1RN4A

His92ala mutation in ribonuclease t1 induces segmental flexibility. an x-ray study
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
100
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITATNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title His92Ala mutation in ribonuclease T1 induces segmental flexibility. An X-ray study.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 25
structure length 100
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rn4A00
1RNTA 1RHLA 1LRAA 1CH0A 3D5GA 1BSDA 4BIRA 1C54A 5RNTA 1BU4A 1RLSA 3AHWA 1BRSA 1DETA 2F56A 1JBTA 1BNFA 1GSPA 4HOHA 2AAEA 1TRQA 1SARA 1PYLA 5BIRA 1HYFA 3RNTA 1BSEA 1LOYA 1IYYA 1I0XA 1FUSA 1LOVA 3URPA 9RNTA 4GSPA 3WR2A 3DH2A 1BSCA 3D4AA 4BU4A 2HOHA 1HZ1A 4J5KA 1GMRA 1GOYA 1BRIA 1AY7A 3BIRA 5BU4A 2KF3A 1BNRA 1B2UA 2RBIA 1BAOA 1RDSA 1B3SA 1T2HA 2F5MA 1BRKA 1RTUA 1AQZA 2GSPA 3AGOA 1JBSA 1BNJA 1RN1A 4GHOA 1I2GA 1X1UA 1T2IA 1BNEA 7RNTA 1RGGA 1I70A 2ZA4A 3KCHA 1BRNL 1LNIA 1FYSA 1BGSA 1BRJA 1PY3A 4J5GA 3WHOA 1X1WA 1LOWA 1RGLA 1BNSA 1X1YA 1RSNA 5GSPA 1B2SA 3GSPA 4HAAA 1RCLA 1I2FA 1BNIA 1B2ZA 1FUTA 1RGAA 1RN4A 3Q3FA 1BIRA 1RGCA 1FZUA 1TRPA 2AADA 2BIRA 3DGYA 1BSAA 8RNTA 1G02A 1YVSA 1A2PA 2KF6A 2KF5A 2F4YA 1MGRA 1YNVX 1Q9EA 1RMSA 3AHSA 1GMQA 1I2EA 1B20A 1R4YA 2SARA 2C4BA 1X1XA 2RNTA 1BOXA 1B2XA 1UCJA 1BSBA 3A5EA 1I0VA 7GSPA 1RGFA 1YGWA 1I8VA 6RNTA 1BANA 1UCIA 3HOHA 1I3IA 1B21A 1B27A 1BRHA 1GOVA 1RCKA 2KF4A 3BU4A 3SYUA 1TTOA 1I3FA 1RGEA 1BUJA 1DE3A 1RNBA 1GMPA 2F5WA 1B2MA 5HOHA 1ZGXA 1MGWA 1RGHA 4RNTA 1FW7A 1UCKA 3D5IA 2KAAA 1BRGA 1RGKA 6GSPA 1UCLA 1GOUA 1JBRA 3AGNA 2BU4A 1BNGA 1BVIA
chains in the Genus database with same CATH superfamily
1A2VA 1LRAA 1ULJB 2IUJA 1STDA 4LSOA 1JJ22 5G2GA 1OHOA 1K8A4 5RNTA 5EEOA 8CHOA 1N8QA 4R9KA 1U8CB 3AHWA 1BRSA 1DETA 1JZOA 1UUWB 2INXA 4N6V0 1A67A 1BNFA 4TX4A 1E3VA 2W0QA 3SOAA 4XBTA 3VF1A 3ZG5A 3X3ZA 3V92A 2FNQA 3F14A 5M1AA 3FZWA 3U97A 1VQ43 3CNMA 3T0UA 1US1A 4K61A 2LQVA 2GBWB 3DGMA 3WA3A 3WOEB 1LOYA 2W6JH 3CCS3 3IPTA 4NPBA 1LOVA 1IQ8A 1VZZA 3URPA 4ZM8A 3WR2A 2P0MA 4BU4A 4AKZA 2B1XB 2QEX3 2GBXB 1EQKA 1KC84 1AY7A 1IQXA 5BU4A 2L1SA 1DMQA 3SX1A 3NV0A 3LTAA 1CYVA 3GZXB 1WMNA 3BNEA 1ZX2A 2F5MA 1BRKA 1UW1A 1NB3I 1AQZA 1QAFA 3AGOA 4HM4B 3CNXA 5JPUA 3JUQA 1BNJA 1I2GA 3LMLA 4K1VA 3HIGA 3VGNA 1IQYA 3BNBA 3F7XA 2QA43 2YFJB 1YJN3 1JV2B 1NWWA 2HMOB 2CWVA 2ZA4A 3U1WA 3I563 2ZHXB 3K9MC 3DGOA 3CC43 4J5GA 4L8PA 1ZO2A 1X1WA 1DMNA 1V74A 5GSPA 3DMCA 2KRTA 1YIT3 1W6GA 3SOYA 4N6UA 1SIIA 2CFLA 1IT8A 2L4VA 3UJMA 1VQ63 4EBGA 1FZUA 1M1XB 3K63A 3EF8A 1TRPA 5HGRA 4L7KA 3DGYA 1QJGA 2WOHA 1DVCA 1OUNA 2Z76A 1TP6A 3H3HA 3K5TA 1W02A 3WMDA 1GY6A 3MKIA 3NQZA 4K1UA 5AEWB 1W5ZA 1Q42A 1RMSA 1JKGA 3Q90A 2UUGC 1GMQA 5EQLA 1I2EA 1B20A 1FGRA 5IG0A 1OPYA 1TJDA 2C4BA 2P05A 5CLKA 4KZ1A 5CK6A 1EEJA 1BOXA 3SLUA 4EXRA 3JVCA 3X41A 5IF6A 3RGRA 1T3BA 1MWUA 3FKAA 1Q7Y4 4O8SA 1YGWA 1I8VA 2JQ5A 6RNTA 2H0HA 1ZS7A 4WYKA 3S67A 3N54B 1JB5A 5D81A 5ELUA 2XSHB 2BO9B 3NXJA 1W6CA 5IW9A 4IPBA 3PZWA 3DGLA 1GD3A 3KSED 3O8YA 4X2HA 1LXEA 3BNDA 1RGEA 2WOFA 4KT3B 5DRVA 1BUJA 1GYBA 5HOHA 1ASKA 3LH4A 1MGWA 1RGHA 3FLJA 4HM1B 3ECFA 4HM0B 4OK0A 4GL6A 5LC6A 1VQM3 2IUKA 5STDA 1IVXA 3G6E3 4K90B 4N6TA 3X40A 1JBRA 2OOVA 5IG3A 1BVIA 1TIJA 1OF5A 5AIIA 3FGYA 1CH0A 4Q53A 2D1WA 2YFLB 1LOXA 2GXFA 2CK3H 5CXOA 5KP4A 5A0OB 4STDA 1BU4A 1NB5I 1C54A 1RLSA 2XRXB 3EQQB 1G96A 4GB5A 3HI7A 3KZTA 3B4OA 4FCZA 1YIJ3 4O02B 1YJ93 3V99A 2CWUA 1K41A 1FUWA 4HZ9B 2AAEA 1V57A 1AV4A 1VQ73 2HMMB 4NHFA 2Y73A 2JDIH 1UDII 1SARA 3DUKA 3NQYA 3CCE3 1PYLA 1AVLA 5IG5A 1NJI4 5AYSC 3S29A 3RNTA 1IVVA 1W2ZA 3D3LA 2W56B 2R4IA 1Q864 1W7CA 2P09A 3AMOB 3GZRA 4GSPA 2XH9A 1BSCA 3CMA3 5FGOA 1PU4A 1IDPA 1V58A 4J5KA 4L8OA 1OHPA 5AI1A 3OV4A 1T5YA 3BIRA 1UI8A 3EBYA 2KF3A 3KKGA 2WO0A 3UNLA 1RDSA 5M19A 1YJW3 4KFDA 2IMJA 4BL2A 2E2VA 3X3YA 3CPOA 4DKIA 2H0IA 1FGMA 1GD4A 4N3VA 3LTBA 1NU3A 3NBJA 3CCM3 1X1UA 2BT3A 3EBTA 2ML6A 4N6LA 1U5OA 1BNEA 1N5HA 1UGIA 1WTHA 1JB4A 3PYJA 1VQ53 1W2B2 1LNIA 1ISKA 4BL3A 1M9GA 1FYSA 5EVHA 1FGTA 3LTDA 5JPPA 4LEHA 1JN5A 2RSXA 1BNSA 4LZIA 1RSNA 3N8BA 2XSOB 2QGUA 5JBSA 1VQ83 1RCLA 1TFKA 1I2FA 4N6OB 3ROBA 1A90A 3CU3A 3B4PA 1FUTA 1LQGC 4JF8A 2CFWA 1BIRA 3X3XA 5M18A 1RRLA 2W03A 4XDWA 1TU5A 3SVAA 4FMDA 3KFQC 2BIRA 1EG9B 4MMYB 1BSAA 1IU7A 2K3DA 3KE7A 1G0TA 1YVSA 2R41A 1A2KA 2KF6A 2KF5A 4HM8B 1MGRA 1YNVX 1SIHA 3FG1A 1Q824 3PGBA 2C11A 1E3RA 3FCSB 1R4YA 2WGOA 2XFTA 4LGQA 1X1XA 2RNTA 2CFKA 4ILFA 3B7CA 3OXAA 4FR9A 4I5QA 1B2XA 1IV9A 1KSIA 3HZPA 2PZVA 5ELJA 1D6UA 3CD63 4R9LA 1I0VA 2HMLB 7GSPA 2STDA 3S27A 3T8NA 1AVKA 1BANA 1OGZA 4J8TA 1Q40B 4FMCA 1VQN3 4HM3B 3CC73 1B27A 1BRHA 1GOVA 1RCKA 1OCVA 3DGNA 3GZYB 1VQK3 4FMBA 3PCRA 2OQEA 1I3FA 1GMPA 4PEJA 1B2MA 5AIHA 1W6YA 3EX9A 4BTWA 2CC3A 2KXGA 4RNTA 1UCKA 2GU3A 3D5IA 4RBNA 4LYLB 4XBXA 3CXC2 1UCLA 1GOUA 2BMRB 2F99A 3AGNA 3T8UA 2O3OA 1EKMA 1LQMB 1RHLA 2W04A 4HM5B 3L0RA 4KVHA 3HIIA 3MSOA 1OACA 2A15A 3DM8A 1YI23 3J7Yd 5LC7A 4WP5A 3LXUX 1CQSA 1GY5A 4WFOA 1JBTA 4HVNA 4HM6B 1KWIA 2K54A 4XM4A 5D83A 3FF2A 3MHEA 3I0YA 3F9SA 1BUQA 1K28A 2XF3A 4HM2B 1VQP3 3S5CA 4HM7B 3X42A 1WQLB 4EW5A 1SPUA 3QRDA 3FH1A 1NO3A 1SQWA 2J8XB 4U13A 4RNZA 5BIRA 1HYFA 3BNCA 3Q1CA 1BSEA 2ZL8A 3CPW2 1YVBI 1I0XA 2CKFB 3ALAA 3LT9A 2BMOB 3KIIA 2CX0A 2Q07A 1NDOB 3D4AA 4EC6A 1HZ1A 1DMMA 1O7MB 2B24B 3FG3A 3F7SA 3NUVA 4HBRA 2LYXA 4J9AA 4EV5A 1BNRA 4OVMA 1B2UA 2RBIA 1BAOA 1GS3A 3WOFB 3E99A 3ZG0A 2CHCA 1W00A 2GSPA 3JUMA 6STDA 2XEPA 1JBSA 1O7HB 2ZDJA 4GHOA 3NHXA 2CW9A 3ZFZA 1T2IA 3LOYA 2YFIB 7RNTA 1STFI 2PNCA 2Z7AA 2YX9A 3PCSA 1BRNL 1JNQA 3EN8A 1JZDA 4G1MB 3CCR3 2CX1A 1RKYA 1BGSA 2SBLA 3KN4A 4IT7A 3WHOA 3DXOA 3G713 3BLZA 1LOWA 2CG0A 1X1YA 2Z77A 1FGQA 1B2SA 2CFDA 4BTYA 1BNIA 1B2ZA 3HK4A 3FG4A 1RGAA 1Z1SA 2CIUA 1O7PB 1RN4A 1MWTA 3LZAA 3NV0B 2W9QA 3Q3FA 1RGCA 1WMOA 2D42A 4LMIA 4JRFA 1UUGB 8RNTA 1G02A 1NNVA 4FCJA 3MWZA 1HKXA 1N9EA 2XGLA 3LYGA 3ER7A 3NX0A 1A2PA 7STDA 1O7NB 2F4YA 2RCDA 1Q9EA 3AHSA 3F8HA 1O7GB 3G0KA 3EHCA 1AR0A 1K734 5CF1A 3CCQ3 2SARA 4BTXA 1IK3A 5G1LA 4H3UA 3RGAA 1O7WB 4NREA 4QWTA 3OW22 3JUOA 3D79A 3RDEA 3OWUA 1JRQA 1UCJA 2RFRA 3A5EA 2F86B 2GEXA 1LNHA 4RNYA 1RGFA 5FW5A 3EN1B 2W2CA 4HKVB 3LT8A 3QK9A 4WHAA 3G16A 3IJEB 3CCJ3 1F8NA 1MOLA 3FF0A 4EV2A 5BVBA 1FA3A 1VQQA 1VQO3 1L5GB 1TTOA 2K0MA 3MG3A 3MYTA 3G4S3 2BMQB 4N6NB 2HMJB 1Q7HA 5TGNA 1JKGB 5AEUB 2F5WA 1N9JA 2XR8B 5IG4A 1ROVA 1FW7A 1LVNA 3GRDA 5IEOA 4IIAA 4O3VA 2KAAA 1BRGA 2HMNB 2W56A 1RGKA 6GSPA 4I4KA 3WDGB 2BHMA 2GU1A 2BU4A 1BNGA 3AMOA 3HX8A 3PXMA 1RNTA 2ML5A 3PS8A 2GEYA 4KFFA 3D5GA 1BSDA 4HZBB 1Y4KA 1QVF2 4WYKB 4BIRA 3EC9A 4HYZA 3OX9A 2OWPA 2Z6BA 2CG1A 2I9WA 3LTCA 4RZMA 1WMPA 5AIGA 2F56A 3TDGA 3IMAB 1GSPA 1OGXA 3MPHA 4HOHA 4WWUC 4MMXB 1TFOA 1J2BA 1E97A 1TRQA 2Y74A 5D82A 2CWTA 2UGIA 1W01A 3KSPA 2IYJA 3F40A 3G8ZA 1IYYA 1RRHA 1OH0A 3H51A 4X2OA 1EUIC 4MJDA 1FUSA 3NBBA 4XDVA 9RNTA 3K7CA 3CCV3 3DH2A 2E2TA 3DY5A 3CCU3 1QALA 1OF5B 2HOHA 1S723 1KD14 1K9M4 5AIFA 1GMRA 1GOYA 1BRIA 2IY2A 2RGQA 1CEWI 1M904 4MEIA 3CC23 3A76A 1IVWA 1RN7A 2CFGA 1JB2A 1FGOA 3SXXA 1B3SA 1T2HA 2FXTA 1RTUA 1WNHA 3N9HA 3GWRA 1RN1A 4XB5A 4MMZB 2KCDA 1CYUA 1S5AA 1UUVB 3OWYA 5DREA 1QAKA 5CF2A 2MC8A 1RJOA 4FMAA 1RGGA 2F98A 1I70A 5I97A 3KCHA 4CCVA 3UB1A 2CH9A 1D6ZA 4N6MA 3VSYA 3WA2X 2MF7A 4AKYA 3B8LA 3NM2A 4HJLB 1QVG2 1BRJA 3GAXA 1PY3A 2O9UX 2W9PA 4H61A 1RGLA 1DVDA 4HAAA 1GY7A 3GSPA 4AEQA 5IENA 3WODG 1SJWA 4XBYA 4KFEA 1C7HA 1UGHI 2UX0A 3FSDA 1M1K4 1W4NA 1QMAA 2XFSA 2M7OA 3EJVA 5G1KA 1Q40A 1TUHA 3JUNA 1VQ93 2AADA 3NM7A 4ORLA 3CCL3 3I553 4FCMA 1R4CA 1OHSA 2C10A 2V1LA 2OQEC 3F8XA 2P38A 1VQL3 3SEDA 3V98A 2QIYA 3NBRA 2OCTA 1YGEA 4R80A 2OTJ3 3Q2PA 1IV7A 2H0GA 3UL5A 1Q814 3DZLA 1UI7A 3MG2A 1N8R4 2XGNA 1DYUA 1JN5B 3D9RA 2BNGA 1D6YA 4R1KA 5AYRB 5IEPA 1BSBA 3S28A 3MG1A 3GZBA 1EA2A 2E2UA 4CJNA 4CDLA 5KP1A 1UCIA 3HOHA 1YHQ3 1KQS2 1I3IA 2IA7A 1B21A 1HU9A 3K0ZA 3JUPA 3CME3 3BU4A 2KF4A 1MNLA 1MWRA 3SYUA 3BB9A 3UL6A 3EB8A 4CPKA 4O2HA 5IERA 1PFPA 2OTL3 1DE3A 1IT7A 4OUQA 5BXQA 1RNBA 3EE1A 2WGQA 1ZGXA 1N5PA 1ULIB 3M8CA 1ROAA 1IVUA 3STDA 4R4KA 2OOVC 2P0XA 2FGTA 5KP3A 1MWSA 3OWSA 2HMKB 4EYCA
chains in the Genus database with same CATH topology
1RNTA 1RHLA 1LRAA 1CH0A 3D5GA 1BSDA 4BIRA 1C54A 5RNTA 1BU4A 1RLSA 3AHWA 1BRSA 1DETA 2F56A 1JBTA 1BNFA 1GSPA 4HOHA 2AAEA 1TRQA 1SARA 1PYLA 5BIRA 1HYFA 3RNTA 1BSEA 1LOYA 1IYYA 1I0XA 1FUSA 1LOVA 3URPA 9RNTA 4GSPA 3WR2A 3DH2A 1BSCA 3D4AA 4BU4A 2HOHA 1HZ1A 4J5KA 1GMRA 1GOYA 1BRIA 1AY7A 3BIRA 5BU4A 2KF3A 1BNRA 1B2UA 2RBIA 1BAOA 1RDSA 1B3SA 1T2HA 2F5MA 1BRKA 1RTUA 1AQZA 2GSPA 3AGOA 1JBSA 1BNJA 1RN1A 4GHOA 1I2GA 1X1UA 1T2IA 1BNEA 7RNTA 1RGGA 1I70A 2ZA4A 3KCHA 1BRNL 1LNIA 1FYSA 1BGSA 1BRJA 1PY3A 4J5GA 3WHOA 1X1WA 1LOWA 1RGLA 1BNSA 1X1YA 1RSNA 5GSPA 1B2SA 3GSPA 4HAAA 1RCLA 1I2FA 1BNIA 1B2ZA 1FUTA 1RGAA 1RN4A 3Q3FA 1BIRA 1RGCA 1FZUA 1TRPA 2AADA 2BIRA 3DGYA 1BSAA 8RNTA 1G02A 1YVSA 1A2PA 2KF6A 2KF5A 2F4YA 1MGRA 1YNVX 1Q9EA 1RMSA 3AHSA 1GMQA 1I2EA 1B20A 1R4YA 2SARA 2C4BA 1X1XA 2RNTA 1BOXA 1B2XA 1UCJA 1BSBA 3A5EA 1I0VA 7GSPA 1RGFA 1YGWA 1I8VA 6RNTA 1BANA 1UCIA 3HOHA 1I3IA 1B21A 1B27A 1BRHA 1GOVA 1RCKA 2KF4A 3BU4A 3SYUA 1TTOA 1I3FA 1RGEA 1BUJA 1DE3A 1RNBA 1GMPA 2F5WA 1B2MA 5HOHA 1ZGXA 1MGWA 1RGHA 4RNTA 1FW7A 1UCKA 3D5IA 2KAAA 1BRGA 1RGKA 6GSPA 1UCLA 1GOUA 1JBRA 3AGNA 2BU4A 1BNGA 1BVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNT A;  1RHL A;  1LRA A;  1CH0 A;  3D5G A;  1BSD A;  4BIR A;  1C54 A;  5RNT A;  1BU4 A;  1RLS A;  3AHW A;  1BRS A;  1DET A;  2F56 A;  1JBT A;  1BNF A;  1GSP A;  4HOH A;  2AAE A;  1TRQ A;  1SAR A;  1PYL A;  5BIR A;  1HYF A;  3RNT A;  1BSE A;  1LOY A;  1IYY A;  1I0X A;  1FUS A;  1LOV A;  3URP A;  9RNT A;  4GSP A;  3WR2 A;  3DH2 A;  1BSC A;  3D4A A;  4BU4 A;  2HOH A;  1HZ1 A;  4J5K A;  1GMR A;  1GOY A;  1BRI A;  1AY7 A;  3BIR A;  5BU4 A;  2KF3 A;  1BNR A;  1B2U A;  2RBI A;  1BAO A;  1RDS A;  1B3S A;  1T2H A;  2F5M A;  1BRK A;  1RTU A;  1AQZ A;  2GSP A;  3AGO A;  1JBS A;  1BNJ A;  1RN1 A;  4GHO A;  1I2G A;  1X1U A;  1T2I A;  1BNE A;  7RNT A;  1RGG A;  1I70 A;  2ZA4 A;  3KCH A;  1BRN L;  1LNI A;  1FYS A;  1BGS A;  1BRJ A;  1PY3 A;  4J5G A;  3WHO A;  1X1W A;  1LOW A;  1RGL A;  1BNS A;  1X1Y A;  1RSN A;  5GSP A;  1B2S A;  3GSP A;  4HAA A;  1RCL A;  1I2F A;  1BNI A;  1B2Z A;  1FUT A;  1RGA A;  1RN4 A;  3Q3F A;  1BIR A;  1RGC A;  1FZU A;  1TRP A;  2AAD A;  2BIR A;  3DGY A;  1BSA A;  8RNT A;  1G02 A;  1YVS A;  1A2P A;  2KF6 A;  2KF5 A;  2F4Y A;  1MGR A;  1YNV X;  1Q9E A;  1RMS A;  3AHS A;  1GMQ A;  1I2E A;  1B20 A;  1R4Y A;  2SAR A;  2C4B A;  1X1X A;  2RNT A;  1BOX A;  1B2X A;  1UCJ A;  1BSB A;  3A5E A;  1I0V A;  7GSP A;  1RGF A;  1YGW A;  1I8V A;  6RNT A;  1BAN A;  1UCI A;  3HOH A;  1I3I A;  1B21 A;  1B27 A;  1BRH A;  1GOV A;  1RCK A;  2KF4 A;  3BU4 A;  3SYU A;  1TTO A;  1I3F A;  1RGE A;  1BUJ A;  1DE3 A;  1RNB A;  1GMP A;  2F5W A;  1B2M A;  5HOH A;  1ZGX A;  1MGW A;  1RGH A;  4RNT A;  1FW7 A;  1UCK A;  3D5I A;  2KAA A;  1BRG A;  1RGK A;  6GSP A;  1UCL A;  1GOU A;  1JBR A;  3AGN A;  2BU4 A;  1BNG A;  1BVI A; 
#chains in the Genus database with same CATH topology
 1A2V A;  1LRA A;  1ULJ B;  2IUJ A;  1STD A;  4LSO A;  1JJ2 2;  5G2G A;  1OHO A;  1K8A 4;  5RNT A;  5EEO A;  8CHO A;  1N8Q A;  4R9K A;  1U8C B;  3AHW A;  1BRS A;  1DET A;  1JZO A;  1UUW B;  2INX A;  4N6V 0;  1A67 A;  1BNF A;  4TX4 A;  1E3V A;  2W0Q A;  3SOA A;  4XBT A;  3VF1 A;  3ZG5 A;  3X3Z A;  3V92 A;  2FNQ A;  3F14 A;  5M1A A;  3FZW A;  3U97 A;  1VQ4 3;  3CNM A;  3T0U A;  1US1 A;  4K61 A;  2LQV A;  2GBW B;  3DGM A;  3WA3 A;  3WOE B;  1LOY A;  2W6J H;  3CCS 3;  3IPT A;  4NPB A;  1LOV A;  1IQ8 A;  1VZZ A;  3URP A;  4ZM8 A;  3WR2 A;  2P0M A;  4BU4 A;  4AKZ A;  2B1X B;  2QEX 3;  2GBX B;  1EQK A;  1KC8 4;  1AY7 A;  1IQX A;  5BU4 A;  2L1S A;  1DMQ A;  3SX1 A;  3NV0 A;  3LTA A;  1CYV A;  3GZX B;  1WMN A;  3BNE A;  1ZX2 A;  2F5M A;  1BRK A;  1UW1 A;  1NB3 I;  1AQZ A;  1QAF A;  3AGO A;  4HM4 B;  3CNX A;  5JPU A;  3JUQ A;  1BNJ A;  1I2G A;  3LML A;  4K1V A;  3HIG A;  3VGN A;  1IQY A;  3BNB A;  3F7X A;  2QA4 3;  2YFJ B;  1YJN 3;  1JV2 B;  1NWW A;  2HMO B;  2CWV A;  2ZA4 A;  3U1W A;  3I56 3;  2ZHX B;  3K9M C;  3DGO A;  3CC4 3;  4J5G A;  4L8P A;  1ZO2 A;  1X1W A;  1DMN A;  1V74 A;  5GSP A;  3DMC A;  2KRT A;  1YIT 3;  1W6G A;  3SOY A;  4N6U A;  1SII A;  2CFL A;  1IT8 A;  2L4V A;  3UJM A;  1VQ6 3;  4EBG A;  1FZU A;  1M1X B;  3K63 A;  3EF8 A;  1TRP A;  5HGR A;  4L7K A;  3DGY A;  1QJG A;  2WOH A;  1DVC A;  1OUN A;  2Z76 A;  1TP6 A;  3H3H A;  3K5T A;  1W02 A;  3WMD A;  1GY6 A;  3MKI A;  3NQZ A;  4K1U A;  5AEW B;  1W5Z A;  1Q42 A;  1RMS A;  1JKG A;  3Q90 A;  2UUG C;  1GMQ A;  5EQL A;  1I2E A;  1B20 A;  1FGR A;  5IG0 A;  1OPY A;  1TJD A;  2C4B A;  2P05 A;  5CLK A;  4KZ1 A;  5CK6 A;  1EEJ A;  1BOX A;  3SLU A;  4EXR A;  3JVC A;  3X41 A;  5IF6 A;  3RGR A;  1T3B A;  1MWU A;  3FKA A;  1Q7Y 4;  4O8S A;  1YGW A;  1I8V A;  2JQ5 A;  6RNT A;  2H0H A;  1ZS7 A;  4WYK A;  3S67 A;  3N54 B;  1JB5 A;  5D81 A;  5ELU A;  2XSH B;  2BO9 B;  3NXJ A;  1W6C A;  5IW9 A;  4IPB A;  3PZW A;  3DGL A;  1GD3 A;  3KSE D;  3O8Y A;  4X2H A;  1LXE A;  3BND A;  1RGE A;  2WOF A;  4KT3 B;  5DRV A;  1BUJ A;  1GYB A;  5HOH A;  1ASK A;  3LH4 A;  1MGW A;  1RGH A;  3FLJ A;  4HM1 B;  3ECF A;  4HM0 B;  4OK0 A;  4GL6 A;  5LC6 A;  1VQM 3;  2IUK A;  5STD A;  1IVX A;  3G6E 3;  4K90 B;  4N6T A;  3X40 A;  1JBR A;  2OOV A;  5IG3 A;  1BVI A;  1TIJ A;  1OF5 A;  5AII A;  3FGY A;  1CH0 A;  4Q53 A;  2D1W A;  2YFL B;  1LOX A;  2GXF A;  2CK3 H;  5CXO A;  5KP4 A;  5A0O B;  4STD A;  1BU4 A;  1NB5 I;  1C54 A;  1RLS A;  2XRX B;  3EQQ B;  1G96 A;  4GB5 A;  3HI7 A;  3KZT A;  3B4O A;  4FCZ A;  1YIJ 3;  4O02 B;  1YJ9 3;  3V99 A;  2CWU A;  1K41 A;  1FUW A;  4HZ9 B;  2AAE A;  1V57 A;  1AV4 A;  1VQ7 3;  2HMM B;  4NHF A;  2Y73 A;  2JDI H;  1UDI I;  1SAR A;  3DUK A;  3NQY A;  3CCE 3;  1PYL A;  1AVL A;  5IG5 A;  1NJI 4;  5AYS C;  3S29 A;  3RNT A;  1IVV A;  1W2Z A;  3D3L A;  2W56 B;  2R4I A;  1Q86 4;  1W7C A;  2P09 A;  3AMO B;  3GZR A;  4GSP A;  2XH9 A;  1BSC A;  3CMA 3;  5FGO A;  1PU4 A;  1IDP A;  1V58 A;  4J5K A;  4L8O A;  1OHP A;  5AI1 A;  3OV4 A;  1T5Y A;  3BIR A;  1UI8 A;  3EBY A;  2KF3 A;  3KKG A;  2WO0 A;  3UNL A;  1RDS A;  5M19 A;  1YJW 3;  4KFD A;  2IMJ A;  4BL2 A;  2E2V A;  3X3Y A;  3CPO A;  4DKI A;  2H0I A;  1FGM A;  1GD4 A;  4N3V A;  3LTB A;  1NU3 A;  3NBJ A;  3CCM 3;  1X1U A;  2BT3 A;  3EBT A;  2ML6 A;  4N6L A;  1U5O A;  1BNE A;  1N5H A;  1UGI A;  1WTH A;  1JB4 A;  3PYJ A;  1VQ5 3;  1W2B 2;  1LNI A;  1ISK A;  4BL3 A;  1M9G A;  1FYS A;  5EVH A;  1FGT A;  3LTD A;  5JPP A;  4LEH A;  1JN5 A;  2RSX A;  1BNS A;  4LZI A;  1RSN A;  3N8B A;  2XSO B;  2QGU A;  5JBS A;  1VQ8 3;  1RCL A;  1TFK A;  1I2F A;  4N6O B;  3ROB A;  1A90 A;  3CU3 A;  3B4P A;  1FUT A;  1LQG C;  4JF8 A;  2CFW A;  1BIR A;  3X3X A;  5M18 A;  1RRL A;  2W03 A;  4XDW A;  1TU5 A;  3SVA A;  4FMD A;  3KFQ C;  2BIR A;  1EG9 B;  4MMY B;  1BSA A;  1IU7 A;  2K3D A;  3KE7 A;  1G0T A;  1YVS A;  2R41 A;  1A2K A;  2KF6 A;  2KF5 A;  4HM8 B;  1MGR A;  1YNV X;  1SIH A;  3FG1 A;  1Q82 4;  3PGB A;  2C11 A;  1E3R A;  3FCS B;  1R4Y A;  2WGO A;  2XFT A;  4LGQ A;  1X1X A;  2RNT A;  2CFK A;  4ILF A;  3B7C A;  3OXA A;  4FR9 A;  4I5Q A;  1B2X A;  1IV9 A;  1KSI A;  3HZP A;  2PZV A;  5ELJ A;  1D6U A;  3CD6 3;  4R9L A;  1I0V A;  2HML B;  7GSP A;  2STD A;  3S27 A;  3T8N A;  1AVK A;  1BAN A;  1OGZ A;  4J8T A;  1Q40 B;  4FMC A;  1VQN 3;  4HM3 B;  3CC7 3;  1B27 A;  1BRH A;  1GOV A;  1RCK A;  1OCV A;  3DGN A;  3GZY B;  1VQK 3;  4FMB A;  3PCR A;  2OQE A;  1I3F A;  1GMP A;  4PEJ A;  1B2M A;  5AIH A;  1W6Y A;  3EX9 A;  4BTW A;  2CC3 A;  2KXG A;  4RNT A;  1UCK A;  2GU3 A;  3D5I A;  4RBN A;  4LYL B;  4XBX A;  3CXC 2;  1UCL A;  1GOU A;  2BMR B;  2F99 A;  3AGN A;  3T8U A;  2O3O A;  1EKM A;  1LQM B;  1RHL A;  2W04 A;  4HM5 B;  3L0R A;  4KVH A;  3HII A;  3MSO A;  1OAC A;  2A15 A;  3DM8 A;  1YI2 3;  3J7Y d;  5LC7 A;  4WP5 A;  3LXU X;  1CQS A;  1GY5 A;  4WFO A;  1JBT A;  4HVN A;  4HM6 B;  1KWI A;  2K54 A;  4XM4 A;  5D83 A;  3FF2 A;  3MHE A;  3I0Y A;  3F9S A;  1BUQ A;  1K28 A;  2XF3 A;  4HM2 B;  1VQP 3;  3S5C A;  4HM7 B;  3X42 A;  1WQL B;  4EW5 A;  1SPU A;  3QRD A;  3FH1 A;  1NO3 A;  1SQW A;  2J8X B;  4U13 A;  4RNZ A;  5BIR A;  1HYF A;  3BNC A;  3Q1C A;  1BSE A;  2ZL8 A;  3CPW 2;  1YVB I;  1I0X A;  2CKF B;  3ALA A;  3LT9 A;  2BMO B;  3KII A;  2CX0 A;  2Q07 A;  1NDO B;  3D4A A;  4EC6 A;  1HZ1 A;  1DMM A;  1O7M B;  2B24 B;  3FG3 A;  3F7S A;  3NUV A;  4HBR A;  2LYX A;  4J9A A;  4EV5 A;  1BNR A;  4OVM A;  1B2U A;  2RBI A;  1BAO A;  1GS3 A;  3WOF B;  3E99 A;  3ZG0 A;  2CHC A;  1W00 A;  2GSP A;  3JUM A;  6STD A;  2XEP A;  1JBS A;  1O7H B;  2ZDJ A;  4GHO A;  3NHX A;  2CW9 A;  3ZFZ A;  1T2I A;  3LOY A;  2YFI B;  7RNT A;  1STF I;  2PNC A;  2Z7A A;  2YX9 A;  3PCS A;  1BRN L;  1JNQ A;  3EN8 A;  1JZD A;  4G1M B;  3CCR 3;  2CX1 A;  1RKY A;  1BGS A;  2SBL A;  3KN4 A;  4IT7 A;  3WHO A;  3DXO A;  3G71 3;  3BLZ A;  1LOW A;  2CG0 A;  1X1Y A;  2Z77 A;  1FGQ A;  1B2S A;  2CFD A;  4BTY A;  1BNI A;  1B2Z A;  3HK4 A;  3FG4 A;  1RGA A;  1Z1S A;  2CIU A;  1O7P B;  1RN4 A;  1MWT A;  3LZA A;  3NV0 B;  2W9Q A;  3Q3F A;  1RGC A;  1WMO A;  2D42 A;  4LMI A;  4JRF A;  1UUG B;  8RNT A;  1G02 A;  1NNV A;  4FCJ A;  3MWZ A;  1HKX A;  1N9E A;  2XGL A;  3LYG A;  3ER7 A;  3NX0 A;  1A2P A;  7STD A;  1O7N B;  2F4Y A;  2RCD A;  1Q9E A;  3AHS A;  3F8H A;  1O7G B;  3G0K A;  3EHC A;  1AR0 A;  1K73 4;  5CF1 A;  3CCQ 3;  2SAR A;  4BTX A;  1IK3 A;  5G1L A;  4H3U A;  3RGA A;  1O7W B;  4NRE A;  4QWT A;  3OW2 2;  3JUO A;  3D79 A;  3RDE A;  3OWU A;  1JRQ A;  1UCJ A;  2RFR A;  3A5E A;  2F86 B;  2GEX A;  1LNH A;  4RNY A;  1RGF A;  5FW5 A;  3EN1 B;  2W2C A;  4HKV B;  3LT8 A;  3QK9 A;  4WHA A;  3G16 A;  3IJE B;  3CCJ 3;  1F8N A;  1MOL A;  3FF0 A;  4EV2 A;  5BVB A;  1FA3 A;  1VQQ A;  1VQO 3;  1L5G B;  1TTO A;  2K0M A;  3MG3 A;  3MYT A;  3G4S 3;  2BMQ B;  4N6N B;  2HMJ B;  1Q7H A;  5TGN A;  1JKG B;  5AEU B;  2F5W A;  1N9J A;  2XR8 B;  5IG4 A;  1ROV A;  1FW7 A;  1LVN A;  3GRD A;  5IEO A;  4IIA A;  4O3V A;  2KAA A;  1BRG A;  2HMN B;  2W56 A;  1RGK A;  6GSP A;  4I4K A;  3WDG B;  2BHM A;  2GU1 A;  2BU4 A;  1BNG A;  3AMO A;  3HX8 A;  3PXM A;  1RNT A;  2ML5 A;  3PS8 A;  2GEY A;  4KFF A;  3D5G A;  1BSD A;  4HZB B;  1Y4K A;  1QVF 2;  4WYK B;  4BIR A;  3EC9 A;  4HYZ A;  3OX9 A;  2OWP A;  2Z6B A;  2CG1 A;  2I9W A;  3LTC A;  4RZM A;  1WMP A;  5AIG A;  2F56 A;  3TDG A;  3IMA B;  1GSP A;  1OGX A;  3MPH A;  4HOH A;  4WWU C;  4MMX B;  1TFO A;  1J2B A;  1E97 A;  1TRQ A;  2Y74 A;  5D82 A;  2CWT A;  2UGI A;  1W01 A;  3KSP A;  2IYJ A;  3F40 A;  3G8Z A;  1IYY A;  1RRH A;  1OH0 A;  3H51 A;  4X2O A;  1EUI C;  4MJD A;  1FUS A;  3NBB A;  4XDV A;  9RNT A;  3K7C A;  3CCV 3;  3DH2 A;  2E2T A;  3DY5 A;  3CCU 3;  1QAL A;  1OF5 B;  2HOH A;  1S72 3;  1KD1 4;  1K9M 4;  5AIF A;  1GMR A;  1GOY A;  1BRI A;  2IY2 A;  2RGQ A;  1CEW I;  1M90 4;  4MEI A;  3CC2 3;  3A76 A;  1IVW A;  1RN7 A;  2CFG A;  1JB2 A;  1FGO A;  3SXX A;  1B3S A;  1T2H A;  2FXT A;  1RTU A;  1WNH A;  3N9H A;  3GWR A;  1RN1 A;  4XB5 A;  4MMZ B;  2KCD A;  1CYU A;  1S5A A;  1UUV B;  3OWY A;  5DRE A;  1QAK A;  5CF2 A;  2MC8 A;  1RJO A;  4FMA A;  1RGG A;  2F98 A;  1I70 A;  5I97 A;  3KCH A;  4CCV A;  3UB1 A;  2CH9 A;  1D6Z A;  4N6M A;  3VSY A;  3WA2 X;  2MF7 A;  4AKY A;  3B8L A;  3NM2 A;  4HJL B;  1QVG 2;  1BRJ A;  3GAX A;  1PY3 A;  2O9U X;  2W9P A;  4H61 A;  1RGL A;  1DVD A;  4HAA A;  1GY7 A;  3GSP A;  4AEQ A;  5IEN A;  3WOD G;  1SJW A;  4XBY A;  4KFE A;  1C7H A;  1UGH I;  2UX0 A;  3FSD A;  1M1K 4;  1W4N A;  1QMA A;  2XFS A;  2M7O A;  3EJV A;  5G1K A;  1Q40 A;  1TUH A;  3JUN A;  1VQ9 3;  2AAD A;  3NM7 A;  4ORL A;  3CCL 3;  3I55 3;  4FCM A;  1R4C A;  1OHS A;  2C10 A;  2V1L A;  2OQE C;  3F8X A;  2P38 A;  1VQL 3;  3SED A;  3V98 A;  2QIY A;  3NBR A;  2OCT A;  1YGE A;  4R80 A;  2OTJ 3;  3Q2P A;  1IV7 A;  2H0G A;  3UL5 A;  1Q81 4;  3DZL A;  1UI7 A;  3MG2 A;  1N8R 4;  2XGN A;  1DYU A;  1JN5 B;  3D9R A;  2BNG A;  1D6Y A;  4R1K A;  5AYR B;  5IEP A;  1BSB A;  3S28 A;  3MG1 A;  3GZB A;  1EA2 A;  2E2U A;  4CJN A;  4CDL A;  5KP1 A;  1UCI A;  3HOH A;  1YHQ 3;  1KQS 2;  1I3I A;  2IA7 A;  1B21 A;  1HU9 A;  3K0Z A;  3JUP A;  3CME 3;  3BU4 A;  2KF4 A;  1MNL A;  1MWR A;  3SYU A;  3BB9 A;  3UL6 A;  3EB8 A;  4CPK A;  4O2H A;  5IER A;  1PFP A;  2OTL 3;  1DE3 A;  1IT7 A;  4OUQ A;  5BXQ A;  1RNB A;  3EE1 A;  2WGQ A;  1ZGX A;  1N5P A;  1ULI B;  3M8C A;  1ROA A;  1IVU A;  3STD A;  4R4K A;  2OOV C;  2P0X A;  2FGT A;  5KP3 A;  1MWS A;  3OWS A;  2HMK B;  4EYC A; 
#chains in the Genus database with same CATH homology
 1RNT A;  1RHL A;  1LRA A;  1CH0 A;  3D5G A;  1BSD A;  4BIR A;  1C54 A;  5RNT A;  1BU4 A;  1RLS A;  3AHW A;  1BRS A;  1DET A;  2F56 A;  1JBT A;  1BNF A;  1GSP A;  4HOH A;  2AAE A;  1TRQ A;  1SAR A;  1PYL A;  5BIR A;  1HYF A;  3RNT A;  1BSE A;  1LOY A;  1IYY A;  1I0X A;  1FUS A;  1LOV A;  3URP A;  9RNT A;  4GSP A;  3WR2 A;  3DH2 A;  1BSC A;  3D4A A;  4BU4 A;  2HOH A;  1HZ1 A;  4J5K A;  1GMR A;  1GOY A;  1BRI A;  1AY7 A;  3BIR A;  5BU4 A;  2KF3 A;  1BNR A;  1B2U A;  2RBI A;  1BAO A;  1RDS A;  1B3S A;  1T2H A;  2F5M A;  1BRK A;  1RTU A;  1AQZ A;  2GSP A;  3AGO A;  1JBS A;  1BNJ A;  1RN1 A;  4GHO A;  1I2G A;  1X1U A;  1T2I A;  1BNE A;  7RNT A;  1RGG A;  1I70 A;  2ZA4 A;  3KCH A;  1BRN L;  1LNI A;  1FYS A;  1BGS A;  1BRJ A;  1PY3 A;  4J5G A;  3WHO A;  1X1W A;  1LOW A;  1RGL A;  1BNS A;  1X1Y A;  1RSN A;  5GSP A;  1B2S A;  3GSP A;  4HAA A;  1RCL A;  1I2F A;  1BNI A;  1B2Z A;  1FUT A;  1RGA A;  1RN4 A;  3Q3F A;  1BIR A;  1RGC A;  1FZU A;  1TRP A;  2AAD A;  2BIR A;  3DGY A;  1BSA A;  8RNT A;  1G02 A;  1YVS A;  1A2P A;  2KF6 A;  2KF5 A;  2F4Y A;  1MGR A;  1YNV X;  1Q9E A;  1RMS A;  3AHS A;  1GMQ A;  1I2E A;  1B20 A;  1R4Y A;  2SAR A;  2C4B A;  1X1X A;  2RNT A;  1BOX A;  1B2X A;  1UCJ A;  1BSB A;  3A5E A;  1I0V A;  7GSP A;  1RGF A;  1YGW A;  1I8V A;  6RNT A;  1BAN A;  1UCI A;  3HOH A;  1I3I A;  1B21 A;  1B27 A;  1BRH A;  1GOV A;  1RCK A;  2KF4 A;  3BU4 A;  3SYU A;  1TTO A;  1I3F A;  1RGE A;  1BUJ A;  1DE3 A;  1RNB A;  1GMP A;  2F5W A;  1B2M A;  5HOH A;  1ZGX A;  1MGW A;  1RGH A;  4RNT A;  1FW7 A;  1UCK A;  3D5I A;  2KAA A;  1BRG A;  1RGK A;  6GSP A;  1UCL A;  1GOU A;  1JBR A;  3AGN A;  2BU4 A;  1BNG A;  1BVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...