2M7OA

Nmr structure of the protein np_346341.1 from streptococcus pneumoniae
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
GDDRKLMKTQEELTEIVRDHFSDMGEIATLYVQVYESSLESLVGGVIFEDGRHYTFVYENEDLVYEEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title NMR Structure of the protein NP_346341.1 from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
total genus 10
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15513 DUF4651 Domain of unknown function (DUF4651)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.400 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2m7oA00
2M7OA
chains in the Genus database with same CATH superfamily
2STDA 4KZ1A 2XFSA 2JQ5A 1GD4A 5AI1A 1Q864 1UI8A 2CIUA 1QMAA 3DGNA 4U13A 1RGEA 1BAOA 1RGFA 3LH4A 1OACA 3CCV3 4N6NB 1I0XA 1VQK3 1GY7A 1HU9A 2K3DA 2CFWA 3FCSB 5IENA 1A90A 2KF3A 4XB5A 1BSCA 5IEOA 3VSYA 3D5GA 2I9WA 1O7WB 5IERA 1UGIA 2OTJ3 3MWZA 1BRKA 1VQ83 3NBBA 3RGAA 4R80A 1BSAA 2CG1A 3T8NA 3EN8A 2BNGA 4EV5A 2KCDA 2W9PA 1YVBI 1IV9A 2HOHA 3JVCA 4LYLB 5FW5A 2KF6A 4MMZB 3WDGB 2HMOB 1GMPA 1E3RA 7STDA 4HZ9B 4K1UA 1G96A 2RSXA 1EA2A 1OHOA 3K0ZA 2IA7A 4BIRA 4EBGA 1FUSA 3HI7A 2QGUA 1W00A 4LZIA 3BIRA 5AEWB 1B2XA 1RGAA 3RDEA 1D6UA 3CCM3 5G2GA 3B4OA 3EF8A 1BRGA 3FH1A 1X1XA 3K9MC 1GS3A 5G1KA 1SQWA 1BRJA 2YFIB 3CNXA 5CXOA 5KP3A 3WA3A 4FCZA 3AMOB 1KD14 2IUKA 3BNCA 5DREA 3FG3A 3F9SA 2W0QA 3HIGA 1AY7A 1ZO2A 3JUPA 1RSNA 1Y4KA 3KCHA 1I70A 3URPA 1YIJ3 5GSPA 1CEWI 1Q9EA 1JN5A 3EBTA 3KSED 1GY6A 1OPYA 5BXQA 4R1KA 5M19A 3WA2X 1B20A 1MWTA 3MSOA 3IJEB 2K54A 4AKZA 1JBSA 3LTBA 2OOVA 2XR8B 2ML6A 1TTOA 4XDWA 5EQLA 2Y73A 3FKAA 2L4VA 2XRXB 2XGLA 1OGZA 1CYVA 2A15A 8RNTA 5RNTA 1N5PA 1NWWA 1DVDA 4L8PA 1RGHA 3FF2A 2BMOB 3KKGA 3GZBA 1ROVA 4R9KA 5A0OB 2GBWB 1W02A 3CPW2 1FGQA 4FMBA 2HMJB 1VQ73 1GMQA 1U5OA 4CJNA 1STDA 4FR9A 2W56B 3AHWA 5IG4A 1GMRA 2MF7A 4WHAA 2B24B 3FSDA 4HM4B 3S5CA 2HMLB 2YFJB 3F40A 3EJVA 3DGOA 4EV2A 1FGRA 4BL3A 4L8OA 1UCLA 1YGEA 3TDGA 1GD3A 4WYKA 3STDA 1X1WA 4O3VA 4FMAA 1JB4A 4N6LA 4LGQA 3UJMA 3HZPA 2CWTA 3N8BA 5CLKA 1KC84 3SXXA 2IY2A 1LOWA 1AR0A 1WQLB 4FCJA 4N6V0 3CCS3 3MPHA 1JKGA 2BO9B 3OX9A 3D3LA 4IIAA 3PCSA 1BOXA 3HK4A 3JUNA 5AYRB 2P0MA 3B8LA 1BRSA 2BU4A 1O7MB 4ILFA 3F7XA 1JNQA 4PEJA 3SLUA 4O8SA 3D9RA 2GEYA 1VZZA 1CH0A 4GB5A 4JF8A 1LNIA 2P05A 5KP4A 4XM4A 2B1XB 4OK0A 1RNTA 8CHOA 5HGRA 3HOHA 9RNTA 1QAKA 3F8XA 2WOFA 4HM3B 2GSPA 3ALAA 4XDVA 3KN4A 4MEIA 1RRHA 3S27A 2BIRA 4RBNA 1ZGXA 1LVNA 1SARA 1K734 1YHQ3 3H3HA 2D42A 2QA43 3G8ZA 1JB5A 3SOYA 1Q42A 3U97A 4BTYA 3WMDA 1JV2B 4CDLA 1E97A 2YFLB 3WOEB 2GXFA 3AGNA 2ZDJA 3CMA3 1O7NB 1IVVA 1A67A 3FLJA 1M1XB 3DH2A 3LOYA 2F4YA 3ECFA 3N54B 3J7Yd 1VQO3 1YJW3 1BVIA 1IT8A 1WNHA 1RN4A 2KAAA 1RLSA 5CF1A 1UCJA 5CF2A 3A5EA 4N6OB 4MMXB 2W6JH 1K41A 1KQS2 3DMCA 1G0TA 1T2HA 1W7CA 1TFKA 1X1YA 3DGYA 2CWVA 3CNMA 1IDPA 4LMIA 2PZVA 4WP5A 3U1WA 1I2FA 1LQMB 3DM8A 4R9LA 3QRDA 3EQQB 3NV0B 4TX4A 3FG4A 2IUJA 1I2GA 3PXMA 1K28A 1BSBA 1TU5A 1B2MA 1BRNL 2WGQA 3PZWA 4HVNA 1UDII 1WTHA 1E3VA 5BVBA 1PU4A 5LC7A 1TUHA 1V57A 2CKFB 3S29A 1SIHA 5KP1A 3PGBA 2XFTA 4J9AA 2GU3A 2PNCA 2E2TA 2XF3A 4KT3B 3V92A 4EXRA 3CC23 3T0UA 3LMLA 1YIT3 1YNVX 4EC6A 1W01A 2XSOB 4X2HA 5JPUA 2F98A 1MWSA 5AIIA 2F5WA 1LXEA 3A76A 3K5TA 5FGOA 1R4CA 1UI7A 1DMNA 1EUIC 1IK3A 1VQ53 3KZTA 3I553 3OWUA 2GU1A 3AMOA 2XGNA 3NXJA 4G1MB 4EW5A 2CW9A 1IVXA 3NQYA 2CK3H 3WHOA 1IV7A 3UL5A 1C54A 3GRDA 3DY5A 3OXAA 1A2KA 1LNHA 2CFKA 5M1AA 2CFGA 2L1SA 2F5MA 3D5IA 3IMAB 2CX1A 1RMSA 3MG1A 1RRLA 4XBXA 1AVLA 3MG2A 3CPOA 4J5GA 4X2OA 3JUOA 3WR2A 2FNQA 1UGHI 1X1UA 3EN1B 4WFOA 1NJI4 3DXOA 3F14A 4EYCA 1BNIA 4HM7B 5AEUB 1T5YA 3PCRA 2XH9A 5AIGA 5AYSC 4L7KA 4XBTA 1B2UA 1IQ8A 3MHEA 5IG5A 1B3SA 4IT7A 4O2HA 4O02B 2CWUA 5STDA 1N9JA 5TGNA 3FGYA 1JZDA 1DMQA 4GHOA 3G0KA 3B4PA 1BRIA 1BSDA 4FCMA 2W56A 1RGCA 1EEJA 4Q53A 1ULIB 3WODG 3HX8A 2O9UX 2HMMB 2RBIA 1HZ1A 3CCR3 2LQVA 1VQQA 5G1LA 2WOHA 1PYLA 3SOAA 1T3BA 3K7CA 2Z7AA 3CCQ3 2QEX3 3HIIA 3LTDA 2C4BA 1ZX2A 3UL6A 1ULJB 3ZG5A 1A2VA 2RFRA 5EEOA 1ZS7A 3KE7A 2INXA 2CX0A 1RGKA 3FF0A 2C11A 4HAAA 3B7CA 3RGRA 1Q40B 5IW9A 3ZG0A 3GSPA 2CHCA 2Y74A 1WMOA 1YVSA 1RN1A 2H0IA 1RN7A 1BSEA 4HJLB 3ROBA 4CCVA 1N5HA 4AKYA 4RNZA 2GBXB 3RNTA 4XBYA 3AGOA 1Q824 3F7SA 4N6UA 1MGRA 2XEPA 2YX9A 2M7OA 1W2ZA 3DGLA 4WWUC 3G4S3 3NM7A 1FYSA 2Z77A 4NPBA 2HMKB 2OQEA 1GSPA 2H0HA 3NBRA 1VQ93 1EKMA 1TP6A 1W4NA 3PS8A 3S67A 3L0RA 3CU3A 2Q07A 5AIFA 4FMDA 1IQXA 3BNBA 1VQN3 2KRTA 1I8VA 1BNEA 1EG9B 1BU4A 1LQGC 5I97A 5IG3A 1K9M4 1B27A 3ZFZA 1KSIA 4HOHA 1BNFA 2F99A 2IMJA 1NNVA 6RNTA 1UCIA 1RTUA 3X40A 1RDSA 2F56A 1UCKA 5BU4A 1GY5A 2Z6BA 4FMCA 1J2BA 5D83A 3EB8A 3K63A 2KXGA 1RNBA 1ASKA 1QAFA 1V58A 1B21A 3MYTA 2XSHB 1LOYA 3EBYA 4HZBB 1FGTA 2WGOA 1BGSA 3LTAA 5M18A 2ZHXB 1S723 2E2VA 3PYJA 1CQSA 3QK9A 5HOHA 1MGWA 3CC73 1BUJA 4BTWA 1SPUA 1JBRA 1B2SA 1M904 2OTL3 1BNSA 3Q3FA 1YJ93 1N8QA 3NV0A 5JPPA 1FW7A 1I3IA 1OHSA 1KWIA 1RGLA 4HM1B 1HKXA 1I0VA 3UB1A 3CCJ3 2UX0A 3T8UA 4JRFA 1BUQA 2ZL8A 1QALA 5DRVA 1OF5B 3CC43 3BNEA 1UUVB 1BNGA 1PY3A 1IVWA 1OCVA 3D4AA 3NHXA 7RNTA 3BB9A 3SVAA 1TIJA 1HYFA 4N3VA 1MWUA 1G02A 2BHMA 2SBLA 1TRPA 5ELUA 3SYUA 1M1K4 3GWRA 1R4YA 4NHFA 2AAEA 1Q7HA 3ER7A 1UUWB 1W6CA 4HM6B 1FUTA 2ML5A 3V98A 2FXTA 3NM2A 4MMYB 3KFQC 1GOYA 4KVHA 1GOVA 4OUQA 4J5KA 2RCDA 3EE1A 3GZRA 3X3XA 3MKIA 3GZYB 1O7GB 5BIRA 2GEXA 3BU4A 3LXUX 4OVMA 2E2UA 1T2IA 3Q1CA 5CK6A 3OW22 1JBTA 1WMPA 1YI23 3OV4A 4KFFA 3CD63 3WOFB 2P0XA 4HM5B 4HM0B 1NB3I 1MNLA 4KFDA 1BNJA 3S28A 7GSPA 1JRQA 1I2EA 3DZLA 1FA3A 4QWTA 3CCL3 2HMNB 1JB2A 2R4IA 2UGIA 1K8A4 4ZM8A 2CFLA 1O7PB 4BL2A 2LYXA 3JUQA 1FZUA 1F8NA 1TJDA 4HKVB 3I0YA 4N6MA 1MWRA 2CG0A 2QIYA 2W03A 1QVG2 4K61A 4K1VA 1RCLA 5IEPA 1OHPA 2P09A 3F8HA 1WMNA 3NUVA 1ISKA 3IPTA 1QJGA 2BMQB 2R41A 3H51A 3D79A 4HM8B 3SX1A 3E99A 4RNTA 3CME3 1BRHA 3EC9A 3LTCA 1L5GB 2V1LA 2BT3A 3OWYA 3BLZA 2CFDA 1LOXA 4J8TA 2JDIH 1AQZA 2OCTA 1Q40A 4KFEA 4MJDA 2KF4A 2W2CA 1NB5I 1W6YA 4HYZA 3NX0A 1A2PA 3LT9A 1W6GA 2CC3A 3LZAA 1UW1A 3UNLA 1Q7Y4 6GSPA 1RKYA 1BANA 4NREA 2FGTA 1STFI 4H3UA 3EHCA 4H61A 1RHLA 3X41A 1YJN3 5AIHA 1VQM3 2SARA 1OGXA 2P38A 1IQYA 1JN5B 3NBJA 1UUGB 3I563 1DE3A 4N6TA 3NQZA 1IU7A 2W9QA 3X42A 3LT8A 1RGGA 1GYBA 3EX9A 2H0GA 1VQ43 1C7HA 1NU3A 1CYUA 2OOVC 4CPKA 4AEQA 5LC6A 3Q2PA 4BTXA 2C10A 1QVF2 1JJ22 4HBRA 3SEDA 1I3FA 1TRQA 1AVKA 1DVCA 1JZOA 1YGWA 1LRAA 2J8XB 2RGQA 3G16A 3KSPA 1N8R4 1US1A 1VQP3 4DKIA 1SIIA 4LSOA 1IT7A 1Z1SA 2KF5A 2RNTA 4GSPA 3FG1A 1IVUA 1GOUA 1LOVA 1OH0A 2D1WA 3CXC2 1NO3A 1S5AA 3GZXB 4WYKB 4I5QA 1W5ZA 3G713 1MOLA 3G6E3 1V74A 3VF1A 4I4KA 4RNYA 1Q814 3X3ZA 3M8CA 3O8YA 1JKGB 4BU4A 4GL6A 1FGOA 3N9HA 1D6ZA 3Q90A 3DGMA 4K90B 2IYJA 1AV4A 3GAXA 1OUNA 3JUMA 1BNRA 3CCE3 3LYGA 1DYUA 1OF5A 1ROAA 2OWPA 3KIIA 3BNDA 1B2ZA 1VQ63 4IPBA 4ORLA 1EQKA 1RJOA 3X3YA 1IYYA 5IF6A 5D81A 1FUWA 1DMMA 2OQEC 3OWSA 1W2B2 3DUKA 3FZWA 3CCU3 1N9EA 1O7HB 1TFOA 2WO0A 2Z76A 2ZA4A 4R4KA 5ELJA 2CH9A 3AHSA 1M9GA 1NDOB 5EVHA 1FGMA 1DETA 2AADA 2W04A 4LEHA 5D82A 2MC8A 2BMRB 2O3OA 1PFPA 3VGNA 1BIRA 3V99A 1VQL3 2K0MA 4HM2B 4RZMA 4STDA 2F86B 1D6YA 5JBSA 6STDA 1RCKA 2UUGC 5IG0A 3MG3A 1SJWA 1U8CB
chains in the Genus database with same CATH topology
2STDA 4KZ1A 2XFSA 2JQ5A 1GD4A 5AI1A 1Q864 1UI8A 2CIUA 1QMAA 3DGNA 4U13A 3LH4A 1OACA 3CCV3 4N6NB 1VQK3 1GY7A 1HU9A 3FCSB 2CFWA 1A90A 5IENA 4XB5A 3VSYA 5IEOA 2I9WA 1O7WB 5IERA 2OTJ3 3MWZA 1VQ83 3NBBA 3RGAA 4R80A 2CG1A 3T8NA 3EN8A 2BNGA 4EV5A 2KCDA 2W9PA 1YVBI 1IV9A 3WDGB 3JVCA 5FW5A 4MMZB 2HMOB 1E3RA 7STDA 4HZ9B 4K1UA 1G96A 2RSXA 1EA2A 1OHOA 3K0ZA 2IA7A 4EBGA 3HI7A 2QGUA 1W00A 4LZIA 5AEWB 3RDEA 1D6UA 3CCM3 5G2GA 3B4OA 3EF8A 3FH1A 3K9MC 1GS3A 1SQWA 2YFIB 3CNXA 5CXOA 5KP3A 3WA3A 4FCZA 3AMOB 1KD14 2IUKA 3BNCA 5DREA 3FG3A 3F9SA 2W0QA 3HIGA 1ZO2A 3JUPA 1Y4KA 1YIJ3 1CEWI 3KSED 1JN5A 3EBTA 1GY6A 1OPYA 5BXQA 4R1KA 3WA2X 4AKZA 3MSOA 3IJEB 2K54A 3LTBA 2OOVA 2XR8B 2ML6A 4XDWA 5EQLA 2Y73A 3FKAA 2L4VA 2XRXB 2XGLA 1OGZA 1CYVA 2A15A 1N5PA 1NWWA 1DVDA 4L8PA 3FF2A 2BMOB 3KKGA 3GZBA 1ROVA 4R9KA 5A0OB 2GBWB 1W02A 3CPW2 1FGQA 4FMBA 2HMJB 1VQ73 1U5OA 1STDA 4FR9A 2W56B 5IG4A 2MF7A 4WHAA 2B24B 3FSDA 4HM4B 3S5CA 2HMLB 2YFJB 3F40A 3EJVA 3DGOA 4EV2A 1FGRA 4L8OA 1YGEA 3TDGA 1GD3A 4WYKA 3STDA 4O3VA 4FMAA 1JB4A 4N6LA 4LGQA 3UJMA 3HZPA 2CWTA 3N8BA 5CLKA 1KC84 3SXXA 1AR0A 1WQLB 4FCJA 4N6V0 3CCS3 3MPHA 1JKGA 2BO9B 3OX9A 3D3LA 4IIAA 3PCSA 3HK4A 3JUNA 5AYRB 2P0MA 3B8LA 4PEJA 1O7MB 3SLUA 3F7XA 1JNQA 4O8SA 3D9RA 2GEYA 1VZZA 4GB5A 4JF8A 2P05A 5KP4A 4XM4A 2B1XB 4OK0A 8CHOA 5HGRA 1QAKA 3F8XA 2WOFA 4HM3B 3ALAA 4XDVA 3KN4A 4MEIA 1RRHA 3S27A 4RBNA 1LVNA 1K734 1YHQ3 3H3HA 2D42A 2QA43 3G8ZA 1JB5A 3SOYA 1Q42A 3U97A 4BTYA 3WMDA 1JV2B 4CDLA 1E97A 2YFLB 3WOEB 2GXFA 3CMA3 2ZDJA 1O7NB 1IVVA 1A67A 3FLJA 1M1XB 3LOYA 3ECFA 1VQO3 3N54B 3J7Yd 1YJW3 1IT8A 1WNHA 5CF1A 5CF2A 4N6OB 4MMXB 2W6JH 1K41A 1KQS2 3DMCA 1W7CA 1TFKA 2CWVA 3CNMA 1IDPA 4LMIA 2PZVA 4WP5A 3U1WA 4R9LA 3DM8A 3QRDA 3EQQB 3NV0B 4TX4A 3FG4A 2IUJA 3PXMA 1K28A 1TU5A 2WGQA 3PZWA 4HVNA 1WTHA 1E3VA 5BVBA 1PU4A 5LC7A 1TUHA 2CKFB 3S29A 1SIHA 5KP1A 3PGBA 2XFTA 4J9AA 2GU3A 2PNCA 2E2TA 2XF3A 3V92A 4EXRA 3CC23 1YIT3 3T0UA 3LMLA 4EC6A 1W01A 2XSOB 4X2HA 5JPUA 2F98A 5AIIA 5FGOA 1LXEA 3A76A 3K5TA 1R4CA 1UI7A 1DMNA 1IK3A 1VQ53 3KZTA 3I553 3OWUA 2GU1A 3AMOA 2XGNA 3NXJA 4G1MB 2CW9A 1IVXA 3NQYA 2CK3H 1IV7A 3UL5A 3GRDA 3DY5A 3OXAA 1A2KA 1LNHA 2CFKA 2CFGA 3IMAB 3MG1A 1RRLA 4XBXA 1AVLA 3MG2A 3CPOA 4X2OA 3JUOA 2FNQA 4WFOA 3EN1B 1NJI4 3DXOA 3F14A 4EYCA 4HM7B 5AEUB 1T5YA 3PCRA 2XH9A 5AIGA 5AYSC 4L7KA 4XBTA 1IQ8A 3MHEA 5IG5A 4IT7A 4O2HA 4O02B 2CWUA 5STDA 1N9JA 5TGNA 3FGYA 1DMQA 3G0KA 3B4PA 4FCMA 2W56A 4Q53A 1ULIB 3WODG 3HX8A 2O9UX 2HMMB 3CCR3 2LQVA 2WOHA 3SOAA 3K7CA 3CCQ3 2Z7AA 2QEX3 3HIIA 3LTDA 1ZX2A 3UL6A 1ULJB 1A2VA 2RFRA 5EEOA 3KE7A 2INXA 3RGRA 3FF0A 2C11A 3B7CA 1Q40B 5IW9A 2CHCA 2Y74A 1WMOA 1RN7A 3ROBA 4HJLB 4CCVA 1N5HA 4AKYA 4RNZA 2GBXB 4XBYA 1Q824 3F7SA 4N6UA 2XEPA 2YX9A 2M7OA 1W2ZA 3DGLA 4WWUC 3G4S3 3NM7A 2Z77A 2HMKB 2OQEA 1VQ93 3NBRA 1EKMA 1TP6A 1W4NA 3PS8A 3S67A 3L0RA 3CU3A 2Q07A 5AIFA 4FMDA 1IQXA 3BNBA 1VQN3 2KRTA 1EG9B 5I97A 5IG3A 1K9M4 1KSIA 2F99A 2IMJA 3X40A 1GY5A 2Z6BA 4FMCA 1J2BA 5D83A 3EB8A 3K63A 2KXGA 1ASKA 1QAFA 3MYTA 4HZBB 2XSHB 3EBYA 1FGTA 2WGOA 3LTAA 1S723 2E2VA 3PYJA 1CQSA 3QK9A 3CC73 4BTWA 1SPUA 1M904 2OTL3 1YJ93 1N8QA 3NV0A 5JPPA 1OHSA 4HM1B 1KWIA 3UB1A 1HKXA 3CCJ3 2UX0A 3T8UA 4JRFA 1BUQA 2ZL8A 1QALA 5DRVA 1OF5B 3CC43 3BNEA 1UUVB 1IVWA 1OCVA 3NHXA 3BB9A 3SVAA 1TIJA 4N3VA 2BHMA 2SBLA 5ELUA 1M1K4 3GWRA 4NHFA 3ER7A 1UUWB 1W6CA 4HM6B 2ML5A 3V98A 2FXTA 3NM2A 4MMYB 3KFQC 4KVHA 4OUQA 2RCDA 3EE1A 3GZRA 3X3XA 3MKIA 3GZYB 1O7GB 2GEXA 3LXUX 4OVMA 5CK6A 2E2UA 3Q1CA 3OW22 1WMPA 1YI23 3OV4A 4KFFA 3CD63 3WOFB 2P0XA 4HM5B 4HM0B 1NB3I 1MNLA 4KFDA 3S28A 1JRQA 3DZLA 1FA3A 4QWTA 3CCL3 2HMNB 1JB2A 2R4IA 1K8A4 4ZM8A 2CFLA 1O7PB 2LYXA 3JUQA 1F8NA 4HKVB 3I0YA 4N6MA 2CG0A 2QIYA 2W03A 1QVG2 4K61A 4K1VA 5IEPA 1OHPA 2P09A 3F8HA 1WMNA 3NUVA 1ISKA 3IPTA 1QJGA 2BMQB 3H51A 4HM8B 3SX1A 3E99A 3CME3 3EC9A 3LTCA 1L5GB 2V1LA 2BT3A 3OWYA 3BLZA 2CFDA 1LOXA 4J8TA 2JDIH 2OCTA 1Q40A 4KFEA 4MJDA 2W2CA 1NB5I 1W6YA 4HYZA 3NX0A 3LT9A 1W6GA 2CC3A 3LZAA 1UW1A 3UNLA 1Q7Y4 1RKYA 4NREA 2FGTA 1STFI 4H3UA 3EHCA 4H61A 3X41A 1YJN3 5AIHA 1VQM3 1OGXA 2P38A 1IQYA 1JN5B 3NBJA 3I563 4N6TA 3NQZA 1IU7A 2W9QA 3X42A 3LT8A 1GYBA 3EX9A 1VQ43 1C7HA 1NU3A 1CYUA 2OOVC 4AEQA 5LC6A 3Q2PA 4BTXA 2C10A 1QVF2 1JJ22 4HBRA 3SEDA 1AVKA 1DVCA 3G16A 2RGQA 3KSPA 1N8R4 1US1A 1VQP3 1SIIA 4LSOA 1IT7A 1Z1SA 3FG1A 1IVUA 1OH0A 2D1WA 3CXC2 1NO3A 1S5AA 3GZXB 4WYKB 1W5ZA 3G713 1MOLA 3G6E3 1V74A 3VF1A 4I4KA 4RNYA 1Q814 3X3ZA 3M8CA 3O8YA 1JKGB 4GL6A 1FGOA 3N9HA 1D6ZA 3Q90A 3DGMA 4K90B 1AV4A 3GAXA 1OUNA 3JUMA 3CCE3 3LYGA 1DYUA 1OF5A 1ROAA 2OWPA 3KIIA 3BNDA 1VQ63 4IPBA 4ORLA 1EQKA 1RJOA 3X3YA 5IF6A 5D81A 1FUWA 1DMMA 2OQEC 3OWSA 1W2B2 3DUKA 3FZWA 3CCU3 1N9EA 1O7HB 1TFOA 2WO0A 2Z76A 4R4KA 5ELJA 2CH9A 1M9GA 1NDOB 5EVHA 1FGMA 2W04A 5D82A 4LEHA 2MC8A 3VGNA 3V99A 2BMRB 2O3OA 1PFPA 1VQL3 2K0MA 4HM2B 4RZMA 4STDA 2F86B 1D6YA 5JBSA 6STDA 5IG0A 3MG3A 1SJWA 1U8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7O A; 
#chains in the Genus database with same CATH topology
 2STD A;  4KZ1 A;  2XFS A;  2JQ5 A;  1GD4 A;  5AI1 A;  1Q86 4;  1UI8 A;  2CIU A;  1QMA A;  3DGN A;  4U13 A;  1RGE A;  1BAO A;  1RGF A;  3LH4 A;  1OAC A;  3CCV 3;  4N6N B;  1I0X A;  1VQK 3;  1GY7 A;  1HU9 A;  2K3D A;  2CFW A;  3FCS B;  5IEN A;  1A90 A;  2KF3 A;  4XB5 A;  1BSC A;  5IEO A;  3VSY A;  3D5G A;  2I9W A;  1O7W B;  5IER A;  1UGI A;  2OTJ 3;  3MWZ A;  1BRK A;  1VQ8 3;  3NBB A;  3RGA A;  4R80 A;  1BSA A;  2CG1 A;  3T8N A;  3EN8 A;  2BNG A;  4EV5 A;  2KCD A;  2W9P A;  1YVB I;  1IV9 A;  2HOH A;  3JVC A;  4LYL B;  5FW5 A;  2KF6 A;  4MMZ B;  3WDG B;  2HMO B;  1GMP A;  1E3R A;  7STD A;  4HZ9 B;  4K1U A;  1G96 A;  2RSX A;  1EA2 A;  1OHO A;  3K0Z A;  2IA7 A;  4BIR A;  4EBG A;  1FUS A;  3HI7 A;  2QGU A;  1W00 A;  4LZI A;  3BIR A;  5AEW B;  1B2X A;  1RGA A;  3RDE A;  1D6U A;  3CCM 3;  5G2G A;  3B4O A;  3EF8 A;  1BRG A;  3FH1 A;  1X1X A;  3K9M C;  1GS3 A;  5G1K A;  1SQW A;  1BRJ A;  2YFI B;  3CNX A;  5CXO A;  5KP3 A;  3WA3 A;  4FCZ A;  3AMO B;  1KD1 4;  2IUK A;  3BNC A;  5DRE A;  3FG3 A;  3F9S A;  2W0Q A;  3HIG A;  1AY7 A;  1ZO2 A;  3JUP A;  1RSN A;  1Y4K A;  3KCH A;  1I70 A;  3URP A;  1YIJ 3;  5GSP A;  1CEW I;  1Q9E A;  1JN5 A;  3EBT A;  3KSE D;  1GY6 A;  1OPY A;  5BXQ A;  4R1K A;  5M19 A;  3WA2 X;  1B20 A;  1MWT A;  3MSO A;  3IJE B;  2K54 A;  4AKZ A;  1JBS A;  3LTB A;  2OOV A;  2XR8 B;  2ML6 A;  1TTO A;  4XDW A;  5EQL A;  2Y73 A;  3FKA A;  2L4V A;  2XRX B;  2XGL A;  1OGZ A;  1CYV A;  2A15 A;  8RNT A;  5RNT A;  1N5P A;  1NWW A;  1DVD A;  4L8P A;  1RGH A;  3FF2 A;  2BMO B;  3KKG A;  3GZB A;  1ROV A;  4R9K A;  5A0O B;  2GBW B;  1W02 A;  3CPW 2;  1FGQ A;  4FMB A;  2HMJ B;  1VQ7 3;  1GMQ A;  1U5O A;  4CJN A;  1STD A;  4FR9 A;  2W56 B;  3AHW A;  5IG4 A;  1GMR A;  2MF7 A;  4WHA A;  2B24 B;  3FSD A;  4HM4 B;  3S5C A;  2HML B;  2YFJ B;  3F40 A;  3EJV A;  3DGO A;  4EV2 A;  1FGR A;  4BL3 A;  4L8O A;  1UCL A;  1YGE A;  3TDG A;  1GD3 A;  4WYK A;  3STD A;  1X1W A;  4O3V A;  4FMA A;  1JB4 A;  4N6L A;  4LGQ A;  3UJM A;  3HZP A;  2CWT A;  3N8B A;  5CLK A;  1KC8 4;  3SXX A;  2IY2 A;  1LOW A;  1AR0 A;  1WQL B;  4FCJ A;  4N6V 0;  3CCS 3;  3MPH A;  1JKG A;  2BO9 B;  3OX9 A;  3D3L A;  4IIA A;  3PCS A;  1BOX A;  3HK4 A;  3JUN A;  5AYR B;  2P0M A;  3B8L A;  1BRS A;  2BU4 A;  1O7M B;  4ILF A;  3F7X A;  1JNQ A;  4PEJ A;  3SLU A;  4O8S A;  3D9R A;  2GEY A;  1VZZ A;  1CH0 A;  4GB5 A;  4JF8 A;  1LNI A;  2P05 A;  5KP4 A;  4XM4 A;  2B1X B;  4OK0 A;  1RNT A;  8CHO A;  5HGR A;  3HOH A;  9RNT A;  1QAK A;  3F8X A;  2WOF A;  4HM3 B;  2GSP A;  3ALA A;  4XDV A;  3KN4 A;  4MEI A;  1RRH A;  3S27 A;  2BIR A;  4RBN A;  1ZGX A;  1LVN A;  1SAR A;  1K73 4;  1YHQ 3;  3H3H A;  2D42 A;  2QA4 3;  3G8Z A;  1JB5 A;  3SOY A;  1Q42 A;  3U97 A;  4BTY A;  3WMD A;  1JV2 B;  4CDL A;  1E97 A;  2YFL B;  3WOE B;  2GXF A;  3AGN A;  2ZDJ A;  3CMA 3;  1O7N B;  1IVV A;  1A67 A;  3FLJ A;  1M1X B;  3DH2 A;  3LOY A;  2F4Y A;  3ECF A;  3N54 B;  3J7Y d;  1VQO 3;  1YJW 3;  1BVI A;  1IT8 A;  1WNH A;  1RN4 A;  2KAA A;  1RLS A;  5CF1 A;  1UCJ A;  5CF2 A;  3A5E A;  4N6O B;  4MMX B;  2W6J H;  1K41 A;  1KQS 2;  3DMC A;  1G0T A;  1T2H A;  1W7C A;  1TFK A;  1X1Y A;  3DGY A;  2CWV A;  3CNM A;  1IDP A;  4LMI A;  2PZV A;  4WP5 A;  3U1W A;  1I2F A;  1LQM B;  3DM8 A;  4R9L A;  3QRD A;  3EQQ B;  3NV0 B;  4TX4 A;  3FG4 A;  2IUJ A;  1I2G A;  3PXM A;  1K28 A;  1BSB A;  1TU5 A;  1B2M A;  1BRN L;  2WGQ A;  3PZW A;  4HVN A;  1UDI I;  1WTH A;  1E3V A;  5BVB A;  1PU4 A;  5LC7 A;  1TUH A;  1V57 A;  2CKF B;  3S29 A;  1SIH A;  5KP1 A;  3PGB A;  2XFT A;  4J9A A;  2GU3 A;  2PNC A;  2E2T A;  2XF3 A;  4KT3 B;  3V92 A;  4EXR A;  3CC2 3;  3T0U A;  3LML A;  1YIT 3;  1YNV X;  4EC6 A;  1W01 A;  2XSO B;  4X2H A;  5JPU A;  2F98 A;  1MWS A;  5AII A;  2F5W A;  1LXE A;  3A76 A;  3K5T A;  5FGO A;  1R4C A;  1UI7 A;  1DMN A;  1EUI C;  1IK3 A;  1VQ5 3;  3KZT A;  3I55 3;  3OWU A;  2GU1 A;  3AMO A;  2XGN A;  3NXJ A;  4G1M B;  4EW5 A;  2CW9 A;  1IVX A;  3NQY A;  2CK3 H;  3WHO A;  1IV7 A;  3UL5 A;  1C54 A;  3GRD A;  3DY5 A;  3OXA A;  1A2K A;  1LNH A;  2CFK A;  5M1A A;  2CFG A;  2L1S A;  2F5M A;  3D5I A;  3IMA B;  2CX1 A;  1RMS A;  3MG1 A;  1RRL A;  4XBX A;  1AVL A;  3MG2 A;  3CPO A;  4J5G A;  4X2O A;  3JUO A;  3WR2 A;  2FNQ A;  1UGH I;  1X1U A;  3EN1 B;  4WFO A;  1NJI 4;  3DXO A;  3F14 A;  4EYC A;  1BNI A;  4HM7 B;  5AEU B;  1T5Y A;  3PCR A;  2XH9 A;  5AIG A;  5AYS C;  4L7K A;  4XBT A;  1B2U A;  1IQ8 A;  3MHE A;  5IG5 A;  1B3S A;  4IT7 A;  4O2H A;  4O02 B;  2CWU A;  5STD A;  1N9J A;  5TGN A;  3FGY A;  1JZD A;  1DMQ A;  4GHO A;  3G0K A;  3B4P A;  1BRI A;  1BSD A;  4FCM A;  2W56 A;  1RGC A;  1EEJ A;  4Q53 A;  1ULI B;  3WOD G;  3HX8 A;  2O9U X;  2HMM B;  2RBI A;  1HZ1 A;  3CCR 3;  2LQV A;  1VQQ A;  5G1L A;  2WOH A;  1PYL A;  3SOA A;  1T3B A;  3K7C A;  2Z7A A;  3CCQ 3;  2QEX 3;  3HII A;  3LTD A;  2C4B A;  1ZX2 A;  3UL6 A;  1ULJ B;  3ZG5 A;  1A2V A;  2RFR A;  5EEO A;  1ZS7 A;  3KE7 A;  2INX A;  2CX0 A;  1RGK A;  3FF0 A;  2C11 A;  4HAA A;  3B7C A;  3RGR A;  1Q40 B;  5IW9 A;  3ZG0 A;  3GSP A;  2CHC A;  2Y74 A;  1WMO A;  1YVS A;  1RN1 A;  2H0I A;  1RN7 A;  1BSE A;  4HJL B;  3ROB A;  4CCV A;  1N5H A;  4AKY A;  4RNZ A;  2GBX B;  3RNT A;  4XBY A;  3AGO A;  1Q82 4;  3F7S A;  4N6U A;  1MGR A;  2XEP A;  2YX9 A;  2M7O A;  1W2Z A;  3DGL A;  4WWU C;  3G4S 3;  3NM7 A;  1FYS A;  2Z77 A;  4NPB A;  2HMK B;  2OQE A;  1GSP A;  2H0H A;  3NBR A;  1VQ9 3;  1EKM A;  1TP6 A;  1W4N A;  3PS8 A;  3S67 A;  3L0R A;  3CU3 A;  2Q07 A;  5AIF A;  4FMD A;  1IQX A;  3BNB A;  1VQN 3;  2KRT A;  1I8V A;  1BNE A;  1EG9 B;  1BU4 A;  1LQG C;  5I97 A;  5IG3 A;  1K9M 4;  1B27 A;  3ZFZ A;  1KSI A;  4HOH A;  1BNF A;  2F99 A;  2IMJ A;  1NNV A;  6RNT A;  1UCI A;  1RTU A;  3X40 A;  1RDS A;  2F56 A;  1UCK A;  5BU4 A;  1GY5 A;  2Z6B A;  4FMC A;  1J2B A;  5D83 A;  3EB8 A;  3K63 A;  2KXG A;  1RNB A;  1ASK A;  1QAF A;  1V58 A;  1B21 A;  3MYT A;  2XSH B;  1LOY A;  3EBY A;  4HZB B;  1FGT A;  2WGO A;  1BGS A;  3LTA A;  5M18 A;  2ZHX B;  1S72 3;  2E2V A;  3PYJ A;  1CQS A;  3QK9 A;  5HOH A;  1MGW A;  3CC7 3;  1BUJ A;  4BTW A;  1SPU A;  1JBR A;  1B2S A;  1M90 4;  2OTL 3;  1BNS A;  3Q3F A;  1YJ9 3;  1N8Q A;  3NV0 A;  5JPP A;  1FW7 A;  1I3I A;  1OHS A;  1KWI A;  1RGL A;  4HM1 B;  1HKX A;  1I0V A;  3UB1 A;  3CCJ 3;  2UX0 A;  3T8U A;  4JRF A;  1BUQ A;  2ZL8 A;  1QAL A;  5DRV A;  1OF5 B;  3CC4 3;  3BNE A;  1UUV B;  1BNG A;  1PY3 A;  1IVW A;  1OCV A;  3D4A A;  3NHX A;  7RNT A;  3BB9 A;  3SVA A;  1TIJ A;  1HYF A;  4N3V A;  1MWU A;  1G02 A;  2BHM A;  2SBL A;  1TRP A;  5ELU A;  3SYU A;  1M1K 4;  3GWR A;  1R4Y A;  4NHF A;  2AAE A;  1Q7H A;  3ER7 A;  1UUW B;  1W6C A;  4HM6 B;  1FUT A;  2ML5 A;  3V98 A;  2FXT A;  3NM2 A;  4MMY B;  3KFQ C;  1GOY A;  4KVH A;  1GOV A;  4OUQ A;  4J5K A;  2RCD A;  3EE1 A;  3GZR A;  3X3X A;  3MKI A;  3GZY B;  1O7G B;  5BIR A;  2GEX A;  3BU4 A;  3LXU X;  4OVM A;  2E2U A;  1T2I A;  3Q1C A;  5CK6 A;  3OW2 2;  1JBT A;  1WMP A;  1YI2 3;  3OV4 A;  4KFF A;  3CD6 3;  3WOF B;  2P0X A;  4HM5 B;  4HM0 B;  1NB3 I;  1MNL A;  4KFD A;  1BNJ A;  3S28 A;  7GSP A;  1JRQ A;  1I2E A;  3DZL A;  1FA3 A;  4QWT A;  3CCL 3;  2HMN B;  1JB2 A;  2R4I A;  2UGI A;  1K8A 4;  4ZM8 A;  2CFL A;  1O7P B;  4BL2 A;  2LYX A;  3JUQ A;  1FZU A;  1F8N A;  1TJD A;  4HKV B;  3I0Y A;  4N6M A;  1MWR A;  2CG0 A;  2QIY A;  2W03 A;  1QVG 2;  4K61 A;  4K1V A;  1RCL A;  5IEP A;  1OHP A;  2P09 A;  3F8H A;  1WMN A;  3NUV A;  1ISK A;  3IPT A;  1QJG A;  2BMQ B;  2R41 A;  3H51 A;  3D79 A;  4HM8 B;  3SX1 A;  3E99 A;  4RNT A;  3CME 3;  1BRH A;  3EC9 A;  3LTC A;  1L5G B;  2V1L A;  2BT3 A;  3OWY A;  3BLZ A;  2CFD A;  1LOX A;  4J8T A;  2JDI H;  1AQZ A;  2OCT A;  1Q40 A;  4KFE A;  4MJD A;  2KF4 A;  2W2C A;  1NB5 I;  1W6Y A;  4HYZ A;  3NX0 A;  1A2P A;  3LT9 A;  1W6G A;  2CC3 A;  3LZA A;  1UW1 A;  3UNL A;  1Q7Y 4;  6GSP A;  1RKY A;  1BAN A;  4NRE A;  2FGT A;  1STF I;  4H3U A;  3EHC A;  4H61 A;  1RHL A;  3X41 A;  1YJN 3;  5AIH A;  1VQM 3;  2SAR A;  1OGX A;  2P38 A;  1IQY A;  1JN5 B;  3NBJ A;  1UUG B;  3I56 3;  1DE3 A;  4N6T A;  3NQZ A;  1IU7 A;  2W9Q A;  3X42 A;  3LT8 A;  1RGG A;  1GYB A;  3EX9 A;  2H0G A;  1VQ4 3;  1C7H A;  1NU3 A;  1CYU A;  2OOV C;  4CPK A;  4AEQ A;  5LC6 A;  3Q2P A;  4BTX A;  2C10 A;  1QVF 2;  1JJ2 2;  4HBR A;  3SED A;  1I3F A;  1TRQ A;  1AVK A;  1DVC A;  1JZO A;  1YGW A;  1LRA A;  2J8X B;  2RGQ A;  3G16 A;  3KSP A;  1N8R 4;  1US1 A;  1VQP 3;  4DKI A;  1SII A;  4LSO A;  1IT7 A;  1Z1S A;  2KF5 A;  2RNT A;  4GSP A;  3FG1 A;  1IVU A;  1GOU A;  1LOV A;  1OH0 A;  2D1W A;  3CXC 2;  1NO3 A;  1S5A A;  3GZX B;  4WYK B;  4I5Q A;  1W5Z A;  3G71 3;  1MOL A;  3G6E 3;  1V74 A;  3VF1 A;  4I4K A;  4RNY A;  1Q81 4;  3X3Z A;  3M8C A;  3O8Y A;  1JKG B;  4BU4 A;  4GL6 A;  1FGO A;  3N9H A;  1D6Z A;  3Q90 A;  3DGM A;  4K90 B;  2IYJ A;  1AV4 A;  3GAX A;  1OUN A;  3JUM A;  1BNR A;  3CCE 3;  3LYG A;  1DYU A;  1OF5 A;  1ROA A;  2OWP A;  3KII A;  3BND A;  1B2Z A;  1VQ6 3;  4IPB A;  4ORL A;  1EQK A;  1RJO A;  3X3Y A;  1IYY A;  5IF6 A;  5D81 A;  1FUW A;  1DMM A;  2OQE C;  3OWS A;  1W2B 2;  3DUK A;  3FZW A;  3CCU 3;  1N9E A;  1O7H B;  1TFO A;  2WO0 A;  2Z76 A;  2ZA4 A;  4R4K A;  5ELJ A;  2CH9 A;  3AHS A;  1M9G A;  1NDO B;  5EVH A;  1FGM A;  1DET A;  2AAD A;  2W04 A;  4LEH A;  5D82 A;  2MC8 A;  2BMR B;  2O3O A;  1PFP A;  3VGN A;  1BIR A;  3V99 A;  1VQL 3;  2K0M A;  4HM2 B;  4RZM A;  4STD A;  2F86 B;  1D6Y A;  5JBS A;  6STD A;  1RCK A;  2UUG C;  5IG0 A;  3MG3 A;  1SJW A;  1U8C B; 
#chains in the Genus database with same CATH homology
 2STD A;  4KZ1 A;  2XFS A;  2JQ5 A;  1GD4 A;  5AI1 A;  1Q86 4;  1UI8 A;  2CIU A;  1QMA A;  3DGN A;  4U13 A;  3LH4 A;  1OAC A;  3CCV 3;  4N6N B;  1VQK 3;  1GY7 A;  1HU9 A;  3FCS B;  2CFW A;  1A90 A;  5IEN A;  4XB5 A;  3VSY A;  5IEO A;  2I9W A;  1O7W B;  5IER A;  2OTJ 3;  3MWZ A;  1VQ8 3;  3NBB A;  3RGA A;  4R80 A;  2CG1 A;  3T8N A;  3EN8 A;  2BNG A;  4EV5 A;  2KCD A;  2W9P A;  1YVB I;  1IV9 A;  3WDG B;  3JVC A;  5FW5 A;  4MMZ B;  2HMO B;  1E3R A;  7STD A;  4HZ9 B;  4K1U A;  1G96 A;  2RSX A;  1EA2 A;  1OHO A;  3K0Z A;  2IA7 A;  4EBG A;  3HI7 A;  2QGU A;  1W00 A;  4LZI A;  5AEW B;  3RDE A;  1D6U A;  3CCM 3;  5G2G A;  3B4O A;  3EF8 A;  3FH1 A;  3K9M C;  1GS3 A;  1SQW A;  2YFI B;  3CNX A;  5CXO A;  5KP3 A;  3WA3 A;  4FCZ A;  3AMO B;  1KD1 4;  2IUK A;  3BNC A;  5DRE A;  3FG3 A;  3F9S A;  2W0Q A;  3HIG A;  1ZO2 A;  3JUP A;  1Y4K A;  1YIJ 3;  1CEW I;  3KSE D;  1JN5 A;  3EBT A;  1GY6 A;  1OPY A;  5BXQ A;  4R1K A;  3WA2 X;  4AKZ A;  3MSO A;  3IJE B;  2K54 A;  3LTB A;  2OOV A;  2XR8 B;  2ML6 A;  4XDW A;  5EQL A;  2Y73 A;  3FKA A;  2L4V A;  2XRX B;  2XGL A;  1OGZ A;  1CYV A;  2A15 A;  1N5P A;  1NWW A;  1DVD A;  4L8P A;  3FF2 A;  2BMO B;  3KKG A;  3GZB A;  1ROV A;  4R9K A;  5A0O B;  2GBW B;  1W02 A;  3CPW 2;  1FGQ A;  4FMB A;  2HMJ B;  1VQ7 3;  1U5O A;  1STD A;  4FR9 A;  2W56 B;  5IG4 A;  2MF7 A;  4WHA A;  2B24 B;  3FSD A;  4HM4 B;  3S5C A;  2HML B;  2YFJ B;  3F40 A;  3EJV A;  3DGO A;  4EV2 A;  1FGR A;  4L8O A;  1YGE A;  3TDG A;  1GD3 A;  4WYK A;  3STD A;  4O3V A;  4FMA A;  1JB4 A;  4N6L A;  4LGQ A;  3UJM A;  3HZP A;  2CWT A;  3N8B A;  5CLK A;  1KC8 4;  3SXX A;  1AR0 A;  1WQL B;  4FCJ A;  4N6V 0;  3CCS 3;  3MPH A;  1JKG A;  2BO9 B;  3OX9 A;  3D3L A;  4IIA A;  3PCS A;  3HK4 A;  3JUN A;  5AYR B;  2P0M A;  3B8L A;  4PEJ A;  1O7M B;  3SLU A;  3F7X A;  1JNQ A;  4O8S A;  3D9R A;  2GEY A;  1VZZ A;  4GB5 A;  4JF8 A;  2P05 A;  5KP4 A;  4XM4 A;  2B1X B;  4OK0 A;  8CHO A;  5HGR A;  1QAK A;  3F8X A;  2WOF A;  4HM3 B;  3ALA A;  4XDV A;  3KN4 A;  4MEI A;  1RRH A;  3S27 A;  4RBN A;  1LVN A;  1K73 4;  1YHQ 3;  3H3H A;  2D42 A;  2QA4 3;  3G8Z A;  1JB5 A;  3SOY A;  1Q42 A;  3U97 A;  4BTY A;  3WMD A;  1JV2 B;  4CDL A;  1E97 A;  2YFL B;  3WOE B;  2GXF A;  3CMA 3;  2ZDJ A;  1O7N B;  1IVV A;  1A67 A;  3FLJ A;  1M1X B;  3LOY A;  3ECF A;  1VQO 3;  3N54 B;  3J7Y d;  1YJW 3;  1IT8 A;  1WNH A;  5CF1 A;  5CF2 A;  4N6O B;  4MMX B;  2W6J H;  1K41 A;  1KQS 2;  3DMC A;  1W7C A;  1TFK A;  2CWV A;  3CNM A;  1IDP A;  4LMI A;  2PZV A;  4WP5 A;  3U1W A;  4R9L A;  3DM8 A;  3QRD A;  3EQQ B;  3NV0 B;  4TX4 A;  3FG4 A;  2IUJ A;  3PXM A;  1K28 A;  1TU5 A;  2WGQ A;  3PZW A;  4HVN A;  1WTH A;  1E3V A;  5BVB A;  1PU4 A;  5LC7 A;  1TUH A;  2CKF B;  3S29 A;  1SIH A;  5KP1 A;  3PGB A;  2XFT A;  4J9A A;  2GU3 A;  2PNC A;  2E2T A;  2XF3 A;  3V92 A;  4EXR A;  3CC2 3;  1YIT 3;  3T0U A;  3LML A;  4EC6 A;  1W01 A;  2XSO B;  4X2H A;  5JPU A;  2F98 A;  5AII A;  5FGO A;  1LXE A;  3A76 A;  3K5T A;  1R4C A;  1UI7 A;  1DMN A;  1IK3 A;  1VQ5 3;  3KZT A;  3I55 3;  3OWU A;  2GU1 A;  3AMO A;  2XGN A;  3NXJ A;  4G1M B;  2CW9 A;  1IVX A;  3NQY A;  2CK3 H;  1IV7 A;  3UL5 A;  3GRD A;  3DY5 A;  3OXA A;  1A2K A;  1LNH A;  2CFK A;  2CFG A;  3IMA B;  3MG1 A;  1RRL A;  4XBX A;  1AVL A;  3MG2 A;  3CPO A;  4X2O A;  3JUO A;  2FNQ A;  4WFO A;  3EN1 B;  1NJI 4;  3DXO A;  3F14 A;  4EYC A;  4HM7 B;  5AEU B;  1T5Y A;  3PCR A;  2XH9 A;  5AIG A;  5AYS C;  4L7K A;  4XBT A;  1IQ8 A;  3MHE A;  5IG5 A;  4IT7 A;  4O2H A;  4O02 B;  2CWU A;  5STD A;  1N9J A;  5TGN A;  3FGY A;  1DMQ A;  3G0K A;  3B4P A;  4FCM A;  2W56 A;  4Q53 A;  1ULI B;  3WOD G;  3HX8 A;  2O9U X;  2HMM B;  3CCR 3;  2LQV A;  2WOH A;  3SOA A;  3K7C A;  3CCQ 3;  2Z7A A;  2QEX 3;  3HII A;  3LTD A;  1ZX2 A;  3UL6 A;  1ULJ B;  1A2V A;  2RFR A;  5EEO A;  3KE7 A;  2INX A;  3RGR A;  3FF0 A;  2C11 A;  3B7C A;  1Q40 B;  5IW9 A;  2CHC A;  2Y74 A;  1WMO A;  1RN7 A;  3ROB A;  4HJL B;  4CCV A;  1N5H A;  4AKY A;  4RNZ A;  2GBX B;  4XBY A;  1Q82 4;  3F7S A;  4N6U A;  2XEP A;  2YX9 A;  2M7O A;  1W2Z A;  3DGL A;  4WWU C;  3G4S 3;  3NM7 A;  2Z77 A;  2HMK B;  2OQE A;  1VQ9 3;  3NBR A;  1EKM A;  1TP6 A;  1W4N A;  3PS8 A;  3S67 A;  3L0R A;  3CU3 A;  2Q07 A;  5AIF A;  4FMD A;  1IQX A;  3BNB A;  1VQN 3;  2KRT A;  1EG9 B;  5I97 A;  5IG3 A;  1K9M 4;  1KSI A;  2F99 A;  2IMJ A;  3X40 A;  1GY5 A;  2Z6B A;  4FMC A;  1J2B A;  5D83 A;  3EB8 A;  3K63 A;  2KXG A;  1ASK A;  1QAF A;  3MYT A;  4HZB B;  2XSH B;  3EBY A;  1FGT A;  2WGO A;  3LTA A;  1S72 3;  2E2V A;  3PYJ A;  1CQS A;  3QK9 A;  3CC7 3;  4BTW A;  1SPU A;  1M90 4;  2OTL 3;  1YJ9 3;  1N8Q A;  3NV0 A;  5JPP A;  1OHS A;  4HM1 B;  1KWI A;  3UB1 A;  1HKX A;  3CCJ 3;  2UX0 A;  3T8U A;  4JRF A;  1BUQ A;  2ZL8 A;  1QAL A;  5DRV A;  1OF5 B;  3CC4 3;  3BNE A;  1UUV B;  1IVW A;  1OCV A;  3NHX A;  3BB9 A;  3SVA A;  1TIJ A;  4N3V A;  2BHM A;  2SBL A;  5ELU A;  1M1K 4;  3GWR A;  4NHF A;  3ER7 A;  1UUW B;  1W6C A;  4HM6 B;  2ML5 A;  3V98 A;  2FXT A;  3NM2 A;  4MMY B;  3KFQ C;  4KVH A;  4OUQ A;  2RCD A;  3EE1 A;  3GZR A;  3X3X A;  3MKI A;  3GZY B;  1O7G B;  2GEX A;  3LXU X;  4OVM A;  5CK6 A;  2E2U A;  3Q1C A;  3OW2 2;  1WMP A;  1YI2 3;  3OV4 A;  4KFF A;  3CD6 3;  3WOF B;  2P0X A;  4HM5 B;  4HM0 B;  1NB3 I;  1MNL A;  4KFD A;  3S28 A;  1JRQ A;  3DZL A;  1FA3 A;  4QWT A;  3CCL 3;  2HMN B;  1JB2 A;  2R4I A;  1K8A 4;  4ZM8 A;  2CFL A;  1O7P B;  2LYX A;  3JUQ A;  1F8N A;  4HKV B;  3I0Y A;  4N6M A;  2CG0 A;  2QIY A;  2W03 A;  1QVG 2;  4K61 A;  4K1V A;  5IEP A;  1OHP A;  2P09 A;  3F8H A;  1WMN A;  3NUV A;  1ISK A;  3IPT A;  1QJG A;  2BMQ B;  3H51 A;  4HM8 B;  3SX1 A;  3E99 A;  3CME 3;  3EC9 A;  3LTC A;  1L5G B;  2V1L A;  2BT3 A;  3OWY A;  3BLZ A;  2CFD A;  1LOX A;  4J8T A;  2JDI H;  2OCT A;  1Q40 A;  4KFE A;  4MJD A;  2W2C A;  1NB5 I;  1W6Y A;  4HYZ A;  3NX0 A;  3LT9 A;  1W6G A;  2CC3 A;  3LZA A;  1UW1 A;  3UNL A;  1Q7Y 4;  1RKY A;  4NRE A;  2FGT A;  1STF I;  4H3U A;  3EHC A;  4H61 A;  3X41 A;  1YJN 3;  5AIH A;  1VQM 3;  1OGX A;  2P38 A;  1IQY A;  1JN5 B;  3NBJ A;  3I56 3;  4N6T A;  3NQZ A;  1IU7 A;  2W9Q A;  3X42 A;  3LT8 A;  1GYB A;  3EX9 A;  1VQ4 3;  1C7H A;  1NU3 A;  1CYU A;  2OOV C;  4AEQ A;  5LC6 A;  3Q2P A;  4BTX A;  2C10 A;  1QVF 2;  1JJ2 2;  4HBR A;  3SED A;  1AVK A;  1DVC A;  3G16 A;  2RGQ A;  3KSP A;  1N8R 4;  1US1 A;  1VQP 3;  1SII A;  4LSO A;  1IT7 A;  1Z1S A;  3FG1 A;  1IVU A;  1OH0 A;  2D1W A;  3CXC 2;  1NO3 A;  1S5A A;  3GZX B;  4WYK B;  1W5Z A;  3G71 3;  1MOL A;  3G6E 3;  1V74 A;  3VF1 A;  4I4K A;  4RNY A;  1Q81 4;  3X3Z A;  3M8C A;  3O8Y A;  1JKG B;  4GL6 A;  1FGO A;  3N9H A;  1D6Z A;  3Q90 A;  3DGM A;  4K90 B;  1AV4 A;  3GAX A;  1OUN A;  3JUM A;  3CCE 3;  3LYG A;  1DYU A;  1OF5 A;  1ROA A;  2OWP A;  3KII A;  3BND A;  1VQ6 3;  4IPB A;  4ORL A;  1EQK A;  1RJO A;  3X3Y A;  5IF6 A;  5D81 A;  1FUW A;  1DMM A;  2OQE C;  3OWS A;  1W2B 2;  3DUK A;  3FZW A;  3CCU 3;  1N9E A;  1O7H B;  1TFO A;  2WO0 A;  2Z76 A;  4R4K A;  5ELJ A;  2CH9 A;  1M9G A;  1NDO B;  5EVH A;  1FGM A;  2W04 A;  5D82 A;  4LEH A;  2MC8 A;  3VGN A;  3V99 A;  2BMR B;  2O3O A;  1PFP A;  1VQL 3;  2K0M A;  4HM2 B;  4RZM A;  4STD A;  2F86 B;  1D6Y A;  5JBS A;  6STD A;  5IG0 A;  3MG3 A;  1SJW A;  1U8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...