1ZX2A

Crystal structure of yeast ubp3-associated protein bre5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
130
Chain Sequence
SMGVTVQDICFAFLQNYYERMRTDPSKLAYFYASTAELTHTNYPTVKVTGRENINKFFSRNDAKVRSLKLKLDTIDFQYTGHLHKSILIMATGEMFWTGTPVYKFCQTFILLPSSNGSTFDITNDIIRFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBP3-associated protein BRE5
publication title Structural basis for interaction between the Ubp3 deubiquitinating enzyme and its Bre5 cofactor
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 31
structure length 130
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1zx2A00
2IMJA 3G16A 3IPTA 1O7HB 2XSOB 1O7GB 4HJLB 3NHXA 5STDA 2CKFB 3KKGA 1ISKA 3RGRA 4HZBB 4H3UA 4L7KA 3ER7A 3FF0A 4WP5A 1UUWB 2B1XB 3OWUA 2YFIB 5IG0A 5CF2A 7STDA 2A15A 5AI1A 1A2KA 3DM8A 5DREA 2BMRB 5CK6A 1OH0A 4Q53A 1DMMA 2HMKB 3UNLA 1DMNA 4J8TA 2OWPA 1E3RA 5CXOA 3OXAA 2HMMB 4OUQA 3H51A 1IDPA 3D9RA 5CLKA 1OPYA 1S5AA 5IG4A 3A76A 4HM1B 4R9KA 3WMDA 4HM8B 3GWRA 4LEHA 4KVHA 3SEDA 3EF8A 1JB2A 4XDWA 5IEPA 1JB4A 1EA2A 3B4OA 4WYKA 4MJDA 5EVHA 3BLZA 1OHSA 3EHCA 4XB5A 4HM7B 5TGNA 3VGNA 4J9AA 5DRVA 3OV4A 2W2CA 2XR8B 2YFLB 1OF5A 2QIYA 4R1KA 3GZXB 1ULIB 3H3HA 1Z1SA 4X2OA 5IERA 1AR0A 3LZAA 1OCVA 2K54A 4HVNA 5AEWB 5CF1A 8CHOA 3I0YA 1ASKA 4XBYA 3DMCA 3FGYA 3MG1A 1JN5B 2YFJB 3MHEA 5AIIA 4XBXA 4XDVA 3EC9A 4RZMA 2BNGA 2R4IA 4K1VA 3FLJA 3NV0B 4FCMA 1JKGB 3VSYA 1OF5B 3T8UA 3OX9A 3FKAA 2XRXB 3EN1B 5AIFA 2HMOB 3K0ZA 5AIGA 3NBRA 4N3VA 1ZO2A 2I9WA 2STDA 1TP6A 4R9LA 3NUVA 5D81A 2GEYA 2BMOB 2PZVA 1OGXA 3JUOA 6STDA 3DZLA 1OHOA 5BVBA 3JUPA 3EN8A 3F7XA 2Z7AA 3M8CA 3F8HA 2F98A 4HKVB 4WWUC 3LYGA 3FF2A 1W00A 1VZZA 3DUKA 3GZRA 3EBTA 3JUMA 4K1UA 2HMJB 4STDA 3KE7A 1QJGA 2UX0A 1ZX2A 3SOAA 1W01A 1SJWA 5G2GA 5KP4A 4HM2B 3KZTA 4HZ9B 4XBTA 1W02A 3F14A 5JPPA 1K41A 5BXQA 3NM2A 1O7PB 4HM5B 1GY5A 1UUVB 5IEOA 5IG5A 4L8PA 2GBWB 5D82A 1U5OA 4WYKB 1EG9B 2XSHB 1GY7A 3MSOA 3GRDA 4GB5A 3DXOA 3RGAA 1JB5A 2HMNB 4LMIA 3SOYA 4IIAA 3B7CA 4CDLA 5AEUB 3BB9A 4X2HA 5AIHA 1OHPA 1GY6A 3KSPA 3Q90A 1O7WB 2RGQA 2HMLB 1E97A 3JUNA 4HM4B 4LGQA 1HKXA 2B24B 3FZWA 1NDOB 3CNMA 3OWSA 1BUQA 3HZPA 4PEJA 4L8OA 2F86B 3MKIA 5D83A 2F99A 4U13A 1GYBA 5IF6A 1OUNA 2BMQB 3B4PA 4HM6B 3G0KA 1O7MB 3HX8A 1QMAA 1Q40A 3F9SA 2Z77A 3JUQA 3EBYA 5IG3A 1STDA 3ROBA 1NU3A 1DMQA 3STDA 2JQ5A 3HK4A 2CHCA 2INXA 4I4KA 3UJMA 3F7SA 3CNXA 3T8NA 2RCDA 3CU3A 3EX9A 1E3VA 3FH1A 1OGZA 1C7HA 4XM4A 4HM3B 3EQQB 2GEXA 2QGUA 3CPOA 1WQLB 2GXFA 5FW5A 1Q40B 3MG2A 1O7NB 3GZYB 1Q42A 5JPUA 1ULJB 4OVMA 3S5CA 1JN5A 4ORLA 2GBXB 3FSDA 1TUHA 3ECFA 2RFRA 3NV0A 3G8ZA 3GZBA 1JKGA 2Z76A 3OWYA 4FCJA 3E99A 5HGRA 3F8XA 1NWWA 3K7CA 3MG3A 5IENA 5KP3A 3F40A 3EJVA 1CQSA 4HM0B 3B8LA 1W6YA 5KP1A 3NXJA 1GS3A 3MYTA
chains in the Genus database with same CATH superfamily
3IMAB 1LQMB 1WMPA 2IMJA 3G16A 3IPTA 1IU7A 1O7HB 4GL6A 3HIGA 1IVVA 2O3OA 3U97A 2W9PA 3N8BA 2XSOB 1O7GB 3X3XA 5ELUA 3LH4A 4HJLB 1EQKA 1NJI4 1QVF2 3NHXA 1VQ73 2RNTA 1PFPA 1TFKA 5STDA 2CKFB 4NREA 3KKGA 1VQ63 1UGIA 4GSPA 1AVLA 2KF3A 3CC43 1ISKA 2P0MA 4MEIA 1KSIA 3RGRA 1OACA 2KRTA 4HZBB 2WOHA 3BU4A 4H3UA 4L7KA 3ER7A 4MMXB 3FF0A 2MC8A 1BRHA 1D6UA 2YX9A 1UUWB 4WP5A 1DVCA 2CX1A 2B1XB 1MWTA 3OWUA 1RCKA 1FA3A 1W4NA 1BSBA 2P05A 2YFIB 5IG0A 5CF2A 7STDA 2A15A 5AI1A 3AHWA 3PZWA 1A2KA 3DM8A 5DREA 2BMRB 5CK6A 1OH0A 1B2SA 4Q53A 4WFOA 1VQN3 3DH2A 1M1K4 1DMMA 2L1SA 2HMKB 3S29A 1VQL3 3UNLA 4N6MA 3X3YA 2XF3A 3T0UA 2WO0A 3MWZA 1DMNA 2AAEA 3HIIA 4J8TA 2CX0A 1T2IA 2OWPA 1E3RA 3Q3FA 5CXOA 4KFDA 5M19A 3IJEB 4BL2A 3LT9A 1IV7A 2GSPA 3OXAA 4N6TA 1FZUA 2HMMB 3AGOA 4MMZB 3SLUA 1UI7A 3WDGB 2CIUA 1RKYA 1Q7Y4 4OUQA 1ROVA 1UUGB 4EXRA 3H51A 1IDPA 3Q2PA 3VF1A 1GOYA 3D9RA 3FG1A 5CLKA 1OPYA 1PY3A 3HI7A 3X42A 2R41A 2L4VA 1YVSA 1BNIA 4HOHA 4RNYA 1S5AA 2W56A 5IG4A 1KD14 3CXC2 1N5PA 1RGGA 3U1WA 3A76A 2J8XB 4HM1B 3KSED 4N6V0 4R9KA 1BNFA 3CCS3 3WMDA 1BRIA 4HM8B 3GWRA 4LEHA 4KVHA 3QRDA 1RGCA 3WR2A 3ZFZA 2F56A 3G713 3RNTA 2FGTA 3MYTA 3SEDA 1D6YA 1GD3A 1WMNA 1G0TA 1W2ZA 5AYSC 1FGTA 2IYJA 1V58A 2HOHA 1JB2A 3EF8A 4XDWA 4RNZA 5M1AA 5IEPA 1S723 1IT8A 1NNVA 1RGEA 2H0HA 5ELJA 3UB1A 2BIRA 2IA7A 3Q1CA 5JBSA 1AY7A 3GAXA 1JB4A 1D6ZA 1EA2A 5BIRA 3B4OA 2Y73A 3X40A 4WYKA 1EKMA 4MJDA 5EVHA 3AMOB 3BLZA 1N8QA 1OHSA 1TRPA 3DY5A 3SYUA 3EHCA 4XB5A 2OOVA 4HM7B 1RNBA 2IY2A 5TGNA 3VGNA 4EYCA 1CH0A 2OOVC 3CCJ3 3KFQC 2K0MA 2XH9A 1F8NA 1B20A 4J9AA 5DRVA 2GU3A 1GD4A 3OV4A 1NB5I 1N5HA 2C4BA 4GHOA 2W2CA 2XR8B 4BU4A 2YFLB 2H0IA 1VQ93 1OF5A 2QIYA 2D42A 3L0RA 4R1KA 3GZXB 4OK0A 1T5YA 1Q864 4NHFA 4AEQA 1BSDA 2XEPA 1ULIB 3H3HA 1ROAA 3CPW2 4NPBA 1G02A 1RGFA 1UGHI 1Z1SA 4K61A 1B2XA 4X2OA 1IVUA 3CCV3 5IERA 3WA3A 1AR0A 4FMAA 1FUSA 3LZAA 5A0OB 1OCVA 1BSCA 1JNQA 1T3BA 2K54A 2QEX3 1ZGXA 1M904 4HVNA 4ZM8A 5AEWB 5CF1A 1ZS7A 8CHOA 4KZ1A 3I0YA 1ASKA 4XBYA 3DMCA 3FGYA 4I5QA 1LOWA 3MG1A 3NBJA 1TU5A 2XGLA 1JN5B 3NQYA 3X41A 2YFJB 1V74A 3MHEA 3ZG0A 5AIIA 4XBXA 2D1WA 4XDVA 5AYRB 4N6OB 3EC9A 4RZMA 1RNTA 2BNGA 2CH9A 1RN1A 2R4IA 4FMCA 4K1VA 3CCL3 1CYVA 2ZL8A 3DGNA 1I0XA 2UGIA 3FLJA 3FG3A 3NV0B 4FCMA 4ILFA 4DKIA 1JKGB 3VSYA 2KXGA 1N8R4 1FGMA 2CFGA 3V98A 2BHMA 1BNRA 3WHOA 2P09A 1OF5B 3T8UA 4J5KA 2BO9B 2CFDA 1LXEA 2BU4A 1TTOA 1BNSA 3ALAA 2F5WA 4BL3A 1MWUA 3OX9A 1I8VA 1IVWA 3FKAA 5RNTA 2XRXB 3EN1B 3PCRA 3LMLA 4R80A 1BU4A 5AIFA 1YNVX 4J5GA 2HMOB 3K0ZA 2CC3A 1PU4A 2FNQA 5G1LA 5AIGA 3NBRA 1N9JA 1IVXA 2SBLA 1A90A 4N3VA 1L5GB 1ZO2A 2I9WA 2STDA 1TP6A 1BGSA 4R9LA 1IK3A 3LTAA 3NUVA 1A2PA 1SPUA 2GEYA 1RGLA 5D81A 1YJN3 2BMOB 2ZHXB 3G4S3 2PZVA 4EV5A 1EEJA 1OGXA 4BTWA 2C10A 1KQS2 1X1XA 1V57A 1WMOA 3JUOA 6STDA 3DZLA 2E2VA 2AADA 1MOLA 1Q824 3UL5A 1OHOA 1Y4KA 5BVBA 1DVDA 3JUPA 2CG1A 2CW9A 2WGQA 1JV2B 3EN8A 3F7XA 2Z7AA 4BIRA 3M8CA 3AHSA 1UDII 3F8HA 3QK9A 2F98A 4HKVB 2IUKA 2CG0A 4LSOA 4WWUC 3LYGA 1YIT3 1KWIA 3LT8A 3PCSA 3FF2A 1W00A 4KT3B 1VZZA 3DUKA 5HOHA 1X1YA 5BU4A 1FW7A 3D4AA 2V1LA 3EBTA 3GZRA 3N9HA 1AVKA 1GSPA 3BNEA 3JUMA 4K1UA 1BOXA 4HYZA 7GSPA 2KF5A 1HYFA 2P38A 3CMA3 2LQVA 2HMJB 3D5GA 1BAOA 2CFWA 4O3VA 3TDGA 4FMDA 4STDA 4JRFA 3KCHA 1EUIC 4BTXA 4O8SA 2IUJA 1R4YA 2CFKA 3KE7A 2CWTA 1QJGA 1BRJA 2UX0A 1ZX2A 2W03A 2W9QA 5EEOA 1MNLA 2BT3A 3SOAA 3CC73 1W01A 3SXXA 2W56B 1R4CA 1SJWA 4EC6A 5G2GA 1K28A 5KP4A 1VQ43 1G96A 3CC23 2E2UA 4HM2B 3D3LA 4LYLB 3RDEA 3KZTA 1VQM3 2OTJ3 2Z6BA 2P0XA 4CPKA 4HZ9B 1LOXA 1SARA 2F4YA 1RJOA 1BVIA 3WODG 5FGOA 4XBTA 2C11A 1RCLA 2WOFA 1W02A 3F14A 3PS8A 2W6JH 3FCSB 3CD63 1SQWA 2CWVA 3FG4A 1W6GA 5JPPA 1K41A 1UCJA 1T2HA 1UCIA 1UCKA 3WOFB 1IQXA 1BSEA 5BXQA 4O2HA 3X3ZA 3NM2A 1RN4A 1O7PB 1WNHA 1QAKA 2FXTA 4KFFA 1AQZA 1U8CB 1GY5A 4HM5B 1BRNL 1UUVB 5IEOA 4AKZA 8RNTA 5IG5A 2W04A 4L8PA 2GBWB 1I0VA 1I2FA 1FGQA 5D82A 1I3FA 1U5OA 4WYKB 3UL6A 1EG9B 2RBIA 1BNGA 1LVNA 2XSHB 3DGMA 3OW22 1M9GA 1GY7A 3MSOA 3BNDA 1BIRA 2E2TA 3GRDA 1RHLA 4GB5A 1W5ZA 2JDIH 1AV4A 1I3IA 3DXOA 3PXMA 3RGAA 1LNIA 3K9MC 1JB5A 3I553 2HMNB 4LMIA 4K90B 1BANA 4O02B 4QWTA 4IIAA 3SOYA 3B7CA 4FMBA 3JVCA 1W6CA 3BB9A 4CDLA 1RLSA 5AEUB 1BSAA 2O9UX 4X2HA 3AGNA 4TX4A 5AIHA 1OHPA 2KCDA 1CYUA 1RSNA 1HZ1A 5IW9A 1GY6A 3S28A 1JZOA 2K3DA 2ML6A 3KSPA 3Q90A 5LC7A 1O7WB 1I70A 1IT7A 3O8YA 1IYYA 1FGOA 1JBTA 3CME3 1FGRA 1X1UA 1I2EA 3DGOA 1VQP3 2WGOA 2RGQA 4IPBA 1WTHA 2HMLB 1QVG2 2MF7A 3CCE3 3JUNA 4HM4B 1RMSA 1TJDA 1HKXA 4LGQA 1SIHA 2B24B 2W0QA 1VQ83 3FZWA 3KIIA 1GMQA 1NO3A 1NDOB 3CNMA 1JRQA 3OWSA 4FR9A 1US1A 4R4KA 3HZPA 1GOVA 4G1MB 3KN4A 4PEJA 1YVBI 1BUQA 4L8OA 1K9M4 2Y74A 2F86B 3MKIA 1B27A 3EB8A 1BNJA 5G1KA 5D83A 1B2MA 4CJNA 2F99A 1GYBA 2ZDJA 4U13A 3SVAA 2UUGC 5IF6A 2OCTA 1VQO3 2XFTA 3LXUX 1OUNA 3BNCA 4KFEA 4CCVA 3CCU3 1HU9A 2BMQB 3URPA 2KF4A 6GSPA 1NB3I 1N9EA 1W2B2 1DETA 1YJ93 3B4PA 3K5TA 3LTDA 1YGEA 4EBGA 1YJW3 4HM6B 3D5IA 1B3SA 2F5MA 1JBSA 1SIIA 3CCM3 3G0KA 4IT7A 3S27A 1MWRA 1O7MB 3HX8A 4FCZA 2QA43 1Q814 1K8A4 1FUWA 1GOUA 2OTL3 1JZDA 1QMAA 1IQ8A 1Q40A 3F9SA 2Z77A 3JUQA 3EBYA 3NM7A 3BIRA 3G6E3 9RNTA 4N6UA 5IG3A 1STDA 1B2UA 2CWUA 5GSPA 3ROBA 1YI23 2LYXA 2KF6A 1NU3A 3AMOA 3GSPA 4HBRA 3ZG5A 1DMQA 1RRHA 5EQLA 1M1XB 3STDA 1RGHA 4AKYA 2JQ5A 1RRLA 1YHQ3 1RDSA 4EW5A 3HK4A 1CEWI 2CHCA 2INXA 3NBBA 4I4KA 1TRQA 1VQQA 3LTBA 4WHAA 3UJMA 1I2GA 1GMRA 1QALA 1FYSA 2ZA4A 3F7SA 2Q07A 3CNXA 3NQZA 3T8NA 2RCDA 3N54B 3CU3A 1PYLA 1X1WA 1LQGC 1LOVA 1RTUA 3EX9A 4RNTA 1E3VA 1TIJA 3V92A 5I97A 2OQEA 3FH1A 1OGZA 1C7HA 5M18A 1MGWA 4XM4A 3LTCA 4HM3B 3J7Yd 3EQQB 1A2VA 4EV2A 2OQEC 2GEXA 1UCLA 2QGUA 3EE1A 3CPOA 2GU1A 1BRSA 1VQK3 4JF8A 1WQLB 2GXFA 5FW5A 1LOYA 1J2BA 1DE3A 1Q40B 1KC84 1JBRA 3MG2A 1O7NB 2CFLA 3PYJA 4N6NB 1B21A 3GZYB 1RN7A 1JJ22 1VQ53 1Q42A 5JPUA 4MMYB 1ULJB 4OVMA 2H0GA 6RNTA 4RBNA 1UI8A 3DGLA 3BNBA 3S5CA 1JN5A 1RGAA 4ORLA 2GBXB 1FUTA 4LZIA 1STFI 3FSDA 1TUHA 3ECFA 1GMPA 2RFRA 3I563 2M7OA 1BNEA 1BRGA 1YIJ3 1IV9A 1BRKA 1UW1A 2PNCA 3G8ZA 3NV0A 1C54A 1QAFA 3MPHA 1Q9EA 2RSXA 1RGKA 3GZBA 4H61A 1JKGA 2Z76A 3V99A 7RNTA 3OWYA 1IQYA 2KAAA 3K63A 3SX1A 3WA2X 1K734 2CK3H 3D79A 1LRAA 3A5EA 4BTYA 4N6LA 3DGYA 4FCJA 3E99A 5HGRA 1TFOA 3F8XA 3HOHA 3WOEB 1YGWA 1NWWA 4HAAA 3CCR3 3K7CA 2XFSA 2ML5A 3MG3A 1LNHA 1DYUA 1W7CA 5IENA 3PGBA 5KP3A 2XGNA 3F40A 3CCQ3 3EJVA 3LOYA 3NX0A 1B2ZA 1CQSA 1A67A 4HM0B 2SARA 1Q7HA 1BUJA 1MWSA 3B8LA 1W6YA 1MGRA 5KP1A 3NXJA 5LC6A 3S67A 1GS3A 1E97A
chains in the Genus database with same CATH topology
3IMAB 1WMPA 2IMJA 3G16A 3IPTA 1IU7A 1O7HB 4GL6A 3HIGA 1IVVA 2O3OA 3U97A 2W9PA 3N8BA 2XSOB 1O7GB 3X3XA 5ELUA 3LH4A 4HJLB 1EQKA 1NJI4 1QVF2 3NHXA 1VQ73 1PFPA 1TFKA 5STDA 2CKFB 4NREA 3KKGA 1VQ63 1ISKA 1AVLA 3CC43 2P0MA 4MEIA 1KSIA 3RGRA 1OACA 2KRTA 4HZBB 2WOHA 4H3UA 4L7KA 4MMXB 3ER7A 2MC8A 3FF0A 2YX9A 1D6UA 4WP5A 1UUWB 1DVCA 2B1XB 3OWUA 1FA3A 1W4NA 2P05A 2YFIB 5IG0A 5CF2A 7STDA 2A15A 5AI1A 3PZWA 1A2KA 3DM8A 5DREA 2BMRB 5CK6A 1OH0A 4Q53A 4WFOA 1VQN3 1M1K4 1DMMA 2HMKB 3S29A 1VQL3 3UNLA 4N6MA 3X3YA 2XF3A 3T0UA 2WO0A 3MWZA 1DMNA 3HIIA 4J8TA 2OWPA 1E3RA 5CXOA 4KFDA 3IJEB 3LT9A 1IV7A 3OXAA 4N6TA 3SLUA 2HMMB 4MMZB 1UI7A 3WDGB 2CIUA 1RKYA 1Q7Y4 4OUQA 1ROVA 4EXRA 3H51A 1IDPA 3Q2PA 3VF1A 3D9RA 3FG1A 5CLKA 1OPYA 3HI7A 3X42A 2L4VA 4RNYA 1S5AA 2W56A 5IG4A 1KD14 3CXC2 1N5PA 3U1WA 3A76A 4HM1B 4N6V0 3KSED 4R9KA 3CCS3 3WMDA 4HM8B 3GWRA 4LEHA 4KVHA 3QRDA 3G713 2FGTA 3MYTA 3SEDA 1D6YA 1GD3A 1WMNA 1W2ZA 5AYSC 1FGTA 3EF8A 1JB2A 4XDWA 1S723 4RNZA 5IEPA 1IT8A 5ELJA 3UB1A 2IA7A 3Q1CA 5JBSA 3GAXA 1JB4A 1D6ZA 1EA2A 3B4OA 2Y73A 3X40A 4WYKA 1EKMA 4MJDA 5EVHA 3AMOB 3BLZA 1N8QA 1OHSA 3DY5A 3EHCA 4XB5A 2OOVA 4HM7B 5TGNA 3VGNA 4EYCA 2OOVC 3CCJ3 3KFQC 2K0MA 2XH9A 1F8NA 4J9AA 5DRVA 2GU3A 1GD4A 3OV4A 1NB5I 1N5HA 2W2CA 2XR8B 2YFLB 1VQ93 1OF5A 2QIYA 2D42A 3L0RA 4R1KA 3GZXB 4OK0A 1T5YA 1Q864 4NHFA 4AEQA 2XEPA 1ULIB 3H3HA 1ROAA 3CPW2 4K61A 1Z1SA 4X2OA 1IVUA 3CCV3 5IERA 3WA3A 1AR0A 4FMAA 3LZAA 5A0OB 1OCVA 2K54A 1JNQA 2QEX3 1M904 4HVNA 4ZM8A 5AEWB 5CF1A 8CHOA 4KZ1A 3I0YA 1ASKA 4XBYA 3DMCA 3FGYA 3NBJA 3MG1A 1TU5A 2XGLA 1JN5B 3NQYA 3X41A 2YFJB 1V74A 3MHEA 5AIIA 4XBXA 2D1WA 4XDVA 5AYRB 4N6OB 3EC9A 4RZMA 2BNGA 2R4IA 2CH9A 3CCL3 4FMCA 4K1VA 1CYVA 2ZL8A 3DGNA 3FLJA 3FG3A 3NV0B 4FCMA 1JKGB 3VSYA 2KXGA 1N8R4 1FGMA 2CFGA 3V98A 2BHMA 2P09A 1OF5B 3T8UA 2BO9B 2CFDA 1LXEA 3ALAA 3OX9A 3FKAA 1IVWA 2XRXB 3EN1B 3PCRA 3LMLA 4R80A 5AIFA 2HMOB 3K0ZA 2CC3A 1PU4A 2FNQA 5AIGA 3NBRA 1N9JA 1IVXA 2SBLA 1A90A 4N3VA 1L5GB 1ZO2A 2I9WA 2STDA 1TP6A 4R9LA 1IK3A 3LTAA 3NUVA 5D81A 1SPUA 2GEYA 1YJN3 2BMOB 3G4S3 2PZVA 4EV5A 1OGXA 4BTWA 2C10A 1KQS2 1WMOA 3JUOA 6STDA 3DZLA 2E2VA 1MOLA 1Q824 3UL5A 1OHOA 1Y4KA 5BVBA 1DVDA 3JUPA 2CG1A 2CW9A 2WGQA 1JV2B 3EN8A 3F7XA 2Z7AA 3M8CA 3QK9A 3F8HA 2F98A 4HKVB 2IUKA 2CG0A 4LSOA 4WWUC 3LYGA 1YIT3 1KWIA 3LT8A 3PCSA 3FF2A 1W00A 1VZZA 3DUKA 3EBTA 2V1LA 3GZRA 3N9HA 1AVKA 3BNEA 3JUMA 4K1UA 4HYZA 2P38A 3CMA3 2LQVA 2HMJB 2CFWA 4O3VA 3TDGA 4FMDA 4STDA 4JRFA 4BTXA 4O8SA 2IUJA 2CFKA 3KE7A 2CWTA 1QJGA 2UX0A 2W9QA 1ZX2A 2W03A 5EEOA 1MNLA 2BT3A 3SOAA 3CC73 1W01A 3SXXA 2W56B 1R4CA 1SJWA 4EC6A 5G2GA 1K28A 5KP4A 1VQ43 1G96A 3CC23 2E2UA 4HM2B 3D3LA 3RDEA 1VQM3 3KZTA 2OTJ3 2Z6BA 2P0XA 4HZ9B 1LOXA 1RJOA 3WODG 5FGOA 4XBTA 2C11A 2WOFA 3PS8A 1W02A 3F14A 2W6JH 3FCSB 3CD63 1SQWA 2CWVA 3FG4A 1W6GA 5JPPA 1K41A 3WOFB 1IQXA 5BXQA 4O2HA 3X3ZA 3NM2A 1O7PB 1WNHA 1QAKA 2FXTA 4KFFA 1U8CB 1GY5A 4HM5B 1UUVB 5IEOA 4AKZA 5IG5A 2W04A 4L8PA 2GBWB 5D82A 1FGQA 1U5OA 4WYKB 3UL6A 1EG9B 1LVNA 2XSHB 3DGMA 3OW22 1M9GA 1GY7A 3MSOA 3BNDA 2E2TA 3GRDA 4GB5A 1W5ZA 2JDIH 1AV4A 3PXMA 3DXOA 3RGAA 3K9MC 1JB5A 3I553 2HMNB 4LMIA 4K90B 4O02B 3SOYA 4QWTA 4IIAA 3B7CA 4FMBA 3JVCA 1W6CA 3BB9A 4CDLA 5AEUB 2O9UX 4X2HA 4TX4A 5AIHA 1OHPA 2KCDA 1CYUA 5IW9A 1GY6A 3S28A 2ML6A 3KSPA 3Q90A 5LC7A 1O7WB 3O8YA 1IT7A 1FGOA 3CME3 1FGRA 3DGOA 1VQP3 2WGOA 2RGQA 4IPBA 1WTHA 2HMLB 1QVG2 2MF7A 3CCE3 3JUNA 4HM4B 4LGQA 1HKXA 1VQ83 1SIHA 2B24B 2W0QA 3FZWA 3KIIA 1NO3A 1NDOB 3CNMA 1JRQA 3OWSA 4FR9A 1US1A 4R4KA 3HZPA 4G1MB 4PEJA 3KN4A 1BUQA 1YVBI 4L8OA 1K9M4 2Y74A 2F86B 3MKIA 3EB8A 5D83A 2F99A 2ZDJA 1GYBA 4U13A 3SVAA 5IF6A 2OCTA 1VQO3 2XFTA 3LXUX 1OUNA 3BNCA 4KFEA 4CCVA 3CCU3 1HU9A 2BMQB 1NB3I 1N9EA 1W2B2 1YJ93 3B4PA 3K5TA 3LTDA 1YGEA 4EBGA 1YJW3 4HM6B 1SIIA 3CCM3 3G0KA 4IT7A 3S27A 1O7MB 3HX8A 2QA43 4FCZA 1Q814 1K8A4 1FUWA 2OTL3 1QMAA 1IQ8A 1Q40A 3F9SA 2Z77A 3JUQA 3EBYA 3NM7A 3G6E3 5IG3A 4N6UA 1STDA 2CWUA 3ROBA 1YI23 2LYXA 1NU3A 3AMOA 4HBRA 1DMQA 1RRHA 5EQLA 1M1XB 3STDA 4AKYA 2JQ5A 1RRLA 1YHQ3 3HK4A 1CEWI 2CHCA 2INXA 3NBBA 4I4KA 4WHAA 3UJMA 3LTBA 1QALA 3F7SA 2Q07A 3CNXA 3NQZA 3T8NA 2RCDA 3N54B 3CU3A 3EX9A 1E3VA 1TIJA 3V92A 5I97A 2OQEA 3FH1A 1OGZA 1C7HA 4XM4A 3LTCA 4HM3B 3J7Yd 3EQQB 1A2VA 4EV2A 2OQEC 2GEXA 3EE1A 2QGUA 3CPOA 2GU1A 1VQK3 4JF8A 1WQLB 2GXFA 5FW5A 1J2BA 1Q40B 1KC84 3MG2A 1O7NB 2CFLA 3PYJA 4N6NB 3GZYB 1RN7A 1JJ22 1VQ53 1Q42A 5JPUA 4MMYB 1ULJB 4OVMA 4RBNA 1UI8A 3DGLA 3BNBA 3S5CA 1JN5A 4ORLA 2GBXB 4LZIA 1STFI 3FSDA 1TUHA 3ECFA 2RFRA 3I563 2M7OA 1YIJ3 1IV9A 1UW1A 2PNCA 3G8ZA 3NV0A 1QAFA 3MPHA 3V99A 2RSXA 3GZBA 4H61A 1JKGA 2Z76A 3OWYA 1IQYA 3K63A 3SX1A 3WA2X 1K734 2CK3H 4BTYA 4N6LA 4FCJA 3E99A 5HGRA 1TFOA 3F8XA 3WOEB 1NWWA 3CCR3 3K7CA 2XFSA 2ML5A 3MG3A 1LNHA 1DYUA 1W7CA 5IENA 3PGBA 5KP3A 2XGNA 3F40A 3CCQ3 3EJVA 3LOYA 3NX0A 1CQSA 1A67A 4HM0B 3B8LA 1W6YA 5KP1A 3NXJA 5LC6A 3S67A 1GS3A 1E97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IMJ A;  3G16 A;  3IPT A;  1O7H B;  2XSO B;  1O7G B;  4HJL B;  3NHX A;  5STD A;  2CKF B;  3KKG A;  1ISK A;  3RGR A;  4HZB B;  4H3U A;  4L7K A;  3ER7 A;  3FF0 A;  4WP5 A;  1UUW B;  2B1X B;  3OWU A;  2YFI B;  5IG0 A;  5CF2 A;  7STD A;  2A15 A;  5AI1 A;  1A2K A;  3DM8 A;  5DRE A;  2BMR B;  5CK6 A;  1OH0 A;  4Q53 A;  1DMM A;  2HMK B;  3UNL A;  1DMN A;  4J8T A;  2OWP A;  1E3R A;  5CXO A;  3OXA A;  2HMM B;  4OUQ A;  3H51 A;  1IDP A;  3D9R A;  5CLK A;  1OPY A;  1S5A A;  5IG4 A;  3A76 A;  4HM1 B;  4R9K A;  3WMD A;  4HM8 B;  3GWR A;  4LEH A;  4KVH A;  3SED A;  3EF8 A;  1JB2 A;  4XDW A;  5IEP A;  1JB4 A;  1EA2 A;  3B4O A;  4WYK A;  4MJD A;  5EVH A;  3BLZ A;  1OHS A;  3EHC A;  4XB5 A;  4HM7 B;  5TGN A;  3VGN A;  4J9A A;  5DRV A;  3OV4 A;  2W2C A;  2XR8 B;  2YFL B;  1OF5 A;  2QIY A;  4R1K A;  3GZX B;  1ULI B;  3H3H A;  1Z1S A;  4X2O A;  5IER A;  1AR0 A;  3LZA A;  1OCV A;  2K54 A;  4HVN A;  5AEW B;  5CF1 A;  8CHO A;  3I0Y A;  1ASK A;  4XBY A;  3DMC A;  3FGY A;  3MG1 A;  1JN5 B;  2YFJ B;  3MHE A;  5AII A;  4XBX A;  4XDV A;  3EC9 A;  4RZM A;  2BNG A;  2R4I A;  4K1V A;  3FLJ A;  3NV0 B;  4FCM A;  1JKG B;  3VSY A;  1OF5 B;  3T8U A;  3OX9 A;  3FKA A;  2XRX B;  3EN1 B;  5AIF A;  2HMO B;  3K0Z A;  5AIG A;  3NBR A;  4N3V A;  1ZO2 A;  2I9W A;  2STD A;  1TP6 A;  4R9L A;  3NUV A;  5D81 A;  2GEY A;  2BMO B;  2PZV A;  1OGX A;  3JUO A;  6STD A;  3DZL A;  1OHO A;  5BVB A;  3JUP A;  3EN8 A;  3F7X A;  2Z7A A;  3M8C A;  3F8H A;  2F98 A;  4HKV B;  4WWU C;  3LYG A;  3FF2 A;  1W00 A;  1VZZ A;  3DUK A;  3GZR A;  3EBT A;  3JUM A;  4K1U A;  2HMJ B;  4STD A;  3KE7 A;  1QJG A;  2UX0 A;  1ZX2 A;  3SOA A;  1W01 A;  1SJW A;  5G2G A;  5KP4 A;  4HM2 B;  3KZT A;  4HZ9 B;  4XBT A;  1W02 A;  3F14 A;  5JPP A;  1K41 A;  5BXQ A;  3NM2 A;  1O7P B;  4HM5 B;  1GY5 A;  1UUV B;  5IEO A;  5IG5 A;  4L8P A;  2GBW B;  5D82 A;  1U5O A;  4WYK B;  1EG9 B;  2XSH B;  1GY7 A;  3MSO A;  3GRD A;  4GB5 A;  3DXO A;  3RGA A;  1JB5 A;  2HMN B;  4LMI A;  3SOY A;  4IIA A;  3B7C A;  4CDL A;  5AEU B;  3BB9 A;  4X2H A;  5AIH A;  1OHP A;  1GY6 A;  3KSP A;  3Q90 A;  1O7W B;  2RGQ A;  2HML B;  1E97 A;  3JUN A;  4HM4 B;  4LGQ A;  1HKX A;  2B24 B;  3FZW A;  1NDO B;  3CNM A;  3OWS A;  1BUQ A;  3HZP A;  4PEJ A;  4L8O A;  2F86 B;  3MKI A;  5D83 A;  2F99 A;  4U13 A;  1GYB A;  5IF6 A;  1OUN A;  2BMQ B;  3B4P A;  4HM6 B;  3G0K A;  1O7M B;  3HX8 A;  1QMA A;  1Q40 A;  3F9S A;  2Z77 A;  3JUQ A;  3EBY A;  5IG3 A;  1STD A;  3ROB A;  1NU3 A;  1DMQ A;  3STD A;  2JQ5 A;  3HK4 A;  2CHC A;  2INX A;  4I4K A;  3UJM A;  3F7S A;  3CNX A;  3T8N A;  2RCD A;  3CU3 A;  3EX9 A;  1E3V A;  3FH1 A;  1OGZ A;  1C7H A;  4XM4 A;  4HM3 B;  3EQQ B;  2GEX A;  2QGU A;  3CPO A;  1WQL B;  2GXF A;  5FW5 A;  1Q40 B;  3MG2 A;  1O7N B;  3GZY B;  1Q42 A;  5JPU A;  1ULJ B;  4OVM A;  3S5C A;  1JN5 A;  4ORL A;  2GBX B;  3FSD A;  1TUH A;  3ECF A;  2RFR A;  3NV0 A;  3G8Z A;  3GZB A;  1JKG A;  2Z76 A;  3OWY A;  4FCJ A;  3E99 A;  5HGR A;  3F8X A;  1NWW A;  3K7C A;  3MG3 A;  5IEN A;  5KP3 A;  3F40 A;  3EJV A;  1CQS A;  4HM0 B;  3B8L A;  1W6Y A;  5KP1 A;  3NXJ A;  1GS3 A;  3MYT A; 
#chains in the Genus database with same CATH topology
 3IMA B;  1LQM B;  1WMP A;  2IMJ A;  3G16 A;  3IPT A;  1IU7 A;  1O7H B;  4GL6 A;  3HIG A;  1IVV A;  2O3O A;  3U97 A;  2W9P A;  3N8B A;  2XSO B;  1O7G B;  3X3X A;  5ELU A;  3LH4 A;  4HJL B;  1EQK A;  1NJI 4;  1QVF 2;  3NHX A;  1VQ7 3;  2RNT A;  1PFP A;  1TFK A;  5STD A;  2CKF B;  4NRE A;  3KKG A;  1VQ6 3;  1UGI A;  4GSP A;  1AVL A;  2KF3 A;  3CC4 3;  1ISK A;  2P0M A;  4MEI A;  1KSI A;  3RGR A;  1OAC A;  2KRT A;  4HZB B;  2WOH A;  3BU4 A;  4H3U A;  4L7K A;  3ER7 A;  4MMX B;  3FF0 A;  2MC8 A;  1BRH A;  1D6U A;  2YX9 A;  1UUW B;  4WP5 A;  1DVC A;  2CX1 A;  2B1X B;  1MWT A;  3OWU A;  1RCK A;  1FA3 A;  1W4N A;  1BSB A;  2P05 A;  2YFI B;  5IG0 A;  5CF2 A;  7STD A;  2A15 A;  5AI1 A;  3AHW A;  3PZW A;  1A2K A;  3DM8 A;  5DRE A;  2BMR B;  5CK6 A;  1OH0 A;  1B2S A;  4Q53 A;  4WFO A;  1VQN 3;  3DH2 A;  1M1K 4;  1DMM A;  2L1S A;  2HMK B;  3S29 A;  1VQL 3;  3UNL A;  4N6M A;  3X3Y A;  2XF3 A;  3T0U A;  2WO0 A;  3MWZ A;  1DMN A;  2AAE A;  3HII A;  4J8T A;  2CX0 A;  1T2I A;  2OWP A;  1E3R A;  3Q3F A;  5CXO A;  4KFD A;  5M19 A;  3IJE B;  4BL2 A;  3LT9 A;  1IV7 A;  2GSP A;  3OXA A;  4N6T A;  1FZU A;  2HMM B;  3AGO A;  4MMZ B;  3SLU A;  1UI7 A;  3WDG B;  2CIU A;  1RKY A;  1Q7Y 4;  4OUQ A;  1ROV A;  1UUG B;  4EXR A;  3H51 A;  1IDP A;  3Q2P A;  3VF1 A;  1GOY A;  3D9R A;  3FG1 A;  5CLK A;  1OPY A;  1PY3 A;  3HI7 A;  3X42 A;  2R41 A;  2L4V A;  1YVS A;  1BNI A;  4HOH A;  4RNY A;  1S5A A;  2W56 A;  5IG4 A;  1KD1 4;  3CXC 2;  1N5P A;  1RGG A;  3U1W A;  3A76 A;  2J8X B;  4HM1 B;  3KSE D;  4N6V 0;  4R9K A;  1BNF A;  3CCS 3;  3WMD A;  1BRI A;  4HM8 B;  3GWR A;  4LEH A;  4KVH A;  3QRD A;  1RGC A;  3WR2 A;  3ZFZ A;  2F56 A;  3G71 3;  3RNT A;  2FGT A;  3MYT A;  3SED A;  1D6Y A;  1GD3 A;  1WMN A;  1G0T A;  1W2Z A;  5AYS C;  1FGT A;  2IYJ A;  1V58 A;  2HOH A;  1JB2 A;  3EF8 A;  4XDW A;  4RNZ A;  5M1A A;  5IEP A;  1S72 3;  1IT8 A;  1NNV A;  1RGE A;  2H0H A;  5ELJ A;  3UB1 A;  2BIR A;  2IA7 A;  3Q1C A;  5JBS A;  1AY7 A;  3GAX A;  1JB4 A;  1D6Z A;  1EA2 A;  5BIR A;  3B4O A;  2Y73 A;  3X40 A;  4WYK A;  1EKM A;  4MJD A;  5EVH A;  3AMO B;  3BLZ A;  1N8Q A;  1OHS A;  1TRP A;  3DY5 A;  3SYU A;  3EHC A;  4XB5 A;  2OOV A;  4HM7 B;  1RNB A;  2IY2 A;  5TGN A;  3VGN A;  4EYC A;  1CH0 A;  2OOV C;  3CCJ 3;  3KFQ C;  2K0M A;  2XH9 A;  1F8N A;  1B20 A;  4J9A A;  5DRV A;  2GU3 A;  1GD4 A;  3OV4 A;  1NB5 I;  1N5H A;  2C4B A;  4GHO A;  2W2C A;  2XR8 B;  4BU4 A;  2YFL B;  2H0I A;  1VQ9 3;  1OF5 A;  2QIY A;  2D42 A;  3L0R A;  4R1K A;  3GZX B;  4OK0 A;  1T5Y A;  1Q86 4;  4NHF A;  4AEQ A;  1BSD A;  2XEP A;  1ULI B;  3H3H A;  1ROA A;  3CPW 2;  4NPB A;  1G02 A;  1RGF A;  1UGH I;  1Z1S A;  4K61 A;  1B2X A;  4X2O A;  1IVU A;  3CCV 3;  5IER A;  3WA3 A;  1AR0 A;  4FMA A;  1FUS A;  3LZA A;  5A0O B;  1OCV A;  1BSC A;  1JNQ A;  1T3B A;  2K54 A;  2QEX 3;  1ZGX A;  1M90 4;  4HVN A;  4ZM8 A;  5AEW B;  5CF1 A;  1ZS7 A;  8CHO A;  4KZ1 A;  3I0Y A;  1ASK A;  4XBY A;  3DMC A;  3FGY A;  4I5Q A;  1LOW A;  3MG1 A;  3NBJ A;  1TU5 A;  2XGL A;  1JN5 B;  3NQY A;  3X41 A;  2YFJ B;  1V74 A;  3MHE A;  3ZG0 A;  5AII A;  4XBX A;  2D1W A;  4XDV A;  5AYR B;  4N6O B;  3EC9 A;  4RZM A;  1RNT A;  2BNG A;  2CH9 A;  1RN1 A;  2R4I A;  4FMC A;  4K1V A;  3CCL 3;  1CYV A;  2ZL8 A;  3DGN A;  1I0X A;  2UGI A;  3FLJ A;  3FG3 A;  3NV0 B;  4FCM A;  4ILF A;  4DKI A;  1JKG B;  3VSY A;  2KXG A;  1N8R 4;  1FGM A;  2CFG A;  3V98 A;  2BHM A;  1BNR A;  3WHO A;  2P09 A;  1OF5 B;  3T8U A;  4J5K A;  2BO9 B;  2CFD A;  1LXE A;  2BU4 A;  1TTO A;  1BNS A;  3ALA A;  2F5W A;  4BL3 A;  1MWU A;  3OX9 A;  1I8V A;  1IVW A;  3FKA A;  5RNT A;  2XRX B;  3EN1 B;  3PCR A;  3LML A;  4R80 A;  1BU4 A;  5AIF A;  1YNV X;  4J5G A;  2HMO B;  3K0Z A;  2CC3 A;  1PU4 A;  2FNQ A;  5G1L A;  5AIG A;  3NBR A;  1N9J A;  1IVX A;  2SBL A;  1A90 A;  4N3V A;  1L5G B;  1ZO2 A;  2I9W A;  2STD A;  1TP6 A;  1BGS A;  4R9L A;  1IK3 A;  3LTA A;  3NUV A;  1A2P A;  1SPU A;  2GEY A;  1RGL A;  5D81 A;  1YJN 3;  2BMO B;  2ZHX B;  3G4S 3;  2PZV A;  4EV5 A;  1EEJ A;  1OGX A;  4BTW A;  2C10 A;  1KQS 2;  1X1X A;  1V57 A;  1WMO A;  3JUO A;  6STD A;  3DZL A;  2E2V A;  2AAD A;  1MOL A;  1Q82 4;  3UL5 A;  1OHO A;  1Y4K A;  5BVB A;  1DVD A;  3JUP A;  2CG1 A;  2CW9 A;  2WGQ A;  1JV2 B;  3EN8 A;  3F7X A;  2Z7A A;  4BIR A;  3M8C A;  3AHS A;  1UDI I;  3F8H A;  3QK9 A;  2F98 A;  4HKV B;  2IUK A;  2CG0 A;  4LSO A;  4WWU C;  3LYG A;  1YIT 3;  1KWI A;  3LT8 A;  3PCS A;  3FF2 A;  1W00 A;  4KT3 B;  1VZZ A;  3DUK A;  5HOH A;  1X1Y A;  5BU4 A;  1FW7 A;  3D4A A;  2V1L A;  3EBT A;  3GZR A;  3N9H A;  1AVK A;  1GSP A;  3BNE A;  3JUM A;  4K1U A;  1BOX A;  4HYZ A;  7GSP A;  2KF5 A;  1HYF A;  2P38 A;  3CMA 3;  2LQV A;  2HMJ B;  3D5G A;  1BAO A;  2CFW A;  4O3V A;  3TDG A;  4FMD A;  4STD A;  4JRF A;  3KCH A;  1EUI C;  4BTX A;  4O8S A;  2IUJ A;  1R4Y A;  2CFK A;  3KE7 A;  2CWT A;  1QJG A;  1BRJ A;  2UX0 A;  1ZX2 A;  2W03 A;  2W9Q A;  5EEO A;  1MNL A;  2BT3 A;  3SOA A;  3CC7 3;  1W01 A;  3SXX A;  2W56 B;  1R4C A;  1SJW A;  4EC6 A;  5G2G A;  1K28 A;  5KP4 A;  1VQ4 3;  1G96 A;  3CC2 3;  2E2U A;  4HM2 B;  3D3L A;  4LYL B;  3RDE A;  3KZT A;  1VQM 3;  2OTJ 3;  2Z6B A;  2P0X A;  4CPK A;  4HZ9 B;  1LOX A;  1SAR A;  2F4Y A;  1RJO A;  1BVI A;  3WOD G;  5FGO A;  4XBT A;  2C11 A;  1RCL A;  2WOF A;  1W02 A;  3F14 A;  3PS8 A;  2W6J H;  3FCS B;  3CD6 3;  1SQW A;  2CWV A;  3FG4 A;  1W6G A;  5JPP A;  1K41 A;  1UCJ A;  1T2H A;  1UCI A;  1UCK A;  3WOF B;  1IQX A;  1BSE A;  5BXQ A;  4O2H A;  3X3Z A;  3NM2 A;  1RN4 A;  1O7P B;  1WNH A;  1QAK A;  2FXT A;  4KFF A;  1AQZ A;  1U8C B;  1GY5 A;  4HM5 B;  1BRN L;  1UUV B;  5IEO A;  4AKZ A;  8RNT A;  5IG5 A;  2W04 A;  4L8P A;  2GBW B;  1I0V A;  1I2F A;  1FGQ A;  5D82 A;  1I3F A;  1U5O A;  4WYK B;  3UL6 A;  1EG9 B;  2RBI A;  1BNG A;  1LVN A;  2XSH B;  3DGM A;  3OW2 2;  1M9G A;  1GY7 A;  3MSO A;  3BND A;  1BIR A;  2E2T A;  3GRD A;  1RHL A;  4GB5 A;  1W5Z A;  2JDI H;  1AV4 A;  1I3I A;  3DXO A;  3PXM A;  3RGA A;  1LNI A;  3K9M C;  1JB5 A;  3I55 3;  2HMN B;  4LMI A;  4K90 B;  1BAN A;  4O02 B;  4QWT A;  4IIA A;  3SOY A;  3B7C A;  4FMB A;  3JVC A;  1W6C A;  3BB9 A;  4CDL A;  1RLS A;  5AEU B;  1BSA A;  2O9U X;  4X2H A;  3AGN A;  4TX4 A;  5AIH A;  1OHP A;  2KCD A;  1CYU A;  1RSN A;  1HZ1 A;  5IW9 A;  1GY6 A;  3S28 A;  1JZO A;  2K3D A;  2ML6 A;  3KSP A;  3Q90 A;  5LC7 A;  1O7W B;  1I70 A;  1IT7 A;  3O8Y A;  1IYY A;  1FGO A;  1JBT A;  3CME 3;  1FGR A;  1X1U A;  1I2E A;  3DGO A;  1VQP 3;  2WGO A;  2RGQ A;  4IPB A;  1WTH A;  2HML B;  1QVG 2;  2MF7 A;  3CCE 3;  3JUN A;  4HM4 B;  1RMS A;  1TJD A;  1HKX A;  4LGQ A;  1SIH A;  2B24 B;  2W0Q A;  1VQ8 3;  3FZW A;  3KII A;  1GMQ A;  1NO3 A;  1NDO B;  3CNM A;  1JRQ A;  3OWS A;  4FR9 A;  1US1 A;  4R4K A;  3HZP A;  1GOV A;  4G1M B;  3KN4 A;  4PEJ A;  1YVB I;  1BUQ A;  4L8O A;  1K9M 4;  2Y74 A;  2F86 B;  3MKI A;  1B27 A;  3EB8 A;  1BNJ A;  5G1K A;  5D83 A;  1B2M A;  4CJN A;  2F99 A;  1GYB A;  2ZDJ A;  4U13 A;  3SVA A;  2UUG C;  5IF6 A;  2OCT A;  1VQO 3;  2XFT A;  3LXU X;  1OUN A;  3BNC A;  4KFE A;  4CCV A;  3CCU 3;  1HU9 A;  2BMQ B;  3URP A;  2KF4 A;  6GSP A;  1NB3 I;  1N9E A;  1W2B 2;  1DET A;  1YJ9 3;  3B4P A;  3K5T A;  3LTD A;  1YGE A;  4EBG A;  1YJW 3;  4HM6 B;  3D5I A;  1B3S A;  2F5M A;  1JBS A;  1SII A;  3CCM 3;  3G0K A;  4IT7 A;  3S27 A;  1MWR A;  1O7M B;  3HX8 A;  4FCZ A;  2QA4 3;  1Q81 4;  1K8A 4;  1FUW A;  1GOU A;  2OTL 3;  1JZD A;  1QMA A;  1IQ8 A;  1Q40 A;  3F9S A;  2Z77 A;  3JUQ A;  3EBY A;  3NM7 A;  3BIR A;  3G6E 3;  9RNT A;  4N6U A;  5IG3 A;  1STD A;  1B2U A;  2CWU A;  5GSP A;  3ROB A;  1YI2 3;  2LYX A;  2KF6 A;  1NU3 A;  3AMO A;  3GSP A;  4HBR A;  3ZG5 A;  1DMQ A;  1RRH A;  5EQL A;  1M1X B;  3STD A;  1RGH A;  4AKY A;  2JQ5 A;  1RRL A;  1YHQ 3;  1RDS A;  4EW5 A;  3HK4 A;  1CEW I;  2CHC A;  2INX A;  3NBB A;  4I4K A;  1TRQ A;  1VQQ A;  3LTB A;  4WHA A;  3UJM A;  1I2G A;  1GMR A;  1QAL A;  1FYS A;  2ZA4 A;  3F7S A;  2Q07 A;  3CNX A;  3NQZ A;  3T8N A;  2RCD A;  3N54 B;  3CU3 A;  1PYL A;  1X1W A;  1LQG C;  1LOV A;  1RTU A;  3EX9 A;  4RNT A;  1E3V A;  1TIJ A;  3V92 A;  5I97 A;  2OQE A;  3FH1 A;  1OGZ A;  1C7H A;  5M18 A;  1MGW A;  4XM4 A;  3LTC A;  4HM3 B;  3J7Y d;  3EQQ B;  1A2V A;  4EV2 A;  2OQE C;  2GEX A;  1UCL A;  2QGU A;  3EE1 A;  3CPO A;  2GU1 A;  1BRS A;  1VQK 3;  4JF8 A;  1WQL B;  2GXF A;  5FW5 A;  1LOY A;  1J2B A;  1DE3 A;  1Q40 B;  1KC8 4;  1JBR A;  3MG2 A;  1O7N B;  2CFL A;  3PYJ A;  4N6N B;  1B21 A;  3GZY B;  1RN7 A;  1JJ2 2;  1VQ5 3;  1Q42 A;  5JPU A;  4MMY B;  1ULJ B;  4OVM A;  2H0G A;  6RNT A;  4RBN A;  1UI8 A;  3DGL A;  3BNB A;  3S5C A;  1JN5 A;  1RGA A;  4ORL A;  2GBX B;  1FUT A;  4LZI A;  1STF I;  3FSD A;  1TUH A;  3ECF A;  1GMP A;  2RFR A;  3I56 3;  2M7O A;  1BNE A;  1BRG A;  1YIJ 3;  1IV9 A;  1BRK A;  1UW1 A;  2PNC A;  3G8Z A;  3NV0 A;  1C54 A;  1QAF A;  3MPH A;  1Q9E A;  2RSX A;  1RGK A;  3GZB A;  4H61 A;  1JKG A;  2Z76 A;  3V99 A;  7RNT A;  3OWY A;  1IQY A;  2KAA A;  3K63 A;  3SX1 A;  3WA2 X;  1K73 4;  2CK3 H;  3D79 A;  1LRA A;  3A5E A;  4BTY A;  4N6L A;  3DGY A;  4FCJ A;  3E99 A;  5HGR A;  1TFO A;  3F8X A;  3HOH A;  3WOE B;  1YGW A;  1NWW A;  4HAA A;  3CCR 3;  3K7C A;  2XFS A;  2ML5 A;  3MG3 A;  1LNH A;  1DYU A;  1W7C A;  5IEN A;  3PGB A;  5KP3 A;  2XGN A;  3F40 A;  3CCQ 3;  3EJV A;  3LOY A;  3NX0 A;  1B2Z A;  1CQS A;  1A67 A;  4HM0 B;  2SAR A;  1Q7H A;  1BUJ A;  1MWS A;  3B8L A;  1W6Y A;  1MGR A;  5KP1 A;  3NXJ A;  5LC6 A;  3S67 A;  1GS3 A;  1E97 A; 
#chains in the Genus database with same CATH homology
 3IMA B;  1WMP A;  2IMJ A;  3G16 A;  3IPT A;  1IU7 A;  1O7H B;  4GL6 A;  3HIG A;  1IVV A;  2O3O A;  3U97 A;  2W9P A;  3N8B A;  2XSO B;  1O7G B;  3X3X A;  5ELU A;  3LH4 A;  4HJL B;  1EQK A;  1NJI 4;  1QVF 2;  3NHX A;  1VQ7 3;  1PFP A;  1TFK A;  5STD A;  2CKF B;  4NRE A;  3KKG A;  1VQ6 3;  1ISK A;  1AVL A;  3CC4 3;  2P0M A;  4MEI A;  1KSI A;  3RGR A;  1OAC A;  2KRT A;  4HZB B;  2WOH A;  4H3U A;  4L7K A;  4MMX B;  3ER7 A;  2MC8 A;  3FF0 A;  2YX9 A;  1D6U A;  4WP5 A;  1UUW B;  1DVC A;  2B1X B;  3OWU A;  1FA3 A;  1W4N A;  2P05 A;  2YFI B;  5IG0 A;  5CF2 A;  7STD A;  2A15 A;  5AI1 A;  3PZW A;  1A2K A;  3DM8 A;  5DRE A;  2BMR B;  5CK6 A;  1OH0 A;  4Q53 A;  4WFO A;  1VQN 3;  1M1K 4;  1DMM A;  2HMK B;  3S29 A;  1VQL 3;  3UNL A;  4N6M A;  3X3Y A;  2XF3 A;  3T0U A;  2WO0 A;  3MWZ A;  1DMN A;  3HII A;  4J8T A;  2OWP A;  1E3R A;  5CXO A;  4KFD A;  3IJE B;  3LT9 A;  1IV7 A;  3OXA A;  4N6T A;  3SLU A;  2HMM B;  4MMZ B;  1UI7 A;  3WDG B;  2CIU A;  1RKY A;  1Q7Y 4;  4OUQ A;  1ROV A;  4EXR A;  3H51 A;  1IDP A;  3Q2P A;  3VF1 A;  3D9R A;  3FG1 A;  5CLK A;  1OPY A;  3HI7 A;  3X42 A;  2L4V A;  4RNY A;  1S5A A;  2W56 A;  5IG4 A;  1KD1 4;  3CXC 2;  1N5P A;  3U1W A;  3A76 A;  4HM1 B;  4N6V 0;  3KSE D;  4R9K A;  3CCS 3;  3WMD A;  4HM8 B;  3GWR A;  4LEH A;  4KVH A;  3QRD A;  3G71 3;  2FGT A;  3MYT A;  3SED A;  1D6Y A;  1GD3 A;  1WMN A;  1W2Z A;  5AYS C;  1FGT A;  3EF8 A;  1JB2 A;  4XDW A;  1S72 3;  4RNZ A;  5IEP A;  1IT8 A;  5ELJ A;  3UB1 A;  2IA7 A;  3Q1C A;  5JBS A;  3GAX A;  1JB4 A;  1D6Z A;  1EA2 A;  3B4O A;  2Y73 A;  3X40 A;  4WYK A;  1EKM A;  4MJD A;  5EVH A;  3AMO B;  3BLZ A;  1N8Q A;  1OHS A;  3DY5 A;  3EHC A;  4XB5 A;  2OOV A;  4HM7 B;  5TGN A;  3VGN A;  4EYC A;  2OOV C;  3CCJ 3;  3KFQ C;  2K0M A;  2XH9 A;  1F8N A;  4J9A A;  5DRV A;  2GU3 A;  1GD4 A;  3OV4 A;  1NB5 I;  1N5H A;  2W2C A;  2XR8 B;  2YFL B;  1VQ9 3;  1OF5 A;  2QIY A;  2D42 A;  3L0R A;  4R1K A;  3GZX B;  4OK0 A;  1T5Y A;  1Q86 4;  4NHF A;  4AEQ A;  2XEP A;  1ULI B;  3H3H A;  1ROA A;  3CPW 2;  4K61 A;  1Z1S A;  4X2O A;  1IVU A;  3CCV 3;  5IER A;  3WA3 A;  1AR0 A;  4FMA A;  3LZA A;  5A0O B;  1OCV A;  2K54 A;  1JNQ A;  2QEX 3;  1M90 4;  4HVN A;  4ZM8 A;  5AEW B;  5CF1 A;  8CHO A;  4KZ1 A;  3I0Y A;  1ASK A;  4XBY A;  3DMC A;  3FGY A;  3NBJ A;  3MG1 A;  1TU5 A;  2XGL A;  1JN5 B;  3NQY A;  3X41 A;  2YFJ B;  1V74 A;  3MHE A;  5AII A;  4XBX A;  2D1W A;  4XDV A;  5AYR B;  4N6O B;  3EC9 A;  4RZM A;  2BNG A;  2R4I A;  2CH9 A;  3CCL 3;  4FMC A;  4K1V A;  1CYV A;  2ZL8 A;  3DGN A;  3FLJ A;  3FG3 A;  3NV0 B;  4FCM A;  1JKG B;  3VSY A;  2KXG A;  1N8R 4;  1FGM A;  2CFG A;  3V98 A;  2BHM A;  2P09 A;  1OF5 B;  3T8U A;  2BO9 B;  2CFD A;  1LXE A;  3ALA A;  3OX9 A;  3FKA A;  1IVW A;  2XRX B;  3EN1 B;  3PCR A;  3LML A;  4R80 A;  5AIF A;  2HMO B;  3K0Z A;  2CC3 A;  1PU4 A;  2FNQ A;  5AIG A;  3NBR A;  1N9J A;  1IVX A;  2SBL A;  1A90 A;  4N3V A;  1L5G B;  1ZO2 A;  2I9W A;  2STD A;  1TP6 A;  4R9L A;  1IK3 A;  3LTA A;  3NUV A;  5D81 A;  1SPU A;  2GEY A;  1YJN 3;  2BMO B;  3G4S 3;  2PZV A;  4EV5 A;  1OGX A;  4BTW A;  2C10 A;  1KQS 2;  1WMO A;  3JUO A;  6STD A;  3DZL A;  2E2V A;  1MOL A;  1Q82 4;  3UL5 A;  1OHO A;  1Y4K A;  5BVB A;  1DVD A;  3JUP A;  2CG1 A;  2CW9 A;  2WGQ A;  1JV2 B;  3EN8 A;  3F7X A;  2Z7A A;  3M8C A;  3QK9 A;  3F8H A;  2F98 A;  4HKV B;  2IUK A;  2CG0 A;  4LSO A;  4WWU C;  3LYG A;  1YIT 3;  1KWI A;  3LT8 A;  3PCS A;  3FF2 A;  1W00 A;  1VZZ A;  3DUK A;  3EBT A;  2V1L A;  3GZR A;  3N9H A;  1AVK A;  3BNE A;  3JUM A;  4K1U A;  4HYZ A;  2P38 A;  3CMA 3;  2LQV A;  2HMJ B;  2CFW A;  4O3V A;  3TDG A;  4FMD A;  4STD A;  4JRF A;  4BTX A;  4O8S A;  2IUJ A;  2CFK A;  3KE7 A;  2CWT A;  1QJG A;  2UX0 A;  2W9Q A;  1ZX2 A;  2W03 A;  5EEO A;  1MNL A;  2BT3 A;  3SOA A;  3CC7 3;  1W01 A;  3SXX A;  2W56 B;  1R4C A;  1SJW A;  4EC6 A;  5G2G A;  1K28 A;  5KP4 A;  1VQ4 3;  1G96 A;  3CC2 3;  2E2U A;  4HM2 B;  3D3L A;  3RDE A;  1VQM 3;  3KZT A;  2OTJ 3;  2Z6B A;  2P0X A;  4HZ9 B;  1LOX A;  1RJO A;  3WOD G;  5FGO A;  4XBT A;  2C11 A;  2WOF A;  3PS8 A;  1W02 A;  3F14 A;  2W6J H;  3FCS B;  3CD6 3;  1SQW A;  2CWV A;  3FG4 A;  1W6G A;  5JPP A;  1K41 A;  3WOF B;  1IQX A;  5BXQ A;  4O2H A;  3X3Z A;  3NM2 A;  1O7P B;  1WNH A;  1QAK A;  2FXT A;  4KFF A;  1U8C B;  1GY5 A;  4HM5 B;  1UUV B;  5IEO A;  4AKZ A;  5IG5 A;  2W04 A;  4L8P A;  2GBW B;  5D82 A;  1FGQ A;  1U5O A;  4WYK B;  3UL6 A;  1EG9 B;  1LVN A;  2XSH B;  3DGM A;  3OW2 2;  1M9G A;  1GY7 A;  3MSO A;  3BND A;  2E2T A;  3GRD A;  4GB5 A;  1W5Z A;  2JDI H;  1AV4 A;  3PXM A;  3DXO A;  3RGA A;  3K9M C;  1JB5 A;  3I55 3;  2HMN B;  4LMI A;  4K90 B;  4O02 B;  3SOY A;  4QWT A;  4IIA A;  3B7C A;  4FMB A;  3JVC A;  1W6C A;  3BB9 A;  4CDL A;  5AEU B;  2O9U X;  4X2H A;  4TX4 A;  5AIH A;  1OHP A;  2KCD A;  1CYU A;  5IW9 A;  1GY6 A;  3S28 A;  2ML6 A;  3KSP A;  3Q90 A;  5LC7 A;  1O7W B;  3O8Y A;  1IT7 A;  1FGO A;  3CME 3;  1FGR A;  3DGO A;  1VQP 3;  2WGO A;  2RGQ A;  4IPB A;  1WTH A;  2HML B;  1QVG 2;  2MF7 A;  3CCE 3;  3JUN A;  4HM4 B;  4LGQ A;  1HKX A;  1VQ8 3;  1SIH A;  2B24 B;  2W0Q A;  3FZW A;  3KII A;  1NO3 A;  1NDO B;  3CNM A;  1JRQ A;  3OWS A;  4FR9 A;  1US1 A;  4R4K A;  3HZP A;  4G1M B;  4PEJ A;  3KN4 A;  1BUQ A;  1YVB I;  4L8O A;  1K9M 4;  2Y74 A;  2F86 B;  3MKI A;  3EB8 A;  5D83 A;  2F99 A;  2ZDJ A;  1GYB A;  4U13 A;  3SVA A;  5IF6 A;  2OCT A;  1VQO 3;  2XFT A;  3LXU X;  1OUN A;  3BNC A;  4KFE A;  4CCV A;  3CCU 3;  1HU9 A;  2BMQ B;  1NB3 I;  1N9E A;  1W2B 2;  1YJ9 3;  3B4P A;  3K5T A;  3LTD A;  1YGE A;  4EBG A;  1YJW 3;  4HM6 B;  1SII A;  3CCM 3;  3G0K A;  4IT7 A;  3S27 A;  1O7M B;  3HX8 A;  2QA4 3;  4FCZ A;  1Q81 4;  1K8A 4;  1FUW A;  2OTL 3;  1QMA A;  1IQ8 A;  1Q40 A;  3F9S A;  2Z77 A;  3JUQ A;  3EBY A;  3NM7 A;  3G6E 3;  5IG3 A;  4N6U A;  1STD A;  2CWU A;  3ROB A;  1YI2 3;  2LYX A;  1NU3 A;  3AMO A;  4HBR A;  1DMQ A;  1RRH A;  5EQL A;  1M1X B;  3STD A;  4AKY A;  2JQ5 A;  1RRL A;  1YHQ 3;  3HK4 A;  1CEW I;  2CHC A;  2INX A;  3NBB A;  4I4K A;  4WHA A;  3UJM A;  3LTB A;  1QAL A;  3F7S A;  2Q07 A;  3CNX A;  3NQZ A;  3T8N A;  2RCD A;  3N54 B;  3CU3 A;  3EX9 A;  1E3V A;  1TIJ A;  3V92 A;  5I97 A;  2OQE A;  3FH1 A;  1OGZ A;  1C7H A;  4XM4 A;  3LTC A;  4HM3 B;  3J7Y d;  3EQQ B;  1A2V A;  4EV2 A;  2OQE C;  2GEX A;  3EE1 A;  2QGU A;  3CPO A;  2GU1 A;  1VQK 3;  4JF8 A;  1WQL B;  2GXF A;  5FW5 A;  1J2B A;  1Q40 B;  1KC8 4;  3MG2 A;  1O7N B;  2CFL A;  3PYJ A;  4N6N B;  3GZY B;  1RN7 A;  1JJ2 2;  1VQ5 3;  1Q42 A;  5JPU A;  4MMY B;  1ULJ B;  4OVM A;  4RBN A;  1UI8 A;  3DGL A;  3BNB A;  3S5C A;  1JN5 A;  4ORL A;  2GBX B;  4LZI A;  1STF I;  3FSD A;  1TUH A;  3ECF A;  2RFR A;  3I56 3;  2M7O A;  1YIJ 3;  1IV9 A;  1UW1 A;  2PNC A;  3G8Z A;  3NV0 A;  1QAF A;  3MPH A;  3V99 A;  2RSX A;  3GZB A;  4H61 A;  1JKG A;  2Z76 A;  3OWY A;  1IQY A;  3K63 A;  3SX1 A;  3WA2 X;  1K73 4;  2CK3 H;  4BTY A;  4N6L A;  4FCJ A;  3E99 A;  5HGR A;  1TFO A;  3F8X A;  3WOE B;  1NWW A;  3CCR 3;  3K7C A;  2XFS A;  2ML5 A;  3MG3 A;  1LNH A;  1DYU A;  1W7C A;  5IEN A;  3PGB A;  5KP3 A;  2XGN A;  3F40 A;  3CCQ 3;  3EJV A;  3LOY A;  3NX0 A;  1CQS A;  1A67 A;  4HM0 B;  3B8L A;  1W6Y A;  5KP1 A;  3NXJ A;  5LC6 A;  3S67 A;  1GS3 A;  1E97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...