 1DMNA 1FUSA 1D6ZA 3LTDA 1GOVA 1B2SA 4WYKA 2ZA4A 1V58A 5AIHA 4OK0A 5JPUA 1NB5I 5GSPA 2BO9B 1Q7HA 1M904 1BSAA 2F98A 4NHFA 3SVAA 4WP5A 1I2EA 4CCVA 1Q814 1S723 2PZVA 1RGHA 3LZAA 5D81A 2D42A 1JBTA 5ELJA 4N6TA 3O8YA 4HJLB 1BRIA 1T2HA 3K0ZA 1RGKA 4HM4B 3A5EA 1SQWA 5IG0A 5JPPA 1FGMA 4N3VA 2INXA 2C11A 2Q07A 1TRQA 4HVNA 4K90B 2ZDJA 1SIHA 1Y4KA 4WFOA 8RNTA 5IEPA 3ER7A 4GSPA 4FCZA 3NM7A 3T8UA 1O7WB 3CCQ3 3EBTA 7RNTA 1N8R4 1OGZA 2KF6A 3HIIA 4HM6B 4STDA 2CK3H 3CC73 1J2BA 1B2ZA 1RMSA 2MF7A 2BU4A 2SARA 4LGQA 1IT7A 1I3IA 3UNLA 3LOYA 2O3OA 1TU5A 1PU4A 3AHWA 4K61A 4AKYA 1BUJA 1OHSA 1Q40B 2C4BA 5AYSC 3FSDA 5IG4A 1LNHA 2CFGA 4EV2A 1BRNL 5HOHA 2IUJA 6GSPA 4HM0B 1IVVA 4I4KA 1ZGXA 4XDVA 1RGCA 2IMJA 3CPW2 2CG1A 2UGIA 3PCSA 1L5GB 2F5WA 3OX9A 2STDA 2XGLA 1VZZA 3UJMA 1JB4A 2BT3A 4GL6A 2OWPA 1KWIA 4HOHA 5TGNA 2OTJ3 1RCLA 3KIIA 2XSHB 2ML5A 4FMDA 4KFDA 3LMLA 2I9WA 4TX4A 1JB5A 3S28A 2W03A 2MC8A 1UUWB 3DUKA 1MGWA 3CU3A 4K1UA 3B4PA 3MYTA 2JDIH 1FW7A 1FGOA 1BGSA 1YNVX 2FNQA 1RN1A 4HBRA 4R9KA 4HM2B 2KF3A 3WA2X 3OW22 1JJ22 1UCJA 3GSPA 3MHEA 5CLKA 1RN4A 1MWRA 3AMOA 3K63A 4GHOA 1AV4A 4H3UA 3FKAA 5IEOA 4BU4A 2E2TA 3JUQA 1O7HB 1D6YA 2LQVA 3NXJA 6RNTA 7GSPA 4JRFA 4XDWA 1M1K4 1A2PA 1HYFA 2CWTA 2M7OA 2Z76A 5IG3A 3MPHA 1OF5B 2XEPA 1BNJA 4JF8A 2ZHXB 2WOFA 3G16A 1BRGA 3T8NA 1BSEA 4MMYB 2P38A 2GEYA 3LXUX 1OPYA 1V74A 2XH9A 1LRAA 1A2VA 3B8LA 3IJEB 1NB3I 5DRVA 3GZYB 3X3ZA 3B4OA 1LQMB 1RRHA 1JB2A 2CX0A 3DM8A 4BL3A 1Q864 1BNEA 4MJDA 3F9SA 3PZWA 2HMJB 3JUOA 2BMOB 3GZXB 1UW1A 1GOYA 2XRXB 4MMXB 3VSYA 1JBSA 1UUGB 1W01A 3SLUA 2ZL8A 4HM1B 4PEJA 3G8ZA 2RNTA 3EQQB 3EN8A 1CQSA 8CHOA 1OHOA 2RFRA 4GB5A 5CK6A 4KFEA 1YI23 3BLZA 3EBYA 5AYRB 2W6JH 2WGQA 3CC23 2CHCA 4LYLB 4HZ9B 4U13A 4RNYA 2RSXA 1IU7A 2OQEC 3KZTA 4BTWA 1RKYA 5IF6A 2CIUA 1R4YA 1G96A 1U5OA 2CFWA 1IVXA 1EEJA 2XFTA 2SBLA 1JKGB 1TP6A 3HOHA 3MG1A 5DREA 3H51A 3S5CA 3CCR3 1SIIA 3BIRA 1GY6A 1UCKA 2CWVA 2OTL3 1A2KA 3ALAA 4XM4A 1I0VA 2OOVA 3IMAB 1LOYA 3X3XA 2HOHA 4DKIA 5CXOA 1C54A 3SOAA 4R9LA 3OWYA 4NPBA 3GWRA 1O7MB 3ECFA 3HZPA 3CCS3 1BIRA 2CH9A 3CCE3 4ZM8A 3NUVA 1BUQA 1BSDA 2F56A 2IUKA 1KD14 3AGOA 3Q2PA 5STDA 1M1XB 2XF3A 2QA43 1YIJ3 1VQP3 2E2VA 1QVF2 1G02A 4N6LA 5EEOA 4KZ1A 2CC3A 1AVKA 3FCSB 3OXAA 2UUGC 2CKFB 2P05A 3BNDA 3FH1A 1B21A 3K7CA 1I0XA 3FZWA 1IV7A 3LT8A 4N6OB 1BNFA 3PCRA 3JUMA 1N8QA 1NDOB 2OCTA 1FGRA 3X42A 3Q3FA 3CCV3 1GMRA 2Z77A 5D83A 4FMAA 2XR8B 4IPBA 5JBSA 3KE7A 5EVHA 3FG3A 1MWUA 5BVBA 3EF8A 3F8HA 1IV9A 3HIGA 3NX0A 2WOHA 4EV5A 1JKGA 1TJDA 5AI1A 1A67A 3AMOB 5D82A 3N9HA 4NREA 3SEDA 3F40A 3CNXA 1DETA 4KVHA 1BANA 1WNHA 1FYSA 1IQYA 1UCLA 4J9AA 3K9MC 5IERA 1RJOA 1BAOA 1STDA 1ZX2A 3D4AA 3EX9A 2GU1A 3UB1A 1OHPA 2W56B 1QAKA 3WODG 1LNIA 3PGBA 1A90A 1W6GA 3X41A 4N6UA 1YGEA 3LT9A 3WOEB 1RCKA 1T2IA 2HMNB 1Q9EA 1VQL3 3SYUA 1AY7A 5ELUA 1NJI4 1JNQA 1RLSA 1YVBI 3D5IA 3LH4A 3V98A 1X1WA 4RNZA 3I563 1BRKA 1OUNA 1NO3A 3BNBA 3BU4A 1TIJA 3FF0A 1DVDA 1IT8A 2B1XB 3NM2A 5G2GA 3ZFZA 1MNLA 4X2OA 3CNMA 2CFLA 3CCU3 1DVCA 3TDGA 1D6UA 5M19A 3CCJ3 1DMMA 1W6CA 4ILFA 4J8TA 2FXTA 3JUNA 5G1KA 4FMCA 4ORLA 2QIYA 1FA3A 3IPTA 2H0GA 4XB5A 2RCDA 1ZO2A 3DY5A 6STDA 2GBWB 5BXQA 1OCVA 1N5PA 3KKGA 3DGLA 5FGOA 1ULIB 1IQXA 1Q7Y4 3GAXA 1VQ53 1UGHI 1OGXA 1NU3A 1QAFA 3NV0A 4HYZA 5AIFA 4CJNA 1B2MA 2F5MA 4EBGA 3S67A 1PY3A 1HZ1A 2E2UA 5CF2A 1GMPA 2AADA 4I5QA 1IYYA 4CDLA 1PFPA 3MSOA 1VQ63 1GSPA 1LVNA 1OH0A 1O7NB 1RN7A 1IVUA 1QMAA 2BHMA 2W56A 3HK4A 1I2FA 3FLJA 3F8XA 3QK9A 2W9PA 2IA7A 1V57A 3S29A 1T3BA 1VQQA 3MG2A 3EB8A 3X40A 2KXGA 3OWUA 4FCMA 3GZBA 3MKIA 3EJVA 3BB9A 4MEIA 1ULJB 1BNRA 2CWUA 3EC9A 2RBIA 3AGNA 1JBRA 1GY7A 5KP4A 2PNCA 1CEWI 1FUTA 3PXMA 1IQ8A 4N6V0 3DMCA 1B27A 1RGFA 1ZS7A 1BSBA 7STDA 1X1YA 1E3RA 1MGRA 4MMZB 9RNTA 1DMQA 2XGNA 1IK3A 1N9JA 2GEXA 4BTYA 3CCM3 2QGUA 2K0MA 1K41A 1GYBA 3A76A 3PS8A 1VQN3 1RSNA 1DYUA 3X3YA 4EC6A 1I8VA 3DGYA 1NNVA 4O8SA 1KQS2 1ISKA 4XBXA 3FGYA 1GMQA 3D9RA 3LTCA 1UCIA 1UDII 2KF5A 1VQM3 4WHAA 3CCL3 3Q1CA 1ROAA 2HMOB 1QALA 2ML6A 3D79A 3D3LA 4LMIA 5IW9A 1QVG2 3V99A 1F8NA 1W02A 1W2B2 3FG1A 1WMOA 2H0IA 2CW9A 1I70A 1CYVA 2OQEA 3ROBA 4EXRA 3OV4A 1GOUA 1GS3A 3U97A 3VF1A 4R4KA 1RGEA 4BL2A 2XSOB 3SX1A 1RTUA 2W9QA 1LQGC 4LSOA 4Q53A 5IG5A 1Z1SA 3NBRA 2P0XA 2YFLB 3F7SA 4BIRA 1GD4A 1UGIA 3N54B 2RGQA 4OVMA 1K9M4 4L7KA 1BSCA 3EE1A 2K3DA 1ROVA 1FZUA 1EA2A 4FR9A 1UUVB 2BMQB 3EN1B 3G0KA 3N8BA 4H61A 3WMDA 1LOVA 1YJ93 4KT3B 5G1LA 5A0OB 1S5AA 3CXC2 5AIGA 2UX0A 1HKXA 1VQ93 1IDPA 1AQZA 5AIIA 2IYJA 3ZG0A 1TFKA 1G0TA 4J5KA 3LTAA 2HMKB 4FCJA 2F4YA 3NV0B 1MOLA 3U1WA 4EW5A 1X1XA 2HMLB 3M8CA 1W00A 3DXOA 1BVIA 3ZG5A 1BOXA 4L8OA 1BRSA 4BTXA 1US1A 3STDA 2Y73A 4HM3B 1SARA 1W4NA 4RBNA 1JZDA 3MWZA 1GY5A 1YJW3 4G1MB 2F99A 2B24B 1EQKA 4HKVB 4O02B 2HMMB 3AHSA 3DGOA 3RGAA 1VQO3 5HGRA 1AVLA 3RDEA 3I553 1FUWA 1B20A 3KSPA 4R80A 5BU4A 1MWSA 1E3VA 2LYXA 1WTHA 1KC84 3PYJA 1TUHA 4LZIA 2GXFA 5M18A 3GRDA 3G4S3 1K734 2QEX3 2WO0A 3LTBA 1LOXA 3DZLA 5KP1A 2F86B 1LOWA 1YJN3 1JN5B 1TRPA 1SJWA 3KCHA 1T5YA 3SOYA 3Q90A 4X2HA 3JVCA 3CPOA 2YFIB 1RGGA 5KP3A 1N9EA 3LYGA 2Y74A 1EG9B 2CG0A 3E99A 3FF2A 1JV2B 1BNGA 3F7XA 1BNSA 1UI7A 3HI7A 1B3SA 1W5ZA 2W0QA 1RNTA 2KCDA 3B7CA 3KN4A 3HX8A 3MG3A 3J7Yd 1B2XA 3DGMA 1VQ43 3CD63 2YX9A 3KFQC 3SXXA 4N6MA 3L0RA 4J5GA 1YHQ3 3G6E3 3F14A 2J8XB 3OWSA 1R4CA 1STFI 3JUPA 1W2ZA 1SPUA 4XBYA 3WOFB 3V92A 2BIRA 4N6NB 2R4IA 2CFDA 4HM8B 1EKMA 1O7PB 1WQLB 2R41A 3CMA3 1VQ83 4IT7A 3BNCA 3URPA 1X1UA 3WHOA 1IVWA 1TFOA 2C10A 4WWUC 5AEUB 5I97A 4HZBB 2W2CA 5FW5A 3CME3 3NQYA 2GBXB 2XFSA 5M1AA 3D5GA 1JN5A 1U8CB 3NBBA 2Z7AA 1E97A 1Q40A 4CPKA 1ASKA 4L8PA 1FGTA 1RDSA 1RGLA 1RRLA 1OACA 1LXEA 2KAAA 3KSED 3QRDA 1O7GB 1GD3A 3NBJA 5LC6A 2KRTA 1M9GA 3FG4A 3G713 1RGAA 1C7HA 3NHXA 2Z6BA 2BNGA 1QJGA 1MWTA 2JQ5A 1KSIA 4HM5B 4IIAA 1TTOA 3T0UA 5CF1A 2CFKA 4FMBA 2W04A 1FGQA
chains in the Genus database with same CATH topology
1BNIA 1RNBA 1RN4A 1B2UA 4GHOA 1RCKA 1T2IA 1LOVA 1Q9EA 4BU4A 1BRJA 3SYUA 1AY7A 1RLSA 3D5IA 1X1WA 2AAEA 6RNTA 1DE3A 1BRKA 2GSPA 3BU4A 7GSPA 1AQZA 1A2PA 1HYFA 1RHLA 1YVSA 4J5KA 1BNJA 2F4YA 1X1XA 1BVIA 1BRGA 4HAAA 1BOXA 1BSEA 1BRSA 1I2GA 1I3FA 1UCJA 3RNTA 3WR2A 1LRAA 1SARA 5RNTA 1YGWA 1PYLA 1BNEA 4RNTA 1CH0A 3DH2A 3AHSA 1B2MA 2KF4A 2F5MA 1PY3A 1B20A 1HZ1A 5BIRA 5BU4A 1GOYA 1JBSA 1GMPA 2AADA 1IYYA 1BU4A 1BRHA 1FUSA 1GSPA 2RNTA 1GOVA 1B2SA 1I2FA 2ZA4A 1LOWA 5GSPA 1TRPA 3KCHA 1R4YA 1BSAA 1I2EA 3HOHA 1RGHA 3BIRA 1UCKA 1JBTA 1BNRA 1RGGA 2RBIA 1I0VA 1BRIA 1T2HA 3AGNA 1LOYA 1RGKA 3A5EA 1BNGA 2HOHA 1JBRA 1C54A 1BNSA 1B3SA 1FUTA 1TRQA 1RNTA 1BIRA 8RNTA 1B27A 4GSPA 1RGFA 1BSDA 2F56A 1B2XA 3AGOA 1BSBA 7RNTA 1X1YA 2KF6A 1G02A 1MGRA 9RNTA 4J5GA 1B2ZA 1RMSA 2BU4A 2SARA 1I3IA 3AHWA 1BUJA 1RSNA 2C4BA 1B21A 1I8VA 1BRNL 1I0XA 3DGYA 2BIRA 5HOHA 6GSPA 1BNFA 1ZGXA 1GMQA 1RGCA 3URPA 1X1UA 3WHOA 1UCIA 2KF5A 3Q3FA 2F5WA 1GMRA 3D5GA 4HOHA 1I70A 1RCLA 1RDSA 1RGLA 1GOUA 2KAAA 1RGEA 1RTUA 1MGWA 1DETA 1RGAA 1BANA 1FW7A 1FYSA 1BGSA 1UCLA 1YNVX 1RN1A 1TTOA 4BIRA 1BAOA 3D4AA 2KF3A 1BSCA 1FZUA 3GSPA 1LNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNI A;  1RNB A;  1RN4 A;  1B2U A;  4GHO A;  1RCK A;  1T2I A;  1LOV A;  1Q9E A;  4BU4 A;  1BRJ A;  3SYU A;  1AY7 A;  1RLS A;  3D5I A;  1X1W A;  2AAE A;  6RNT A;  1DE3 A;  1BRK A;  2GSP A;  3BU4 A;  7GSP A;  1AQZ A;  1A2P A;  1HYF A;  1RHL A;  1YVS A;  4J5K A;  1BNJ A;  2F4Y A;  1X1X A;  1BVI A;  1BRG A;  4HAA A;  1BOX A;  1BSE A;  1BRS A;  1I2G A;  1I3F A;  1UCJ A;  3RNT A;  3WR2 A;  1LRA A;  1SAR A;  5RNT A;  1YGW A;  1PYL A;  1BNE A;  4RNT A;  1CH0 A;  3DH2 A;  3AHS A;  1B2M A;  2KF4 A;  2F5M A;  1PY3 A;  1B20 A;  1HZ1 A;  5BIR A;  5BU4 A;  1GOY A;  1JBS A;  1GMP A;  2AAD A;  1IYY A;  1BU4 A;  1BRH A;  1FUS A;  1GSP A;  2RNT A;  1GOV A;  1B2S A;  1I2F A;  2ZA4 A;  1LOW A;  5GSP A;  1TRP A;  3KCH A;  1R4Y A;  1BSA A;  1I2E A;  3HOH A;  1RGH A;  3BIR A;  1UCK A;  1JBT A;  1BNR A;  1RGG A;  2RBI A;  1I0V A;  1BRI A;  1T2H A;  3AGN A;  1LOY A;  1RGK A;  3A5E A;  1BNG A;  2HOH A;  1JBR A;  1C54 A;  1BNS A;  1B3S A;  1FUT A;  1TRQ A;  1RNT A;  1BIR A;  8RNT A;  1B27 A;  4GSP A;  1RGF A;  1BSD A;  2F56 A;  1B2X A;  3AGO A;  1BSB A;  7RNT A;  1X1Y A;  2KF6 A;  1G02 A;  1MGR A;  9RNT A;  4J5G A;  1B2Z A;  1RMS A;  2BU4 A;  2SAR A;  1I3I A;  3AHW A;  1BUJ A;  1RSN A;  2C4B A;  1B21 A;  1I8V A;  1BRN L;  1I0X A;  3DGY A;  2BIR A;  5HOH A;  6GSP A;  1BNF A;  1ZGX A;  1GMQ A;  1RGC A;  3URP A;  1X1U A;  3WHO A;  1UCI A;  2KF5 A;  3Q3F A;  2F5W A;  1GMR A;  3D5G A;  4HOH A;  1I70 A;  1RCL A;  1RDS A;  1RGL A;  1GOU A;  2KAA A;  1RGE A;  1RTU A;  1MGW A;  1DET A;  1RGA A;  1BAN A;  1FW7 A;  1FYS A;  1BGS A;  1UCL A;  1YNV X;  1RN1 A;  1TTO A;  4BIR A;  1BAO A;  3D4A A;  2KF3 A;  1BSC A;  1FZU A;  3GSP A;  1LNI A; 
#chains in the Genus database with same CATH topology
 1BNI A;  1RNB A;  4OUQ A;  4WYK B;  1B2U A;  1W6Y A;  3EHC A;  3BNE A;  4K1V A;  3UL5 A;  1VQ7 3;  2P09 A;  2K54 A;  2L1S A;  1BRJ A;  2O9U X;  3RGR A;  1Q82 4;  5IEN A;  1K28 A;  2AAE A;  1DE3 A;  2CX1 A;  2GSP A;  4QWT A;  2D1W A;  4R1K A;  1JRQ A;  2OOV C;  1VQK 3;  1YIT 3;  3DGN A;  1HU9 A;  1WMP A;  1WMN A;  1RHL A;  1NWW A;  1YVS A;  1Q42 A;  4RZM A;  1CYU A;  3CC4 3;  2WGO A;  2A15 A;  1UI8 A;  2FGT A;  4HAA A;  1I3F A;  1I2G A;  1JZO A;  4AKZ A;  3K5T A;  3RNT A;  5AEW B;  3VGN A;  5EQL A;  2H0H A;  3WR2 A;  3H3H A;  4KFF A;  4AEQ A;  5RNT A;  1K8A 4;  3S27 A;  5LC7 A;  1YGW A;  3NQZ A;  1AR0 A;  2GU3 A;  2IY2 A;  3WA3 A;  1PYL A;  4RNT A;  1EUI C;  3I0Y A;  1OF5 A;  1CH0 A;  3DH2 A;  2YFJ B;  3GZR A;  2KF4 A;  4O3V A;  2BMR B;  2V1L A;  2L4V A;  4EYC A;  2P0M A;  1N5H A;  5BIR A;  4XBT A;  4HM7 B;  1W7C A;  1BU4 A;  4O2H A;  4LEH A;  3WDG B;  3UL6 A;  1BRH A;  1DMN A;  1FUS A;  1D6Z A;  3LTD A;  1GOV A;  1B2S A;  4WYK A;  2ZA4 A;  1V58 A;  5AIH A;  4OK0 A;  5JPU A;  1NB5 I;  5GSP A;  2BO9 B;  1Q7H A;  1M90 4;  1BSA A;  2F98 A;  4NHF A;  3SVA A;  4WP5 A;  1I2E A;  4CCV A;  1Q81 4;  1S72 3;  2PZV A;  1RGH A;  3LZA A;  5D81 A;  2D42 A;  1JBT A;  5ELJ A;  4N6T A;  3O8Y A;  4HJL B;  1BRI A;  1T2H A;  3K0Z A;  1RGK A;  4HM4 B;  3A5E A;  1SQW A;  5IG0 A;  5JPP A;  1FGM A;  4N3V A;  2INX A;  2C11 A;  2Q07 A;  1TRQ A;  4HVN A;  4K90 B;  2ZDJ A;  1SIH A;  1Y4K A;  4WFO A;  8RNT A;  5IEP A;  3ER7 A;  4GSP A;  4FCZ A;  3NM7 A;  3T8U A;  1O7W B;  3CCQ 3;  3EBT A;  7RNT A;  1N8R 4;  1OGZ A;  2KF6 A;  3HII A;  4HM6 B;  4STD A;  2CK3 H;  3CC7 3;  1J2B A;  1B2Z A;  1RMS A;  2MF7 A;  2BU4 A;  2SAR A;  4LGQ A;  1IT7 A;  1I3I A;  3UNL A;  3LOY A;  2O3O A;  1TU5 A;  1PU4 A;  3AHW A;  4K61 A;  4AKY A;  1BUJ A;  1OHS A;  1Q40 B;  2C4B A;  5AYS C;  3FSD A;  5IG4 A;  1LNH A;  2CFG A;  4EV2 A;  1BRN L;  5HOH A;  2IUJ A;  6GSP A;  4HM0 B;  1IVV A;  4I4K A;  1ZGX A;  4XDV A;  1RGC A;  2IMJ A;  3CPW 2;  2CG1 A;  2UGI A;  3PCS A;  1L5G B;  2F5W A;  3OX9 A;  2STD A;  2XGL A;  1VZZ A;  3UJM A;  1JB4 A;  2BT3 A;  4GL6 A;  2OWP A;  1KWI A;  4HOH A;  5TGN A;  2OTJ 3;  1RCL A;  3KII A;  2XSH B;  2ML5 A;  4FMD A;  4KFD A;  3LML A;  2I9W A;  4TX4 A;  1JB5 A;  3S28 A;  2W03 A;  2MC8 A;  1UUW B;  3DUK A;  1MGW A;  3CU3 A;  4K1U A;  3B4P A;  3MYT A;  2JDI H;  1FW7 A;  1FGO A;  1BGS A;  1YNV X;  2FNQ A;  1RN1 A;  4HBR A;  4R9K A;  4HM2 B;  2KF3 A;  3WA2 X;  3OW2 2;  1JJ2 2;  1UCJ A;  3GSP A;  3MHE A;  5CLK A;  1RN4 A;  1MWR A;  3AMO A;  3K63 A;  4GHO A;  1AV4 A;  4H3U A;  3FKA A;  5IEO A;  4BU4 A;  2E2T A;  3JUQ A;  1O7H B;  1D6Y A;  2LQV A;  3NXJ A;  6RNT A;  7GSP A;  4JRF A;  4XDW A;  1M1K 4;  1A2P A;  1HYF A;  2CWT A;  2M7O A;  2Z76 A;  5IG3 A;  3MPH A;  1OF5 B;  2XEP A;  1BNJ A;  4JF8 A;  2ZHX B;  2WOF A;  3G16 A;  1BRG A;  3T8N A;  1BSE A;  4MMY B;  2P38 A;  2GEY A;  3LXU X;  1OPY A;  1V74 A;  2XH9 A;  1LRA A;  1A2V A;  3B8L A;  3IJE B;  1NB3 I;  5DRV A;  3GZY B;  3X3Z A;  3B4O A;  1LQM B;  1RRH A;  1JB2 A;  2CX0 A;  3DM8 A;  4BL3 A;  1Q86 4;  1BNE A;  4MJD A;  3F9S A;  3PZW A;  2HMJ B;  3JUO A;  2BMO B;  3GZX B;  1UW1 A;  1GOY A;  2XRX B;  4MMX B;  3VSY A;  1JBS A;  1UUG B;  1W01 A;  3SLU A;  2ZL8 A;  4HM1 B;  4PEJ A;  3G8Z A;  2RNT A;  3EQQ B;  3EN8 A;  1CQS A;  8CHO A;  1OHO A;  2RFR A;  4GB5 A;  5CK6 A;  4KFE A;  1YI2 3;  3BLZ A;  3EBY A;  5AYR B;  2W6J H;  2WGQ A;  3CC2 3;  2CHC A;  4LYL B;  4HZ9 B;  4U13 A;  4RNY A;  2RSX A;  1IU7 A;  2OQE C;  3KZT A;  4BTW A;  1RKY A;  5IF6 A;  2CIU A;  1R4Y A;  1G96 A;  1U5O A;  2CFW A;  1IVX A;  1EEJ A;  2XFT A;  2SBL A;  1JKG B;  1TP6 A;  3HOH A;  3MG1 A;  5DRE A;  3H51 A;  3S5C A;  3CCR 3;  1SII A;  3BIR A;  1GY6 A;  1UCK A;  2CWV A;  2OTL 3;  1A2K A;  3ALA A;  4XM4 A;  1I0V A;  2OOV A;  3IMA B;  1LOY A;  3X3X A;  2HOH A;  4DKI A;  5CXO A;  1C54 A;  3SOA A;  4R9L A;  3OWY A;  4NPB A;  3GWR A;  1O7M B;  3ECF A;  3HZP A;  3CCS 3;  1BIR A;  2CH9 A;  3CCE 3;  4ZM8 A;  3NUV A;  1BUQ A;  1BSD A;  2F56 A;  2IUK A;  1KD1 4;  3AGO A;  3Q2P A;  5STD A;  1M1X B;  2XF3 A;  2QA4 3;  1YIJ 3;  1VQP 3;  2E2V A;  1QVF 2;  1G02 A;  4N6L A;  5EEO A;  4KZ1 A;  2CC3 A;  1AVK A;  3FCS B;  3OXA A;  2UUG C;  2CKF B;  2P05 A;  3BND A;  3FH1 A;  1B21 A;  3K7C A;  1I0X A;  3FZW A;  1IV7 A;  3LT8 A;  4N6O B;  1BNF A;  3PCR A;  3JUM A;  1N8Q A;  1NDO B;  2OCT A;  1FGR A;  3X42 A;  3Q3F A;  3CCV 3;  1GMR A;  2Z77 A;  5D83 A;  4FMA A;  2XR8 B;  4IPB A;  5JBS A;  3KE7 A;  5EVH A;  3FG3 A;  1MWU A;  5BVB A;  3EF8 A;  3F8H A;  1IV9 A;  3HIG A;  3NX0 A;  2WOH A;  4EV5 A;  1JKG A;  1TJD A;  5AI1 A;  1A67 A;  3AMO B;  5D82 A;  3N9H A;  4NRE A;  3SED A;  3F40 A;  3CNX A;  1DET A;  4KVH A;  1BAN A;  1WNH A;  1FYS A;  1IQY A;  1UCL A;  4J9A A;  3K9M C;  5IER A;  1RJO A;  1BAO A;  1STD A;  1ZX2 A;  3D4A A;  3EX9 A;  2GU1 A;  3UB1 A;  1OHP A;  2W56 B;  1QAK A;  3WOD G;  1LNI A;  3PGB A;  1A90 A;  1W6G A;  3X41 A;  4N6U A;  1YGE A;  3LT9 A;  3WOE B;  1RCK A;  1T2I A;  2HMN B;  1Q9E A;  1VQL 3;  3SYU A;  1AY7 A;  5ELU A;  1NJI 4;  1JNQ A;  1RLS A;  1YVB I;  3D5I A;  3LH4 A;  3V98 A;  1X1W A;  4RNZ A;  3I56 3;  1BRK A;  1OUN A;  1NO3 A;  3BNB A;  3BU4 A;  1TIJ A;  3FF0 A;  1DVD A;  1IT8 A;  2B1X B;  3NM2 A;  5G2G A;  3ZFZ A;  1MNL A;  4X2O A;  3CNM A;  2CFL A;  3CCU 3;  1DVC A;  3TDG A;  1D6U A;  5M19 A;  3CCJ 3;  1DMM A;  1W6C A;  4ILF A;  4J8T A;  2FXT A;  3JUN A;  5G1K A;  4FMC A;  4ORL A;  2QIY A;  1FA3 A;  3IPT A;  2H0G A;  4XB5 A;  2RCD A;  1ZO2 A;  3DY5 A;  6STD A;  2GBW B;  5BXQ A;  1OCV A;  1N5P A;  3KKG A;  3DGL A;  5FGO A;  1ULI B;  1IQX A;  1Q7Y 4;  3GAX A;  1VQ5 3;  1UGH I;  1OGX A;  1NU3 A;  1QAF A;  3NV0 A;  4HYZ A;  5AIF A;  4CJN A;  1B2M A;  2F5M A;  4EBG A;  3S67 A;  1PY3 A;  1HZ1 A;  2E2U A;  5CF2 A;  1GMP A;  2AAD A;  4I5Q A;  1IYY A;  4CDL A;  1PFP A;  3MSO A;  1VQ6 3;  1GSP A;  1LVN A;  1OH0 A;  1O7N B;  1RN7 A;  1IVU A;  1QMA A;  2BHM A;  2W56 A;  3HK4 A;  1I2F A;  3FLJ A;  3F8X A;  3QK9 A;  2W9P A;  2IA7 A;  1V57 A;  3S29 A;  1T3B A;  1VQQ A;  3MG2 A;  3EB8 A;  3X40 A;  2KXG A;  3OWU A;  4FCM A;  3GZB A;  3MKI A;  3EJV A;  3BB9 A;  4MEI A;  1ULJ B;  1BNR A;  2CWU A;  3EC9 A;  2RBI A;  3AGN A;  1JBR A;  1GY7 A;  5KP4 A;  2PNC A;  1CEW I;  1FUT A;  3PXM A;  1IQ8 A;  4N6V 0;  3DMC A;  1B27 A;  1RGF A;  1ZS7 A;  1BSB A;  7STD A;  1X1Y A;  1E3R A;  1MGR A;  4MMZ B;  9RNT A;  1DMQ A;  2XGN A;  1IK3 A;  1N9J A;  2GEX A;  4BTY A;  3CCM 3;  2QGU A;  2K0M A;  1K41 A;  1GYB A;  3A76 A;  3PS8 A;  1VQN 3;  1RSN A;  1DYU A;  3X3Y A;  4EC6 A;  1I8V A;  3DGY A;  1NNV A;  4O8S A;  1KQS 2;  1ISK A;  4XBX A;  3FGY A;  1GMQ A;  3D9R A;  3LTC A;  1UCI A;  1UDI I;  2KF5 A;  1VQM 3;  4WHA A;  3CCL 3;  3Q1C A;  1ROA A;  2HMO B;  1QAL A;  2ML6 A;  3D79 A;  3D3L A;  4LMI A;  5IW9 A;  1QVG 2;  3V99 A;  1F8N A;  1W02 A;  1W2B 2;  3FG1 A;  1WMO A;  2H0I A;  2CW9 A;  1I70 A;  1CYV A;  2OQE A;  3ROB A;  4EXR A;  3OV4 A;  1GOU A;  1GS3 A;  3U97 A;  3VF1 A;  4R4K A;  1RGE A;  4BL2 A;  2XSO B;  3SX1 A;  1RTU A;  2W9Q A;  1LQG C;  4LSO A;  4Q53 A;  5IG5 A;  1Z1S A;  3NBR A;  2P0X A;  2YFL B;  3F7S A;  4BIR A;  1GD4 A;  1UGI A;  3N54 B;  2RGQ A;  4OVM A;  1K9M 4;  4L7K A;  1BSC A;  3EE1 A;  2K3D A;  1ROV A;  1FZU A;  1EA2 A;  4FR9 A;  1UUV B;  2BMQ B;  3EN1 B;  3G0K A;  3N8B A;  4H61 A;  3WMD A;  1LOV A;  1YJ9 3;  4KT3 B;  5G1L A;  5A0O B;  1S5A A;  3CXC 2;  5AIG A;  2UX0 A;  1HKX A;  1VQ9 3;  1IDP A;  1AQZ A;  5AII A;  2IYJ A;  3ZG0 A;  1TFK A;  1G0T A;  4J5K A;  3LTA A;  2HMK B;  4FCJ A;  2F4Y A;  3NV0 B;  1MOL A;  3U1W A;  4EW5 A;  1X1X A;  2HML B;  3M8C A;  1W00 A;  3DXO A;  1BVI A;  3ZG5 A;  1BOX A;  4L8O A;  1BRS A;  4BTX A;  1US1 A;  3STD A;  2Y73 A;  4HM3 B;  1SAR A;  1W4N A;  4RBN A;  1JZD A;  3MWZ A;  1GY5 A;  1YJW 3;  4G1M B;  2F99 A;  2B24 B;  1EQK A;  4HKV B;  4O02 B;  2HMM B;  3AHS A;  3DGO A;  3RGA A;  1VQO 3;  5HGR A;  1AVL A;  3RDE A;  3I55 3;  1FUW A;  1B20 A;  3KSP A;  4R80 A;  5BU4 A;  1MWS A;  1E3V A;  2LYX A;  1WTH A;  1KC8 4;  3PYJ A;  1TUH A;  4LZI A;  2GXF A;  5M18 A;  3GRD A;  3G4S 3;  1K73 4;  2QEX 3;  2WO0 A;  3LTB A;  1LOX A;  3DZL A;  5KP1 A;  2F86 B;  1LOW A;  1YJN 3;  1JN5 B;  1TRP A;  1SJW A;  3KCH A;  1T5Y A;  3SOY A;  3Q90 A;  4X2H A;  3JVC A;  3CPO A;  2YFI B;  1RGG A;  5KP3 A;  1N9E A;  3LYG A;  2Y74 A;  1EG9 B;  2CG0 A;  3E99 A;  3FF2 A;  1JV2 B;  1BNG A;  3F7X A;  1BNS A;  1UI7 A;  3HI7 A;  1B3S A;  1W5Z A;  2W0Q A;  1RNT A;  2KCD A;  3B7C A;  3KN4 A;  3HX8 A;  3MG3 A;  3J7Y d;  1B2X A;  3DGM A;  1VQ4 3;  3CD6 3;  2YX9 A;  3KFQ C;  3SXX A;  4N6M A;  3L0R A;  4J5G A;  1YHQ 3;  3G6E 3;  3F14 A;  2J8X B;  3OWS A;  1R4C A;  1STF I;  3JUP A;  1W2Z A;  1SPU A;  4XBY A;  3WOF B;  3V92 A;  2BIR A;  4N6N B;  2R4I A;  2CFD A;  4HM8 B;  1EKM A;  1O7P B;  1WQL B;  2R41 A;  3CMA 3;  1VQ8 3;  4IT7 A;  3BNC A;  3URP A;  1X1U A;  3WHO A;  1IVW A;  1TFO A;  2C10 A;  4WWU C;  5AEU B;  5I97 A;  4HZB B;  2W2C A;  5FW5 A;  3CME 3;  3NQY A;  2GBX B;  2XFS A;  5M1A A;  3D5G A;  1JN5 A;  1U8C B;  3NBB A;  2Z7A A;  1E97 A;  1Q40 A;  4CPK A;  1ASK A;  4L8P A;  1FGT A;  1RDS A;  1RGL A;  1RRL A;  1OAC A;  1LXE A;  2KAA A;  3KSE D;  3QRD A;  1O7G B;  1GD3 A;  3NBJ A;  5LC6 A;  2KRT A;  1M9G A;  3FG4 A;  3G71 3;  1RGA A;  1C7H A;  3NHX A;  2Z6B A;  2BNG A;  1QJG A;  1MWT A;  2JQ5 A;  1KSI A;  4HM5 B;  4IIA A;  1TTO A;  3T0U A;  5CF1 A;  2CFK A;  4FMB A;  2W04 A;  1FGQ A; 
#chains in the Genus database with same CATH homology
 1BNI A;  1RNB A;  1RN4 A;  1B2U A;  4GHO A;  1RCK A;  1T2I A;  1LOV A;  1Q9E A;  4BU4 A;  1BRJ A;  3SYU A;  1AY7 A;  1RLS A;  3D5I A;  1X1W A;  2AAE A;  6RNT A;  1DE3 A;  1BRK A;  2GSP A;  3BU4 A;  7GSP A;  1AQZ A;  1A2P A;  1HYF A;  1RHL A;  1YVS A;  4J5K A;  1BNJ A;  2F4Y A;  1X1X A;  1BVI A;  1BRG A;  4HAA A;  1BOX A;  1BSE A;  1BRS A;  1I2G A;  1I3F A;  1UCJ A;  3RNT A;  3WR2 A;  1LRA A;  1SAR A;  5RNT A;  1YGW A;  1PYL A;  1BNE A;  4RNT A;  1CH0 A;  3DH2 A;  3AHS A;  1B2M A;  2KF4 A;  2F5M A;  1PY3 A;  1B20 A;  1HZ1 A;  5BIR A;  5BU4 A;  1GOY A;  1JBS A;  1GMP A;  2AAD A;  1IYY A;  1BU4 A;  1BRH A;  1FUS A;  1GSP A;  2RNT A;  1GOV A;  1B2S A;  1I2F A;  2ZA4 A;  1LOW A;  5GSP A;  1TRP A;  3KCH A;  1R4Y A;  1BSA A;  1I2E A;  3HOH A;  1RGH A;  3BIR A;  1UCK A;  1JBT A;  1BNR A;  1RGG A;  2RBI A;  1I0V A;  1BRI A;  1T2H A;  3AGN A;  1LOY A;  1RGK A;  3A5E A;  1BNG A;  2HOH A;  1JBR A;  1C54 A;  1BNS A;  1B3S A;  1FUT A;  1TRQ A;  1RNT A;  1BIR A;  8RNT A;  1B27 A;  4GSP A;  1RGF A;  1BSD A;  2F56 A;  1B2X A;  3AGO A;  1BSB A;  7RNT A;  1X1Y A;  2KF6 A;  1G02 A;  1MGR A;  9RNT A;  4J5G A;  1B2Z A;  1RMS A;  2BU4 A;  2SAR A;  1I3I A;  3AHW A;  1BUJ A;  1RSN A;  2C4B A;  1B21 A;  1I8V A;  1BRN L;  1I0X A;  3DGY A;  2BIR A;  5HOH A;  6GSP A;  1BNF A;  1ZGX A;  1GMQ A;  1RGC A;  3URP A;  1X1U A;  3WHO A;  1UCI A;  2KF5 A;  3Q3F A;  2F5W A;  1GMR A;  3D5G A;  4HOH A;  1I70 A;  1RCL A;  1RDS A;  1RGL A;  1GOU A;  2KAA A;  1RGE A;  1RTU A;  1MGW A;  1DET A;  1RGA A;  1BAN A;  1FW7 A;  1FYS A;  1BGS A;  1UCL A;  1YNV X;  1RN1 A;  1TTO A;  4BIR A;  1BAO A;  3D4A A;  2KF3 A;  1BSC A;  1FZU A;  3GSP A;  1LNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...