1ZX2A

Crystal structure of yeast ubp3-associated protein bre5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
130
Chain Sequence
SMGVTVQDICFAFLQNYYERMRTDPSKLAYFYASTAELTHTNYPTVKVTGRENINKFFSRNDAKVRSLKLKLDTIDFQYTGHLHKSILIMATGEMFWTGTPVYKFCQTFILLPSSNGSTFDITNDIIRFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBP3-associated protein BRE5
publication title Structural basis for interaction between the Ubp3 deubiquitinating enzyme and its Bre5 cofactor
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 31
structure length 130
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1zx2A00
3STDA 5EVHA 2HMLB 3DMCA 3CNXA 3MG3A 4WYKA 2HMKB 4XBYA 3EBTA 2OWPA 2GBXB 5IEOA 3M8CA 3NV0B 2GXFA 4LEHA 4HVNA 5CLKA 5TGNA 4N3VA 1JKGA 1OHPA 5CK6A 2XSHB 3EX9A 1NWWA 5AIIA 3F7XA 5CF2A 4HZBB 2YFLB 2BNGA 5HGRA 4STDA 4WYKB 1W6YA 1Z1SA 3KKGA 4HM2B 4HM1B 1DMQA 4XBTA 1JKGB 6STDA 3KE7A 2HMNB 4X2HA 4HM5B 1W02A 3FSDA 4LGQA 3NHXA 4XB5A 5JPUA 3LZAA 3BLZA 5IG0A 2RFRA 4ORLA 4WP5A 1O7GB 3JUNA 3EN8A 2YFIB 4XDVA 4K1UA 2I9WA 3HX8A 3JUMA 5IG3A 1ULIB 3D9RA 3MYTA 3T8UA 1OHOA 3HZPA 3FGYA 3OV4A 5IG5A 1JB4A 2B1XB 5KP3A 1GY5A 2GEYA 5IEPA 3F7SA 4U13A 1O7MB 1Q40A 4OVMA 5CXOA 5DRVA 1OHSA 3ROBA 1OGZA 2W2CA 3OX9A 1CQSA 1AR0A 1VZZA 1DMMA 3IPTA 4J8TA 1BUQA 2XSOB 4R1KA 2YFJB 1O7HB 1Q40B 1ULJB 4XM4A 3MG2A 3F40A 3B8LA 2GEXA 4HM7B 3NV0A 1E97A 2BMQB 3NXJA 4I4KA 2XRXB 2UX0A 3ER7A 1TUHA 2QIYA 3E99A 1EA2A 3CU3A 5G2GA 3SOYA 1JB2A 5CF1A 1O7NB 3UJMA 3RGRA 3HK4A 5BVBA 5IERA 8CHOA 2XR8B 3Q90A 1EG9B 3MG1A 4FCJA 1OUNA 1OF5A 5FW5A 3LYGA 4LMIA 1UUWB 1Q42A 1UUVB 4XBXA 4IIAA 1ZO2A 3GRDA 4HM0B 3EBYA 3T8NA 4XDWA 1OF5B 4X2OA 2JQ5A 2B24B 1OCVA 2RGQA 4K1VA 3F8XA 3CNMA 3F9SA 3FH1A 3EF8A 2Z7AA 3KSPA 3OWUA 4H3UA 2BMRB 4GB5A 1NU3A 1O7PB 3GWRA 3BB9A 3EN1B 3EC9A 4RZMA 5IENA 3H51A 3FLJA 3K7CA 5IG4A 3GZXB 2F99A 3DM8A 2CKFB 3VSYA 1IDPA 3DXOA 1W00A 3FZWA 2BMOB 1A2KA 2R4IA 2IMJA 2QGUA 1SJWA 5BXQA 2INXA 4OUQA 3F14A 3NUVA 3WMDA 1WQLB 5AI1A 3B4PA 4FCMA 1QJGA 4KVHA 3I0YA 3K0ZA 3JUOA 3G0KA 1JB5A 3NBRA 4L8OA 1ZX2A 1S5AA 2STDA 1OH0A 3MHEA 3EQQB 3H3HA 1E3RA 4HM8B 1STDA 4CDLA 3JUQA 5IF6A 1U5OA 1GYBA 2HMMB 1E3VA 2GBWB 3FKAA 4L8PA 1JN5B 5AIHA 1NDOB 3DZLA 3G8ZA 3B4OA 5AEUB 3A76A 1TP6A 1GY7A 3DUKA 1DMNA 2HMOB 3GZYB 4PEJA 2A15A 3JUPA 3S5CA 5STDA 3VGNA 2Z77A 5AIGA 2F98A 3GZBA 3KZTA 4L7KA 4J9AA 3FF2A 3EHCA 1ASKA 7STDA 4MJDA 1HKXA 3B7CA 1OPYA 1QMAA 4HZ9B 3MKIA 3MSOA 3NM2A 3SOAA 5KP4A 3FF0A 1ISKA 4R9LA 3F8HA 3RGAA 5AEWB 5DREA 1GY6A 3G16A 3SEDA 3OWSA 4HKVB 5D82A 3CPOA 2RCDA 3ECFA 2Z76A 2CHCA 4HJLB 5KP1A 2PZVA 3EJVA 4WWUC 2K54A 5D83A 1K41A 2HMJB 3OWYA 1C7HA 3UNLA 1O7WB 4HM6B 5D81A 1JN5A 2F86B 5AIFA 4Q53A 3OXAA 1W01A 4R9KA 4HM4B 3GZRA 1OGXA 4HM3B 5JPPA 1GS3A
chains in the Genus database with same CATH superfamily
3STDA 1BNEA 3LTCA 5EVHA 2HMLB 1MWRA 1B20A 1GD4A 3DMCA 3CNXA 1TFKA 3SLUA 3MG3A 4WYKA 2HMKB 5M18A 1VQM3 4XBYA 3EBTA 3CD63 2OWPA 3S27A 1N8QA 1FGRA 4EBGA 2GBXB 5BU4A 1JZDA 4MMYB 3D3LA 1PYLA 7GSPA 1BNJA 5IEOA 1YIT3 3LH4A 3M8CA 3NV0B 2GXFA 4LEHA 4HVNA 4RBNA 5CLKA 4NPBA 5TGNA 1M9GA 4N3VA 1JKGA 1OHPA 4O2HA 1BSDA 1ZS7A 2XFSA 5CK6A 1DVCA 2XSHB 3X41A 3DH2A 3EX9A 3LT9A 4IT7A 4FMDA 1I3IA 1RHLA 1NWWA 1FUTA 2C11A 2JDIH 5AIIA 3F7XA 4R80A 5CF2A 2W9QA 4HZBB 4O3VA 2YFLB 2BNGA 5HGRA 1VQK3 2E2VA 4STDA 4WYKB 1W6YA 4O02B 4EV2A 2OQEC 1Z1SA 3JVCA 3KKGA 3G713 3BNEA 2KXGA 1MOLA 1W6CA 4HM2B 4HM1B 3WOEB 1IK3A 1GOUA 2W03A 1BSBA 1DMQA 3LOYA 3BNDA 2P38A 1BVIA 1QALA 2J8XB 3DY5A 1FZUA 1I2GA 1YVBI 4LYLB 4XBTA 4RNTA 1JKGB 6STDA 3KE7A 3WHOA 2HMNB 4X2HA 4HM5B 1W02A 2GU3A 3FSDA 2KAAA 3HI7A 1BOXA 2O9UX 4LGQA 1BNIA 3DGOA 3O8YA 3NHXA 1WMOA 2GU1A 4XB5A 5JPUA 1M1K4 1EUIC 4DKIA 3LZAA 3LMLA 3BLZA 1Q824 2CW9A 5IG0A 2ZDJA 1GD3A 4MEIA 3K63A 2RFRA 1NO3A 4ORLA 4WP5A 3V92A 4BTYA 1O7GB 1Q864 1VQ43 4WFOA 1QVG2 3AHSA 3JUNA 3EN8A 1NNVA 2YFIB 1JV2B 1FGOA 4XDVA 4K1UA 4EC6A 1LNHA 1IQ8A 2I9WA 3HX8A 3JUMA 1ULIB 3D9RA 5IG3A 3MYTA 2Y74A 5GSPA 1LOXA 4N6UA 3T8UA 1DE3A 1OHOA 2CFDA 1IV7A 3HZPA 3CMA3 3FGYA 3Q1CA 2IY2A 4GSPA 1BRIA 2ZHXB 3OV4A 3ZFZA 4LZIA 1IT8A 1UCLA 4MMZB 5IG5A 1MWSA 4RNZA 1B3SA 1JB4A 2B1XB 5KP3A 1KSIA 1BRGA 1TU5A 1BSCA 3CCV3 1GY5A 1BGSA 2YX9A 1IVVA 1N8R4 3G6E3 2GEYA 2HOHA 2W04A 5HOHA 1IV9A 5IEPA 2OCTA 1IYYA 1WMPA 3F7SA 4AKYA 4U13A 1O7MB 5ELJA 4CJNA 1Q40A 1K734 4OVMA 1G96A 5CXOA 5DRVA 3OW22 2MF7A 1OHSA 4FMCA 3ROBA 3GSPA 1SQWA 3MWZA 1A2VA 1B21A 3D5IA 1OGZA 2W2CA 1N5HA 3OX9A 2ML6A 3KIIA 1CQSA 3CCJ3 5I97A 3PGBA 1YGEA 1AR0A 1KQS2 3V98A 1W5ZA 3GAXA 1VZZA 3SVAA 1KC84 1DMMA 2LYXA 1US1A 3IPTA 1B2XA 4J8TA 4BIRA 3K5TA 2XSOB 1K8A4 3KN4A 1BUQA 2WOHA 4R1KA 2YFJB 3NBJA 2W56A 1O7HB 1AQZA 1R4YA 1Q40B 1ULJB 2E2TA 4XM4A 3MG2A 2IUKA 3F40A 3B8LA 2GEXA 4HM7B 1EKMA 3NV0A 1IQXA 1W2ZA 1E97A 4IPBA 1PFPA 4TX4A 2BMQB 1R4CA 1QAKA 2WGOA 3FG1A 3NXJA 1VQ53 1DVDA 4I4KA 2XRXB 1YJN3 2UX0A 2RBIA 5LC6A 1D6YA 3ER7A 1M904 1I0VA 1TUHA 2QIYA 3E99A 1EA2A 2P05A 4OK0A 1YIJ3 1JBTA 1FGQA 3UL6A 3CU3A 3AMOA 2W56B 1TRPA 3LT8A 1LRAA 5G2GA 1BSEA 1JB2A 1LOWA 3SOYA 3CCE3 3U97A 5RNTA 5CF1A 1O7NB 3SYUA 3UJMA 4AEQA 1BRNL 4QWTA 1HYFA 1N5PA 3RGRA 3HK4A 5BVBA 5IERA 1BNRA 8CHOA 2XR8B 3Q90A 1IVXA 1EG9B 3MG1A 4FCJA 2L4VA 1UI7A 1FUSA 1OUNA 1OF5A 1BRSA 2BHMA 3X3ZA 2OOVA 4FCZA 5FW5A 3L0RA 1UCKA 4FMAA 1N9JA 3LYGA 2XH9A 4G1MB 4HAAA 4LMIA 1D6ZA 2V1LA 1V58A 3AMOB 1UUWB 1LQGC 1GMRA 1Q42A 1UUVB 2IYJA 2ZL8A 4XBXA 3Q3FA 4IIAA 4J5GA 1BNGA 1ZO2A 5LC7A 2IUJA 3GRDA 1TIJA 1RMSA 1WMNA 4HM0B 4HOHA 1FW7A 3S29A 1MWUA 3BU4A 1A67A 2P0MA 4FR9A 1T3BA 4BTXA 3EBYA 1IT7A 3T8NA 4XDWA 1OF5B 2CG0A 4X2OA 1SARA 1TFOA 2QEX3 2JQ5A 1JBSA 2B24B 1OCVA 3PCRA 2ZA4A 2RGQA 2CC3A 4K1VA 5G1KA 1IVWA 1FUWA 1L5GB 3VF1A 3F8XA 2BT3A 3N54B 1U8CB 1HZ1A 1UUGB 3CNMA 3WODG 2BO9B 3F9SA 3FH1A 3ZG0A 1UCIA 3EF8A 2Z7AA 3PCSA 1FGTA 2SARA 5G1LA 2K0MA 2FGTA 3KSPA 3CCU3 3RNTA 3OWUA 1UCJA 4H3UA 1YHQ3 2SBLA 3RDEA 2BMRB 1LOVA 4GB5A 3WOFB 1B2MA 1NU3A 1O7PB 3GWRA 3U1WA 1GMPA 3BB9A 5EEOA 1RN4A 2CFWA 3EN1B 1A90A 3EC9A 5IG4A 4RZMA 5IENA 3CCS3 4EW5A 3H51A 3NM7A 1JRQA 1X1WA 1RGFA 2RNTA 2W6JH 3FLJA 3GZXB 2F99A 3K7CA 3PYJA 1UGIA 2BIRA 4GHOA 1Y4KA 3UL5A 1Q814 3DM8A 2CX0A 2CKFB 5BIRA 1RCLA 5M1AA 1PY3A 4JF8A 2AADA 3VSYA 1YJW3 1FYSA 1IDPA 1SIIA 3DXOA 3BNCA 1W00A 5IW9A 1YI23 2W0QA 2P09A 3CCL3 1RDSA 2UUGC 2XGNA 3FZWA 1TJDA 2BMOB 2CX1A 2RSXA 1A2KA 2R4IA 2IMJA 5JBSA 2QGUA 4KFDA 1EQKA 1SJWA 3D4AA 3PXMA 5BXQA 1RTUA 4H61A 3LTAA 3QK9A 2INXA 1IQYA 4OUQA 3F14A 3NX0A 2CWVA 3NUVA 1RN1A 1ZGXA 3WMDA 4KZ1A 3HIGA 4AKZA 2C4BA 3V99A 3CC73 1WQLB 1ROVA 5AYSC 1LNIA 1RRLA 2H0GA 2ML5A 5AI1A 3ZG5A 3HOHA 1WTHA 2CIUA 3B4PA 3IJEB 4FCMA 1QJGA 3SXXA 2D42A 4N6V0 4KT3B 1RGCA 4KVHA 1G02A 1BAOA 1BRKA 1BSAA 3X42A 1I70A 3I0YA 3K0ZA 1AY7A 3JUOA 4ZM8A 3G0KA 1JB5A 3NBRA 4L8OA 1JZOA 1YNVX 5M19A 1RNTA 1SPUA 1ZX2A 1S5AA 2Q07A 1J2BA 3N8BA 4GL6A 3S67A 1X1YA 2STDA 3J7Yd 1OH0A 2CFLA 3TDGA 2W9PA 4EYCA 1Q7Y4 3MHEA 3EQQB 3H3HA 3I563 3CXC2 1LXEA 3FG3A 2F5MA 2KF5A 1X1UA 1E3RA 3NBBA 2KF3A 1RLSA 1BNFA 4HM8B 2OQEA 3UB1A 4I5QA 1Q7HA 1STDA 1KD14 1BUJA 3D5GA 1GOYA 1FA3A 4HYZA 4ILFA 4CCVA 1RGEA 3KCHA 1VQ83 3NQYA 1C54A 4CDLA 3FG4A 1Q9EA 3JUQA 3AHWA 1T2IA 5IF6A 1RGLA 1U5OA 2OTJ3 2XGLA 1BIRA 1CYUA 1GYBA 3AGNA 1VQL3 1F8NA 2HMMB 1K28A 1UI8A 3WR2A 6RNTA 1NB5I 2O3OA 7RNTA 3CC23 1GMQA 1E3VA 2C10A 3FCSB 1CEWI 2FXTA 2MC8A 2GBWB 1LQMB 3FKAA 1A2PA 4L8PA 2F4YA 4K61A 2QA43 1JN5B 1RGAA 2XF3A 4BL2A 5AIHA 4BU4A 1NDOB 2WOFA 1B2UA 1AV4A 4N6TA 3CME3 1RGGA 3DZLA 3G8ZA 4N6MA 3QRDA 2D1WA 3B4OA 5AEUB 1VQQA 3SX1A 3A76A 3X3YA 1TP6A 1VQ63 3LTBA 1GY7A 1BRJA 2CWUA 3URPA 6GSPA 3DUKA 1DMNA 5A0OB 1MGRA 4LSOA 2HMOB 3X3XA 3PS8A 1JBRA 3GZYB 1CH0A 4PEJA 2A15A 2KF6A 1NB3I 3JUPA 4J5KA 5FGOA 1FGMA 3S5CA 5STDA 4KFEA 1S723 3PZWA 1UDII 3VGNA 1YJ93 2Z77A 3S28A 5AIGA 1AVKA 2KCDA 2XEPA 3DGYA 3K9MC 4N6OB 2CH9A 3CPW2 2F98A 1T2HA 3GZBA 4FMBA 1BU4A 3KZTA 4L7KA 4J9AA 1W2B2 2M7OA 2CK3H 1LOYA 3CCQ3 1BRHA 3EE1A 5AYRB 8RNTA 3FF2A 1EEJA 2Y73A 1ASKA 3EB8A 2CWTA 3EHCA 2GSPA 3N9HA 4R4KA 7STDA 4MJDA 1VQ93 1RSNA 2OOVC 4NHFA 1MWTA 2WO0A 1HKXA 1MGWA 1DETA 1W6GA 3B7CA 1AVLA 1YGWA 1D6UA 2XFTA 2H0HA 2K3DA 2E2UA 1OPYA 1QMAA 1TTOA 1I8VA 1RRHA 4HZ9B 3MKIA 3MSOA 2R41A 3NM2A 1OACA 1T5YA 3SOAA 4EXRA 5KP4A 1QVF2 3FF0A 1ISKA 4R9LA 3F8HA 3RGAA 2Z6BA 5AEWB 1VQO3 4NREA 5EQLA 1GOVA 1N9EA 5DREA 1LVNA 1GY6A 3G16A 3SEDA 1IU7A 1SIHA 2UGIA 3OWSA 2H0IA 3KSED 1VQP3 4BL3A 1QAFA 1BANA 1WNHA 4HKVB 5D82A 1CYVA 4CPKA 1MNLA 2P0XA 2OTL3 3CPOA 2RCDA 3G4S3 3D79A 3CC43 3LTDA 4N6NB 1K9M4 3DGNA 1V74A 1W7CA 1I2FA 1RNBA 3ECFA 3I553 1STFI 3DGLA 3ALAA 2KRTA 2IA7A 3CCR3 1NJI4 1G0TA 1RGKA 4KFFA 1GSPA 4EV5A 4JRFA 1I2EA 1IVUA 1UW1A 3WA2X 1W4NA 1KWIA 1ROAA 1BNSA 2Z76A 2CHCA 2CFGA 1UGHI 3BIRA 4HJLB 5KP1A 2PZVA 1I3FA 1VQ73 3AGOA 1JJ22 3EJVA 3WA3A 3KFQC 4WWUC 2K54A 3A5EA 4RNYA 1M1XB 3HIIA 2PNCA 2F56A 4MMXB 1RCKA 5D83A 1K41A 2HMJB 1V57A 1PU4A 4K90B 1B2ZA 4BTWA 3CCM3 1RN7A 1TRQA 2LQVA 2F5WA 3OWYA 1X1XA 1C7HA 3DGMA 3T0UA 1O7WB 3UNLA 1JNQA 3WDGB 4HM6B 4N6LA 1YVSA 1JN5A 2F86B 4WHAA 5D81A 5ELUA 1DYUA 3IMAB 3Q2PA 1RGHA 3MPHA 3X40A 2FNQA 1RJOA 4HBRA 5AIFA 2CFKA 3OXAA 1W01A 4Q53A 3LXUX 4R9KA 1HU9A 3BNBA 4HM4B 1B2SA 2AAEA 2WGQA 3GZRA 9RNTA 1VQN3 1B27A 2L1SA 1RKYA 2BU4A 3NQZA 1OGXA 4HM3B 2CG1A 4O8SA 1I0XA 2KF4A 5JPPA 1GS3A
chains in the Genus database with same CATH topology
3STDA 3LTCA 5EVHA 2HMLB 1GD4A 3DMCA 3CNXA 1TFKA 3SLUA 3MG3A 4WYKA 2HMKB 1VQM3 3CD63 4XBYA 3EBTA 2OWPA 3S27A 1N8QA 1FGRA 4EBGA 2GBXB 4MMYB 3D3LA 1YIT3 5IEOA 3LH4A 3M8CA 3NV0B 2GXFA 4LEHA 4HVNA 4RBNA 5CLKA 5TGNA 1M9GA 4N3VA 1JKGA 1OHPA 4O2HA 5CK6A 2XFSA 1DVCA 2XSHB 3X41A 3EX9A 3LT9A 4IT7A 4FMDA 2C11A 1NWWA 5AIIA 2JDIH 3F7XA 4R80A 5CF2A 2W9QA 4HZBB 4O3VA 2YFLB 2BNGA 5HGRA 1VQK3 2E2VA 4STDA 4WYKB 1W6YA 4O02B 4EV2A 2OQEC 1Z1SA 3JVCA 3KKGA 3G713 3BNEA 2KXGA 1MOLA 1W6CA 4HM2B 4HM1B 3WOEB 1IK3A 2W03A 1DMQA 3LOYA 3BNDA 2P38A 1QALA 3DY5A 1YVBI 4XBTA 1JKGB 6STDA 3KE7A 2HMNB 4X2HA 4HM5B 1W02A 2GU3A 3FSDA 3HI7A 2O9UX 4LGQA 3DGOA 3O8YA 3NHXA 1WMOA 2GU1A 4XB5A 5JPUA 1M1K4 3LZAA 3LMLA 3BLZA 1Q824 2CW9A 5IG0A 2ZDJA 1GD3A 4MEIA 3K63A 2RFRA 1NO3A 4ORLA 4WP5A 3V92A 4BTYA 1O7GB 1Q864 1VQ43 4WFOA 1QVG2 3JUNA 3EN8A 2YFIB 1JV2B 1FGOA 4XDVA 4K1UA 4EC6A 1LNHA 1IQ8A 2I9WA 3HX8A 3JUMA 1ULIB 3D9RA 5IG3A 3MYTA 2Y74A 1LOXA 4N6UA 3T8UA 1OHOA 2CFDA 1IV7A 3HZPA 3CMA3 3FGYA 3Q1CA 3OV4A 4LZIA 1IT8A 4MMZB 5IG5A 4RNZA 1JB4A 2B1XB 5KP3A 1KSIA 1TU5A 3CCV3 1GY5A 2YX9A 1IVVA 1N8R4 3G6E3 2GEYA 2W04A 1IV9A 5IEPA 2OCTA 1WMPA 3F7SA 4AKYA 4U13A 1O7MB 5ELJA 1Q40A 1K734 4OVMA 1G96A 5CXOA 5DRVA 3OW22 2MF7A 1OHSA 4FMCA 3ROBA 1SQWA 3MWZA 1A2VA 1OGZA 2W2CA 1N5HA 3OX9A 2ML6A 3KIIA 1CQSA 3CCJ3 5I97A 3PGBA 1YGEA 1AR0A 1KQS2 3V98A 1W5ZA 3GAXA 1VZZA 3SVAA 1KC84 1DMMA 2LYXA 1US1A 3IPTA 4J8TA 1K8A4 1BUQA 3K5TA 2XSOB 3KN4A 2WOHA 4R1KA 2YFJB 3NBJA 2W56A 1O7HB 1Q40B 1ULJB 2E2TA 4XM4A 3MG2A 2IUKA 3F40A 3B8LA 2GEXA 4HM7B 1EKMA 3NV0A 1IQXA 1W2ZA 1E97A 4IPBA 1PFPA 4TX4A 2BMQB 1R4CA 1QAKA 2WGOA 3FG1A 3NXJA 1VQ53 1DVDA 4I4KA 2XRXB 1YJN3 2UX0A 5LC6A 1D6YA 3ER7A 1M904 1TUHA 2QIYA 3E99A 1EA2A 2P05A 4OK0A 1YIJ3 1FGQA 3UL6A 3CU3A 3AMOA 2W56B 3LT8A 3CCE3 5G2GA 1JB2A 3SOYA 3U97A 5CF1A 1O7NB 3UJMA 4AEQA 4QWTA 1N5PA 3RGRA 3HK4A 5BVBA 5IERA 8CHOA 2XR8B 3Q90A 1IVXA 1EG9B 3MG1A 4FCJA 2L4VA 1UI7A 1OUNA 1OF5A 2BHMA 3X3ZA 2OOVA 4FCZA 5FW5A 3L0RA 4FMAA 1N9JA 3LYGA 2XH9A 4G1MB 4LMIA 1D6ZA 2V1LA 3AMOB 1UUWB 1Q42A 1UUVB 2ZL8A 4XBXA 4IIAA 1ZO2A 2IUJA 5LC7A 3GRDA 1TIJA 1WMNA 4HM0B 3S29A 1A67A 2P0MA 4FR9A 4BTXA 3EBYA 1IT7A 3T8NA 4XDWA 1OF5B 2CG0A 4X2OA 1TFOA 2QEX3 2JQ5A 2B24B 1OCVA 3PCRA 2RGQA 2CC3A 4K1VA 1IVWA 1FUWA 1L5GB 3VF1A 3F8XA 2BT3A 3N54B 1U8CB 3CNMA 3WODG 2BO9B 3F9SA 3FH1A 3EF8A 2Z7AA 3PCSA 1FGTA 2K0MA 2FGTA 3KSPA 3CCU3 3OWUA 4H3UA 1YHQ3 2SBLA 3RDEA 2BMRB 4GB5A 3WOFB 1NU3A 1O7PB 3GWRA 3U1WA 3BB9A 5EEOA 2CFWA 3EN1B 1A90A 3EC9A 4RZMA 5IENA 3CCS3 3H51A 3NM7A 1JRQA 3FLJA 3K7CA 5IG4A 2W6JH 3GZXB 3CCL3 2F99A 3PYJA 3UL5A 1Y4KA 1Q814 3DM8A 2CKFB 3VSYA 1YJW3 4JF8A 1IDPA 1SIIA 3DXOA 3BNCA 1W00A 5IW9A 1YI23 2W0QA 2P09A 2XGNA 3FZWA 5JBSA 2BMOB 2RSXA 1A2KA 2R4IA 2IMJA 2QGUA 4KFDA 1EQKA 1SJWA 3PXMA 5BXQA 4H61A 3LTAA 3QK9A 2INXA 1IQYA 4OUQA 3F14A 3NX0A 2CWVA 3NUVA 3WMDA 4KZ1A 3HIGA 4AKZA 3V99A 3CC73 1WQLB 1ROVA 5AYSC 1RRLA 2ML5A 5AI1A 1WTHA 2CIUA 3B4PA 3IJEB 4FCMA 1QJGA 3SXXA 2D42A 4N6V0 4KVHA 3X42A 3I0YA 3K0ZA 3JUOA 4ZM8A 3G0KA 1JB5A 3NBRA 4L8OA 1SPUA 1ZX2A 1S5AA 2Q07A 1J2BA 3N8BA 4GL6A 3S67A 2STDA 3J7Yd 1OH0A 2CFLA 3TDGA 2W9PA 4EYCA 1Q7Y4 3MHEA 3EQQB 3H3HA 3I563 3CXC2 1LXEA 3FG3A 1E3RA 3NBBA 4HM8B 3UB1A 2OQEA 1STDA 1KD14 1FA3A 4HYZA 4CCVA 1VQ83 3NQYA 4CDLA 3FG4A 3JUQA 5IF6A 2OTJ3 1U5OA 2XGLA 1CYUA 1GYBA 1VQL3 1F8NA 2HMMB 1K28A 1UI8A 1NB5I 2O3OA 3CC23 1E3VA 2C10A 3FCSB 1CEWI 2FXTA 2MC8A 2GBWB 3FKAA 4L8PA 4K61A 2QA43 1JN5B 2XF3A 5AIHA 1NDOB 2WOFA 1AV4A 4N6TA 3CME3 3DZLA 3G8ZA 4N6MA 3QRDA 2D1WA 3B4OA 5AEUB 3SX1A 3A76A 3X3YA 1TP6A 1VQ63 3LTBA 1GY7A 2CWUA 3DUKA 1DMNA 5A0OB 4LSOA 2HMOB 3X3XA 3PS8A 3GZYB 4PEJA 2A15A 1NB3I 3JUPA 5FGOA 1FGMA 3S5CA 5STDA 4KFEA 1S723 3PZWA 3VGNA 1YJ93 2Z77A 3S28A 5AIGA 1AVKA 2KCDA 2XEPA 3K9MC 4N6OB 2CH9A 3CPW2 2F98A 3GZBA 4FMBA 3KZTA 4L7KA 4J9AA 1W2B2 2M7OA 2CK3H 3CCQ3 3EE1A 5AYRB 3FF2A 2Y73A 3EHCA 1ASKA 3EB8A 2CWTA 3N9HA 4R4KA 7STDA 4MJDA 1VQ93 2OOVC 4NHFA 2WO0A 1HKXA 1W6GA 3B7CA 1AVLA 1D6UA 2XFTA 2E2UA 1OPYA 1QMAA 1RRHA 4HZ9B 3MKIA 3MSOA 3NM2A 1OACA 1T5YA 3SOAA 4EXRA 5KP4A 1QVF2 3FF0A 1ISKA 4R9LA 3F8HA 3RGAA 2Z6BA 5AEWB 1VQO3 4NREA 5EQLA 1N9EA 5DREA 1LVNA 1GY6A 3G16A 3SEDA 1IU7A 1SIHA 3OWSA 3KSED 1VQP3 1QAFA 1WNHA 4HKVB 5D82A 1CYVA 1MNLA 2P0XA 2OTL3 3CPOA 2RCDA 3G4S3 3CC43 3LTDA 4N6NB 1K9M4 3DGNA 1V74A 1W7CA 3ECFA 3I553 1STFI 3DGLA 3ALAA 2KRTA 2IA7A 3CCR3 1NJI4 4KFFA 4EV5A 4JRFA 1IVUA 1UW1A 3WA2X 1W4NA 1KWIA 1ROAA 2Z76A 2CHCA 2CFGA 4HJLB 5KP1A 1VQ73 2PZVA 1JJ22 3EJVA 3WA3A 3KFQC 4WWUC 2K54A 4RNYA 1M1XB 3HIIA 2PNCA 4MMXB 5D83A 1K41A 2HMJB 1PU4A 4K90B 4BTWA 3CCM3 1RN7A 2LQVA 3OWYA 1C7HA 3DGMA 3T0UA 1O7WB 3UNLA 1JNQA 3WDGB 4HM6B 4N6LA 5D81A 1JN5A 2F86B 4WHAA 5ELUA 3X40A 1DYUA 3IMAB 3Q2PA 3MPHA 2FNQA 1RJOA 4HBRA 5AIFA 2CFKA 3OXAA 1W01A 4Q53A 3LXUX 4R9KA 1HU9A 3BNBA 4HM4B 2WGQA 3GZRA 1RKYA 3NQZA 1OGXA 4HM3B 2CG1A 4O8SA 5JPPA 1VQN3 1GS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STD A;  5EVH A;  2HML B;  3DMC A;  3CNX A;  3MG3 A;  4WYK A;  2HMK B;  4XBY A;  3EBT A;  2OWP A;  2GBX B;  5IEO A;  3M8C A;  3NV0 B;  2GXF A;  4LEH A;  4HVN A;  5CLK A;  5TGN A;  4N3V A;  1JKG A;  1OHP A;  5CK6 A;  2XSH B;  3EX9 A;  1NWW A;  5AII A;  3F7X A;  5CF2 A;  4HZB B;  2YFL B;  2BNG A;  5HGR A;  4STD A;  4WYK B;  1W6Y A;  1Z1S A;  3KKG A;  4HM2 B;  4HM1 B;  1DMQ A;  4XBT A;  1JKG B;  6STD A;  3KE7 A;  2HMN B;  4X2H A;  4HM5 B;  1W02 A;  3FSD A;  4LGQ A;  3NHX A;  4XB5 A;  5JPU A;  3LZA A;  3BLZ A;  5IG0 A;  2RFR A;  4ORL A;  4WP5 A;  1O7G B;  3JUN A;  3EN8 A;  2YFI B;  4XDV A;  4K1U A;  2I9W A;  3HX8 A;  3JUM A;  5IG3 A;  1ULI B;  3D9R A;  3MYT A;  3T8U A;  1OHO A;  3HZP A;  3FGY A;  3OV4 A;  5IG5 A;  1JB4 A;  2B1X B;  5KP3 A;  1GY5 A;  2GEY A;  5IEP A;  3F7S A;  4U13 A;  1O7M B;  1Q40 A;  4OVM A;  5CXO A;  5DRV A;  1OHS A;  3ROB A;  1OGZ A;  2W2C A;  3OX9 A;  1CQS A;  1AR0 A;  1VZZ A;  1DMM A;  3IPT A;  4J8T A;  1BUQ A;  2XSO B;  4R1K A;  2YFJ B;  1O7H B;  1Q40 B;  1ULJ B;  4XM4 A;  3MG2 A;  3F40 A;  3B8L A;  2GEX A;  4HM7 B;  3NV0 A;  1E97 A;  2BMQ B;  3NXJ A;  4I4K A;  2XRX B;  2UX0 A;  3ER7 A;  1TUH A;  2QIY A;  3E99 A;  1EA2 A;  3CU3 A;  5G2G A;  3SOY A;  1JB2 A;  5CF1 A;  1O7N B;  3UJM A;  3RGR A;  3HK4 A;  5BVB A;  5IER A;  8CHO A;  2XR8 B;  3Q90 A;  1EG9 B;  3MG1 A;  4FCJ A;  1OUN A;  1OF5 A;  5FW5 A;  3LYG A;  4LMI A;  1UUW B;  1Q42 A;  1UUV B;  4XBX A;  4IIA A;  1ZO2 A;  3GRD A;  4HM0 B;  3EBY A;  3T8N A;  4XDW A;  1OF5 B;  4X2O A;  2JQ5 A;  2B24 B;  1OCV A;  2RGQ A;  4K1V A;  3F8X A;  3CNM A;  3F9S A;  3FH1 A;  3EF8 A;  2Z7A A;  3KSP A;  3OWU A;  4H3U A;  2BMR B;  4GB5 A;  1NU3 A;  1O7P B;  3GWR A;  3BB9 A;  3EN1 B;  3EC9 A;  4RZM A;  5IEN A;  3H51 A;  3FLJ A;  3K7C A;  5IG4 A;  3GZX B;  2F99 A;  3DM8 A;  2CKF B;  3VSY A;  1IDP A;  3DXO A;  1W00 A;  3FZW A;  2BMO B;  1A2K A;  2R4I A;  2IMJ A;  2QGU A;  1SJW A;  5BXQ A;  2INX A;  4OUQ A;  3F14 A;  3NUV A;  3WMD A;  1WQL B;  5AI1 A;  3B4P A;  4FCM A;  1QJG A;  4KVH A;  3I0Y A;  3K0Z A;  3JUO A;  3G0K A;  1JB5 A;  3NBR A;  4L8O A;  1ZX2 A;  1S5A A;  2STD A;  1OH0 A;  3MHE A;  3EQQ B;  3H3H A;  1E3R A;  4HM8 B;  1STD A;  4CDL A;  3JUQ A;  5IF6 A;  1U5O A;  1GYB A;  2HMM B;  1E3V A;  2GBW B;  3FKA A;  4L8P A;  1JN5 B;  5AIH A;  1NDO B;  3DZL A;  3G8Z A;  3B4O A;  5AEU B;  3A76 A;  1TP6 A;  1GY7 A;  3DUK A;  1DMN A;  2HMO B;  3GZY B;  4PEJ A;  2A15 A;  3JUP A;  3S5C A;  5STD A;  3VGN A;  2Z77 A;  5AIG A;  2F98 A;  3GZB A;  3KZT A;  4L7K A;  4J9A A;  3FF2 A;  3EHC A;  1ASK A;  7STD A;  4MJD A;  1HKX A;  3B7C A;  1OPY A;  1QMA A;  4HZ9 B;  3MKI A;  3MSO A;  3NM2 A;  3SOA A;  5KP4 A;  3FF0 A;  1ISK A;  4R9L A;  3F8H A;  3RGA A;  5AEW B;  5DRE A;  1GY6 A;  3G16 A;  3SED A;  3OWS A;  4HKV B;  5D82 A;  3CPO A;  2RCD A;  3ECF A;  2Z76 A;  2CHC A;  4HJL B;  5KP1 A;  2PZV A;  3EJV A;  4WWU C;  2K54 A;  5D83 A;  1K41 A;  2HMJ B;  3OWY A;  1C7H A;  3UNL A;  1O7W B;  4HM6 B;  5D81 A;  1JN5 A;  2F86 B;  5AIF A;  4Q53 A;  3OXA A;  1W01 A;  4R9K A;  4HM4 B;  3GZR A;  1OGX A;  4HM3 B;  5JPP A;  1GS3 A; 
#chains in the Genus database with same CATH topology
 3STD A;  1BNE A;  3LTC A;  5EVH A;  2HML B;  1MWR A;  1B20 A;  1GD4 A;  3DMC A;  3CNX A;  1TFK A;  3SLU A;  3MG3 A;  4WYK A;  2HMK B;  5M18 A;  1VQM 3;  4XBY A;  3EBT A;  3CD6 3;  2OWP A;  3S27 A;  1N8Q A;  1FGR A;  4EBG A;  2GBX B;  5BU4 A;  1JZD A;  4MMY B;  3D3L A;  1PYL A;  7GSP A;  1BNJ A;  5IEO A;  1YIT 3;  3LH4 A;  3M8C A;  3NV0 B;  2GXF A;  4LEH A;  4HVN A;  4RBN A;  5CLK A;  4NPB A;  5TGN A;  1M9G A;  4N3V A;  1JKG A;  1OHP A;  4O2H A;  1BSD A;  1ZS7 A;  2XFS A;  5CK6 A;  1DVC A;  2XSH B;  3X41 A;  3DH2 A;  3EX9 A;  3LT9 A;  4IT7 A;  4FMD A;  1I3I A;  1RHL A;  1NWW A;  1FUT A;  2C11 A;  2JDI H;  5AII A;  3F7X A;  4R80 A;  5CF2 A;  2W9Q A;  4HZB B;  4O3V A;  2YFL B;  2BNG A;  5HGR A;  1VQK 3;  2E2V A;  4STD A;  4WYK B;  1W6Y A;  4O02 B;  4EV2 A;  2OQE C;  1Z1S A;  3JVC A;  3KKG A;  3G71 3;  3BNE A;  2KXG A;  1MOL A;  1W6C A;  4HM2 B;  4HM1 B;  3WOE B;  1IK3 A;  1GOU A;  2W03 A;  1BSB A;  1DMQ A;  3LOY A;  3BND A;  2P38 A;  1BVI A;  1QAL A;  2J8X B;  3DY5 A;  1FZU A;  1I2G A;  1YVB I;  4LYL B;  4XBT A;  4RNT A;  1JKG B;  6STD A;  3KE7 A;  3WHO A;  2HMN B;  4X2H A;  4HM5 B;  1W02 A;  2GU3 A;  3FSD A;  2KAA A;  3HI7 A;  1BOX A;  2O9U X;  4LGQ A;  1BNI A;  3DGO A;  3O8Y A;  3NHX A;  1WMO A;  2GU1 A;  4XB5 A;  5JPU A;  1M1K 4;  1EUI C;  4DKI A;  3LZA A;  3LML A;  3BLZ A;  1Q82 4;  2CW9 A;  5IG0 A;  2ZDJ A;  1GD3 A;  4MEI A;  3K63 A;  2RFR A;  1NO3 A;  4ORL A;  4WP5 A;  3V92 A;  4BTY A;  1O7G B;  1Q86 4;  1VQ4 3;  4WFO A;  1QVG 2;  3AHS A;  3JUN A;  3EN8 A;  1NNV A;  2YFI B;  1JV2 B;  1FGO A;  4XDV A;  4K1U A;  4EC6 A;  1LNH A;  1IQ8 A;  2I9W A;  3HX8 A;  3JUM A;  1ULI B;  3D9R A;  5IG3 A;  3MYT A;  2Y74 A;  5GSP A;  1LOX A;  4N6U A;  3T8U A;  1DE3 A;  1OHO A;  2CFD A;  1IV7 A;  3HZP A;  3CMA 3;  3FGY A;  3Q1C A;  2IY2 A;  4GSP A;  1BRI A;  2ZHX B;  3OV4 A;  3ZFZ A;  4LZI A;  1IT8 A;  1UCL A;  4MMZ B;  5IG5 A;  1MWS A;  4RNZ A;  1B3S A;  1JB4 A;  2B1X B;  5KP3 A;  1KSI A;  1BRG A;  1TU5 A;  1BSC A;  3CCV 3;  1GY5 A;  1BGS A;  2YX9 A;  1IVV A;  1N8R 4;  3G6E 3;  2GEY A;  2HOH A;  2W04 A;  5HOH A;  1IV9 A;  5IEP A;  2OCT A;  1IYY A;  1WMP A;  3F7S A;  4AKY A;  4U13 A;  1O7M B;  5ELJ A;  4CJN A;  1Q40 A;  1K73 4;  4OVM A;  1G96 A;  5CXO A;  5DRV A;  3OW2 2;  2MF7 A;  1OHS A;  4FMC A;  3ROB A;  3GSP A;  1SQW A;  3MWZ A;  1A2V A;  1B21 A;  3D5I A;  1OGZ A;  2W2C A;  1N5H A;  3OX9 A;  2ML6 A;  3KII A;  1CQS A;  3CCJ 3;  5I97 A;  3PGB A;  1YGE A;  1AR0 A;  1KQS 2;  3V98 A;  1W5Z A;  3GAX A;  1VZZ A;  3SVA A;  1KC8 4;  1DMM A;  2LYX A;  1US1 A;  3IPT A;  1B2X A;  4J8T A;  4BIR A;  3K5T A;  2XSO B;  1K8A 4;  3KN4 A;  1BUQ A;  2WOH A;  4R1K A;  2YFJ B;  3NBJ A;  2W56 A;  1O7H B;  1AQZ A;  1R4Y A;  1Q40 B;  1ULJ B;  2E2T A;  4XM4 A;  3MG2 A;  2IUK A;  3F40 A;  3B8L A;  2GEX A;  4HM7 B;  1EKM A;  3NV0 A;  1IQX A;  1W2Z A;  1E97 A;  4IPB A;  1PFP A;  4TX4 A;  2BMQ B;  1R4C A;  1QAK A;  2WGO A;  3FG1 A;  3NXJ A;  1VQ5 3;  1DVD A;  4I4K A;  2XRX B;  1YJN 3;  2UX0 A;  2RBI A;  5LC6 A;  1D6Y A;  3ER7 A;  1M90 4;  1I0V A;  1TUH A;  2QIY A;  3E99 A;  1EA2 A;  2P05 A;  4OK0 A;  1YIJ 3;  1JBT A;  1FGQ A;  3UL6 A;  3CU3 A;  3AMO A;  2W56 B;  1TRP A;  3LT8 A;  1LRA A;  5G2G A;  1BSE A;  1JB2 A;  1LOW A;  3SOY A;  3CCE 3;  3U97 A;  5RNT A;  5CF1 A;  1O7N B;  3SYU A;  3UJM A;  4AEQ A;  1BRN L;  4QWT A;  1HYF A;  1N5P A;  3RGR A;  3HK4 A;  5BVB A;  5IER A;  1BNR A;  8CHO A;  2XR8 B;  3Q90 A;  1IVX A;  1EG9 B;  3MG1 A;  4FCJ A;  2L4V A;  1UI7 A;  1FUS A;  1OUN A;  1OF5 A;  1BRS A;  2BHM A;  3X3Z A;  2OOV A;  4FCZ A;  5FW5 A;  3L0R A;  1UCK A;  4FMA A;  1N9J A;  3LYG A;  2XH9 A;  4G1M B;  4HAA A;  4LMI A;  1D6Z A;  2V1L A;  1V58 A;  3AMO B;  1UUW B;  1LQG C;  1GMR A;  1Q42 A;  1UUV B;  2IYJ A;  2ZL8 A;  4XBX A;  3Q3F A;  4IIA A;  4J5G A;  1BNG A;  1ZO2 A;  5LC7 A;  2IUJ A;  3GRD A;  1TIJ A;  1RMS A;  1WMN A;  4HM0 B;  4HOH A;  1FW7 A;  3S29 A;  1MWU A;  3BU4 A;  1A67 A;  2P0M A;  4FR9 A;  1T3B A;  4BTX A;  3EBY A;  1IT7 A;  3T8N A;  4XDW A;  1OF5 B;  2CG0 A;  4X2O A;  1SAR A;  1TFO A;  2QEX 3;  2JQ5 A;  1JBS A;  2B24 B;  1OCV A;  3PCR A;  2ZA4 A;  2RGQ A;  2CC3 A;  4K1V A;  5G1K A;  1IVW A;  1FUW A;  1L5G B;  3VF1 A;  3F8X A;  2BT3 A;  3N54 B;  1U8C B;  1HZ1 A;  1UUG B;  3CNM A;  3WOD G;  2BO9 B;  3F9S A;  3FH1 A;  3ZG0 A;  1UCI A;  3EF8 A;  2Z7A A;  3PCS A;  1FGT A;  2SAR A;  5G1L A;  2K0M A;  2FGT A;  3KSP A;  3CCU 3;  3RNT A;  3OWU A;  1UCJ A;  4H3U A;  1YHQ 3;  2SBL A;  3RDE A;  2BMR B;  1LOV A;  4GB5 A;  3WOF B;  1B2M A;  1NU3 A;  1O7P B;  3GWR A;  3U1W A;  1GMP A;  3BB9 A;  5EEO A;  1RN4 A;  2CFW A;  3EN1 B;  1A90 A;  3EC9 A;  5IG4 A;  4RZM A;  5IEN A;  3CCS 3;  4EW5 A;  3H51 A;  3NM7 A;  1JRQ A;  1X1W A;  1RGF A;  2RNT A;  2W6J H;  3FLJ A;  3GZX B;  2F99 A;  3K7C A;  3PYJ A;  1UGI A;  2BIR A;  4GHO A;  1Y4K A;  3UL5 A;  1Q81 4;  3DM8 A;  2CX0 A;  2CKF B;  5BIR A;  1RCL A;  5M1A A;  1PY3 A;  4JF8 A;  2AAD A;  3VSY A;  1YJW 3;  1FYS A;  1IDP A;  1SII A;  3DXO A;  3BNC A;  1W00 A;  5IW9 A;  1YI2 3;  2W0Q A;  2P09 A;  3CCL 3;  1RDS A;  2UUG C;  2XGN A;  3FZW A;  1TJD A;  2BMO B;  2CX1 A;  2RSX A;  1A2K A;  2R4I A;  2IMJ A;  5JBS A;  2QGU A;  4KFD A;  1EQK A;  1SJW A;  3D4A A;  3PXM A;  5BXQ A;  1RTU A;  4H61 A;  3LTA A;  3QK9 A;  2INX A;  1IQY A;  4OUQ A;  3F14 A;  3NX0 A;  2CWV A;  3NUV A;  1RN1 A;  1ZGX A;  3WMD A;  4KZ1 A;  3HIG A;  4AKZ A;  2C4B A;  3V99 A;  3CC7 3;  1WQL B;  1ROV A;  5AYS C;  1LNI A;  1RRL A;  2H0G A;  2ML5 A;  5AI1 A;  3ZG5 A;  3HOH A;  1WTH A;  2CIU A;  3B4P A;  3IJE B;  4FCM A;  1QJG A;  3SXX A;  2D42 A;  4N6V 0;  4KT3 B;  1RGC A;  4KVH A;  1G02 A;  1BAO A;  1BRK A;  1BSA A;  3X42 A;  1I70 A;  3I0Y A;  3K0Z A;  1AY7 A;  3JUO A;  4ZM8 A;  3G0K A;  1JB5 A;  3NBR A;  4L8O A;  1JZO A;  1YNV X;  5M19 A;  1RNT A;  1SPU A;  1ZX2 A;  1S5A A;  2Q07 A;  1J2B A;  3N8B A;  4GL6 A;  3S67 A;  1X1Y A;  2STD A;  3J7Y d;  1OH0 A;  2CFL A;  3TDG A;  2W9P A;  4EYC A;  1Q7Y 4;  3MHE A;  3EQQ B;  3H3H A;  3I56 3;  3CXC 2;  1LXE A;  3FG3 A;  2F5M A;  2KF5 A;  1X1U A;  1E3R A;  3NBB A;  2KF3 A;  1RLS A;  1BNF A;  4HM8 B;  2OQE A;  3UB1 A;  4I5Q A;  1Q7H A;  1STD A;  1KD1 4;  1BUJ A;  3D5G A;  1GOY A;  1FA3 A;  4HYZ A;  4ILF A;  4CCV A;  1RGE A;  3KCH A;  1VQ8 3;  3NQY A;  1C54 A;  4CDL A;  3FG4 A;  1Q9E A;  3JUQ A;  3AHW A;  1T2I A;  5IF6 A;  1RGL A;  1U5O A;  2OTJ 3;  2XGL A;  1BIR A;  1CYU A;  1GYB A;  3AGN A;  1VQL 3;  1F8N A;  2HMM B;  1K28 A;  1UI8 A;  3WR2 A;  6RNT A;  1NB5 I;  2O3O A;  7RNT A;  3CC2 3;  1GMQ A;  1E3V A;  2C10 A;  3FCS B;  1CEW I;  2FXT A;  2MC8 A;  2GBW B;  1LQM B;  3FKA A;  1A2P A;  4L8P A;  2F4Y A;  4K61 A;  2QA4 3;  1JN5 B;  1RGA A;  2XF3 A;  4BL2 A;  5AIH A;  4BU4 A;  1NDO B;  2WOF A;  1B2U A;  1AV4 A;  4N6T A;  3CME 3;  1RGG A;  3DZL A;  3G8Z A;  4N6M A;  3QRD A;  2D1W A;  3B4O A;  5AEU B;  1VQQ A;  3SX1 A;  3A76 A;  3X3Y A;  1TP6 A;  1VQ6 3;  3LTB A;  1GY7 A;  1BRJ A;  2CWU A;  3URP A;  6GSP A;  3DUK A;  1DMN A;  5A0O B;  1MGR A;  4LSO A;  2HMO B;  3X3X A;  3PS8 A;  1JBR A;  3GZY B;  1CH0 A;  4PEJ A;  2A15 A;  2KF6 A;  1NB3 I;  3JUP A;  4J5K A;  5FGO A;  1FGM A;  3S5C A;  5STD A;  4KFE A;  1S72 3;  3PZW A;  1UDI I;  3VGN A;  1YJ9 3;  2Z77 A;  3S28 A;  5AIG A;  1AVK A;  2KCD A;  2XEP A;  3DGY A;  3K9M C;  4N6O B;  2CH9 A;  3CPW 2;  2F98 A;  1T2H A;  3GZB A;  4FMB A;  1BU4 A;  3KZT A;  4L7K A;  4J9A A;  1W2B 2;  2M7O A;  2CK3 H;  1LOY A;  3CCQ 3;  1BRH A;  3EE1 A;  5AYR B;  8RNT A;  3FF2 A;  1EEJ A;  2Y73 A;  1ASK A;  3EB8 A;  2CWT A;  3EHC A;  2GSP A;  3N9H A;  4R4K A;  7STD A;  4MJD A;  1VQ9 3;  1RSN A;  2OOV C;  4NHF A;  1MWT A;  2WO0 A;  1HKX A;  1MGW A;  1DET A;  1W6G A;  3B7C A;  1AVL A;  1YGW A;  1D6U A;  2XFT A;  2H0H A;  2K3D A;  2E2U A;  1OPY A;  1QMA A;  1TTO A;  1I8V A;  1RRH A;  4HZ9 B;  3MKI A;  3MSO A;  2R41 A;  3NM2 A;  1OAC A;  1T5Y A;  3SOA A;  4EXR A;  5KP4 A;  1QVF 2;  3FF0 A;  1ISK A;  4R9L A;  3F8H A;  3RGA A;  2Z6B A;  5AEW B;  1VQO 3;  4NRE A;  5EQL A;  1GOV A;  1N9E A;  5DRE A;  1LVN A;  1GY6 A;  3G16 A;  3SED A;  1IU7 A;  1SIH A;  2UGI A;  3OWS A;  2H0I A;  3KSE D;  1VQP 3;  4BL3 A;  1QAF A;  1BAN A;  1WNH A;  4HKV B;  5D82 A;  1CYV A;  4CPK A;  1MNL A;  2P0X A;  2OTL 3;  3CPO A;  2RCD A;  3G4S 3;  3D79 A;  3CC4 3;  3LTD A;  4N6N B;  1K9M 4;  3DGN A;  1V74 A;  1W7C A;  1I2F A;  1RNB A;  3ECF A;  3I55 3;  1STF I;  3DGL A;  3ALA A;  2KRT A;  2IA7 A;  3CCR 3;  1NJI 4;  1G0T A;  1RGK A;  4KFF A;  1GSP A;  4EV5 A;  4JRF A;  1I2E A;  1IVU A;  1UW1 A;  3WA2 X;  1W4N A;  1KWI A;  1ROA A;  1BNS A;  2Z76 A;  2CHC A;  2CFG A;  1UGH I;  3BIR A;  4HJL B;  5KP1 A;  2PZV A;  1I3F A;  1VQ7 3;  3AGO A;  1JJ2 2;  3EJV A;  3WA3 A;  3KFQ C;  4WWU C;  2K54 A;  3A5E A;  4RNY A;  1M1X B;  3HII A;  2PNC A;  2F56 A;  4MMX B;  1RCK A;  5D83 A;  1K41 A;  2HMJ B;  1V57 A;  1PU4 A;  4K90 B;  1B2Z A;  4BTW A;  3CCM 3;  1RN7 A;  1TRQ A;  2LQV A;  2F5W A;  3OWY A;  1X1X A;  1C7H A;  3DGM A;  3T0U A;  1O7W B;  3UNL A;  1JNQ A;  3WDG B;  4HM6 B;  4N6L A;  1YVS A;  1JN5 A;  2F86 B;  4WHA A;  5D81 A;  5ELU A;  1DYU A;  3IMA B;  3Q2P A;  1RGH A;  3MPH A;  3X40 A;  2FNQ A;  1RJO A;  4HBR A;  5AIF A;  2CFK A;  3OXA A;  1W01 A;  4Q53 A;  3LXU X;  4R9K A;  1HU9 A;  3BNB A;  4HM4 B;  1B2S A;  2AAE A;  2WGQ A;  3GZR A;  9RNT A;  1VQN 3;  1B27 A;  2L1S A;  1RKY A;  2BU4 A;  3NQZ A;  1OGX A;  4HM3 B;  2CG1 A;  4O8S A;  1I0X A;  2KF4 A;  5JPP A;  1GS3 A; 
#chains in the Genus database with same CATH homology
 3STD A;  3LTC A;  5EVH A;  2HML B;  1GD4 A;  3DMC A;  3CNX A;  1TFK A;  3SLU A;  3MG3 A;  4WYK A;  2HMK B;  1VQM 3;  3CD6 3;  4XBY A;  3EBT A;  2OWP A;  3S27 A;  1N8Q A;  1FGR A;  4EBG A;  2GBX B;  4MMY B;  3D3L A;  1YIT 3;  5IEO A;  3LH4 A;  3M8C A;  3NV0 B;  2GXF A;  4LEH A;  4HVN A;  4RBN A;  5CLK A;  5TGN A;  1M9G A;  4N3V A;  1JKG A;  1OHP A;  4O2H A;  5CK6 A;  2XFS A;  1DVC A;  2XSH B;  3X41 A;  3EX9 A;  3LT9 A;  4IT7 A;  4FMD A;  2C11 A;  1NWW A;  5AII A;  2JDI H;  3F7X A;  4R80 A;  5CF2 A;  2W9Q A;  4HZB B;  4O3V A;  2YFL B;  2BNG A;  5HGR A;  1VQK 3;  2E2V A;  4STD A;  4WYK B;  1W6Y A;  4O02 B;  4EV2 A;  2OQE C;  1Z1S A;  3JVC A;  3KKG A;  3G71 3;  3BNE A;  2KXG A;  1MOL A;  1W6C A;  4HM2 B;  4HM1 B;  3WOE B;  1IK3 A;  2W03 A;  1DMQ A;  3LOY A;  3BND A;  2P38 A;  1QAL A;  3DY5 A;  1YVB I;  4XBT A;  1JKG B;  6STD A;  3KE7 A;  2HMN B;  4X2H A;  4HM5 B;  1W02 A;  2GU3 A;  3FSD A;  3HI7 A;  2O9U X;  4LGQ A;  3DGO A;  3O8Y A;  3NHX A;  1WMO A;  2GU1 A;  4XB5 A;  5JPU A;  1M1K 4;  3LZA A;  3LML A;  3BLZ A;  1Q82 4;  2CW9 A;  5IG0 A;  2ZDJ A;  1GD3 A;  4MEI A;  3K63 A;  2RFR A;  1NO3 A;  4ORL A;  4WP5 A;  3V92 A;  4BTY A;  1O7G B;  1Q86 4;  1VQ4 3;  4WFO A;  1QVG 2;  3JUN A;  3EN8 A;  2YFI B;  1JV2 B;  1FGO A;  4XDV A;  4K1U A;  4EC6 A;  1LNH A;  1IQ8 A;  2I9W A;  3HX8 A;  3JUM A;  1ULI B;  3D9R A;  5IG3 A;  3MYT A;  2Y74 A;  1LOX A;  4N6U A;  3T8U A;  1OHO A;  2CFD A;  1IV7 A;  3HZP A;  3CMA 3;  3FGY A;  3Q1C A;  3OV4 A;  4LZI A;  1IT8 A;  4MMZ B;  5IG5 A;  4RNZ A;  1JB4 A;  2B1X B;  5KP3 A;  1KSI A;  1TU5 A;  3CCV 3;  1GY5 A;  2YX9 A;  1IVV A;  1N8R 4;  3G6E 3;  2GEY A;  2W04 A;  1IV9 A;  5IEP A;  2OCT A;  1WMP A;  3F7S A;  4AKY A;  4U13 A;  1O7M B;  5ELJ A;  1Q40 A;  1K73 4;  4OVM A;  1G96 A;  5CXO A;  5DRV A;  3OW2 2;  2MF7 A;  1OHS A;  4FMC A;  3ROB A;  1SQW A;  3MWZ A;  1A2V A;  1OGZ A;  2W2C A;  1N5H A;  3OX9 A;  2ML6 A;  3KII A;  1CQS A;  3CCJ 3;  5I97 A;  3PGB A;  1YGE A;  1AR0 A;  1KQS 2;  3V98 A;  1W5Z A;  3GAX A;  1VZZ A;  3SVA A;  1KC8 4;  1DMM A;  2LYX A;  1US1 A;  3IPT A;  4J8T A;  1K8A 4;  1BUQ A;  3K5T A;  2XSO B;  3KN4 A;  2WOH A;  4R1K A;  2YFJ B;  3NBJ A;  2W56 A;  1O7H B;  1Q40 B;  1ULJ B;  2E2T A;  4XM4 A;  3MG2 A;  2IUK A;  3F40 A;  3B8L A;  2GEX A;  4HM7 B;  1EKM A;  3NV0 A;  1IQX A;  1W2Z A;  1E97 A;  4IPB A;  1PFP A;  4TX4 A;  2BMQ B;  1R4C A;  1QAK A;  2WGO A;  3FG1 A;  3NXJ A;  1VQ5 3;  1DVD A;  4I4K A;  2XRX B;  1YJN 3;  2UX0 A;  5LC6 A;  1D6Y A;  3ER7 A;  1M90 4;  1TUH A;  2QIY A;  3E99 A;  1EA2 A;  2P05 A;  4OK0 A;  1YIJ 3;  1FGQ A;  3UL6 A;  3CU3 A;  3AMO A;  2W56 B;  3LT8 A;  3CCE 3;  5G2G A;  1JB2 A;  3SOY A;  3U97 A;  5CF1 A;  1O7N B;  3UJM A;  4AEQ A;  4QWT A;  1N5P A;  3RGR A;  3HK4 A;  5BVB A;  5IER A;  8CHO A;  2XR8 B;  3Q90 A;  1IVX A;  1EG9 B;  3MG1 A;  4FCJ A;  2L4V A;  1UI7 A;  1OUN A;  1OF5 A;  2BHM A;  3X3Z A;  2OOV A;  4FCZ A;  5FW5 A;  3L0R A;  4FMA A;  1N9J A;  3LYG A;  2XH9 A;  4G1M B;  4LMI A;  1D6Z A;  2V1L A;  3AMO B;  1UUW B;  1Q42 A;  1UUV B;  2ZL8 A;  4XBX A;  4IIA A;  1ZO2 A;  2IUJ A;  5LC7 A;  3GRD A;  1TIJ A;  1WMN A;  4HM0 B;  3S29 A;  1A67 A;  2P0M A;  4FR9 A;  4BTX A;  3EBY A;  1IT7 A;  3T8N A;  4XDW A;  1OF5 B;  2CG0 A;  4X2O A;  1TFO A;  2QEX 3;  2JQ5 A;  2B24 B;  1OCV A;  3PCR A;  2RGQ A;  2CC3 A;  4K1V A;  1IVW A;  1FUW A;  1L5G B;  3VF1 A;  3F8X A;  2BT3 A;  3N54 B;  1U8C B;  3CNM A;  3WOD G;  2BO9 B;  3F9S A;  3FH1 A;  3EF8 A;  2Z7A A;  3PCS A;  1FGT A;  2K0M A;  2FGT A;  3KSP A;  3CCU 3;  3OWU A;  4H3U A;  1YHQ 3;  2SBL A;  3RDE A;  2BMR B;  4GB5 A;  3WOF B;  1NU3 A;  1O7P B;  3GWR A;  3U1W A;  3BB9 A;  5EEO A;  2CFW A;  3EN1 B;  1A90 A;  3EC9 A;  4RZM A;  5IEN A;  3CCS 3;  3H51 A;  3NM7 A;  1JRQ A;  3FLJ A;  3K7C A;  5IG4 A;  2W6J H;  3GZX B;  3CCL 3;  2F99 A;  3PYJ A;  3UL5 A;  1Y4K A;  1Q81 4;  3DM8 A;  2CKF B;  3VSY A;  1YJW 3;  4JF8 A;  1IDP A;  1SII A;  3DXO A;  3BNC A;  1W00 A;  5IW9 A;  1YI2 3;  2W0Q A;  2P09 A;  2XGN A;  3FZW A;  5JBS A;  2BMO B;  2RSX A;  1A2K A;  2R4I A;  2IMJ A;  2QGU A;  4KFD A;  1EQK A;  1SJW A;  3PXM A;  5BXQ A;  4H61 A;  3LTA A;  3QK9 A;  2INX A;  1IQY A;  4OUQ A;  3F14 A;  3NX0 A;  2CWV A;  3NUV A;  3WMD A;  4KZ1 A;  3HIG A;  4AKZ A;  3V99 A;  3CC7 3;  1WQL B;  1ROV A;  5AYS C;  1RRL A;  2ML5 A;  5AI1 A;  1WTH A;  2CIU A;  3B4P A;  3IJE B;  4FCM A;  1QJG A;  3SXX A;  2D42 A;  4N6V 0;  4KVH A;  3X42 A;  3I0Y A;  3K0Z A;  3JUO A;  4ZM8 A;  3G0K A;  1JB5 A;  3NBR A;  4L8O A;  1SPU A;  1ZX2 A;  1S5A A;  2Q07 A;  1J2B A;  3N8B A;  4GL6 A;  3S67 A;  2STD A;  3J7Y d;  1OH0 A;  2CFL A;  3TDG A;  2W9P A;  4EYC A;  1Q7Y 4;  3MHE A;  3EQQ B;  3H3H A;  3I56 3;  3CXC 2;  1LXE A;  3FG3 A;  1E3R A;  3NBB A;  4HM8 B;  3UB1 A;  2OQE A;  1STD A;  1KD1 4;  1FA3 A;  4HYZ A;  4CCV A;  1VQ8 3;  3NQY A;  4CDL A;  3FG4 A;  3JUQ A;  5IF6 A;  2OTJ 3;  1U5O A;  2XGL A;  1CYU A;  1GYB A;  1VQL 3;  1F8N A;  2HMM B;  1K28 A;  1UI8 A;  1NB5 I;  2O3O A;  3CC2 3;  1E3V A;  2C10 A;  3FCS B;  1CEW I;  2FXT A;  2MC8 A;  2GBW B;  3FKA A;  4L8P A;  4K61 A;  2QA4 3;  1JN5 B;  2XF3 A;  5AIH A;  1NDO B;  2WOF A;  1AV4 A;  4N6T A;  3CME 3;  3DZL A;  3G8Z A;  4N6M A;  3QRD A;  2D1W A;  3B4O A;  5AEU B;  3SX1 A;  3A76 A;  3X3Y A;  1TP6 A;  1VQ6 3;  3LTB A;  1GY7 A;  2CWU A;  3DUK A;  1DMN A;  5A0O B;  4LSO A;  2HMO B;  3X3X A;  3PS8 A;  3GZY B;  4PEJ A;  2A15 A;  1NB3 I;  3JUP A;  5FGO A;  1FGM A;  3S5C A;  5STD A;  4KFE A;  1S72 3;  3PZW A;  3VGN A;  1YJ9 3;  2Z77 A;  3S28 A;  5AIG A;  1AVK A;  2KCD A;  2XEP A;  3K9M C;  4N6O B;  2CH9 A;  3CPW 2;  2F98 A;  3GZB A;  4FMB A;  3KZT A;  4L7K A;  4J9A A;  1W2B 2;  2M7O A;  2CK3 H;  3CCQ 3;  3EE1 A;  5AYR B;  3FF2 A;  2Y73 A;  3EHC A;  1ASK A;  3EB8 A;  2CWT A;  3N9H A;  4R4K A;  7STD A;  4MJD A;  1VQ9 3;  2OOV C;  4NHF A;  2WO0 A;  1HKX A;  1W6G A;  3B7C A;  1AVL A;  1D6U A;  2XFT A;  2E2U A;  1OPY A;  1QMA A;  1RRH A;  4HZ9 B;  3MKI A;  3MSO A;  3NM2 A;  1OAC A;  1T5Y A;  3SOA A;  4EXR A;  5KP4 A;  1QVF 2;  3FF0 A;  1ISK A;  4R9L A;  3F8H A;  3RGA A;  2Z6B A;  5AEW B;  1VQO 3;  4NRE A;  5EQL A;  1N9E A;  5DRE A;  1LVN A;  1GY6 A;  3G16 A;  3SED A;  1IU7 A;  1SIH A;  3OWS A;  3KSE D;  1VQP 3;  1QAF A;  1WNH A;  4HKV B;  5D82 A;  1CYV A;  1MNL A;  2P0X A;  2OTL 3;  3CPO A;  2RCD A;  3G4S 3;  3CC4 3;  3LTD A;  4N6N B;  1K9M 4;  3DGN A;  1V74 A;  1W7C A;  3ECF A;  3I55 3;  1STF I;  3DGL A;  3ALA A;  2KRT A;  2IA7 A;  3CCR 3;  1NJI 4;  4KFF A;  4EV5 A;  4JRF A;  1IVU A;  1UW1 A;  3WA2 X;  1W4N A;  1KWI A;  1ROA A;  2Z76 A;  2CHC A;  2CFG A;  4HJL B;  5KP1 A;  1VQ7 3;  2PZV A;  1JJ2 2;  3EJV A;  3WA3 A;  3KFQ C;  4WWU C;  2K54 A;  4RNY A;  1M1X B;  3HII A;  2PNC A;  4MMX B;  5D83 A;  1K41 A;  2HMJ B;  1PU4 A;  4K90 B;  4BTW A;  3CCM 3;  1RN7 A;  2LQV A;  3OWY A;  1C7H A;  3DGM A;  3T0U A;  1O7W B;  3UNL A;  1JNQ A;  3WDG B;  4HM6 B;  4N6L A;  5D81 A;  1JN5 A;  2F86 B;  4WHA A;  5ELU A;  3X40 A;  1DYU A;  3IMA B;  3Q2P A;  3MPH A;  2FNQ A;  1RJO A;  4HBR A;  5AIF A;  2CFK A;  3OXA A;  1W01 A;  4Q53 A;  3LXU X;  4R9K A;  1HU9 A;  3BNB A;  4HM4 B;  2WGQ A;  3GZR A;  1RKY A;  3NQZ A;  1OGX A;  4HM3 B;  2CG1 A;  4O8S A;  5JPP A;  1VQN 3;  1GS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...