1ZX2A

Crystal structure of yeast ubp3-associated protein bre5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
130
Chain Sequence
SMGVTVQDICFAFLQNYYERMRTDPSKLAYFYASTAELTHTNYPTVKVTGRENINKFFSRNDAKVRSLKLKLDTIDFQYTGHLHKSILIMATGEMFWTGTPVYKFCQTFILLPSSNGSTFDITNDIIRFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords UBP3-associated protein BRE5
publication title Structural basis for interaction between the Ubp3 deubiquitinating enzyme and its Bre5 cofactor
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 31
structure length 130
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1zx2A00
4PEJA 3K0ZA 5D82A 3UNLA 1E97A 4HVNA 1IDPA 1QMAA 3OWSA 2GEYA 3B4PA 3EC9A 4HM5B 3ER7A 3FZWA 3MKIA 3OX9A 5HGRA 2HMMB 3FF0A 4FCMA 3F8XA 3BB9A 4RZMA 5IG3A 1NDOB 5DREA 3EBYA 1O7PB 1VZZA 3SOYA 4HKVB 1OGXA 1W01A 4GB5A 4KVHA 3GZXB 5BVBA 3RGRA 4LEHA 1OH0A 3CPOA 4XBYA 1CQSA 1OF5B 3NV0A 4LMIA 1HKXA 2B24B 5AIGA 2HMKB 3EF8A 4ORLA 2YFJB 4HM6B 1O7GB 2STDA 1O7HB 5CLKA 5AIHA 2A15A 2F86B 2F98A 3EQQB 1E3RA 3JUQA 3T8NA 3DMCA 1JKGB 4J9AA 3CNXA 3G16A 3DUKA 3H51A 3M8CA 3FF2A 5AIIA 4OUQA 1AR0A 3CNMA 2BMRB 3MG1A 5IEOA 3OWYA 3LYGA 3MHEA 2OWPA 3JUPA 5AEWB 4L7KA 1BUQA 2RCDA 4N3VA 5FW5A 2BNGA 3NM2A 3FSDA 3S5CA 1DMMA 5IEPA 2HMNB 4HZBB 1W00A 5IENA 2CKFB 1GS3A 2UX0A 1C7HA 3KZTA 1OPYA 4L8OA 3OV4A 3B4OA 3WMDA 1DMQA 4XDWA 3MG3A 3GZBA 3SOAA 2GBXB 1JB4A 1TUHA 3DM8A 3VSYA 3GZYB 5CK6A 3NXJA 2RGQA 2QGUA 1GYBA 4HM8B 1ZO2A 3EBTA 1OGZA 3G0KA 1O7WB 2IMJA 3JUNA 2BMQB 3UJMA 5CXOA 3EN1B 1UUWB 3K7CA 4Q53A 1O7MB 3A76A 4WWUC 3Q90A 4FCJA 2W2CA 3RGAA 4WP5A 1EG9B 3DZLA 3HK4A 5D83A 1ASKA 2JQ5A 4HM1B 1OF5A 1ZX2A 4X2HA 5G2GA 5KP1A 4HM4B 5AI1A 3B8LA 2GEXA 2YFIB 1NU3A 3JUMA 1JN5B 1A2KA 3F9SA 2INXA 4K1UA 5AEUB 3GRDA 1JKGA 1W02A 2GBWB 1Q42A 5DRVA 1JB5A 1ISKA 3OXAA 3I0YA 3NHXA 3NBRA 4XBTA 4CDLA 1EA2A 2HMLB 4R9LA 2RFRA 1E3VA 4XM4A 5D81A 3D9RA 2Z7AA 1OUNA 1U5OA 3F40A 3SEDA 4HM0B 5BXQA 3E99A 4L8PA 2XRXB 5STDA 3CU3A 4HJLB 3KSPA 3IPTA 3LZAA 2GXFA 8CHOA 3NUVA 4OVMA 1W6YA 3G8ZA 7STDA 2QIYA 1Z1SA 5JPUA 2XSOB 1K41A 1JB2A 1ULJB 3FGYA 1OHSA 3MYTA 5JPPA 1WQLB 1SJWA 4K1VA 4HZ9B 2F99A 3EHCA 2YFLB 3EX9A 3GZRA 3T8UA 4HM7B 5CF2A 2B1XB 2Z77A 3F7XA 5IG4A 1ULIB 5TGNA 2XSHB 3F7SA 4J8TA 1OCVA 1Q40B 4U13A 1DMNA 2K54A 1Q40A 3F14A 2Z76A 3FH1A 4MJDA 3ECFA 3KKGA 3KE7A 3EJVA 3MG2A 1OHOA 4XBXA 1QJGA 3HX8A 2XR8B 2CHCA 1GY6A 3ROBA 4XB5A 4X2OA 3NV0B 3DXOA 1JN5A 5IERA 3EN8A 2R4IA 1OHPA 3HZPA 4XDVA 3OWUA 5IG5A 4HM2B 3H3HA 1NWWA 4I4KA 3BLZA 4STDA 1S5AA 4WYKB 4HM3B 3FKAA 3FLJA 5CF1A 1UUVB 3F8HA 4WYKA 3VGNA 1STDA 5IG0A 2BMOB 3MSOA 3STDA 6STDA 4H3UA 1GY5A 2I9WA 2PZVA 1TP6A 1GY7A 4R1KA 3JUOA 3B7CA 4LGQA 4R9KA 5EVHA 2HMJB 2HMOB 4IIAA 5AIFA 5KP3A 5KP4A 5IF6A 1O7NB 3GWRA
chains in the Genus database with same CATH superfamily
5A0OB 1EQKA 4PEJA 3K0ZA 4BTYA 2E2VA 1W7CA 3PCSA 4JF8A 4O3VA 2MF7A 1GMPA 5D82A 4O2HA 3UNLA 4WFOA 1E97A 4HVNA 1SIHA 5AYSC 1B3SA 1IDPA 1EUIC 1T3BA 1QMAA 3OWSA 2GEYA 5BU4A 1FGQA 3B4PA 3EC9A 3QK9A 1CH0A 3CME3 1HU9A 3U97A 3LOYA 4HM5B 2P0MA 1V57A 3ER7A 3FZWA 3MKIA 5I97A 3OX9A 1B2MA 5HGRA 1FUTA 3PXMA 3UB1A 2HMMB 4J5GA 3FF0A 4FCMA 3F8XA 4RNTA 3BIRA 2OOVC 2RSXA 3BB9A 1IVUA 1SIIA 3D3LA 4RZMA 1YVSA 1NDOB 5IG3A 3OW22 2KF5A 2W6JH 3ZG0A 4KFDA 4R80A 2ZA4A 3X3YA 5DREA 3ALAA 1VQ93 3EBYA 1O7PB 3Q3FA 3X41A 1VZZA 5M19A 3SOYA 2J8XB 1MGWA 4HKVB 1TU5A 1OGXA 1W01A 1WMNA 4GB5A 5ELUA 2CH9A 1TIJA 3GZXB 4KVHA 5BVBA 1IQ8A 1MNLA 3RGRA 1UDII 1BRJA 3EE1A 4LEHA 1OH0A 1QAKA 2H0IA 2XFSA 3CPOA 4IT7A 4XBYA 1V74A 1CQSA 2CFGA 1N5HA 3HIIA 7RNTA 2HOHA 3GSPA 1DETA 1OF5B 3X42A 3NV0A 4N6OB 3ZG5A 2WO0A 4LMIA 1HKXA 1W6CA 1FYSA 2B24B 3FG4A 5AIGA 2HMKB 1RGEA 3EF8A 2W56A 1BGSA 2IY2A 2YFJB 4ORLA 1I0VA 4HM6B 1O7GB 3PS8A 1B21A 1BNSA 1NNVA 2STDA 1O7HB 5CLKA 3S29A 3UL5A 1G0TA 3NBJA 5AIHA 1ROVA 4FCZA 1UCLA 2A15A 2F86B 2CWTA 2F98A 3LXUX 3EQQB 2FXTA 4FMDA 3CC43 1E3RA 3SLUA 3JUQA 2BT3A 3T8NA 1CYUA 3BNBA 3DMCA 1JKGB 2PNCA 2KAAA 4J9AA 1D6ZA 2Q07A 3CNXA 1B2UA 1IQXA 1N9EA 3PYJA 2P05A 3G16A 4K61A 2IUJA 2IA7A 1RNBA 1W6GA 3DUKA 3H51A 3M8CA 5EQLA 3SXXA 3CCM3 4NREA 3S28A 2CFKA 2K0MA 3FF2A 5AIIA 5BIRA 1RDSA 3KFQC 4OUQA 2YX9A 1FZUA 1AR0A 2AADA 3CNMA 1LXEA 4AEQA 2BMRB 1RGHA 1RTUA 3RDEA 1RHLA 2P09A 3MG1A 1G96A 3OWYA 5IEOA 1FUWA 3LYGA 3MHEA 2OWPA 1CYVA 1W2ZA 3AMOA 4QWTA 3JUPA 2SBLA 4BU4A 5AEWB 1BNIA 4RNYA 2KCDA 4KFEA 3WA3A 3I563 4L7KA 1BUQA 2XEPA 1WMPA 1B2SA 3DGNA 3LT8A 1IT8A 2RCDA 4HOHA 4N3VA 4EYCA 4EW5A 2OQEC 3CCE3 5FW5A 2L4VA 3L0RA 1TRQA 1STFI 3S27A 1M1K4 2JDIH 1IU7A 1B27A 2BNGA 2CX0A 3NM2A 1GD3A 1HZ1A 3FSDA 3S5CA 1DMMA 2W0QA 3DGYA 3UL6A 3IMAB 3V99A 5IEPA 2HMNB 1ROAA 1W00A 4HZBB 1RGGA 2CG0A 2CKFB 3HIGA 4N6UA 3ZFZA 5IENA 1RSNA 1VQL3 4FMBA 4K90B 1GS3A 2P38A 1Q9EA 2UX0A 2E2TA 1K8A4 1C7HA 4I5QA 1GOUA 4LYLB 4NPBA 3FCSB 3KZTA 1BSEA 1D6YA 1AV4A 1OPYA 1BIRA 4G1MB 1LVNA 1TJDA 4MEIA 3KN4A 4L8OA 1JJ22 3CC73 3OV4A 3WHOA 2H0HA 3B4OA 3J7Yd 3WMDA 1DMQA 1LQGC 1NJI4 2IUKA 2V1LA 3NX0A 1R4CA 1UUGB 3MG3A 4XDWA 3GZBA 1BOXA 3PZWA 3SOAA 2GBXB 1JB4A 1TUHA 2D1WA 3DM8A 3VSYA 1J2BA 3GZYB 1A2PA 4TX4A 5CK6A 1BRKA 3NXJA 1LOYA 3CCU3 2RGQA 4FR9A 4EC6A 3URPA 5FGOA 4ILFA 3Q2PA 2OTJ3 2GU1A 1DVCA 7GSPA 2QGUA 1GYBA 4HM8B 1RGKA 1ZO2A 3EBTA 1OGZA 2CW9A 3G0KA 5GSPA 1T2IA 3VF1A 5LC6A 1O7WB 1RJOA 2IMJA 4N6NB 5JBSA 5EEOA 3JUNA 2BMQB 3RNTA 3UJMA 4O02B 1MWUA 2W03A 2C11A 3AHSA 2Y73A 5CXOA 1T5YA 3AGOA 1NO3A 3EN1B 3WODG 1UUWB 1LQMB 2OTL3 9RNTA 3K7CA 1BSAA 4Q53A 1O7MB 1RN1A 4GSPA 1JZDA 1N8R4 3A76A 6GSPA 1BRNL 2FNQA 2ML5A 3LTDA 1FGRA 3IJEB 1KQS2 1UI8A 1LOWA 4WWUC 4EBGA 3Q90A 4FCJA 2WOHA 1K9M4 1BRIA 1UCKA 2W2CA 3RGAA 4WP5A 1EG9B 3DZLA 2CFLA 2CIUA 3HK4A 1JV2B 2F5WA 1IV7A 5D83A 1UCIA 2WGOA 2KF3A 1ASKA 1Q7Y4 2IYJA 2JQ5A 4HM1B 3SYUA 1OF5A 1ZX2A 4X2HA 3V92A 5G2GA 4EXRA 1OACA 5KP1A 4HM4B 3X3XA 5AI1A 1PYLA 1IVVA 3B8LA 2GEXA 3G4S3 2YFIB 1L5GB 1NU3A 3JUMA 1JN5B 1IT7A 1A2VA 1JNQA 1WNHA 2W04A 1MWRA 3O8YA 5G1LA 1A2KA 3F9SA 2XH9A 2F56A 1GMRA 2BO9B 3LTBA 1JRQA 2INXA 1YJN3 2CFWA 2KRTA 2O3OA 1BNJA 1EKMA 1YVBI 4K1UA 5AEUB 3K5TA 4GL6A 4EV2A 1LNHA 3GRDA 2CK3H 3BNCA 1IYYA 1JKGA 1W5ZA 2XF3A 1YI23 1RGFA 1W02A 3AGNA 3BNDA 3SX1A 8RNTA 2UUGC 3I553 2GBWB 1Q42A 5DRVA 2L1SA 1M904 1JB5A 3FG3A 3K63A 1ISKA 4KFFA 3HI7A 2SARA 3OXAA 2MC8A 1TTOA 3I0YA 3NHXA 3NBRA 4XBTA 4FMCA 2K3DA 4CDLA 3G713 1LOXA 1EA2A 4AKYA 4BIRA 1VQ53 4JRFA 2HMLB 1M1XB 1VQQA 1GSPA 2F4YA 4R4KA 1JZOA 1M9GA 1VQM3 1PFPA 4R9LA 1I3IA 1E3VA 2RFRA 4XM4A 5D81A 4WHAA 1VQK3 3LTAA 1YIT3 2XFTA 3CMA3 1A90A 3MWZA 4MMYB 3D9RA 2Z7AA 3T0UA 1I2EA 4HAAA 1AVKA 1PY3A 1TFKA 1OUNA 1U5OA 3F40A 4N6LA 3SEDA 4HM0B 3K9MC 3WDGB 1QALA 3E99A 5BXQA 1QVG2 2OOVA 1UCJA 4L8PA 2XRXB 5STDA 3CU3A 1GD4A 1KSIA 4HJLB 2D42A 3NBBA 1BNRA 4N6MA 1IV9A 2CWVA 1FGMA 3LH4A 3KSPA 3IPTA 3LZAA 2GXFA 3NQZA 3MPHA 4DKIA 1ZGXA 1IVWA 8CHOA 5IW9A 1BNEA 3NUVA 1SQWA 5G1KA 3LMLA 1WMOA 4OVMA 1W6YA 2RBIA 3G8ZA 4HYZA 7STDA 1TRPA 2QIYA 3WR2A 1IQYA 1Z1SA 1AQZA 5JPUA 1LOVA 2C4BA 2XSOB 1K41A 1JB2A 1ULJB 1YGWA 3FGYA 4FMAA 1VQP3 2CC3A 1OHSA 2LYXA 2BU4A 1RN7A 2OCTA 1N9JA 1DE3A 1RRHA 1Q824 4RNZA 3MYTA 4NHFA 2ZHXB 5JPPA 1UGHI 1GOVA 1C54A 1FW7A 1FGOA 1WQLB 3D5GA 3N8BA 1I2FA 1SJWA 4K1VA 4HZ9B 3FG1A 1N5PA 2E2UA 1Q814 4AKZA 1W2B2 1S723 3GAXA 1RCLA 1RGLA 3AHWA 2W9QA 2Z6BA 2F99A 1F8NA 2YFLB 3EHCA 3EX9A 3GZRA 1R4YA 4HM7B 3T8UA 5CF2A 2B1XB 1BRHA 2CG1A 2Z77A 3F7XA 4HBRA 4CCVA 1MOLA 3NQYA 5IG4A 1JBSA 1ULIB 2O9UX 5TGNA 1VQO3 1Y4KA 2XSHB 1RNTA 1FUSA 3DGOA 1BUJA 3N54B 3F7SA 4J8TA 2GSPA 1X1XA 1OCVA 1GOYA 1Q40B 1RLSA 2KF6A 3PCRA 1YHQ3 2R41A 3KCHA 4U13A 1DMNA 1US1A 4RBNA 1DYUA 3SVAA 1VQ63 2K54A 3KSED 4O8SA 1Q40A 1RCKA 1BRSA 2Z76A 3F14A 3FH1A 4OK0A 1JBTA 1RRLA 4MJDA 3JVCA 3BNEA 1U8CB 3N9HA 1CEWI 3ECFA 2QEX3 2KF4A 1A67A 2M7OA 1WTHA 4EV5A 5LC7A 4LZIA 1LNIA 3KKGA 3X40A 3CC23 1KC84 1JBRA 5M1AA 3KE7A 3CCQ3 2CX1A 1K28A 3EJVA 3MG2A 1OHOA 1AY7A 1AVLA 1RN4A 1SPUA 3DH2A 4XBXA 1QJGA 3HX8A 5M18A 2XR8B 2CHCA 2C10A 2OQEA 1IVXA 2XGLA 1GY6A 2BHMA 1BAOA 4XB5A 3ROBA 1LRAA 3BU4A 3DGMA 3NV0B 1X1WA 2CFDA 4MMZB 4X2OA 3V98A 2GU3A 1W4NA 3NM7A 5ELJA 2CWUA 1B2ZA 4H61A 4KZ1A 3DXOA 3X3ZA 3CCJ3 6RNTA 1JN5A 2XGNA 4MMXB 5IERA 1I8VA 2W56B 1TFOA 3LTCA 1RGAA 2F5MA 1YNVX 1D6UA 1ZS7A 3QRDA 3TDGA 2W9PA 4CJNA 2H0GA 3EN8A 1FGTA 3S67A 2R4IA 1VQN3 3U1WA 2BIRA 2QA43 3DGLA 1OHPA 2ZDJA 3HZPA 4LSOA 2ML6A 4XDVA 2WOFA 3OWUA 1Q864 1G02A 1SARA 1VQ43 1UW1A 1BNGA 1YJ93 1MWSA 1HYFA 1UGIA 2P0XA 5IG5A 4HM2B 1RKYA 1N8QA 1KD14 3D79A 1T2HA 3H3HA 1NWWA 4I4KA 4N6TA 3WOFB 4BL3A 3BLZA 3KIIA 4STDA 1S5AA 1X1YA 4IPBA 1BSDA 1VQ83 3Q1CA 1FA3A 1VQ73 1QVF2 4WYKB 4HM3B 1I3FA 2UGIA 3CD63 3FKAA 1GMQA 2WGQA 3FLJA 3WOEB 2KXGA 5CF1A 1NB3I 3CCV3 1UUVB 3F8HA 4N6V0 4WYKA 3VGNA 1STDA 1BNFA 5IG0A 2BMOB 1NB5I 1I2GA 5HOHA 1KWIA 5AYRB 3HOHA 1BU4A 3AMOB 3MSOA 1K734 3STDA 2FGTA 6STDA 1MWTA 1BVIA 3WA2X 3D4AA 3PGBA 1B2XA 1UI7A 4ZM8A 3CXC2 4H3UA 3CCS3 1YJW3 1GY5A 2I9WA 2AAEA 2PZVA 1QAFA 3D5IA 1TP6A 3CPW2 2ZL8A 5RNTA 1IK3A 1GY7A 4R1KA 2RNTA 1I0XA 3JUOA 4BL2A 4GHOA 4KT3B 1PU4A 3CCR3 3B7CA 4J5KA 1MGRA 3A5EA 4LGQA 1DVDA 4R9KA 5EVHA 1BSCA 1I70A 1Q7HA 1BSBA 2HMJB 3LT9A 1X1UA 2HMOB 3CCL3 4IIAA 1EEJA 5AIFA 5KP3A 3EB8A 1RGCA 1YGEA 5KP4A 1YIJ3 2Y74A 3DY5A 1BANA 5IF6A 4BTXA 4CPKA 3G6E3 1RMSA 1BRGA 1O7NB 3GWRA 1B20A 1V58A 4BTWA 2LQVA
chains in the Genus database with same CATH topology
5A0OB 1EQKA 4PEJA 3K0ZA 4BTYA 2E2VA 1W7CA 3PCSA 4JF8A 4O3VA 2MF7A 5D82A 4O2HA 3UNLA 4WFOA 1E97A 4HVNA 1SIHA 5AYSC 1IDPA 1QMAA 3OWSA 2GEYA 1FGQA 3B4PA 3EC9A 3QK9A 3CME3 1HU9A 3U97A 3LOYA 4HM5B 2P0MA 3ER7A 3FZWA 3MKIA 5I97A 3OX9A 5HGRA 3PXMA 3UB1A 2HMMB 3FF0A 4FCMA 3F8XA 2OOVC 2RSXA 3BB9A 1IVUA 1SIIA 3D3LA 4RZMA 5IG3A 1NDOB 3OW22 2W6JH 4KFDA 4R80A 3X3YA 5DREA 3ALAA 1VQ93 3EBYA 1O7PB 3X41A 1VZZA 3SOYA 4HKVB 1TU5A 1OGXA 1W01A 1WMNA 4GB5A 5ELUA 2CH9A 1TIJA 3GZXB 4KVHA 5BVBA 1IQ8A 1MNLA 3RGRA 3EE1A 4LEHA 1OH0A 1QAKA 4IT7A 2XFSA 3CPOA 4XBYA 1V74A 1CQSA 2CFGA 1N5HA 3HIIA 1OF5B 3X42A 3NV0A 4N6OB 2WO0A 4LMIA 1HKXA 1W6CA 2B24B 3FG4A 5AIGA 2HMKB 3EF8A 2W56A 4ORLA 2YFJB 4HM6B 1O7GB 3PS8A 2STDA 1O7HB 5CLKA 3S29A 3UL5A 3NBJA 5AIHA 1ROVA 4FCZA 2A15A 2F86B 2CWTA 2F98A 3LXUX 3EQQB 2FXTA 4FMDA 3CC43 1E3RA 3SLUA 3JUQA 2BT3A 3T8NA 1CYUA 3BNBA 3DMCA 1JKGB 2PNCA 4J9AA 1D6ZA 2Q07A 3CNXA 1IQXA 1N9EA 3PYJA 4K61A 2P05A 3G16A 2IUJA 2IA7A 1W6GA 3DUKA 3H51A 3M8CA 5EQLA 3SXXA 3CCM3 4NREA 3S28A 2CFKA 2K0MA 3FF2A 5AIIA 3KFQC 4OUQA 2YX9A 1AR0A 3CNMA 1LXEA 4AEQA 2BMRB 3RDEA 2P09A 3MG1A 1G96A 3OWYA 5IEOA 1FUWA 3LYGA 3MHEA 2OWPA 1CYVA 1W2ZA 3AMOA 4QWTA 3JUPA 2SBLA 5AEWB 4RNYA 2KCDA 4KFEA 3WA3A 3I563 4L7KA 1BUQA 2XEPA 1WMPA 3DGNA 4EYCA 3LT8A 1IT8A 2RCDA 3CCE3 4N3VA 2OQEC 5FW5A 2L4VA 3L0RA 1STFI 3S27A 1M1K4 2JDIH 1IU7A 2BNGA 3NM2A 1GD3A 3FSDA 3S5CA 1DMMA 2W0QA 3UL6A 3IMAB 3V99A 5IEPA 2HMNB 1ROAA 1W00A 4HZBB 5IENA 2CG0A 2CKFB 3HIGA 4N6UA 1VQL3 4FMBA 4K90B 1GS3A 2P38A 2UX0A 2E2TA 1K8A4 1C7HA 3FCSB 3KZTA 1D6YA 1AV4A 1OPYA 4G1MB 1LVNA 4MEIA 3KN4A 4L8OA 1JJ22 3CC73 3OV4A 3J7Yd 3B4OA 3WMDA 1DMQA 1NJI4 2IUKA 2V1LA 3NX0A 1R4CA 4XDWA 3MG3A 3GZBA 3PZWA 3SOAA 2GBXB 1JB4A 1TUHA 2D1WA 3DM8A 3VSYA 1J2BA 3GZYB 4TX4A 5CK6A 3NXJA 3CCU3 2RGQA 4FR9A 4EC6A 5FGOA 3Q2PA 2OTJ3 2GU1A 1DVCA 2QGUA 1GYBA 4HM8B 1ZO2A 3EBTA 1OGZA 2CW9A 3G0KA 3VF1A 5LC6A 1O7WB 1RJOA 2IMJA 4N6NB 5JBSA 5EEOA 3JUNA 2BMQB 3UJMA 4O02B 2W03A 2C11A 2Y73A 5CXOA 1T5YA 1NO3A 3EN1B 3WODG 1UUWB 2OTL3 3K7CA 4Q53A 1O7MB 1N8R4 3A76A 2FNQA 2ML5A 3LTDA 1FGRA 3IJEB 1KQS2 1UI8A 4WWUC 4EBGA 3Q90A 4FCJA 2WOHA 1K9M4 2W2CA 3RGAA 4WP5A 1EG9B 3DZLA 2CFLA 2CIUA 3HK4A 1JV2B 5D83A 1IV7A 2WGOA 1ASKA 1Q7Y4 2JQ5A 4HM1B 1OF5A 1ZX2A 4X2HA 3V92A 5G2GA 4EXRA 1OACA 5KP1A 4HM4B 3X3XA 5AI1A 1IVVA 3B8LA 2GEXA 3G4S3 2YFIB 1L5GB 1NU3A 3JUMA 1JN5B 1IT7A 1A2VA 1JNQA 1WNHA 2W04A 3O8YA 1A2KA 3F9SA 2XH9A 2BO9B 3LTBA 1JRQA 2INXA 1YJN3 2CFWA 2KRTA 2O3OA 1EKMA 4K1UA 1YVBI 5AEUB 3K5TA 4GL6A 4EV2A 1LNHA 3GRDA 2CK3H 3BNCA 1JKGA 1W5ZA 2XF3A 1YI23 1W02A 3BNDA 3SX1A 3I553 2GBWB 1Q42A 5DRVA 1M904 1JB5A 3FG3A 3K63A 1ISKA 4KFFA 3HI7A 3OXAA 2MC8A 3I0YA 3NHXA 3NBRA 4XBTA 4FMCA 4CDLA 3G713 1LOXA 1EA2A 4AKYA 1VQ53 4JRFA 2HMLB 1M1XB 4R4KA 1M9GA 1VQM3 1PFPA 4R9LA 2RFRA 1E3VA 4XM4A 5D81A 1VQK3 4WHAA 1YIT3 3LTAA 3CMA3 2XFTA 1A90A 3MWZA 4MMYB 3D9RA 2Z7AA 3T0UA 1AVKA 1TFKA 1OUNA 1U5OA 3F40A 4N6LA 3SEDA 4HM0B 3K9MC 3WDGB 1QALA 3E99A 5BXQA 1QVG2 2OOVA 4L8PA 2XRXB 5STDA 3CU3A 1GD4A 1KSIA 4HJLB 2D42A 3NBBA 4N6MA 1IV9A 2CWVA 1FGMA 3LH4A 3KSPA 3IPTA 3LZAA 2GXFA 3NQZA 3MPHA 8CHOA 5IW9A 1IVWA 3NUVA 1SQWA 3LMLA 1WMOA 4OVMA 1W6YA 3G8ZA 4HYZA 7STDA 2QIYA 1IQYA 1Z1SA 5JPUA 2XSOB 1K41A 1JB2A 1ULJB 3FGYA 4FMAA 1VQP3 2CC3A 1OHSA 2LYXA 1RN7A 2OCTA 1N9JA 1RRHA 1Q824 4RNZA 3MYTA 4NHFA 5JPPA 1FGOA 1WQLB 3N8BA 1SJWA 4K1VA 4HZ9B 3FG1A 1N5PA 2E2UA 1Q814 4AKZA 1W2B2 1S723 3GAXA 2W9QA 2Z6BA 2F99A 1F8NA 2YFLB 3EHCA 3EX9A 3GZRA 4HM7B 3T8UA 5CF2A 2B1XB 2CG1A 2Z77A 3F7XA 4HBRA 4CCVA 1MOLA 3NQYA 5IG4A 1ULIB 2O9UX 5TGNA 1VQO3 1Y4KA 2XSHB 3DGOA 3N54B 3F7SA 4J8TA 1OCVA 3PCRA 1Q40B 1YHQ3 4U13A 1DMNA 1US1A 4RBNA 1DYUA 3SVAA 1VQ63 2K54A 3KSED 4O8SA 1Q40A 4OK0A 3F14A 2Z76A 3FH1A 1RRLA 4MJDA 3JVCA 3BNEA 1U8CB 3N9HA 1CEWI 3ECFA 2QEX3 1A67A 2M7OA 1WTHA 4EV5A 5LC7A 4LZIA 3KKGA 3X40A 3CC23 1KC84 3KE7A 3CCQ3 1K28A 3EJVA 3MG2A 1OHOA 1SPUA 1AVLA 4XBXA 1QJGA 3HX8A 2XR8B 2CHCA 2C10A 2OQEA 1IVXA 2XGLA 1GY6A 2BHMA 4XB5A 3ROBA 4X2OA 3DGMA 3NV0B 3V98A 2CFDA 4MMZB 2GU3A 1W4NA 3NM7A 5ELJA 2CWUA 4H61A 4KZ1A 3X3ZA 3DXOA 3CCJ3 1JN5A 2XGNA 4MMXB 5IERA 2W56B 3LTCA 1TFOA 1D6UA 3QRDA 3TDGA 2W9PA 3EN8A 1FGTA 3S67A 2R4IA 1VQN3 3U1WA 2QA43 3DGLA 1OHPA 2ZDJA 3HZPA 4LSOA 2ML6A 4XDVA 2WOFA 3OWUA 1Q864 1VQ43 1UW1A 1YJ93 2P0XA 5IG5A 4HM2B 1RKYA 1N8QA 1KD14 3H3HA 1NWWA 4I4KA 4N6TA 3WOFB 3BLZA 3KIIA 4STDA 1S5AA 4IPBA 1VQ83 3Q1CA 1FA3A 1VQ73 1QVF2 4WYKB 4HM3B 3CD63 3FKAA 2WGQA 3FLJA 3WOEB 2KXGA 5CF1A 1NB3I 3CCV3 1UUVB 3F8HA 4N6V0 4WYKA 3VGNA 1STDA 5IG0A 2BMOB 1NB5I 1KWIA 5AYRB 1K734 3AMOB 3MSOA 3STDA 2FGTA 6STDA 3WA2X 3PGBA 1UI7A 4ZM8A 3CXC2 4H3UA 3CCS3 1YJW3 1GY5A 2I9WA 2PZVA 1QAFA 1TP6A 3CPW2 2ZL8A 1IK3A 1GY7A 4R1KA 3JUOA 1PU4A 3CCR3 3B7CA 4LGQA 1DVDA 4R9KA 5EVHA 2HMJB 3LT9A 2HMOB 3CCL3 4IIAA 5AIFA 5KP3A 3EB8A 1YGEA 5KP4A 1YIJ3 2Y74A 3DY5A 5IF6A 4BTXA 3G6E3 1O7NB 3GWRA 4BTWA 2LQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PEJ A;  3K0Z A;  5D82 A;  3UNL A;  1E97 A;  4HVN A;  1IDP A;  1QMA A;  3OWS A;  2GEY A;  3B4P A;  3EC9 A;  4HM5 B;  3ER7 A;  3FZW A;  3MKI A;  3OX9 A;  5HGR A;  2HMM B;  3FF0 A;  4FCM A;  3F8X A;  3BB9 A;  4RZM A;  5IG3 A;  1NDO B;  5DRE A;  3EBY A;  1O7P B;  1VZZ A;  3SOY A;  4HKV B;  1OGX A;  1W01 A;  4GB5 A;  4KVH A;  3GZX B;  5BVB A;  3RGR A;  4LEH A;  1OH0 A;  3CPO A;  4XBY A;  1CQS A;  1OF5 B;  3NV0 A;  4LMI A;  1HKX A;  2B24 B;  5AIG A;  2HMK B;  3EF8 A;  4ORL A;  2YFJ B;  4HM6 B;  1O7G B;  2STD A;  1O7H B;  5CLK A;  5AIH A;  2A15 A;  2F86 B;  2F98 A;  3EQQ B;  1E3R A;  3JUQ A;  3T8N A;  3DMC A;  1JKG B;  4J9A A;  3CNX A;  3G16 A;  3DUK A;  3H51 A;  3M8C A;  3FF2 A;  5AII A;  4OUQ A;  1AR0 A;  3CNM A;  2BMR B;  3MG1 A;  5IEO A;  3OWY A;  3LYG A;  3MHE A;  2OWP A;  3JUP A;  5AEW B;  4L7K A;  1BUQ A;  2RCD A;  4N3V A;  5FW5 A;  2BNG A;  3NM2 A;  3FSD A;  3S5C A;  1DMM A;  5IEP A;  2HMN B;  4HZB B;  1W00 A;  5IEN A;  2CKF B;  1GS3 A;  2UX0 A;  1C7H A;  3KZT A;  1OPY A;  4L8O A;  3OV4 A;  3B4O A;  3WMD A;  1DMQ A;  4XDW A;  3MG3 A;  3GZB A;  3SOA A;  2GBX B;  1JB4 A;  1TUH A;  3DM8 A;  3VSY A;  3GZY B;  5CK6 A;  3NXJ A;  2RGQ A;  2QGU A;  1GYB A;  4HM8 B;  1ZO2 A;  3EBT A;  1OGZ A;  3G0K A;  1O7W B;  2IMJ A;  3JUN A;  2BMQ B;  3UJM A;  5CXO A;  3EN1 B;  1UUW B;  3K7C A;  4Q53 A;  1O7M B;  3A76 A;  4WWU C;  3Q90 A;  4FCJ A;  2W2C A;  3RGA A;  4WP5 A;  1EG9 B;  3DZL A;  3HK4 A;  5D83 A;  1ASK A;  2JQ5 A;  4HM1 B;  1OF5 A;  1ZX2 A;  4X2H A;  5G2G A;  5KP1 A;  4HM4 B;  5AI1 A;  3B8L A;  2GEX A;  2YFI B;  1NU3 A;  3JUM A;  1JN5 B;  1A2K A;  3F9S A;  2INX A;  4K1U A;  5AEU B;  3GRD A;  1JKG A;  1W02 A;  2GBW B;  1Q42 A;  5DRV A;  1JB5 A;  1ISK A;  3OXA A;  3I0Y A;  3NHX A;  3NBR A;  4XBT A;  4CDL A;  1EA2 A;  2HML B;  4R9L A;  2RFR A;  1E3V A;  4XM4 A;  5D81 A;  3D9R A;  2Z7A A;  1OUN A;  1U5O A;  3F40 A;  3SED A;  4HM0 B;  5BXQ A;  3E99 A;  4L8P A;  2XRX B;  5STD A;  3CU3 A;  4HJL B;  3KSP A;  3IPT A;  3LZA A;  2GXF A;  8CHO A;  3NUV A;  4OVM A;  1W6Y A;  3G8Z A;  7STD A;  2QIY A;  1Z1S A;  5JPU A;  2XSO B;  1K41 A;  1JB2 A;  1ULJ B;  3FGY A;  1OHS A;  3MYT A;  5JPP A;  1WQL B;  1SJW A;  4K1V A;  4HZ9 B;  2F99 A;  3EHC A;  2YFL B;  3EX9 A;  3GZR A;  3T8U A;  4HM7 B;  5CF2 A;  2B1X B;  2Z77 A;  3F7X A;  5IG4 A;  1ULI B;  5TGN A;  2XSH B;  3F7S A;  4J8T A;  1OCV A;  1Q40 B;  4U13 A;  1DMN A;  2K54 A;  1Q40 A;  3F14 A;  2Z76 A;  3FH1 A;  4MJD A;  3ECF A;  3KKG A;  3KE7 A;  3EJV A;  3MG2 A;  1OHO A;  4XBX A;  1QJG A;  3HX8 A;  2XR8 B;  2CHC A;  1GY6 A;  3ROB A;  4XB5 A;  4X2O A;  3NV0 B;  3DXO A;  1JN5 A;  5IER A;  3EN8 A;  2R4I A;  1OHP A;  3HZP A;  4XDV A;  3OWU A;  5IG5 A;  4HM2 B;  3H3H A;  1NWW A;  4I4K A;  3BLZ A;  4STD A;  1S5A A;  4WYK B;  4HM3 B;  3FKA A;  3FLJ A;  5CF1 A;  1UUV B;  3F8H A;  4WYK A;  3VGN A;  1STD A;  5IG0 A;  2BMO B;  3MSO A;  3STD A;  6STD A;  4H3U A;  1GY5 A;  2I9W A;  2PZV A;  1TP6 A;  1GY7 A;  4R1K A;  3JUO A;  3B7C A;  4LGQ A;  4R9K A;  5EVH A;  2HMJ B;  2HMO B;  4IIA A;  5AIF A;  5KP3 A;  5KP4 A;  5IF6 A;  1O7N B;  3GWR A; 
#chains in the Genus database with same CATH topology
 5A0O B;  1EQK A;  4PEJ A;  3K0Z A;  4BTY A;  2E2V A;  1W7C A;  3PCS A;  4JF8 A;  4O3V A;  2MF7 A;  1GMP A;  5D82 A;  4O2H A;  3UNL A;  4WFO A;  1E97 A;  4HVN A;  1SIH A;  5AYS C;  1B3S A;  1IDP A;  1EUI C;  1T3B A;  1QMA A;  3OWS A;  2GEY A;  5BU4 A;  1FGQ A;  3B4P A;  3EC9 A;  3QK9 A;  1CH0 A;  3CME 3;  1HU9 A;  3U97 A;  3LOY A;  4HM5 B;  2P0M A;  1V57 A;  3ER7 A;  3FZW A;  3MKI A;  5I97 A;  3OX9 A;  1B2M A;  5HGR A;  1FUT A;  3PXM A;  3UB1 A;  2HMM B;  4J5G A;  3FF0 A;  4FCM A;  3F8X A;  4RNT A;  3BIR A;  2OOV C;  2RSX A;  3BB9 A;  1IVU A;  1SII A;  3D3L A;  4RZM A;  1YVS A;  1NDO B;  5IG3 A;  3OW2 2;  2KF5 A;  2W6J H;  3ZG0 A;  4KFD A;  4R80 A;  2ZA4 A;  3X3Y A;  5DRE A;  3ALA A;  1VQ9 3;  3EBY A;  1O7P B;  3Q3F A;  3X41 A;  1VZZ A;  5M19 A;  3SOY A;  2J8X B;  1MGW A;  4HKV B;  1TU5 A;  1OGX A;  1W01 A;  1WMN A;  4GB5 A;  5ELU A;  2CH9 A;  1TIJ A;  3GZX B;  4KVH A;  5BVB A;  1IQ8 A;  1MNL A;  3RGR A;  1UDI I;  1BRJ A;  3EE1 A;  4LEH A;  1OH0 A;  1QAK A;  2H0I A;  2XFS A;  3CPO A;  4IT7 A;  4XBY A;  1V74 A;  1CQS A;  2CFG A;  1N5H A;  3HII A;  7RNT A;  2HOH A;  3GSP A;  1DET A;  1OF5 B;  3X42 A;  3NV0 A;  4N6O B;  3ZG5 A;  2WO0 A;  4LMI A;  1HKX A;  1W6C A;  1FYS A;  2B24 B;  3FG4 A;  5AIG A;  2HMK B;  1RGE A;  3EF8 A;  2W56 A;  1BGS A;  2IY2 A;  2YFJ B;  4ORL A;  1I0V A;  4HM6 B;  1O7G B;  3PS8 A;  1B21 A;  1BNS A;  1NNV A;  2STD A;  1O7H B;  5CLK A;  3S29 A;  3UL5 A;  1G0T A;  3NBJ A;  5AIH A;  1ROV A;  4FCZ A;  1UCL A;  2A15 A;  2F86 B;  2CWT A;  2F98 A;  3LXU X;  3EQQ B;  2FXT A;  4FMD A;  3CC4 3;  1E3R A;  3SLU A;  3JUQ A;  2BT3 A;  3T8N A;  1CYU A;  3BNB A;  3DMC A;  1JKG B;  2PNC A;  2KAA A;  4J9A A;  1D6Z A;  2Q07 A;  3CNX A;  1B2U A;  1IQX A;  1N9E A;  3PYJ A;  2P05 A;  3G16 A;  4K61 A;  2IUJ A;  2IA7 A;  1RNB A;  1W6G A;  3DUK A;  3H51 A;  3M8C A;  5EQL A;  3SXX A;  3CCM 3;  4NRE A;  3S28 A;  2CFK A;  2K0M A;  3FF2 A;  5AII A;  5BIR A;  1RDS A;  3KFQ C;  4OUQ A;  2YX9 A;  1FZU A;  1AR0 A;  2AAD A;  3CNM A;  1LXE A;  4AEQ A;  2BMR B;  1RGH A;  1RTU A;  3RDE A;  1RHL A;  2P09 A;  3MG1 A;  1G96 A;  3OWY A;  5IEO A;  1FUW A;  3LYG A;  3MHE A;  2OWP A;  1CYV A;  1W2Z A;  3AMO A;  4QWT A;  3JUP A;  2SBL A;  4BU4 A;  5AEW B;  1BNI A;  4RNY A;  2KCD A;  4KFE A;  3WA3 A;  3I56 3;  4L7K A;  1BUQ A;  2XEP A;  1WMP A;  1B2S A;  3DGN A;  3LT8 A;  1IT8 A;  2RCD A;  4HOH A;  4N3V A;  4EYC A;  4EW5 A;  2OQE C;  3CCE 3;  5FW5 A;  2L4V A;  3L0R A;  1TRQ A;  1STF I;  3S27 A;  1M1K 4;  2JDI H;  1IU7 A;  1B27 A;  2BNG A;  2CX0 A;  3NM2 A;  1GD3 A;  1HZ1 A;  3FSD A;  3S5C A;  1DMM A;  2W0Q A;  3DGY A;  3UL6 A;  3IMA B;  3V99 A;  5IEP A;  2HMN B;  1ROA A;  1W00 A;  4HZB B;  1RGG A;  2CG0 A;  2CKF B;  3HIG A;  4N6U A;  3ZFZ A;  5IEN A;  1RSN A;  1VQL 3;  4FMB A;  4K90 B;  1GS3 A;  2P38 A;  1Q9E A;  2UX0 A;  2E2T A;  1K8A 4;  1C7H A;  4I5Q A;  1GOU A;  4LYL B;  4NPB A;  3FCS B;  3KZT A;  1BSE A;  1D6Y A;  1AV4 A;  1OPY A;  1BIR A;  4G1M B;  1LVN A;  1TJD A;  4MEI A;  3KN4 A;  4L8O A;  1JJ2 2;  3CC7 3;  3OV4 A;  3WHO A;  2H0H A;  3B4O A;  3J7Y d;  3WMD A;  1DMQ A;  1LQG C;  1NJI 4;  2IUK A;  2V1L A;  3NX0 A;  1R4C A;  1UUG B;  3MG3 A;  4XDW A;  3GZB A;  1BOX A;  3PZW A;  3SOA A;  2GBX B;  1JB4 A;  1TUH A;  2D1W A;  3DM8 A;  3VSY A;  1J2B A;  3GZY B;  1A2P A;  4TX4 A;  5CK6 A;  1BRK A;  3NXJ A;  1LOY A;  3CCU 3;  2RGQ A;  4FR9 A;  4EC6 A;  3URP A;  5FGO A;  4ILF A;  3Q2P A;  2OTJ 3;  2GU1 A;  1DVC A;  7GSP A;  2QGU A;  1GYB A;  4HM8 B;  1RGK A;  1ZO2 A;  3EBT A;  1OGZ A;  2CW9 A;  3G0K A;  5GSP A;  1T2I A;  3VF1 A;  5LC6 A;  1O7W B;  1RJO A;  2IMJ A;  4N6N B;  5JBS A;  5EEO A;  3JUN A;  2BMQ B;  3RNT A;  3UJM A;  4O02 B;  1MWU A;  2W03 A;  2C11 A;  3AHS A;  2Y73 A;  5CXO A;  1T5Y A;  3AGO A;  1NO3 A;  3EN1 B;  3WOD G;  1UUW B;  1LQM B;  2OTL 3;  9RNT A;  3K7C A;  1BSA A;  4Q53 A;  1O7M B;  1RN1 A;  4GSP A;  1JZD A;  1N8R 4;  3A76 A;  6GSP A;  1BRN L;  2FNQ A;  2ML5 A;  3LTD A;  1FGR A;  3IJE B;  1KQS 2;  1UI8 A;  1LOW A;  4WWU C;  4EBG A;  3Q90 A;  4FCJ A;  2WOH A;  1K9M 4;  1BRI A;  1UCK A;  2W2C A;  3RGA A;  4WP5 A;  1EG9 B;  3DZL A;  2CFL A;  2CIU A;  3HK4 A;  1JV2 B;  2F5W A;  1IV7 A;  5D83 A;  1UCI A;  2WGO A;  2KF3 A;  1ASK A;  1Q7Y 4;  2IYJ A;  2JQ5 A;  4HM1 B;  3SYU A;  1OF5 A;  1ZX2 A;  4X2H A;  3V92 A;  5G2G A;  4EXR A;  1OAC A;  5KP1 A;  4HM4 B;  3X3X A;  5AI1 A;  1PYL A;  1IVV A;  3B8L A;  2GEX A;  3G4S 3;  2YFI B;  1L5G B;  1NU3 A;  3JUM A;  1JN5 B;  1IT7 A;  1A2V A;  1JNQ A;  1WNH A;  2W04 A;  1MWR A;  3O8Y A;  5G1L A;  1A2K A;  3F9S A;  2XH9 A;  2F56 A;  1GMR A;  2BO9 B;  3LTB A;  1JRQ A;  2INX A;  1YJN 3;  2CFW A;  2KRT A;  2O3O A;  1BNJ A;  1EKM A;  1YVB I;  4K1U A;  5AEU B;  3K5T A;  4GL6 A;  4EV2 A;  1LNH A;  3GRD A;  2CK3 H;  3BNC A;  1IYY A;  1JKG A;  1W5Z A;  2XF3 A;  1YI2 3;  1RGF A;  1W02 A;  3AGN A;  3BND A;  3SX1 A;  8RNT A;  2UUG C;  3I55 3;  2GBW B;  1Q42 A;  5DRV A;  2L1S A;  1M90 4;  1JB5 A;  3FG3 A;  3K63 A;  1ISK A;  4KFF A;  3HI7 A;  2SAR A;  3OXA A;  2MC8 A;  1TTO A;  3I0Y A;  3NHX A;  3NBR A;  4XBT A;  4FMC A;  2K3D A;  4CDL A;  3G71 3;  1LOX A;  1EA2 A;  4AKY A;  4BIR A;  1VQ5 3;  4JRF A;  2HML B;  1M1X B;  1VQQ A;  1GSP A;  2F4Y A;  4R4K A;  1JZO A;  1M9G A;  1VQM 3;  1PFP A;  4R9L A;  1I3I A;  1E3V A;  2RFR A;  4XM4 A;  5D81 A;  4WHA A;  1VQK 3;  3LTA A;  1YIT 3;  2XFT A;  3CMA 3;  1A90 A;  3MWZ A;  4MMY B;  3D9R A;  2Z7A A;  3T0U A;  1I2E A;  4HAA A;  1AVK A;  1PY3 A;  1TFK A;  1OUN A;  1U5O A;  3F40 A;  4N6L A;  3SED A;  4HM0 B;  3K9M C;  3WDG B;  1QAL A;  3E99 A;  5BXQ A;  1QVG 2;  2OOV A;  1UCJ A;  4L8P A;  2XRX B;  5STD A;  3CU3 A;  1GD4 A;  1KSI A;  4HJL B;  2D42 A;  3NBB A;  1BNR A;  4N6M A;  1IV9 A;  2CWV A;  1FGM A;  3LH4 A;  3KSP A;  3IPT A;  3LZA A;  2GXF A;  3NQZ A;  3MPH A;  4DKI A;  1ZGX A;  1IVW A;  8CHO A;  5IW9 A;  1BNE A;  3NUV A;  1SQW A;  5G1K A;  3LML A;  1WMO A;  4OVM A;  1W6Y A;  2RBI A;  3G8Z A;  4HYZ A;  7STD A;  1TRP A;  2QIY A;  3WR2 A;  1IQY A;  1Z1S A;  1AQZ A;  5JPU A;  1LOV A;  2C4B A;  2XSO B;  1K41 A;  1JB2 A;  1ULJ B;  1YGW A;  3FGY A;  4FMA A;  1VQP 3;  2CC3 A;  1OHS A;  2LYX A;  2BU4 A;  1RN7 A;  2OCT A;  1N9J A;  1DE3 A;  1RRH A;  1Q82 4;  4RNZ A;  3MYT A;  4NHF A;  2ZHX B;  5JPP A;  1UGH I;  1GOV A;  1C54 A;  1FW7 A;  1FGO A;  1WQL B;  3D5G A;  3N8B A;  1I2F A;  1SJW A;  4K1V A;  4HZ9 B;  3FG1 A;  1N5P A;  2E2U A;  1Q81 4;  4AKZ A;  1W2B 2;  1S72 3;  3GAX A;  1RCL A;  1RGL A;  3AHW A;  2W9Q A;  2Z6B A;  2F99 A;  1F8N A;  2YFL B;  3EHC A;  3EX9 A;  3GZR A;  1R4Y A;  4HM7 B;  3T8U A;  5CF2 A;  2B1X B;  1BRH A;  2CG1 A;  2Z77 A;  3F7X A;  4HBR A;  4CCV A;  1MOL A;  3NQY A;  5IG4 A;  1JBS A;  1ULI B;  2O9U X;  5TGN A;  1VQO 3;  1Y4K A;  2XSH B;  1RNT A;  1FUS A;  3DGO A;  1BUJ A;  3N54 B;  3F7S A;  4J8T A;  2GSP A;  1X1X A;  1OCV A;  1GOY A;  1Q40 B;  1RLS A;  2KF6 A;  3PCR A;  1YHQ 3;  2R41 A;  3KCH A;  4U13 A;  1DMN A;  1US1 A;  4RBN A;  1DYU A;  3SVA A;  1VQ6 3;  2K54 A;  3KSE D;  4O8S A;  1Q40 A;  1RCK A;  1BRS A;  2Z76 A;  3F14 A;  3FH1 A;  4OK0 A;  1JBT A;  1RRL A;  4MJD A;  3JVC A;  3BNE A;  1U8C B;  3N9H A;  1CEW I;  3ECF A;  2QEX 3;  2KF4 A;  1A67 A;  2M7O A;  1WTH A;  4EV5 A;  5LC7 A;  4LZI A;  1LNI A;  3KKG A;  3X40 A;  3CC2 3;  1KC8 4;  1JBR A;  5M1A A;  3KE7 A;  3CCQ 3;  2CX1 A;  1K28 A;  3EJV A;  3MG2 A;  1OHO A;  1AY7 A;  1AVL A;  1RN4 A;  1SPU A;  3DH2 A;  4XBX A;  1QJG A;  3HX8 A;  5M18 A;  2XR8 B;  2CHC A;  2C10 A;  2OQE A;  1IVX A;  2XGL A;  1GY6 A;  2BHM A;  1BAO A;  4XB5 A;  3ROB A;  1LRA A;  3BU4 A;  3DGM A;  3NV0 B;  1X1W A;  2CFD A;  4MMZ B;  4X2O A;  3V98 A;  2GU3 A;  1W4N A;  3NM7 A;  5ELJ A;  2CWU A;  1B2Z A;  4H61 A;  4KZ1 A;  3DXO A;  3X3Z A;  3CCJ 3;  6RNT A;  1JN5 A;  2XGN A;  4MMX B;  5IER A;  1I8V A;  2W56 B;  1TFO A;  3LTC A;  1RGA A;  2F5M A;  1YNV X;  1D6U A;  1ZS7 A;  3QRD A;  3TDG A;  2W9P A;  4CJN A;  2H0G A;  3EN8 A;  1FGT A;  3S67 A;  2R4I A;  1VQN 3;  3U1W A;  2BIR A;  2QA4 3;  3DGL A;  1OHP A;  2ZDJ A;  3HZP A;  4LSO A;  2ML6 A;  4XDV A;  2WOF A;  3OWU A;  1Q86 4;  1G02 A;  1SAR A;  1VQ4 3;  1UW1 A;  1BNG A;  1YJ9 3;  1MWS A;  1HYF A;  1UGI A;  2P0X A;  5IG5 A;  4HM2 B;  1RKY A;  1N8Q A;  1KD1 4;  3D79 A;  1T2H A;  3H3H A;  1NWW A;  4I4K A;  4N6T A;  3WOF B;  4BL3 A;  3BLZ A;  3KII A;  4STD A;  1S5A A;  1X1Y A;  4IPB A;  1BSD A;  1VQ8 3;  3Q1C A;  1FA3 A;  1VQ7 3;  1QVF 2;  4WYK B;  4HM3 B;  1I3F A;  2UGI A;  3CD6 3;  3FKA A;  1GMQ A;  2WGQ A;  3FLJ A;  3WOE B;  2KXG A;  5CF1 A;  1NB3 I;  3CCV 3;  1UUV B;  3F8H A;  4N6V 0;  4WYK A;  3VGN A;  1STD A;  1BNF A;  5IG0 A;  2BMO B;  1NB5 I;  1I2G A;  5HOH A;  1KWI A;  5AYR B;  3HOH A;  1BU4 A;  3AMO B;  3MSO A;  1K73 4;  3STD A;  2FGT A;  6STD A;  1MWT A;  1BVI A;  3WA2 X;  3D4A A;  3PGB A;  1B2X A;  1UI7 A;  4ZM8 A;  3CXC 2;  4H3U A;  3CCS 3;  1YJW 3;  1GY5 A;  2I9W A;  2AAE A;  2PZV A;  1QAF A;  3D5I A;  1TP6 A;  3CPW 2;  2ZL8 A;  5RNT A;  1IK3 A;  1GY7 A;  4R1K A;  2RNT A;  1I0X A;  3JUO A;  4BL2 A;  4GHO A;  4KT3 B;  1PU4 A;  3CCR 3;  3B7C A;  4J5K A;  1MGR A;  3A5E A;  4LGQ A;  1DVD A;  4R9K A;  5EVH A;  1BSC A;  1I70 A;  1Q7H A;  1BSB A;  2HMJ B;  3LT9 A;  1X1U A;  2HMO B;  3CCL 3;  4IIA A;  1EEJ A;  5AIF A;  5KP3 A;  3EB8 A;  1RGC A;  1YGE A;  5KP4 A;  1YIJ 3;  2Y74 A;  3DY5 A;  1BAN A;  5IF6 A;  4BTX A;  4CPK A;  3G6E 3;  1RMS A;  1BRG A;  1O7N B;  3GWR A;  1B20 A;  1V58 A;  4BTW A;  2LQV A; 
#chains in the Genus database with same CATH homology
 5A0O B;  1EQK A;  4PEJ A;  3K0Z A;  4BTY A;  2E2V A;  1W7C A;  3PCS A;  4JF8 A;  4O3V A;  2MF7 A;  5D82 A;  4O2H A;  3UNL A;  4WFO A;  1E97 A;  4HVN A;  1SIH A;  5AYS C;  1IDP A;  1QMA A;  3OWS A;  2GEY A;  1FGQ A;  3B4P A;  3EC9 A;  3QK9 A;  3CME 3;  1HU9 A;  3U97 A;  3LOY A;  4HM5 B;  2P0M A;  3ER7 A;  3FZW A;  3MKI A;  5I97 A;  3OX9 A;  5HGR A;  3PXM A;  3UB1 A;  2HMM B;  3FF0 A;  4FCM A;  3F8X A;  2OOV C;  2RSX A;  3BB9 A;  1IVU A;  1SII A;  3D3L A;  4RZM A;  5IG3 A;  1NDO B;  3OW2 2;  2W6J H;  4KFD A;  4R80 A;  3X3Y A;  5DRE A;  3ALA A;  1VQ9 3;  3EBY A;  1O7P B;  3X41 A;  1VZZ A;  3SOY A;  4HKV B;  1TU5 A;  1OGX A;  1W01 A;  1WMN A;  4GB5 A;  5ELU A;  2CH9 A;  1TIJ A;  3GZX B;  4KVH A;  5BVB A;  1IQ8 A;  1MNL A;  3RGR A;  3EE1 A;  4LEH A;  1OH0 A;  1QAK A;  4IT7 A;  2XFS A;  3CPO A;  4XBY A;  1V74 A;  1CQS A;  2CFG A;  1N5H A;  3HII A;  1OF5 B;  3X42 A;  3NV0 A;  4N6O B;  2WO0 A;  4LMI A;  1HKX A;  1W6C A;  2B24 B;  3FG4 A;  5AIG A;  2HMK B;  3EF8 A;  2W56 A;  4ORL A;  2YFJ B;  4HM6 B;  1O7G B;  3PS8 A;  2STD A;  1O7H B;  5CLK A;  3S29 A;  3UL5 A;  3NBJ A;  5AIH A;  1ROV A;  4FCZ A;  2A15 A;  2F86 B;  2CWT A;  2F98 A;  3LXU X;  3EQQ B;  2FXT A;  4FMD A;  3CC4 3;  1E3R A;  3SLU A;  3JUQ A;  2BT3 A;  3T8N A;  1CYU A;  3BNB A;  3DMC A;  1JKG B;  2PNC A;  4J9A A;  1D6Z A;  2Q07 A;  3CNX A;  1IQX A;  1N9E A;  3PYJ A;  4K61 A;  2P05 A;  3G16 A;  2IUJ A;  2IA7 A;  1W6G A;  3DUK A;  3H51 A;  3M8C A;  5EQL A;  3SXX A;  3CCM 3;  4NRE A;  3S28 A;  2CFK A;  2K0M A;  3FF2 A;  5AII A;  3KFQ C;  4OUQ A;  2YX9 A;  1AR0 A;  3CNM A;  1LXE A;  4AEQ A;  2BMR B;  3RDE A;  2P09 A;  3MG1 A;  1G96 A;  3OWY A;  5IEO A;  1FUW A;  3LYG A;  3MHE A;  2OWP A;  1CYV A;  1W2Z A;  3AMO A;  4QWT A;  3JUP A;  2SBL A;  5AEW B;  4RNY A;  2KCD A;  4KFE A;  3WA3 A;  3I56 3;  4L7K A;  1BUQ A;  2XEP A;  1WMP A;  3DGN A;  4EYC A;  3LT8 A;  1IT8 A;  2RCD A;  3CCE 3;  4N3V A;  2OQE C;  5FW5 A;  2L4V A;  3L0R A;  1STF I;  3S27 A;  1M1K 4;  2JDI H;  1IU7 A;  2BNG A;  3NM2 A;  1GD3 A;  3FSD A;  3S5C A;  1DMM A;  2W0Q A;  3UL6 A;  3IMA B;  3V99 A;  5IEP A;  2HMN B;  1ROA A;  1W00 A;  4HZB B;  5IEN A;  2CG0 A;  2CKF B;  3HIG A;  4N6U A;  1VQL 3;  4FMB A;  4K90 B;  1GS3 A;  2P38 A;  2UX0 A;  2E2T A;  1K8A 4;  1C7H A;  3FCS B;  3KZT A;  1D6Y A;  1AV4 A;  1OPY A;  4G1M B;  1LVN A;  4MEI A;  3KN4 A;  4L8O A;  1JJ2 2;  3CC7 3;  3OV4 A;  3J7Y d;  3B4O A;  3WMD A;  1DMQ A;  1NJI 4;  2IUK A;  2V1L A;  3NX0 A;  1R4C A;  4XDW A;  3MG3 A;  3GZB A;  3PZW A;  3SOA A;  2GBX B;  1JB4 A;  1TUH A;  2D1W A;  3DM8 A;  3VSY A;  1J2B A;  3GZY B;  4TX4 A;  5CK6 A;  3NXJ A;  3CCU 3;  2RGQ A;  4FR9 A;  4EC6 A;  5FGO A;  3Q2P A;  2OTJ 3;  2GU1 A;  1DVC A;  2QGU A;  1GYB A;  4HM8 B;  1ZO2 A;  3EBT A;  1OGZ A;  2CW9 A;  3G0K A;  3VF1 A;  5LC6 A;  1O7W B;  1RJO A;  2IMJ A;  4N6N B;  5JBS A;  5EEO A;  3JUN A;  2BMQ B;  3UJM A;  4O02 B;  2W03 A;  2C11 A;  2Y73 A;  5CXO A;  1T5Y A;  1NO3 A;  3EN1 B;  3WOD G;  1UUW B;  2OTL 3;  3K7C A;  4Q53 A;  1O7M B;  1N8R 4;  3A76 A;  2FNQ A;  2ML5 A;  3LTD A;  1FGR A;  3IJE B;  1KQS 2;  1UI8 A;  4WWU C;  4EBG A;  3Q90 A;  4FCJ A;  2WOH A;  1K9M 4;  2W2C A;  3RGA A;  4WP5 A;  1EG9 B;  3DZL A;  2CFL A;  2CIU A;  3HK4 A;  1JV2 B;  5D83 A;  1IV7 A;  2WGO A;  1ASK A;  1Q7Y 4;  2JQ5 A;  4HM1 B;  1OF5 A;  1ZX2 A;  4X2H A;  3V92 A;  5G2G A;  4EXR A;  1OAC A;  5KP1 A;  4HM4 B;  3X3X A;  5AI1 A;  1IVV A;  3B8L A;  2GEX A;  3G4S 3;  2YFI B;  1L5G B;  1NU3 A;  3JUM A;  1JN5 B;  1IT7 A;  1A2V A;  1JNQ A;  1WNH A;  2W04 A;  3O8Y A;  1A2K A;  3F9S A;  2XH9 A;  2BO9 B;  3LTB A;  1JRQ A;  2INX A;  1YJN 3;  2CFW A;  2KRT A;  2O3O A;  1EKM A;  4K1U A;  1YVB I;  5AEU B;  3K5T A;  4GL6 A;  4EV2 A;  1LNH A;  3GRD A;  2CK3 H;  3BNC A;  1JKG A;  1W5Z A;  2XF3 A;  1YI2 3;  1W02 A;  3BND A;  3SX1 A;  3I55 3;  2GBW B;  1Q42 A;  5DRV A;  1M90 4;  1JB5 A;  3FG3 A;  3K63 A;  1ISK A;  4KFF A;  3HI7 A;  3OXA A;  2MC8 A;  3I0Y A;  3NHX A;  3NBR A;  4XBT A;  4FMC A;  4CDL A;  3G71 3;  1LOX A;  1EA2 A;  4AKY A;  1VQ5 3;  4JRF A;  2HML B;  1M1X B;  4R4K A;  1M9G A;  1VQM 3;  1PFP A;  4R9L A;  2RFR A;  1E3V A;  4XM4 A;  5D81 A;  1VQK 3;  4WHA A;  1YIT 3;  3LTA A;  3CMA 3;  2XFT A;  1A90 A;  3MWZ A;  4MMY B;  3D9R A;  2Z7A A;  3T0U A;  1AVK A;  1TFK A;  1OUN A;  1U5O A;  3F40 A;  4N6L A;  3SED A;  4HM0 B;  3K9M C;  3WDG B;  1QAL A;  3E99 A;  5BXQ A;  1QVG 2;  2OOV A;  4L8P A;  2XRX B;  5STD A;  3CU3 A;  1GD4 A;  1KSI A;  4HJL B;  2D42 A;  3NBB A;  4N6M A;  1IV9 A;  2CWV A;  1FGM A;  3LH4 A;  3KSP A;  3IPT A;  3LZA A;  2GXF A;  3NQZ A;  3MPH A;  8CHO A;  5IW9 A;  1IVW A;  3NUV A;  1SQW A;  3LML A;  1WMO A;  4OVM A;  1W6Y A;  3G8Z A;  4HYZ A;  7STD A;  2QIY A;  1IQY A;  1Z1S A;  5JPU A;  2XSO B;  1K41 A;  1JB2 A;  1ULJ B;  3FGY A;  4FMA A;  1VQP 3;  2CC3 A;  1OHS A;  2LYX A;  1RN7 A;  2OCT A;  1N9J A;  1RRH A;  1Q82 4;  4RNZ A;  3MYT A;  4NHF A;  5JPP A;  1FGO A;  1WQL B;  3N8B A;  1SJW A;  4K1V A;  4HZ9 B;  3FG1 A;  1N5P A;  2E2U A;  1Q81 4;  4AKZ A;  1W2B 2;  1S72 3;  3GAX A;  2W9Q A;  2Z6B A;  2F99 A;  1F8N A;  2YFL B;  3EHC A;  3EX9 A;  3GZR A;  4HM7 B;  3T8U A;  5CF2 A;  2B1X B;  2CG1 A;  2Z77 A;  3F7X A;  4HBR A;  4CCV A;  1MOL A;  3NQY A;  5IG4 A;  1ULI B;  2O9U X;  5TGN A;  1VQO 3;  1Y4K A;  2XSH B;  3DGO A;  3N54 B;  3F7S A;  4J8T A;  1OCV A;  3PCR A;  1Q40 B;  1YHQ 3;  4U13 A;  1DMN A;  1US1 A;  4RBN A;  1DYU A;  3SVA A;  1VQ6 3;  2K54 A;  3KSE D;  4O8S A;  1Q40 A;  4OK0 A;  3F14 A;  2Z76 A;  3FH1 A;  1RRL A;  4MJD A;  3JVC A;  3BNE A;  1U8C B;  3N9H A;  1CEW I;  3ECF A;  2QEX 3;  1A67 A;  2M7O A;  1WTH A;  4EV5 A;  5LC7 A;  4LZI A;  3KKG A;  3X40 A;  3CC2 3;  1KC8 4;  3KE7 A;  3CCQ 3;  1K28 A;  3EJV A;  3MG2 A;  1OHO A;  1SPU A;  1AVL A;  4XBX A;  1QJG A;  3HX8 A;  2XR8 B;  2CHC A;  2C10 A;  2OQE A;  1IVX A;  2XGL A;  1GY6 A;  2BHM A;  4XB5 A;  3ROB A;  4X2O A;  3DGM A;  3NV0 B;  3V98 A;  2CFD A;  4MMZ B;  2GU3 A;  1W4N A;  3NM7 A;  5ELJ A;  2CWU A;  4H61 A;  4KZ1 A;  3X3Z A;  3DXO A;  3CCJ 3;  1JN5 A;  2XGN A;  4MMX B;  5IER A;  2W56 B;  3LTC A;  1TFO A;  1D6U A;  3QRD A;  3TDG A;  2W9P A;  3EN8 A;  1FGT A;  3S67 A;  2R4I A;  1VQN 3;  3U1W A;  2QA4 3;  3DGL A;  1OHP A;  2ZDJ A;  3HZP A;  4LSO A;  2ML6 A;  4XDV A;  2WOF A;  3OWU A;  1Q86 4;  1VQ4 3;  1UW1 A;  1YJ9 3;  2P0X A;  5IG5 A;  4HM2 B;  1RKY A;  1N8Q A;  1KD1 4;  3H3H A;  1NWW A;  4I4K A;  4N6T A;  3WOF B;  3BLZ A;  3KII A;  4STD A;  1S5A A;  4IPB A;  1VQ8 3;  3Q1C A;  1FA3 A;  1VQ7 3;  1QVF 2;  4WYK B;  4HM3 B;  3CD6 3;  3FKA A;  2WGQ A;  3FLJ A;  3WOE B;  2KXG A;  5CF1 A;  1NB3 I;  3CCV 3;  1UUV B;  3F8H A;  4N6V 0;  4WYK A;  3VGN A;  1STD A;  5IG0 A;  2BMO B;  1NB5 I;  1KWI A;  5AYR B;  1K73 4;  3AMO B;  3MSO A;  3STD A;  2FGT A;  6STD A;  3WA2 X;  3PGB A;  1UI7 A;  4ZM8 A;  3CXC 2;  4H3U A;  3CCS 3;  1YJW 3;  1GY5 A;  2I9W A;  2PZV A;  1QAF A;  1TP6 A;  3CPW 2;  2ZL8 A;  1IK3 A;  1GY7 A;  4R1K A;  3JUO A;  1PU4 A;  3CCR 3;  3B7C A;  4LGQ A;  1DVD A;  4R9K A;  5EVH A;  2HMJ B;  3LT9 A;  2HMO B;  3CCL 3;  4IIA A;  5AIF A;  5KP3 A;  3EB8 A;  1YGE A;  5KP4 A;  1YIJ 3;  2Y74 A;  3DY5 A;  5IF6 A;  4BTX A;  3G6E 3;  1O7N B;  3GWR A;  4BTW A;  2LQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...