2H0IA

Crystal structure of dsbg v216m mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAMGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
total genus 65
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0iA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0iA02
2BMXA 4PXOA 2YN1A 1BYEA 1K0CA 1X9WB 2MMOA 1EEMA 3M3MA 3J7Yb 2TRCP 1FVJA 1SL2B 5KN3A 1XFLA 2YP6A 1GLQA 4POLA 4GSNA 4MJCA 1E2YA 2MYGA 2DBCA 2VM1A 5A4VA 4WF4A 16GSA 1F2EA 4GLTA 3M9KA 2FWHA 3KP9A 1V40A 5C04A 2LTKA 3NIVA 1JZDA 1GTIA 1T8EB 4V1Ap 2OKAA 2X99A 2Z9SA 1Y25A 2P5RA 2VM2A 5IMFA 3C8EA 2GT6A 2V2GA 4E8EA 2WZ9A 2WCIA 4G10A 2IWTA 1Z7RA 5DQSA 2O85A 4WKWA 3FZ4A 5HFGA 2L4CA 4XRAA 4KSMA 4K7OA 1EP8A 2CZ3A 4FYCA 2VO4A 2H0IA 4XHMA 3F3QA 5DQYA 1C72A 3BCKA 4LL1B 4TN8A 1OVNA 1H75A 2DMLA 1A8LA 2H73A 1SK1A 2FD3A 4NHZA 2DJJA 4V2LA 2O8VB 3TKSA 5HR3A 3G7JA 1U87A 2HXKA 4K7NA 2EC4A 5L71A 2KP1A 1G7OA 4LMWA 3ZTLA 2PWJA 4TXOB 3KMNA 1IYIA 4WBRD 5ID2A 2YWOA 1ABAA 4IVFA 4JBBA 4YQUA 4TR1A 2B3SA 1I9DA 3TGZA 1EOHA 1XBSA 1ERTA 1OAZA 3TKPA 1GNWA 2YZUA 5GAND 3LSZA 1NW2A 4MLYA 3FK8A 2P31A 2EIRA 1K0DA 1A8YA 1PSQA 5COHA 1R5PA 2IPAA 2H76A 1H4OA 2C3NA 1FVKA 1XPVA 1TDIA 3KM6A 5ELAA 1RK4A 2B1LA 4KAEA 3GNJA 2LQQA 3F0IA 3I6AA 3IOSA 4AJ8A 1USBA 3CBUA 5ABRA 5IMVA 3HA9A 1K0OA 2RIIA 2MBTA 1TKDB 2B5EA 4F82A 4OFMA 4BVXA 2JSYA 1X9MB 5B6NA 3H8QA 3ZVJD 3CRUA 4KDXA 5ECMB 3MDKA 1S3AA 2AUVA 2LKUA 3HJPA 2CQ9A 2CX4A 4F0CA 2HRNA 3ZVJA 3KH9A 3KGKA 3GHAA 3HKRA 4MF6A 4RI7A 3DWVA 3HD5A 4TR3A 4I8BA 3WGDA 3DXBA 1B4PA 2HNLA 4KB3A 3F63A 4MDCA 5AIXA 3ZMKA 2LS5A 3GUSA 3ZLPA 2VOCA 2H6ZA 1GSFA 2R4VA 3P7XA 2LJRA 1YJ6A 1TK5B 3PGTA 4V1Ag 3C71A 5DAKA 4XS1A 1YF1A 1FOVA 1BX9A 1GUHA 2XC2A 2LNSA 3IR4A 3KEBA 3QFBC 4GSTA 3WT1A 1DUGA 4ZBDA 2C1YA 4HJ2A 2FLSA 4EDZA 4ZB6A 1RW1A 2HLSA 2ON7A 1SD8A 4OO5A 1X5CA 3F4TA 1LJRA 4MH3A 2FWGA 5JCGA 2O7KA 2IL3A 3Q19A 2HI7A 1LU4A 4G2EA 2DJKA 2HZEB 2H1BA 4HJMA 4KE3A 2N5BA 2YNXA 4KCEA 1O81A 5D9WA 5IIZA 2OBIA 5GAPD 4KSOA 1IYHA 4MJAA 5HFKA 1OC9B 4V2MA 1KEBA 1AAZA 1TRSA 3GMFA 1ZZYA 1T7PB 2I3YA 2FNOA 1OYJA 2F8FA 2K8VA 4DSSA 2PVOC 1FHEA 1PA3A 5G31A 3E9JB 3D4MA 4GTUA 3W6GA 2I4AA 1K0AA 4L8EA 5ECHB 5F06A 3HXSA 1U6TA 2YWNA 2PGTA 5LNKe 2C4JA 1PD21 4KDUA 1GLPA 4ZBAA 4N30A 1OE8A 2MMZA 3ZITA 4IN0A 1BG5A 3QR6A 4XS4B 4DVCA 1EWXA 4K0GA 4KH7A 2C0GA 2IN3A 1XCCA 3GURA 5IQYA 5D73A 6GSTA 3TB2A 2VCWA 2QSIA 1QFNA 2HZFA 4I97A 3I69A 2GS3A 1OC3A 3UBLA 3GTUA 3PH9A 1MEKA 2F9SA 4CW9A 1U3AA 5HR0A 1AQXA 1QUWA 2VD0A 2VIMA 3DIEA 5GSTA 2H1GA 3TJBA 3L9VA 4G9HA 2DMMA 2IMDA 1YY7A 1HNAA 5ECOB 4IS0A 3QAGA 4ECBA 4ACSA 1SKRB 4IQ1A 2C80A 2JZRA 2JZSA 4POMA 3GL5A 4KUNA 1PGTA 4ULXA 2GZPA 4IQAA 4MZWA 5A4UA 3I43A 2DJ1A 2AHEA 2H66A 4J2FA 2VL3A 2N5FA 4ZILA 2LRCA 2H8LA 1SU9A 2K18A 2VL9A 4D73B 2EIQA 3EC3A 2CVKA 4HUAA 1TRVA 2C3TA 4ML6A 3APQA 4CHSA 3EU3A 3GX8A 2K6VA 3G7YA 2PU9C 1RQMA 4RI6A 2OADA 4L5OA 4YAPA 3GFKA 2FGXA 3VLNA 2FY6A 2H0GA 3KXOA 3E0UA 2O87A 1VF3A 2IMEA 3UVHA 4V2NA 3HHVA 3A5WA 5ECKB 2NDOA 4KCAA 4WR5A 2H75A 3MAKA 3W8JA 1QK8A 1AIUA 2MBSA 3WD6A 3ZFBA 1M0UA 3GH6A 5CYYA 4KDYA 1K3OA 1W89A 2WB9A 2O89A 1SENA 2DIZA 4ZB9A 1DE2A 5IOWA 1R4WA 1Z6MA 3UEMA 3TKQA 1A0RP 2AV4A 2H0HA 4WBJA 4TW5A 1JLWA 3HCZA 3DYRA 1HNBA 2AJQB 2GTUA 2CT6A 2IYJA 1ZYQB 1V98A 3PR8A 2DSAA 2GLRA 2CX3A 1SYXA 2X8GA 1S3CA 2N5AA 2JADA 2P5QA 2XBIA 2LNTA 4NV2A 2L59A 3LFLA 5KN1A 5CRGA 4EE0A 2ALBA 1V9WA 3FY7A 2VL2C 2K8SA 1XIYA 3MNGA 6GSWA 4HEA2 2MZCA 3TDGA 4ZL8A 4I2UA 4WXTA 3EMXA 4MPFA 2H1DA 3RHBA 4I6XA 3M8NA 14GSA 4X1UA 2FA4A 4KGIA 3CSJA 1SJZA 4JE1A 5FT3A 4EF0A 5EPFA 1LBKA 5D8IA 1B4QA 2A2SA 4HI7A 1DBYA 3IAM2 1VGLA 4K7IA 4PNFA 2KLXA 1MTCA 1G6YA 3K8NA 1WIKA 1ILOA 5AISA 3IXRA 3IC4A 6GSXA 3FKFA 3C1RA 2WS2A 5IOXA 3ED3A 5CO3A 2HSYA 1GL8A 1VF2A 4FH8A 3P8WA 8GSSA 2L4QA 2OE0A 3QPMA 4TVEA 4KNDA 2C3QA 4WETA 1SJIA 3ZFLA 2PN8A 5FHIA 4TXOA 2LJKA 3LGCA 4XIHA 3GKXA 4BVYA 3HZ8A 4MH2A 2G0FA 4HQSA 3HVXA 3BD2A 5J5NA 1GSEA 1X5EA 5DDLA 4I2TA 3HJMA 1AUCA 3QAVA 4YH2A 3KTBA 1JZRA 1Q98A 1YEPA 1TI1A 4POBA 1K0NA 3LXTA 2FCHA 4POKA 2C8UA 2ZUPA 3BBYA 2JL4A 1GSDA 4JR6A 4ZL9A 1XOBA 3DEXA 1GTAA 1SYRA 4MABA 3APOA 1XWBA 4LL4B 1K0BA 3L4NA 1V2AA 4HZ4A 4AGSA 3JCML 2GT5A 4OMVA 2PVQA 2GZYA 3KP8A 4NMUA 5D9VA 3GRXA 2DJ3A 5DJMA 2OBKA 4EO3A 5ECQB 5D96A 1THOA 2VCQA 2YWIA 3O6TA 4OFNA 3TJKA 2LSTA 1G6WA 1FG4A 4OFTA 4QL7A 2X8HA 2LUSA 2M46A 3LG6A 3QCPA 3HYPA 4EXJA 2LRNA 2R3XA 5D9TA 17GSA 4HZ2A 4P3YB 3ZIVA 1PN9A 1B8XA 2YANA 5GZZB 3IRAA 5ECLB 1F3AA 2M72A 4ECIA 1DE1A 13GSA 2GSTA 2FHEA 3CYNA 3APSA 4ZXGA 4F2IA 3VPTA 4F03A 2H19A 4IGJA 1ZGNA 3QDNA 5A4WA 1B48A 3CXGA 3W8SA 4MJEA 2VLVA 4IP6A 4PUAA 2REMA 1B9XC 2RM5A 4OCFA 2KUCA 1GSUA 1TJDA 5G1KA 3ZZXA 1R7HA 2CAQA 2PBJA 2BJXA 4N10A 5INYA 5EVOA 5D9XA 1XWAA 3FYGA 7GSSA 3QAWA 4NWYA 5KN2A 3DRNA 1GSYA 1TK8B 1YKCA 2GQLA 2HZEA 3EU4A 2PUKC 2V1MA 2V6OA 1EP7A 4XRDA 1AQVA 1XOAA 2R2JA 3C73A 3LEFA 3D4TA 3DVXA 2RM6A 3TKSC 2R37A 1GP1A 4IKHA 5ECIB 1WWJA 1OC9A 1EV9A 2L5OA 2YPMA 2IFQB 2GVPA 2F3MA 3H1NA 2V6KA 2ZNMA 5JWRB 4CDOA 5E4WA 4YAVA 3GN3A 5DALB 2E2GA 3EMPA 4ECCA 3LXZA 3CSHA 5G2ZA 3VI7A 4GWRA 4ECJA 4LLRA 2HRFA 4TR0A 1ZMAA 1A2LA 3UBKA 4PGTA 3GIXA 1GUKA 4JU5A 4OD7A 1V58A 4XS4A 5ECRB 3ISOA 4PX1A 1V57A 3GSSA 1TU7A 5HQPA 1U88A 4TKYA 4KA0A 1YEXA 1GSQA 5ECNB 2WULA 3GL3A 4TR4A 4TXVA 1ZYEA 3A3TA 3TKSE 1THXA 4BWQA 1PRXA 4F9ZA 2PMTA 3LORA 4ML1A 1GULA 3Q74A 2V41A 2R6KA 1ST9A 5FWGA 3C7MA 1M9AA 5AN1A 4QL9A 1HNCA 4DSRA 19GSA 1O7UA 1FO5A 2AYTA 11GSA 1MD3A 1K0MA 2RUFA 2FA8A 2HYXA 3P2AA 5F05A 2D2ZA 6GSSA 3FZAA 3FR3A 10GSA 3KD0A 2B5YA 1TW9A 4MA9A 2E0QA 1A2MA 1PKZA 4OO4A 4K0NA 4FYUA 3IV4A 2H70A 2H1AA 4D73A 1VF4A 2F8AA 2B5XA 1GSSA 2B6MA 2OACA 3A2XA 3FR6A 5IMDA 1O85A 4X43A 1Z9HA 3VFIA 2YWMA 4K6XA 5J41A 4JRRA 2JSZA 2RUEA 2GSSA 2H71A 3L9UA 2XHFA 2NPBA 2HFDA 3FW2A 3ZL5A 1QXHA 4OWYA 1ERVA 2H30A 4MJBA 2XPDA 4I5QA 3E3EA 1J0FA 4J57E 1N8JA 3LYPA 2IIYA 3CSIA 2PPTA 1SL1B 1HD2A 4WEYA 1NHYA 2FWEA 1M2DA 1VRSD 1XWCA 3GKKA 4GCIA 3Q6OA 5ENUA 1XW6A 4ZBBA 4IHUA 5IO0A 1UA5A 3CTFA 2V32A 3ZRDA 4BL7A 1TK0B 4H86A 4NHWA 3IAS2 1CQHA 5F07A 6GSUA 1X5DA 3UL3A 4NAXA 2AB6A 2TIRA 1ERWA 2CA8A 2H01A 4MZCA 4AF2A 3VI5A 3SBCA 5IMCA 1BJXA 1EGRA 3MWHA 4FYBA 4O7HA 3VK9A 5KEJA 4HS1A 1YKAA 3MSZA 2HE3A 2VUPA 4PURA 5CRDA 1TI3A 2XBQA 3D6IA 2DLXA 1GWCA 1J08A 5G30A 4NV5A 3J7Yk 1R5AA 1EV4A 1EGOA 4N0VA 3H4KA 1ERUA 2WDUA 5DJLA 3DKSA 1GTUA 3GKMA 2VLTA 2IY2A 5ECSA 1KNGA 3HZ4A 2J23A 3ERFA 2B7KA 1X0RA 4K8MA 5IPHA 4HOJA 4RQRA 3HJOA 1SKWB 1QQ2A 3ERGA 2KP2A 1NM3A 4RQXA 3S9FA 5JWOB 4PUFC 2HT9A 1SK0A 2GQMA 4WR4A 5HR2A 5G5FA 2OE1A 1ACVA 3TKRA 3M0FA 3VWUA 5ECPB 1T4ZA 2I81A 3TJGA 1JFUA 18GSA 5H5QA 1XVQA 3O3TA 2VCXA 2NVLA 4WF5A 3HVVA 4HU9A 2GDRA 2YJHA 1SKSB 1FB0A 1ZCPA 1T3BA 1XWGA 3GV1A 3UVTA 4L5LA 5HR1A 1Z6NA 3ERWA 2JZTA 1JZOA 3PINA 2BTOT 3LWAA 3SWLA 1SD9A 5G1LA 3VURA 5IMZA 1ON4A 5B8BA 3KZQA 2E2MA 2VLUA 4LA1A 1ZL9A 1GRXA 2LRTA 2C0EA 3UMAA 4JZQA 2IJYA 5IMAA 2QKEA 2QC7A 1T1VA 3H79A 4IELA 1TRWA 2M80A 2LQOA 1R26A 5CRHA 4PQHA 3RBTA 1HQOA 2GGTA 1F3BA 3F9UA 3HVSA 2XPEA 4MF5A 2H6YA 3D22A 1FB6A 3RPPA 4GQCA 4MCUA 3FRCA 4N0ZA 2H72A 4Q5QA 5JCUA 5J3RA 1PMTA 1BEDA 4O92A 4DSQA 1SL0B 3P90A 3ME7A 3KH7A 3M9JA 5LD0A 3UAPA 1S3DA 1DSBA 5DCHA 2F51A 1Q4JA 3HDCA 4PQIA 1AC1A 1Z7PA 5EL8A 3KIJA 2ON5A 4IP1A 4ZL7A 3C1SA 3F4RA 3WT2A 1CQGA 2CAIA 4EVMA 5G5EA 1K3LA 3VWWA 2X8CA 4MZBA 1PQNA 5CRWA 3RPNA 2VAFA 4NXIA 4Q5NA 4LMVA 3TJJA 1EOGA 1OKDA 2OE3A 3ZIJA 2CV4A 1W4VA 4QQ7A 1YF0A 2YV9A 3WGEA 2TRXA 3FZ5A 2P0GA 1M2BA 3UOMA 3DD3A 3TOUA 5B6MA 2JU5A 1G0TA 1VF1A 1AW9A 3IA1A 5B7CA 4DEJA 4FIWA 3DGQA 1JHBA 5DVBA 1WOUA 1ZOFA 2C0FA 3ZREA 1Z3EA 1UC7A 1PL2A 4EDYA 2IMKA 20GSA 1AQWA 4RUVA 2AAWA 4HDEA 5J4UA 2GZZA 2IFQA 3CTGA 1BAYA 2H6XA 3TRQA 1A2JA 5IPGA 5IM9A 1AXDA 3EURA 3NZNA 1OC8A 5DALA 5ELGA 3TUEA 3ZMLA 1HYUA 4GF0A 3F6FA 3IK7A 2L6CA 1XXUA 5JCWA 2A2RA 1MD4A 4FO5A 1O8WA 4Q5FA 2X64A 2LJAA 3NOFA 1A0FA 2LV3A 1M2AA 5KN0A 4MK3A 3A2WA 5CNWA 4GXZA 4XS6A 1PL1A 3UIWA 2WFCA 1SK2A 1M99A 5H5SA 4EL1A 5CP1A 1NSWA 1TP9A 5ID2B 4GQFA 3L9SA 3KCMA 4TR1B 1BQ7A 2NBSA 1KTEA 1T4YA 3CRTA 4G19A 4BWSA 4EUYA 4KX4A 3AY8A 2VCTA 3CMIA 3F4SA 5HFIA 22GSA 5E59A 3GYKA 3LQ7A 4ILFA 1T00A 1PKWA 3US3A 4E8HA 1Y6EA 3LJRA 3RHCA 1WPIA 4OCEA 3V1WA 2DIYA 4TRXA 2GSQA 2KHPA 4O32A 1J9BA 3OR5A 5AGYA 2VCZA 2L57A 1XVWA 3RAZA 5H5RA 3BCIA 4J56E 3TOTA 2MMNA 3L0HA 1QMVA 1TOFA 2CVBA 1MDJA 1A23A 4X0XA 5D93A 2WJUA 4IBPA 3I9V2 2J9HA 3N9JA 1G7EA 1XZOA 1X9SB 5IO2A 1PX6A 1MDIA 5C00A 2GSRA 1TU8A 1WJKA 1FAAA 2MMAA 1GTBA 3F8UA 5GSSA 2WGRA 3DMLA 1E6BA 1GUMA 1O6JA 3UARA 2YCDA 1OKTA 3D21A 4EKZA 2LEGA 3GX0A 3EWLA 4MF7A 5J9CA 5DAKB 5CAXA 1M9BA 4L0UA 3HY2A 4ZIJA 2CZ2A 2NTOA 3KJYA 3DVWA 3O76A 2KOKA 3L78A 1QGVA 2FWFA 1F37A 4KW6A 1B9YC 3IHQA 1YDKA 3QFAC 1OE7A 4O5RA 4XTSA 1F6MC 2RLIA 4IJ3A 2K9FA 4K1FA 1WRYA 3VWVA 2I9HA 3A2VA 3F6DA 1A24A 3TJFA 3N5OA 4AJ6A 1WE0A 3GSTA 1O8XA 3GKNA 1O73A 3ZYWA 4F0BA 3EYTA 4JR4A 1MDKA 5AIVA 6GSVA 4MPGA 3KMOA 2OA7A 3IK9A 4MMMA 4L0WA 3LYKA 1XW5A 1Z5YE 3R2QA 1F9MA 3IPZA 4DSSB 1UVZA 3EINA 4ZB8A 4BA7A 3KTLA 3FEUA 1WMJA 3FZ9A 4TOPA 1TTZA 12GSA 3WYWA 4K9ZA 1PX7A 2VL2A 2H74A 3RDWA 1XW9A 4PQ1A 3FHKA 2I1UA 1GNEA 2C0DA 4JEDA 2YZHA 4MP4A 5EY6A 2E7PA 1EEJA 3U6VA 2YJ7A 3IDVA 3QMXA 1EZKA 1TXXA 4K2DA 2FUG2 2GQKA 3UJ1A 5B8AA 3EVIA 1GH2A 2L5LA 3D5JA 4ID0A 2YOIA 4Q5RA 1TRUA 3GTUB 1I5GA 3TCOA 1YZXA 2DC5A 1WP0A 4IW9A 3VWXA 3QD9A 3G9BA 2R5GA 5F0GA 1N2AA 3IE3A 4N11A 3FR9A 4HQZA 5J9BA 2VCVA 3VPQA 4EC0A 1SJ6A 5DCGA 5JWQB 1URMA 9GSSA 1NHOA 2B7JA 4BPYA 2CVDA 3TRXA 6GSYA 2PERA 4YQVA 2L6DA 3WGXA 1ML6A 3TRPA 3U5RE 1M7TA 3M1GA 4Z7XA 4NPBA 1YQ1A 2DJ0A 2WRTA 1K3YA 2B1KA 3Q18A 1KBNA 1U3IA 3BJ5A 3ME8A 4YQMA 5F8BA 1XWKA 2IMIA 3H93A 3QOUA 4ISDA 1UN2A 4GSSA 2EIOA 3G7IA 4PNGA 2YV7A 4AJ7A 2JACA 5LCZA 1JLVA 2VD1A 4XCSA 1FW1A 3IBHA 2DJ2A 3D0ZA 5A5KA 3F3RA 1JZWA 2QGVA 2ZCTA 3EE2A 4IJIA 5DBQA 2ES7A 2IMFA 3GA4A 3GH9A 2G2QA 2HSHA 5CREA 3BOAA 4GRFA 4HU7A 2A4VA 2OJLA
chains in the Genus database with same CATH superfamily
1O7WB 2BMXA 4PXOA 2YN1A 1BYEA 1K0CA 1X9WB 2MMOA 1EEMA 1Q40B 2XR8B 3M3MA 4N3VA 3J7Yb 2TRCP 1FVJA 1SL2B 3Q90A 5KN3A 1T5YA 1XFLA 2YP6A 1BIRA 1GLQA 4POLA 1D6ZA 1SARA 2K54A 4GSNA 4MJCA 1E2YA 3N9HA 2MYGA 3D3LA 2DBCA 2VM1A 1AR0A 1DMMA 5A4VA 5HOHA 4WF4A 16GSA 1F2EA 4Z2TA 3X41A 4GLTA 3WOEB 3M9KA 1DETA 2CFWA 2FWHA 3KP9A 1RN4A 1V40A 5C04A 2LTKA 3NIVA 1JZDA 3CME3 4CCVA 3KCHA 5BRTA 1N9EA 4BTXA 1GTIA 1T8EB 4HSCX 4EIPA 3BNEA 2XEPA 3DGYA 2OKAA 3DZLA 4V1Ap 3MG2A 2X99A 1EKMA 2Z9SA 1Y25A 3JUNA 5JBSA 2P5RA 1GYBA 3B4OA 2VM2A 3B7CA 4CY8A 5IMFA 3C8EA 1IQ8A 2GT6A 2V2GA 4E8EA 2BMQB 2WZ9A 2A4HA 2WCIA 4G10A 2IWTA 1Z7RA 1BRKA 5DQSA 2ZDJA 1O7NB 2O85A 4WKWA 4WYKB 3FZ4A 5HFGA 4OK0A 2L4CA 2W9QA 4XRAA 4KSMA 4K7OA 1EP8A 1BSCA 3DGLA 2P05A 2CZ3A 4FYCA 2VO4A 3WHOA 2H0IA 5KP4A 4XHMA 1MWUA 4R80A 4DKIA 3F3QA 5DQYA 1C72A 3BCKA 4LYLB 4XBYA 4LL1B 1JBRA 4TN8A 1MNLA 1OVNA 1H75A 2DMLA 3VSYA 1A8LA 1X1UA 2F86B 4YKFA 2H73A 3KFQC 1K9M4 1SK1A 2FD3A 4NHZA 2DJJA 4V2LA 2R41A 2HRKA 2O8VB 2IMJA 4XDVA 3TKSA 3HVNA 5HR3A 3UL5A 3LTAA 3G713 3G7JA 1OF5A 5D82A 1U87A 2HXKA 3AMOA 4K7NA 2PNCA 2EC4A 5L71A 4FCMA 1JBSA 2KP1A 3EB8A 1G7OA 1STDA 1CYVA 3DH2A 3NV0B 4LMWA 2PWJA 3ZTLA 1TFOA 4TXOB 3KMNA 1X1WA 1IYIA 4BVYB 4WBRD 2WGQA 3UNLA 5ID2A 4CPKA 5IERA 1BRSA 5IEPA 1HYFA 1YJW3 2YWOA 1ABAA 4IVFA 1LOXA 4JBBA 2KCDA 4YQUA 4TR1A 1B2MA 2B3SA 2CX0A 1I9DA 3DXOA 1KSIA 1BSBA 3TGZA 4Z2RA 5LC6A 1EOHA 1XBSA 2OOVA 1BNFA 3L0RA 1ERTA 1OAZA 3TKPA 1GNWA 3EN1B 3EX9A 2INXA 2YZUA 3LSZA 1YIT3 5GAND 1NW2A 4MLYA 3FK8A 3KSED 2P31A 2EIRA 1K0DA 4NHFA 1NB3I 3N54B 2RNTA 3O8YA 1A8YA 1PSQA 2R0PA 5COHA 1R5PA 2IPAA 2H76A 1H4OA 4N6TA 2C3NA 1FVKA 1XPVA 1TDIA 3KM6A 5ELAA 1RK4A 2B1LA 4KAEA 3GNJA 3R3EA 1FYSA 2LQQA 3F0IA 3OW22 3I6AA 1VQP3 5RNTA 1JN5B 3IOSA 4AJ8A 1USBA 3CBUA 5ABRA 5IMVA 3HA9A 1K0OA 1S723 1LQGC 2RIIA 2MBTA 1IT8A 3KKGA 1TKDB 1RKYA 2B5EA 1GD4A 4X2HA 4F82A 4OFMA 4BVXA 3IJEB 2JSYA 2C4BA 3K5TA 1X9MB 2OQEA 3SXXA 1RNBA 5B6NA 3H8QA 3ZVJD 3V92A 3CRUA 4KDXA 5ECMB 3NUVA 1S3AA 3MDKA 3HX8A 1QVF2 2AUVA 2LKUA 3Q3FA 1RCLA 3GZXB 4LMIA 1GOYA 3HJPA 3GZRA 3N8BA 1IU7A 2CQ9A 1ROAA 4HBRA 2CX4A 4F0CA 1N8QA 2HRNA 1FW7A 3NBBA 3ZVJA 4N6UA 3KH9A 3KGKA 1B2XA 2HMOB 3GHAA 3HKRA 4MF6A 3UL6A 4RI7A 1Q814 2GU3A 3WMDA 1DMNA 3DWVA 3HD5A 4TR3A 4I8BA 3CNXA 4HM5B 2RSXA 2WOFA 3CMA3 3WGDA 5IW9A 3DXBA 1ISKA 3FCSB 1B4PA 2HNLA 4KB3A 3F63A 4MDCA 5AIXA 3ZMKA 2E2VA 2LS5A 3GUSA 3ZLPA 3AGOA 2VOCA 1UGHI 2H6ZA 2UX0A 1GSFA 2KF6A 2R4VA 3P7XA 2LJRA 1UUVB 1YJ6A 1TK5B 3PGTA 1O7MB 5M1AA 4V1Ag 3C71A 5DAKA 4XS1A 1YF1A 1FOVA 1BX9A 5M19A 1GUHA 3IC8A 2CFGA 1W5ZA 2LNSA 2XC2A 2ZHXB 3IR4A 3KEBA 3QFBC 4GSTA 4BL3A 3WT1A 1DUGA 1C7HA 1U5OA 2F4YA 4ZBDA 2C1YA 2O3OA 4HJ2A 1NO3A 2FLSA 4EDZA 1JKGB 4ZB6A 4HM7B 1RW1A 4CJNA 2HLSA 2ON7A 4BTWA 6RNTA 1SD8A 4OO5A 7RNTA 1X5CA 3K0ZA 3F4TA 1YVBI 1LJRA 4MH3A 2FWGA 1GMQA 5JCGA 2O7KA 4EXRA 4FMAA 2IL3A 2GBWB 3LTDA 1IVXA 3Q19A 1I2EA 2HI7A 1LU4A 4G2EA 2DJKA 2B1XB 2KF5A 3BNDA 2HZEB 2H1BA 4HJMA 4KE3A 1W7CA 2N5BA 2YNXA 2J8XB 2L4VA 1IV7A 4KCEA 1O81A 5D9WA 1A2PA 5IIZA 2OBIA 5GAPD 1KWIA 4KSOA 1IYHA 4MJAA 5KOWA 5HFKA 4R4KA 3FZWA 3ROBA 1OC9B 4V2MA 1KEBA 1CYUA 1AAZA 4N6NB 3LXUX 1TRSA 3GMFA 1ZZYA 1T7PB 3NX0A 2I3YA 1BANA 1DMQA 2FNOA 1OYJA 1BOXA 2F8FA 2K8VA 4DSSA 2PVOC 1FHEA 1I8VA 2CH9A 1GD3A 2GBXB 2Z6BA 1IYYA 1PA3A 3E9JB 5G31A 1TTOA 3D4MA 4GTUA 3W6GA 2V1LA 1FOHA 2I4AA 2I9WA 1K0AA 4L8EA 5ECHB 5F06A 3HXSA 1U6TA 1OGXA 1LNIA 2YWNA 2F99A 2PGTA 5LNKe 2C4JA 1PD21 3G4S3 4KDUA 1GLPA 4ZBAA 4N30A 3J7Yd 1QAFA 1OE8A 2MMZA 2OCTA 4FMBA 3SX1A 3ZITA 1BUJA 3ZFZA 4IN0A 4JRFA 1BG5A 3QR6A 4XS4B 3OX9A 4DVCA 1EWXA 4K0GA 1DYUA 4KH7A 5D81A 5JPUA 1MGRA 3MSOA 2C0GA 2DKHA 2IN3A 3KE7A 1XCCA 3GURA 5IQYA 1RCKA 5D73A 3Q2PA 1BSAA 3FG3A 4AEQA 6GSTA 3T8NA 1I0XA 3TB2A 2VCWA 2QSIA 1QFNA 2K3DA 2HZFA 3I69A 4I97A 5BU4A 1ULIB 3PXMA 2GS3A 1OC3A 3UBLA 3GTUA 2HMLB 3PH9A 1MEKA 2F9SA 4CW9A 1U3AA 5HR0A 1EA2A 1AQXA 1QUWA 2Z7AA 3CPOA 2VD0A 2VIMA 2HMKB 4WWUC 2CFLA 3DIEA 2IA7A 2LYXA 5GSTA 2H1GA 3HOHA 3TJBA 3L9VA 4G9HA 2DMMA 2IMDA 1YY7A 1YJ93 3FKAA 4FQUA 4BU4A 1HNAA 4IS0A 3JUQA 5ECOB 3QAGA 4JF8A 4ECBA 3FH1A 4ACSA 1SKRB 4HKVB 4IQ1A 2C80A 2JZRA 1D6UA 1Y4KA 2JZSA 4POMA 3GL5A 2Z76A 4KUNA 1PGTA 1IQXA 4HM1B 3NXJA 4ULXA 2GZPA 4IQAA 3HI7A 4MZWA 5A4UA 3I43A 2DJ1A 3S67A 1OH0A 2PZVA 4L8OA 2AHEA 1XG8A 2H66A 4J2FA 2VL3A 2N5FA 2XFTA 2LRCA 4ZILA 1V74A 1YGEA 2H8LA 1SU9A 2K18A 2VL9A 4D73B 2EIQA 3EC3A 2CVKA 4HUAA 1TRVA 2C3TA 4ML6A 3APQA 4CHSA 1UGIA 3EU3A 1ZS7A 4EW5A 3GX8A 2K6VA 3G7YA 1SIIA 2PU9C 1RQMA 4RI6A 2OADA 4L5OA 3A76A 4YAPA 3WOFB 3GFKA 2FGXA 1RJOA 3VLNA 4L7KA 2FY6A 1JRQA 2H0GA 3KXOA 3ZG0A 3E0UA 2O87A 1B2SA 1JB5A 1VF3A 3CCL3 2IMEA 1WNHA 2CW9A 4HAAA 1RGLA 3UVHA 4V2NA 3HHVA 3A5WA 5ECKB 2NDOA 4KCAA 1UI8A 2P38A 4WR5A 3KIIA 2H75A 1VQ73 2HSMA 1LOVA 3MAKA 3W8JA 1M1K4 1QK8A 1S5AA 1AIUA 2MBSA 3WD6A 3ZFBA 1M0UA 3GH6A 3NM2A 5CYYA 4KDYA 1K3OA 1W89A 5IEOA 2WB9A 2O89A 1SENA 2DIZA 2W03A 3BU4A 4IT7A 1A67A 2AADA 1Q40A 4ZB9A 1AY7A 1DE2A 5IOWA 1R4WA 1Z6MA 3UEMA 3F40A 3TKQA 1A0RP 2AV4A 2H0HA 3G16A 2R0CA 4WBJA 4BL7B 2P0XA 4TW5A 4G1MB 1BAOA 3WODG 1JLWA 3HCZA 3DYRA 3LT8A 1UCKA 1HNBA 2AJQB 2BNGA 1RRLA 2GTUA 1X1XA 2CT6A 2IYJA 4XDWA 1ZYQB 1GSPA 1V98A 2HRAA 3PR8A 1JB2A 1LXEA 1BRJA 1RGAA 1TFKA 2DSAA 1KC84 2GLRA 2CX3A 1PN0A 1SYXA 2X8GA 1IK3A 1BNEA 1S3CA 2OTJ3 2N5AA 1STFI 2JADA 1TIJA 2P5QA 5GSPA 2XBIA 2LNTA 5A0OB 4NV2A 2L59A 3LFLA 5KN1A 5CRGA 4EE0A 3MG1A 3SLUA 2ALBA 1V9WA 3FY7A 2VL2C 2K8SA 2QIYA 5CLKA 1XIYA 3MNGA 4J5KA 2IUJA 4AKZA 1RGEA 4KFDA 1YNVX 6GSWA 4HEA2 2MZCA 3TDGA 4ZL8A 4I2UA 3ECFA 1EUIC 3EMXA 4WXTA 5AYRB 4MPFA 2H1DA 3RHBA 4I6XA 3M8NA 14GSA 4X1UA 5CF1A 2FA4A 4KGIA 3CSJA 4FCJA 1RGFA 1SJZA 2Y73A 1SQWA 4WYKA 3WA3A 4JE1A 5FT3A 4EF0A 1O7GB 5EPFA 3X42A 1LBKA 4NREA 5D8IA 1B4QA 2CFDA 2A2SA 4HI7A 1DBYA 3IAM2 1VGLA 4K7IA 4PNFA 2KLXA 1MTCA 3BIRA 1G6YA 3K8NA 1WIKA 3V99A 3A5EA 4RZMA 3URPA 4R9KA 1QJGA 1ILOA 1SPUA 5AISA 3DM8A 1M3JA 3IXRA 3HK4A 3CC43 3IC4A 5CK6A 2RFRA 2ZL8A 6GSXA 2QGUA 2CIUA 4RBNA 1AV4A 3GRDA 3KSPA 3FKFA 3C1RA 3H51A 2WS2A 5IOXA 3CC23 1BRNL 3ED3A 5CO3A 2HSYA 5LC7A 7GSPA 1GL8A 1K41A 1VF2A 1O7HB 4FH8A 3P8WA 3DGNA 8GSSA 2L4QA 2OE0A 3S5CA 1UUWB 3QPMA 4KNDA 4TVEA 1TU5A 3S29A 4ICYA 2C3QA 4WETA 2OWPA 1SJIA 3NV0A 3ZFLA 3PGBA 2PN8A 5FHIA 3CCU3 4TXOA 2LJKA 3LGCA 4K61A 4XIHA 3GKXA 1QMAA 3D5GA 4BVYA 3HZ8A 4I4KA 4MH2A 2G0FA 1YJN3 1X1YA 4HQSA 3HVXA 4HM0B 1IVUA 3BD2A 5J5NA 1GSEA 4LZIA 1LOWA 2QEX3 1X5EA 2YFIB 5ELJA 5DDLA 4I2TA 3HIIA 3PCSA 1KQS2 3HJMA 5FGOA 3D5IA 1AUCA 1PFOA 3QAVA 4YH2A 3KTBA 1JZRA 1Q98A 1US1A 1YEPA 1A2KA 1ZGXA 1TI1A 4POBA 1K0NA 3LXTA 1N8R4 2FCHA 4POKA 2C8UA 2ZUPA 1ZX2A 5G2GA 3BBYA 2JL4A 4HM3B 1GSDA 4JR6A 4ZL9A 1XOBA 5CXOA 2KF4A 3DEXA 1GTAA 1SYRA 1LOYA 3F8XA 4MABA 3APOA 1XWBA 4LL4B 1WTHA 1K0BA 1GOUA 3L4NA 1V2AA 4LGQA 1JN5A 1OGZA 1BNJA 3CU3A 4HZ4A 4AGSA 3JCML 2GT5A 4YKGA 4OMVA 1SJWA 3IPTA 2PVQA 1VQ43 2E2TA 2GZYA 3KP8A 1M9GA 1QVG2 2BMRB 3I563 4HM2B 4NMUA 2GU1A 5D9VA 1BNRA 3GRXA 2DJ3A 5DJMA 2OBKA 2BHMA 3X40A 4EO3A 2BMOB 5ECQB 5D96A 4EYCA 4MNNA 2WOHA 1THOA 2VCQA 2YWIA 4EBGA 1Q864 4J5GA 3O6TA 4OFNA 3TJKA 2LSTA 1G6WA 4WHAA 1FG4A 1YGWA 4OFTA 4QL7A 2X8HA 2LUSA 2ML5A 2HMNB 2M46A 3LG6A 3QCPA 2F5WA 4FR9A 3HYPA 1E97A 1RGGA 2D42A 4EXJA 2LRNA 1VQO3 2R3XA 5D9TA 3Q1CA 1Q9EA 17GSA 4HZ2A 4P3YB 3ZIVA 1FGQA 2P0MA 1PN9A 3JVCA 3FG1A 4L8PA 1HKXA 1B8XA 1O7PB 2YANA 5GZZB 3IRAA 5ECLB 1F3AA 2M72A 4ECIA 1DE1A 13GSA 2GSTA 2CG0A 1YIJ3 4CDLA 2FHEA 3CYNA 3JUMA 1ZYNA 3APSA 5AIGA 4G0IA 4ZXGA 3VPTA 4F03A 4F2IA 1BRGA 2H19A 4IGJA 1ZGNA 3KZTA 3QDNA 1EQKA 5A4WA 1B48A 3FGYA 3M8CA 1PY3A 3CXGA 3W8SA 4MJEA 2VLVA 1GY6A 4IP6A 4PUAA 1JKGA 1B9XC 2REMA 1UW1A 2RM5A 4OCFA 2KUCA 3CQFA 1GSUA 1TJDA 5G1KA 3ZZXA 1R7HA 2CAQA 2PBJA 2BJXA 4N10A 5INYA 5EVOA 5D9XA 4IIAA 1XWAA 3FYGA 7GSSA 2A2PA 3QAWA 4NWYA 1VQ83 5KN2A 3DRNA 1GSYA 1ULJB 2CX1A 1BRIA 1FGTA 1TK8B 1YKCA 2GQLA 2HZEA 3EU4A 2PUKC 3F7SA 2V1MA 2V6OA 1GS3A 1VQL3 1EP7A 4XRDA 1R4CA 2FNQA 1AQVA 1XOAA 2R2JA 3C73A 3LEFA 3D4TA 3DVXA 2JDIH 2BT3A 4G0KA 2RM6A 3TKSC 3T8UA 2WGOA 2R37A 1M3IA 3MIXA 4HOHA 1GP1A 1Z1SA 3FSDA 3RNTA 3FLJA 4IKHA 1TRQA 1WWJA 1OC9A 3SEDA 2BU4A 1EV9A 5ECIB 2L5OA 2YPMA 2IFQB 2GVPA 1Q824 2F3MA 3H1NA 2V6KA 2ZNMA 5JWRB 4CDOA 3DGOA 5E4WA 4YAVA 3GN3A 5DALB 1EG9B 2E2GA 3EMPA 3LXZA 4ECCA 3CSHA 2W56B 3GZYB 3SOYA 5G2ZA 3VI7A 4GWRA 1MGWA 3F9SA 4ECJA 3GWRA 4LLRA 1W6YA 2LQVA 2HRFA 4TR0A 1ZMAA 3UJMA 1A2LA 3UBKA 4PGTA 3GIXA 4G0LA 1GUKA 4JU5A 1V58A 4OD7A 4XS4A 5ECRB 2OOVC 3ISOA 4PX1A 8CHOA 1V57A 3GSSA 2FXTA 1TU7A 5KP1A 1VZZA 3CXC2 5HQPA 1U88A 2WO0A 4TKYA 4KA0A 1YEXA 2XFSA 1GSQA 5ECNB 2WULA 2GXFA 3GL3A 4TR4A 4TXVA 1ZYEA 3A3TA 3TKSE 1THXA 4BWQA 1PRXA 1UI7A 1T2IA 4F9ZA 4BIKA 2PMTA 4GB5A 3LORA 2OTL3 2SBLA 4ML1A 1GULA 3Q74A 1AVLA 2XH9A 2V41A 2CG1A 2P09A 4N6LA 2R6KA 1ST9A 5FWGA 3C7MA 1M9AA 5AN1A 5KOXA 4QL9A 2YX9A 1HNCA 4DSRA 2OQEC 19GSA 1O7UA 3LW9A 4KT3B 1FO5A 2AYTA 11GSA 1MD3A 1K0MA 3GAXA 2RUFA 1MWTA 2FA8A 3X3YA 2HYXA 3P2AA 5F05A 2D2ZA 1K8A4 6GSSA 3FZAA 3FR3A 10GSA 3KD0A 3CNMA 1BSEA 2B5YA 1TW9A 4MA9A 2E0QA 1UUGB 4H61A 1A2MA 1PKZA 4OO4A 4K0NA 4FYUA 3IV4A 2H70A 2H1AA 3D79A 3F14A 2CWUA 4D73A 2W6JH 1U8CB 1VF4A 2F8AA 2GEYA 2B5XA 1BNGA 1B20A 1GSSA 2B6MA 2XRXB 2OACA 3A2XA 3FR6A 5IMDA 1LVNA 1O85A 5FW5A 4X43A 1LQMB 1Z9HA 3VFIA 1RSNA 2YWMA 4K6XA 1W00A 5J41A 4JRRA 5BVBA 3S27A 2JSZA 4RNTA 2RUEA 2GSSA 4HYZA 2H71A 3L9UA 2XHFA 4RNZA 3LMLA 2NPBA 2HFDA 3FW2A 3ZL5A 1QXHA 4MMZB 4OWYA 1ERVA 1N5HA 2H30A 4EIQA 1M1XB 1I2GA 3SVAA 4MJBA 2XPDA 4EV5A 4I5QA 3E3EA 4K5SA 1J0FA 4J57E 1N8JA 3LYPA 1TRPA 5AIHA 4K90B 2IIYA 3CSIA 2PPTA 1SL1B 2F56A 1HD2A 4WEYA 1ZYPA 1NHYA 4STDA 3UB1A 1M2DA 2FWEA 1WMNA 3EJVA 1VRSD 1XWCA 3GKKA 4GCIA 3Q6OA 3DMCA 4OVMA 5ENUA 1XW6A 4ZBBA 2MF7A 4IHUA 1YHQ3 3LOYA 5IO0A 1GOVA 3CCM3 1UA5A 3AGNA 1NJI4 2V32A 3CTFA 3ZRDA 4BL7A 1TK0B 4H86A 4NHWA 3IAS2 3SOAA 1CQHA 5AIFA 2B24B 4USSA 2IUKA 5F07A 2XSOB 6GSUA 5IG4A 3DY5A 1X5DA 3UL3A 1JJ22 4NAXA 2AB6A 2TIRA 1UCIA 4N6V0 4KZ1A 4BIRA 6STDA 1JB4A 1ERWA 2CA8A 2H01A 4MZCA 4AF2A 3VI5A 2GSPA 5HGRA 3SBCA 5IMCA 2W2CA 1BJXA 3RGRA 3X3ZA 1EGRA 3MWHA 5KP3A 4PEJA 4ORLA 4FYBA 1FUWA 4O7HA 3VK9A 2CWVA 1JV2B 5KEJA 4MJDA 4HS1A 5TGNA 5BMUA 1YKAA 3MSZA 2HE3A 2VUPA 4PURA 5CRDA 1TI3A 3G0KA 3U1WA 2XBQA 1D6YA 2XSHB 4K1VA 3CCS3 2KAAA 2YFJB 3D6IA 3QK9A 4O8SA 4LSOA 1GWCA 5AYSC 1GY7A 5IG5A 2DLXA 1PU4A 1J08A 1VQM3 5G30A 3EN8A 3ER7A 1HZ1A 3S28A 4NV5A 2CHCA 1FZUA 3J7Yk 1R5AA 1EV4A 4EV2A 1EGOA 3WR2A 2CC3A 2W9PA 1GY5A 4X4JA 4N0VA 3H4KA 1FUTA 1ERUA 2WDUA 5DJLA 3DKSA 1GTUA 3GKMA 2VLTA 2IY2A 3ALAA 5ECSA 1VQK3 1KNGA 1UCJA 3CC73 4HZ9B 3HZ4A 1QAKA 2J23A 1B3SA 4FMCA 3VF1A 3ERFA 2B7KA 1B27A 1X0RA 4K8MA 4RNYA 4HOJA 4RQRA 5IPHA 3HJOA 1FUSA 1W01A 3H3HA 3X3XA 2QA1A 4O5QA 1ROVA 1SKWB 3LTBA 1QQ2A 3ERGA 5STDA 2KP2A 1NM3A 2C11A 3EBYA 4RQXA 3S9FA 5JWOB 1G02A 1Q42A 4PUFC 1IT7A 1UDII 2HT9A 1SK0A 1TP6A 2CK3H 2GQMA 4WR4A 5HR2A 5G5FA 2OE1A 1ACVA 3TKRA 5BXQA 1I0VA 2UZ8A 3M0FA 3VWUA 5ECPB 1T4ZA 1AQZA 2I81A 3TJGA 2MC8A 1JFUA 4KFEA 18GSA 3FG4A 5H5QA 3K9MC 1XVQA 3O3TA 1HU9A 2VCXA 2NVLA 4HM4B 4WF5A 3HVVA 1Q7HA 3CCR3 4HU9A 4O02B 2GDRA 2JQ5A 2R0GA 2YJHA 1SKSB 4XB5A 1FB0A 1ZCPA 1T3BA 2YFLB 3BLZA 1XWGA 3GV1A 3UVTA 3E99A 4L5LA 5HR1A 2HMMB 3NQYA 1Z6NA 3ERWA 2JZTA 1JZOA 3PINA 3OWUA 4J9AA 2BTOT 3LWAA 1JBTA 3SWLA 3ZG5A 1SD9A 3AHWA 9RNTA 1W6CA 2FGTA 1C54A 5G1LA 3VURA 3PCRA 3EE1A 5IMZA 4N6OB 1ON4A 5B8BA 1FGRA 1I3FA 4HM6B 1BU4A 3KZQA 2E2MA 2VLUA 3PYJA 3BNCA 4LA1A 1ZL9A 1GRXA 2LRTA 1IVVA 2C0EA 4EC6A 3UMAA 4JZQA 2IJYA 5IMAA 2QKEA 2QC7A 1G96A 3STDA 1T1VA 1PYLA 3H79A 5IENA 2SARA 1DVDA 4IELA 1TRWA 1R4YA 2M80A 2LQOA 1R26A 3CCJ3 5CRHA 4PQHA 3RBTA 1HQOA 2GGTA 1F3BA 3F9UA 3HVSA 2XPEA 4MF5A 2H6YA 3NBJA 4K5RA 3D22A 1YVSA 1RRHA 1FB6A 3VGNA 3RGAA 3RPPA 2HMJB 4GQCA 4K2XA 4MCUA 4R1KA 3FRCA 4N0ZA 1PFPA 2H72A 4Q5QA 1JNQA 5AIIA 1VQQA 4GHOA 5JCUA 5J3RA 1PMTA 4AKYA 1BEDA 4O92A 4GL6A 3LH4A 4DSQA 1SL0B 2RGQA 4XBTA 3P90A 3ME7A 3KH7A 3M9JA 5LD0A 3SYUA 1NU3A 2AAEA 3LT9A 3UAPA 1S3DA 1DSBA 4N6MA 5DCHA 3F8HA 2F51A 1Q4JA 3HDCA 2CWTA 1AC1A 1Z7PA 4PQIA 3KIJA 5EL8A 1BNIA 2ON5A 3EHCA 1OCVA 4IP1A 4ZL7A 1DE3A 1IQYA 3K7CA 3NBRA 3C1SA 3F4RA 3WT2A 2Z77A 4CY6A 1CQGA 2CAIA 1W02A 4PTSA 4EVMA 5G5EA 1K3LA 3VWWA 1FGMA 2X8CA 1GMRA 6GSPA 3OWYA 4MZBA 1PQNA 5CRWA 3RPNA 5IF6A 2VAFA 4NXIA 4QWTA 4LMVA 4Q5NA 3TJJA 1EOGA 1OKDA 2OE3A 1NNVA 3ZIJA 2CV4A 4MMYB 5DRVA 4KF9A 1W4VA 4A5PA 4QQ7A 1FA3A 1BVIA 3MYDA 1YF0A 2YV9A 1DVCA 3WGEA 2TRXA 1W2B2 1MWSA 4GSPA 1W6GA 3FZ5A 2P0GA 1M2BA 4HZBB 3UOMA 3DD3A 1RDSA 3TOUA 5B6MA 2JU5A 1NB5I 1G0TA 1VF1A 1AW9A 3IA1A 1S3RA 5B7CA 4DEJA 4BL2A 3IMAB 5IG0A 4FIWA 2K0MA 3DGQA 4BTYA 5DVBA 1JHBA 2ML6A 1WOUA 1ZOFA 2C0FA 3ZREA 1Z3EA 1UC7A 1PL2A 4EDYA 1CQSA 3MG3A 2IMKA 20GSA 1AQWA 2R4IA 3PPUA 4RUVA 2AAWA 2CFKA 4HDEA 2QA43 2Q07A 5J4UA 2GZZA 3NM7A 2IFQA 2W04A 2ZA4A 3OXAA 2CKFB 1M904 2C10A 4MMXB 3V98A 3CTGA 1BAYA 2H6XA 3TRQA 1A2JA 2D1WA 5IPGA 2F5MA 5IM9A 1AXDA 3EURA 3NZNA 1OC8A 1B21A 3MKIA 5DALA 5ELGA 3TUEA 1OPYA 1J2BA 3ZMLA 1I3IA 3CD63 1HYUA 1IDPA 3F7XA 3F6FA 2W56A 4GF0A 1RGCA 3IK7A 3CCQ3 4J8TA 2L6CA 2BIRA 5JPPA 1N5PA 1XXUA 5JCWA 2A2RA 1WQLB 1OACA 1MD4A 4FO5A 4KVHA 1O8WA 4Q5FA 1WMOA 2LJAA 2X64A 1A0FA 3NOFA 3MHEA 3EBTA 2LV3A 1M2AA 5KN0A 1OF5B 2BO9B 3HIGA 4MK3A 3A2WA 3AMOB 1MWRA 5CNWA 3I0YA 2Y74A 4GXZA 4XS6A 1PL1A 3UIWA 4HJLB 2WFCA 1SK2A 1M99A 3G8ZA 5H5SA 4EL1A 1I70A 5CP1A 1NSWA 1TP9A 5ID2B 4K1UA 4GQFA 1OHPA 3GSPA 3L9SA 1B2ZA 1IVWA 3KCMA 4TR1B 3DGMA 1WMPA 1BQ7A 1RHLA 2NBSA 1KTEA 1T4YA 3CRTA 4G19A 4BWSA 4EUYA 4KX4A 1E3VA 3AY8A 3MWZA 1W4NA 1OHSA 2VCTA 1VQ93 1F8NA 3CMIA 4XM4A 1AVKA 3B8LA 3F4SA 4R9LA 5HFIA 1YI23 22GSA 5EVHA 5IG3A 1RN7A 1RTUA 3JUPA 5E59A 3GYKA 3LQ7A 4ILFA 1T00A 1PKWA 3US3A 1ASKA 4E8HA 1Y6EA 3LJRA 3RHCA 4Z2UA 1WPIA 4OCEA 3CCV3 3V1WA 2DIYA 4TRXA 4O3VA 2GSQA 1N9JA 2KHPA 2UUGC 8RNTA 4O32A 1J9BA 3OR5A 3JUOA 4BVXB 2M7OA 1VQN3 5AGYA 2VCZA 2L57A 2QA2A 3EF8A 5CF2A 1Q7Y4 1XVWA 3RAZA 5H5RA 3OV4A 3BCIA 4J56E 3TOTA 2MMNA 3L0HA 1QMVA 1UCLA 3HZPA 1TOFA 1I2FA 2CVBA 1MDJA 1A23A 4X0XA 5D93A 3LYGA 2DKIA 2WJUA 4IBPA 1BNSA 3I9V2 2J9HA 4O2HA 3N9JA 1G7EA 1XZOA 1X9SB 5IO2A 1PX6A 2L1SA 1MDIA 3EPTA 3NQZA 5C00A 2GSRA 4XBXA 1TU8A 1WJKA 3NHXA 2XGLA 1FAAA 1K734 2MMAA 1GTBA 3F8UA 5GSSA 2WGRA 3DMLA 1E6BA 1GUMA 1GMPA 1O6JA 1LNHA 3UARA 1LRAA 4ZM8A 2YCDA 4HVNA 1FGOA 5BIRA 4O5UA 1OKTA 3D21A 4EKZA 1BGSA 2LEGA 3GX0A 1QALA 3EWLA 4MF7A 5J9CA 5DAKB 5CAXA 4U13A 1M9BA 4L0UA 3HY2A 4ZIJA 2CZ2A 2NTOA 1RGHA 3KJYA 2KRTA 3RDEA 4HM8B 5AI1A 3DVWA 3O76A 2KOKA 3L78A 1QGVA 2FWFA 3B4PA 1F37A 4KW6A 1B9YC 3IHQA 1YDKA 1B2UA 2W0QA 3QFAC 1OE7A 2A15A 4O5RA 4XTSA 4OUQA 1F6MC 4TX4A 2RLIA 4IJ3A 2K9FA 4K1FA 1WRYA 3VWVA 2I9HA 3A2VA 4WP5A 3T0UA 3F6DA 1A24A 3TJFA 3QRDA 3N5OA 4AJ6A 1WE0A 3GSTA 3EC9A 1O8XA 1BSDA 1RLSA 3GKNA 1IV9A 5AEWB 1O73A 2RBIA 3MYTA 1NWWA 1ZO2A 3ZYWA 4F0BA 3EYTA 4JR4A 4FCZA 3K63A 1MDKA 5AIVA 6GSVA 4MPGA 3KMOA 2OA7A 3IK9A 4MMMA 4L0WA 3G6E3 3LYKA 1XW5A 3EQQB 2O9UX 2E2UA 1Z5YE 3R2QA 1F9MA 7STDA 3IPZA 4DSSB 1E3RA 1UVZA 3EINA 4ZB8A 2GEXA 3KTLA 4BA7A 1KD14 3FEUA 3OWSA 1WMJA 3FZ9A 4TOPA 1TTZA 12GSA 1K28A 3WYWA 4K9ZA 1OHOA 3CPW2 1PX7A 2VL2A 3KN4A 2HOHA 2H74A 3RDWA 2RCDA 1XW9A 4PQ1A 3FHKA 2I1UA 1GNEA 1RN1A 5EEOA 1VQ63 2C0DA 5D83A 4WFOA 4JEDA 2YZHA 4FMDA 4Q53A 5EQLA 4MP4A 5EY6A 1RNTA 4KFFA 2E7PA 1EEJA 3U6VA 3MPHA 1NDOB 2YJ7A 3IDVA 3QMXA 1EZKA 3CCE3 3GZBA 1TXXA 4K2DA 2FUG2 2GQKA 3UJ1A 2UGIA 3A5IA 5B8AA 3EVIA 1GH2A 2L5LA 3D5JA 4ID0A 2YOIA 1W2ZA 4Q5RA 1TRUA 1L5GB 3GTUB 1I5GA 3TCOA 1YZXA 2DC5A 1WP0A 4IW9A 3VWXA 3QD9A 1RMSA 3G9BA 3BB9A 2R5GA 5F0GA 1N2AA 3IE3A 4N11A 1CH0A 3FR9A 4HQZA 5J9BA 1CEWI 2VCVA 3VPQA 4EC0A 1BUQA 3I553 4MEIA 1SJ6A 5DCGA 2F98A 5JWQB 3LZAA 1URMA 1VQ53 9GSSA 1NHOA 2B7JA 4BPYA 3PS8A 3PZWA 1SIHA 2CVDA 5I97A 3TRXA 3FF2A 1OUNA 5ELUA 6GSYA 2PERA 4YQVA 2L6DA 3WGXA 1ML6A 3TRPA 3U5RE 1M7TA 3WDGB 3M1GA 4Z7XA 4NPBA 1RGKA 1YQ1A 1A2VA 2DJ0A 1MOLA 3WA2X 2WRTA 2X4AA 1TUHA 2STDA 3LTCA 1K3YA 2B1KA 3Q18A 1KBNA 1BRHA 1U3IA 3BJ5A 3ME8A 1T2HA 2KXGA 4YQMA 5M18A 5F8BA 1XWKA 3DUKA 2IMIA 3H93A 3QOUA 4ISDA 1UN2A 3D9RA 4GSSA 3AHSA 2EIOA 3G7IA 4PNGA 2YV7A 1A90A 4AJ7A 3FMWA 4IPBA 4X2OA 2JACA 2KF3A 5DREA 4H3UA 5LCZA 1JLVA 2VD1A 4XCSA 1FW1A 3IBHA 2DJ2A 3D0ZA 5A5KA 3F3RA 2XF3A 5AEUB 1JZWA 2QGVA 2ZCTA 3EE2A 4IJIA 4LEHA 2XGNA 3D4AA 3FF0A 5DBQA 2ES7A 2IMFA 3GA4A 2X49A 3GH9A 2G2QA 2HSHA 5CREA 3BOAA 3BNBA 4GRFA 4HU7A 2A4VA 3U97A 3IHGA 2OJLA
chains in the Genus database with same CATH topology
2BMXA 4PXOA 2YN1A 1BYEA 1K0CA 1X9WB 2MMOA 1EEMA 3M3MA 3J7Yb 2TRCP 1FVJA 1SL2B 5KN3A 1XFLA 2YP6A 1GLQA 4POLA 4GSNA 4MJCA 1E2YA 2MYGA 2DBCA 2VM1A 5A4VA 4WF4A 16GSA 1F2EA 4Z2TA 4GLTA 3M9KA 2FWHA 3KP9A 1V40A 5C04A 2LTKA 3NIVA 1JZDA 5BRTA 1GTIA 1T8EB 4EIPA 4V1Ap 2OKAA 2X99A 2Z9SA 1Y25A 2P5RA 2VM2A 4CY8A 5IMFA 3C8EA 2GT6A 2V2GA 4E8EA 2WZ9A 2A4HA 2WCIA 4G10A 2IWTA 1Z7RA 5DQSA 2O85A 4WKWA 3FZ4A 5HFGA 2L4CA 4XRAA 4KSMA 4K7OA 1EP8A 2CZ3A 4FYCA 2VO4A 2H0IA 4XHMA 3F3QA 5DQYA 1C72A 3BCKA 4LL1B 4TN8A 1OVNA 1H75A 2DMLA 1A8LA 4YKFA 2H73A 1SK1A 2FD3A 4NHZA 2DJJA 4V2LA 2HRKA 2O8VB 3TKSA 5HR3A 3G7JA 1U87A 2HXKA 4K7NA 2EC4A 5L71A 2KP1A 1G7OA 4LMWA 3ZTLA 2PWJA 4TXOB 3KMNA 1IYIA 4BVYB 4WBRD 5ID2A 2YWOA 1ABAA 4IVFA 4JBBA 4YQUA 4TR1A 2B3SA 1I9DA 3TGZA 4Z2RA 1EOHA 1XBSA 1ERTA 1OAZA 3TKPA 1GNWA 2YZUA 5GAND 3LSZA 1NW2A 4MLYA 3FK8A 2P31A 2EIRA 1K0DA 1A8YA 1PSQA 2R0PA 5COHA 1R5PA 2IPAA 2H76A 1H4OA 2C3NA 1FVKA 1XPVA 1TDIA 3KM6A 5ELAA 1RK4A 2B1LA 4KAEA 3GNJA 3R3EA 2LQQA 3F0IA 3I6AA 3IOSA 4AJ8A 1USBA 3CBUA 5ABRA 5IMVA 3HA9A 1K0OA 2RIIA 2MBTA 1TKDB 2B5EA 4F82A 4OFMA 4BVXA 2JSYA 1X9MB 5B6NA 3H8QA 3ZVJD 3CRUA 4KDXA 5ECMB 3MDKA 1S3AA 2AUVA 2LKUA 3HJPA 2CQ9A 2CX4A 4F0CA 2HRNA 3ZVJA 3KH9A 3KGKA 3GHAA 3HKRA 4MF6A 4RI7A 3DWVA 3HD5A 4TR3A 4I8BA 3WGDA 3DXBA 1B4PA 2HNLA 4KB3A 3F63A 4MDCA 5AIXA 3ZMKA 2LS5A 3GUSA 3ZLPA 2VOCA 2H6ZA 1GSFA 2R4VA 3P7XA 2LJRA 1YJ6A 1TK5B 3PGTA 4V1Ag 3C71A 5DAKA 4XS1A 1YF1A 1FOVA 1BX9A 1GUHA 3IC8A 2XC2A 2LNSA 3IR4A 3KEBA 3QFBC 4GSTA 3WT1A 1DUGA 4ZBDA 2C1YA 4HJ2A 2FLSA 4EDZA 4ZB6A 1RW1A 2HLSA 2ON7A 1SD8A 4OO5A 1X5CA 3F4TA 1LJRA 4MH3A 2FWGA 5JCGA 2O7KA 2IL3A 3Q19A 2HI7A 1LU4A 4G2EA 2DJKA 2HZEB 2H1BA 4HJMA 4KE3A 2N5BA 2YNXA 4KCEA 1O81A 5D9WA 5IIZA 2OBIA 5GAPD 4KSOA 1IYHA 4MJAA 5KOWA 5HFKA 1OC9B 4V2MA 1KEBA 1AAZA 1TRSA 3GMFA 1ZZYA 1T7PB 2I3YA 2FNOA 1OYJA 2F8FA 2K8VA 4DSSA 2PVOC 1FHEA 1PA3A 5G31A 3E9JB 3D4MA 4GTUA 3W6GA 1FOHA 2I4AA 1K0AA 4L8EA 5ECHB 5F06A 3HXSA 1U6TA 2YWNA 2PGTA 5LNKe 2C4JA 1PD21 4KDUA 1GLPA 4ZBAA 4N30A 1OE8A 2MMZA 3ZITA 4IN0A 1BG5A 3QR6A 4XS4B 4DVCA 1EWXA 4K0GA 4KH7A 2C0GA 2DKHA 2IN3A 1XCCA 3GURA 5IQYA 5D73A 6GSTA 3TB2A 2VCWA 2QSIA 1QFNA 2HZFA 4I97A 3I69A 2GS3A 1OC3A 3UBLA 3GTUA 3PH9A 1MEKA 2F9SA 4CW9A 1U3AA 5HR0A 1AQXA 1QUWA 2VD0A 2VIMA 3DIEA 5GSTA 2H1GA 3TJBA 3L9VA 4G9HA 2DMMA 2IMDA 1YY7A 4FQUA 1HNAA 4IS0A 5ECOB 3QAGA 4ECBA 4ACSA 1SKRB 4IQ1A 2C80A 2JZRA 2JZSA 4POMA 3GL5A 4KUNA 1PGTA 4ULXA 2GZPA 4IQAA 4MZWA 5A4UA 3I43A 2DJ1A 2AHEA 2H66A 4J2FA 2VL3A 2N5FA 4ZILA 2LRCA 2H8LA 1SU9A 2K18A 2VL9A 4D73B 2EIQA 3EC3A 2CVKA 4HUAA 1TRVA 2C3TA 4ML6A 3APQA 4CHSA 3EU3A 3GX8A 2K6VA 3G7YA 2PU9C 1RQMA 4RI6A 2OADA 4L5OA 4YAPA 3GFKA 2FGXA 3VLNA 2FY6A 2H0GA 3KXOA 3E0UA 2O87A 1VF3A 2IMEA 3UVHA 4V2NA 3HHVA 3A5WA 5ECKB 2NDOA 4KCAA 4WR5A 2H75A 2HSMA 3MAKA 3W8JA 1QK8A 1AIUA 2MBSA 3WD6A 3ZFBA 1M0UA 3GH6A 5CYYA 4KDYA 1K3OA 1W89A 2WB9A 2O89A 1SENA 2DIZA 4ZB9A 1DE2A 5IOWA 1R4WA 1Z6MA 3UEMA 3TKQA 1A0RP 2AV4A 2H0HA 2R0CA 4WBJA 4BL7B 4TW5A 1JLWA 3HCZA 3DYRA 1HNBA 2AJQB 2GTUA 2CT6A 2IYJA 1ZYQB 1V98A 2HRAA 3PR8A 2DSAA 2GLRA 2CX3A 1PN0A 1SYXA 2X8GA 1S3CA 2N5AA 2JADA 2P5QA 2XBIA 2LNTA 4NV2A 2L59A 3LFLA 5KN1A 5CRGA 4EE0A 2ALBA 1V9WA 3FY7A 2VL2C 2K8SA 1XIYA 3MNGA 6GSWA 4HEA2 2MZCA 3TDGA 4ZL8A 4I2UA 4WXTA 3EMXA 4MPFA 2H1DA 3RHBA 4I6XA 3M8NA 14GSA 4X1UA 2FA4A 4KGIA 3CSJA 1SJZA 4JE1A 5FT3A 4EF0A 5EPFA 1LBKA 5D8IA 1B4QA 2A2SA 4HI7A 1DBYA 3IAM2 1VGLA 4K7IA 4PNFA 2KLXA 1MTCA 1G6YA 3K8NA 1WIKA 1ILOA 5AISA 3IXRA 3IC4A 6GSXA 3FKFA 3C1RA 2WS2A 5IOXA 3ED3A 5CO3A 2HSYA 1GL8A 1VF2A 4FH8A 3P8WA 8GSSA 2L4QA 2OE0A 3QPMA 4TVEA 4KNDA 4ICYA 2C3QA 4WETA 1SJIA 3ZFLA 2PN8A 5FHIA 4TXOA 2LJKA 3LGCA 4XIHA 3GKXA 4BVYA 3HZ8A 4MH2A 2G0FA 4HQSA 3HVXA 3BD2A 5J5NA 1GSEA 1X5EA 5DDLA 4I2TA 3HJMA 1AUCA 3QAVA 4YH2A 3KTBA 1JZRA 1Q98A 1YEPA 1TI1A 4POBA 1K0NA 3LXTA 2FCHA 4POKA 2C8UA 2ZUPA 3BBYA 2JL4A 1GSDA 4JR6A 4ZL9A 1XOBA 3DEXA 1GTAA 1SYRA 4MABA 3APOA 1XWBA 4LL4B 1K0BA 3L4NA 1V2AA 4HZ4A 4AGSA 3JCML 2GT5A 4YKGA 4OMVA 2PVQA 2GZYA 3KP8A 4NMUA 5D9VA 3GRXA 2DJ3A 5DJMA 2OBKA 4EO3A 5ECQB 5D96A 4MNNA 1THOA 2VCQA 2YWIA 3O6TA 4OFNA 3TJKA 2LSTA 1G6WA 1FG4A 4OFTA 4QL7A 2X8HA 2LUSA 2M46A 3LG6A 3QCPA 3HYPA 4EXJA 2LRNA 2R3XA 5D9TA 17GSA 4HZ2A 4P3YB 3ZIVA 1PN9A 1B8XA 2YANA 5GZZB 3IRAA 5ECLB 1F3AA 2M72A 4ECIA 1DE1A 13GSA 2GSTA 2FHEA 3CYNA 3APSA 1ZYNA 4G0IA 4ZXGA 3VPTA 4F03A 4F2IA 2H19A 4IGJA 1ZGNA 3QDNA 5A4WA 1B48A 3CXGA 3W8SA 4MJEA 2VLVA 4IP6A 4PUAA 2REMA 1B9XC 2RM5A 4OCFA 2KUCA 1GSUA 1TJDA 5G1KA 3ZZXA 1R7HA 2CAQA 2PBJA 2BJXA 4N10A 5INYA 5EVOA 5D9XA 1XWAA 3FYGA 7GSSA 2A2PA 3QAWA 4NWYA 5KN2A 3DRNA 1GSYA 1TK8B 1YKCA 2GQLA 2HZEA 3EU4A 2PUKC 2V1MA 2V6OA 1EP7A 4XRDA 1AQVA 1XOAA 2R2JA 3C73A 3LEFA 3D4TA 3DVXA 4G0KA 2RM6A 3TKSC 2R37A 3MIXA 1GP1A 4IKHA 5ECIB 1WWJA 1OC9A 1EV9A 2L5OA 2YPMA 2IFQB 2GVPA 2F3MA 3H1NA 2V6KA 2ZNMA 5JWRB 4CDOA 5E4WA 4YAVA 3GN3A 5DALB 2E2GA 3EMPA 4ECCA 3LXZA 3CSHA 5G2ZA 3VI7A 4GWRA 4ECJA 4LLRA 2HRFA 4TR0A 1ZMAA 1A2LA 3UBKA 4PGTA 3GIXA 4G0LA 1GUKA 4JU5A 4OD7A 1V58A 4XS4A 5ECRB 3ISOA 4PX1A 1V57A 3GSSA 1TU7A 5HQPA 1U88A 4TKYA 4KA0A 1YEXA 1GSQA 5ECNB 2WULA 3GL3A 4TR4A 4TXVA 1ZYEA 3A3TA 3TKSE 1THXA 4BWQA 1PRXA 4F9ZA 2PMTA 3LORA 4ML1A 1GULA 3Q74A 2V41A 2R6KA 1ST9A 5FWGA 3C7MA 1M9AA 5AN1A 5KOXA 4QL9A 1HNCA 4DSRA 19GSA 1O7UA 3LW9A 1FO5A 2AYTA 11GSA 1MD3A 1K0MA 2RUFA 2FA8A 2HYXA 3P2AA 5F05A 2D2ZA 6GSSA 3FZAA 3FR3A 10GSA 3KD0A 2B5YA 1TW9A 4MA9A 2E0QA 1A2MA 1PKZA 4OO4A 4K0NA 4FYUA 3IV4A 2H70A 2H1AA 4D73A 1VF4A 2F8AA 2B5XA 1GSSA 2B6MA 2OACA 3A2XA 3FR6A 5IMDA 1O85A 4X43A 1Z9HA 3VFIA 2YWMA 4K6XA 5J41A 4JRRA 2JSZA 2RUEA 2GSSA 2H71A 3L9UA 2XHFA 2NPBA 2HFDA 3FW2A 3ZL5A 1QXHA 4OWYA 1ERVA 2H30A 4EIQA 4MJBA 2XPDA 4I5QA 3E3EA 4K5SA 1J0FA 4J57E 1N8JA 3LYPA 2IIYA 3CSIA 2PPTA 1SL1B 1HD2A 4WEYA 1ZYPA 1NHYA 2FWEA 1M2DA 1VRSD 1XWCA 3GKKA 4GCIA 3Q6OA 5ENUA 1XW6A 4ZBBA 4IHUA 5IO0A 1UA5A 3CTFA 2V32A 3ZRDA 4BL7A 1TK0B 4H86A 4NHWA 3IAS2 1CQHA 4USSA 5F07A 6GSUA 1X5DA 3UL3A 4NAXA 2AB6A 2TIRA 1ERWA 2CA8A 2H01A 4MZCA 4AF2A 3VI5A 3SBCA 5IMCA 1BJXA 1EGRA 3MWHA 4FYBA 4O7HA 3VK9A 5KEJA 4HS1A 5BMUA 1YKAA 3MSZA 2HE3A 2VUPA 4PURA 5CRDA 1TI3A 2XBQA 3D6IA 2DLXA 1GWCA 1J08A 5G30A 4NV5A 3J7Yk 1R5AA 1EV4A 1EGOA 4X4JA 4N0VA 3H4KA 1ERUA 2WDUA 5DJLA 3DKSA 1GTUA 3GKMA 2VLTA 2IY2A 5ECSA 1KNGA 3HZ4A 2J23A 3ERFA 2B7KA 1X0RA 4K8MA 5IPHA 4HOJA 4RQRA 3HJOA 2QA1A 4O5QA 1SKWB 1QQ2A 3ERGA 2KP2A 1NM3A 4RQXA 3S9FA 5JWOB 4PUFC 2HT9A 1SK0A 2GQMA 4WR4A 5HR2A 5G5FA 2OE1A 1ACVA 3TKRA 2UZ8A 3M0FA 3VWUA 5ECPB 1T4ZA 2I81A 3TJGA 1JFUA 18GSA 5H5QA 1XVQA 3O3TA 2VCXA 2NVLA 4WF5A 3HVVA 4HU9A 2GDRA 2R0GA 2YJHA 1SKSB 1FB0A 1ZCPA 1T3BA 1XWGA 3GV1A 3UVTA 4L5LA 5HR1A 1Z6NA 3ERWA 2JZTA 1JZOA 3PINA 2BTOT 3LWAA 3SWLA 1SD9A 5G1LA 3VURA 5IMZA 1ON4A 5B8BA 3KZQA 2E2MA 2VLUA 4LA1A 1ZL9A 1GRXA 2LRTA 2C0EA 3UMAA 4JZQA 2IJYA 5IMAA 2QKEA 2QC7A 1T1VA 3H79A 4IELA 1TRWA 2M80A 2LQOA 1R26A 5CRHA 4PQHA 3RBTA 1HQOA 2GGTA 1F3BA 3F9UA 3HVSA 2XPEA 4MF5A 2H6YA 4K5RA 3D22A 1FB6A 3RPPA 4GQCA 4K2XA 4MCUA 3FRCA 4N0ZA 2H72A 4Q5QA 5JCUA 5J3RA 1PMTA 1BEDA 4O92A 4DSQA 1SL0B 3P90A 3ME7A 3KH7A 3M9JA 5LD0A 3UAPA 1S3DA 1DSBA 5DCHA 2F51A 1Q4JA 3HDCA 4PQIA 1AC1A 1Z7PA 3KIJA 5EL8A 2ON5A 4IP1A 4ZL7A 3C1SA 3F4RA 3WT2A 4CY6A 1CQGA 2CAIA 4PTSA 4EVMA 5G5EA 1K3LA 3VWWA 2X8CA 4MZBA 1PQNA 5CRWA 3RPNA 2VAFA 4NXIA 4Q5NA 4LMVA 3TJJA 1EOGA 1OKDA 2OE3A 3ZIJA 2CV4A 4KF9A 4A5PA 1W4VA 4QQ7A 3MYDA 1YF0A 2YV9A 3WGEA 2TRXA 3FZ5A 2P0GA 1M2BA 3UOMA 3DD3A 3TOUA 5B6MA 2JU5A 1G0TA 1VF1A 1AW9A 3IA1A 5B7CA 4DEJA 4FIWA 3DGQA 1JHBA 5DVBA 1WOUA 1ZOFA 2C0FA 3ZREA 1Z3EA 1UC7A 1PL2A 4EDYA 2IMKA 20GSA 1AQWA 3PPUA 4RUVA 2AAWA 4HDEA 5J4UA 2GZZA 2IFQA 3CTGA 1BAYA 2H6XA 3TRQA 1A2JA 5IPGA 5IM9A 1AXDA 3EURA 3NZNA 1OC8A 5DALA 5ELGA 3TUEA 3ZMLA 1HYUA 4GF0A 3F6FA 3IK7A 2L6CA 1XXUA 5JCWA 2A2RA 1MD4A 4FO5A 1O8WA 4Q5FA 2X64A 2LJAA 3NOFA 1A0FA 2LV3A 1M2AA 5KN0A 4MK3A 3A2WA 5CNWA 4GXZA 4XS6A 1PL1A 3UIWA 2WFCA 1SK2A 1M99A 5H5SA 4EL1A 5CP1A 1NSWA 1TP9A 5ID2B 4GQFA 3L9SA 3KCMA 4TR1B 1BQ7A 2NBSA 1KTEA 1T4YA 3CRTA 4G19A 4BWSA 4EUYA 4KX4A 3AY8A 2VCTA 3CMIA 3F4SA 5HFIA 22GSA 5E59A 3GYKA 3LQ7A 4ILFA 1T00A 1PKWA 3US3A 4E8HA 1Y6EA 3LJRA 3RHCA 4Z2UA 1WPIA 4OCEA 3V1WA 2DIYA 4TRXA 2GSQA 2KHPA 4O32A 1J9BA 3OR5A 4BVXB 5AGYA 2VCZA 2L57A 2QA2A 1XVWA 3RAZA 5H5RA 3BCIA 4J56E 3TOTA 2MMNA 3L0HA 1QMVA 1TOFA 2CVBA 1MDJA 1A23A 4X0XA 5D93A 2DKIA 2WJUA 4IBPA 3I9V2 2J9HA 3N9JA 1G7EA 1XZOA 1X9SB 5IO2A 1PX6A 1MDIA 3EPTA 5C00A 2GSRA 1TU8A 1WJKA 1FAAA 2MMAA 1GTBA 3F8UA 5GSSA 2WGRA 3DMLA 1E6BA 1GUMA 1O6JA 3UARA 2YCDA 4O5UA 1OKTA 3D21A 4EKZA 2LEGA 3GX0A 3EWLA 4MF7A 5J9CA 5DAKB 5CAXA 1M9BA 4L0UA 3HY2A 4ZIJA 2CZ2A 2NTOA 3KJYA 3DVWA 3O76A 2KOKA 3L78A 1QGVA 2FWFA 1F37A 4KW6A 1B9YC 3IHQA 1YDKA 3QFAC 1OE7A 4O5RA 4XTSA 1F6MC 2RLIA 4IJ3A 2K9FA 4K1FA 1WRYA 3VWVA 2I9HA 3A2VA 3F6DA 1A24A 3TJFA 3N5OA 4AJ6A 1WE0A 3GSTA 1O8XA 3GKNA 1O73A 3ZYWA 4F0BA 3EYTA 4JR4A 1MDKA 5AIVA 6GSVA 4MPGA 3KMOA 2OA7A 3IK9A 4MMMA 4L0WA 3LYKA 1XW5A 1Z5YE 3R2QA 1F9MA 3IPZA 4DSSB 1UVZA 3EINA 4ZB8A 4BA7A 3KTLA 3FEUA 1WMJA 3FZ9A 4TOPA 1TTZA 12GSA 3WYWA 4K9ZA 1PX7A 2VL2A 2H74A 3RDWA 1XW9A 4PQ1A 3FHKA 2I1UA 1GNEA 2C0DA 4JEDA 2YZHA 4MP4A 5EY6A 2E7PA 1EEJA 3U6VA 2YJ7A 3IDVA 3QMXA 1EZKA 1TXXA 4K2DA 2FUG2 2GQKA 3UJ1A 3A5IA 5B8AA 3EVIA 1GH2A 2L5LA 3D5JA 4ID0A 2YOIA 4Q5RA 1TRUA 3GTUB 1I5GA 3TCOA 1YZXA 2DC5A 1WP0A 4IW9A 3VWXA 3QD9A 3G9BA 2R5GA 5F0GA 1N2AA 3IE3A 4N11A 3FR9A 4HQZA 5J9BA 2VCVA 3VPQA 4EC0A 1SJ6A 5DCGA 5JWQB 1URMA 9GSSA 1NHOA 2B7JA 4BPYA 2CVDA 3TRXA 6GSYA 2PERA 4YQVA 2L6DA 3WGXA 1ML6A 3TRPA 3U5RE 1M7TA 3M1GA 4Z7XA 4NPBA 1YQ1A 2DJ0A 2WRTA 2X4AA 1K3YA 2B1KA 3Q18A 1KBNA 1U3IA 3BJ5A 3ME8A 4YQMA 5F8BA 1XWKA 2IMIA 4ISDA 3H93A 3QOUA 1UN2A 4GSSA 2EIOA 3G7IA 4PNGA 2YV7A 4AJ7A 3FMWA 2JACA 5LCZA 1JLVA 2VD1A 4XCSA 1FW1A 3IBHA 2DJ2A 3D0ZA 5A5KA 3F3RA 1JZWA 2QGVA 2ZCTA 3EE2A 4IJIA 5DBQA 2ES7A 2IMFA 3GA4A 2X49A 3GH9A 2G2QA 2HSHA 5CREA 3BOAA 4GRFA 4HU7A 2A4VA 3IHGA 2OJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMX A;  4PXO A;  2YN1 A;  1BYE A;  1K0C A;  1X9W B;  2MMO A;  1EEM A;  3M3M A;  3J7Y b;  2TRC P;  1FVJ A;  1SL2 B;  5KN3 A;  1XFL A;  2YP6 A;  1GLQ A;  4POL A;  4GSN A;  4MJC A;  1E2Y A;  2MYG A;  2DBC A;  2VM1 A;  5A4V A;  4WF4 A;  16GS A;  1F2E A;  4GLT A;  3M9K A;  2FWH A;  3KP9 A;  1V40 A;  5C04 A;  2LTK A;  3NIV A;  1JZD A;  1GTI A;  1T8E B;  4V1A p;  2OKA A;  2X99 A;  2Z9S A;  1Y25 A;  2P5R A;  2VM2 A;  5IMF A;  3C8E A;  2GT6 A;  2V2G A;  4E8E A;  2WZ9 A;  2WCI A;  4G10 A;  2IWT A;  1Z7R A;  5DQS A;  2O85 A;  4WKW A;  3FZ4 A;  5HFG A;  2L4C A;  4XRA A;  4KSM A;  4K7O A;  1EP8 A;  2CZ3 A;  4FYC A;  2VO4 A;  2H0I A;  4XHM A;  3F3Q A;  5DQY A;  1C72 A;  3BCK A;  4LL1 B;  4TN8 A;  1OVN A;  1H75 A;  2DML A;  1A8L A;  2H73 A;  1SK1 A;  2FD3 A;  4NHZ A;  2DJJ A;  4V2L A;  2O8V B;  3TKS A;  5HR3 A;  3G7J A;  1U87 A;  2HXK A;  4K7N A;  2EC4 A;  5L71 A;  2KP1 A;  1G7O A;  4LMW A;  3ZTL A;  2PWJ A;  4TXO B;  3KMN A;  1IYI A;  4WBR D;  5ID2 A;  2YWO A;  1ABA A;  4IVF A;  4JBB A;  4YQU A;  4TR1 A;  2B3S A;  1I9D A;  3TGZ A;  1EOH A;  1XBS A;  1ERT A;  1OAZ A;  3TKP A;  1GNW A;  2YZU A;  5GAN D;  3LSZ A;  1NW2 A;  4MLY A;  3FK8 A;  2P31 A;  2EIR A;  1K0D A;  1A8Y A;  1PSQ A;  5COH A;  1R5P A;  2IPA A;  2H76 A;  1H4O A;  2C3N A;  1FVK A;  1XPV A;  1TDI A;  3KM6 A;  5ELA A;  1RK4 A;  2B1L A;  4KAE A;  3GNJ A;  2LQQ A;  3F0I A;  3I6A A;  3IOS A;  4AJ8 A;  1USB A;  3CBU A;  5ABR A;  5IMV A;  3HA9 A;  1K0O A;  2RII A;  2MBT A;  1TKD B;  2B5E A;  4F82 A;  4OFM A;  4BVX A;  2JSY A;  1X9M B;  5B6N A;  3H8Q A;  3ZVJ D;  3CRU A;  4KDX A;  5ECM B;  3MDK A;  1S3A A;  2AUV A;  2LKU A;  3HJP A;  2CQ9 A;  2CX4 A;  4F0C A;  2HRN A;  3ZVJ A;  3KH9 A;  3KGK A;  3GHA A;  3HKR A;  4MF6 A;  4RI7 A;  3DWV A;  3HD5 A;  4TR3 A;  4I8B A;  3WGD A;  3DXB A;  1B4P A;  2HNL A;  4KB3 A;  3F63 A;  4MDC A;  5AIX A;  3ZMK A;  2LS5 A;  3GUS A;  3ZLP A;  2VOC A;  2H6Z A;  1GSF A;  2R4V A;  3P7X A;  2LJR A;  1YJ6 A;  1TK5 B;  3PGT A;  4V1A g;  3C71 A;  5DAK A;  4XS1 A;  1YF1 A;  1FOV A;  1BX9 A;  1GUH A;  2XC2 A;  2LNS A;  3IR4 A;  3KEB A;  3QFB C;  4GST A;  3WT1 A;  1DUG A;  4ZBD A;  2C1Y A;  4HJ2 A;  2FLS A;  4EDZ A;  4ZB6 A;  1RW1 A;  2HLS A;  2ON7 A;  1SD8 A;  4OO5 A;  1X5C A;  3F4T A;  1LJR A;  4MH3 A;  2FWG A;  5JCG A;  2O7K A;  2IL3 A;  3Q19 A;  2HI7 A;  1LU4 A;  4G2E A;  2DJK A;  2HZE B;  2H1B A;  4HJM A;  4KE3 A;  2N5B A;  2YNX A;  4KCE A;  1O81 A;  5D9W A;  5IIZ A;  2OBI A;  5GAP D;  4KSO A;  1IYH A;  4MJA A;  5HFK A;  1OC9 B;  4V2M A;  1KEB A;  1AAZ A;  1TRS A;  3GMF A;  1ZZY A;  1T7P B;  2I3Y A;  2FNO A;  1OYJ A;  2F8F A;  2K8V A;  4DSS A;  2PVO C;  1FHE A;  1PA3 A;  5G31 A;  3E9J B;  3D4M A;  4GTU A;  3W6G A;  2I4A A;  1K0A A;  4L8E A;  5ECH B;  5F06 A;  3HXS A;  1U6T A;  2YWN A;  2PGT A;  5LNK e;  2C4J A;  1PD2 1;  4KDU A;  1GLP A;  4ZBA A;  4N30 A;  1OE8 A;  2MMZ A;  3ZIT A;  4IN0 A;  1BG5 A;  3QR6 A;  4XS4 B;  4DVC A;  1EWX A;  4K0G A;  4KH7 A;  2C0G A;  2IN3 A;  1XCC A;  3GUR A;  5IQY A;  5D73 A;  6GST A;  3TB2 A;  2VCW A;  2QSI A;  1QFN A;  2HZF A;  4I97 A;  3I69 A;  2GS3 A;  1OC3 A;  3UBL A;  3GTU A;  3PH9 A;  1MEK A;  2F9S A;  4CW9 A;  1U3A A;  5HR0 A;  1AQX A;  1QUW A;  2VD0 A;  2VIM A;  3DIE A;  5GST A;  2H1G A;  3TJB A;  3L9V A;  4G9H A;  2DMM A;  2IMD A;  1YY7 A;  1HNA A;  5ECO B;  4IS0 A;  3QAG A;  4ECB A;  4ACS A;  1SKR B;  4IQ1 A;  2C80 A;  2JZR A;  2JZS A;  4POM A;  3GL5 A;  4KUN A;  1PGT A;  4ULX A;  2GZP A;  4IQA A;  4MZW A;  5A4U A;  3I43 A;  2DJ1 A;  2AHE A;  2H66 A;  4J2F A;  2VL3 A;  2N5F A;  4ZIL A;  2LRC A;  2H8L A;  1SU9 A;  2K18 A;  2VL9 A;  4D73 B;  2EIQ A;  3EC3 A;  2CVK A;  4HUA A;  1TRV A;  2C3T A;  4ML6 A;  3APQ A;  4CHS A;  3EU3 A;  3GX8 A;  2K6V A;  3G7Y A;  2PU9 C;  1RQM A;  4RI6 A;  2OAD A;  4L5O A;  4YAP A;  3GFK A;  2FGX A;  3VLN A;  2FY6 A;  2H0G A;  3KXO A;  3E0U A;  2O87 A;  1VF3 A;  2IME A;  3UVH A;  4V2N A;  3HHV A;  3A5W A;  5ECK B;  2NDO A;  4KCA A;  4WR5 A;  2H75 A;  3MAK A;  3W8J A;  1QK8 A;  1AIU A;  2MBS A;  3WD6 A;  3ZFB A;  1M0U A;  3GH6 A;  5CYY A;  4KDY A;  1K3O A;  1W89 A;  2WB9 A;  2O89 A;  1SEN A;  2DIZ A;  4ZB9 A;  1DE2 A;  5IOW A;  1R4W A;  1Z6M A;  3UEM A;  3TKQ A;  1A0R P;  2AV4 A;  2H0H A;  4WBJ A;  4TW5 A;  1JLW A;  3HCZ A;  3DYR A;  1HNB A;  2AJQ B;  2GTU A;  2CT6 A;  2IYJ A;  1ZYQ B;  1V98 A;  3PR8 A;  2DSA A;  2GLR A;  2CX3 A;  1SYX A;  2X8G A;  1S3C A;  2N5A A;  2JAD A;  2P5Q A;  2XBI A;  2LNT A;  4NV2 A;  2L59 A;  3LFL A;  5KN1 A;  5CRG A;  4EE0 A;  2ALB A;  1V9W A;  3FY7 A;  2VL2 C;  2K8S A;  1XIY A;  3MNG A;  6GSW A;  4HEA 2;  2MZC A;  3TDG A;  4ZL8 A;  4I2U A;  4WXT A;  3EMX A;  4MPF A;  2H1D A;  3RHB A;  4I6X A;  3M8N A;  14GS A;  4X1U A;  2FA4 A;  4KGI A;  3CSJ A;  1SJZ A;  4JE1 A;  5FT3 A;  4EF0 A;  5EPF A;  1LBK A;  5D8I A;  1B4Q A;  2A2S A;  4HI7 A;  1DBY A;  3IAM 2;  1VGL A;  4K7I A;  4PNF A;  2KLX A;  1MTC A;  1G6Y A;  3K8N A;  1WIK A;  1ILO A;  5AIS A;  3IXR A;  3IC4 A;  6GSX A;  3FKF A;  3C1R A;  2WS2 A;  5IOX A;  3ED3 A;  5CO3 A;  2HSY A;  1GL8 A;  1VF2 A;  4FH8 A;  3P8W A;  8GSS A;  2L4Q A;  2OE0 A;  3QPM A;  4TVE A;  4KND A;  2C3Q A;  4WET A;  1SJI A;  3ZFL A;  2PN8 A;  5FHI A;  4TXO A;  2LJK A;  3LGC A;  4XIH A;  3GKX A;  4BVY A;  3HZ8 A;  4MH2 A;  2G0F A;  4HQS A;  3HVX A;  3BD2 A;  5J5N A;  1GSE A;  1X5E A;  5DDL A;  4I2T A;  3HJM A;  1AUC A;  3QAV A;  4YH2 A;  3KTB A;  1JZR A;  1Q98 A;  1YEP A;  1TI1 A;  4POB A;  1K0N A;  3LXT A;  2FCH A;  4POK A;  2C8U A;  2ZUP A;  3BBY A;  2JL4 A;  1GSD A;  4JR6 A;  4ZL9 A;  1XOB A;  3DEX A;  1GTA A;  1SYR A;  4MAB A;  3APO A;  1XWB A;  4LL4 B;  1K0B A;  3L4N A;  1V2A A;  4HZ4 A;  4AGS A;  3JCM L;  2GT5 A;  4OMV A;  2PVQ A;  2GZY A;  3KP8 A;  4NMU A;  5D9V A;  3GRX A;  2DJ3 A;  5DJM A;  2OBK A;  4EO3 A;  5ECQ B;  5D96 A;  1THO A;  2VCQ A;  2YWI A;  3O6T A;  4OFN A;  3TJK A;  2LST A;  1G6W A;  1FG4 A;  4OFT A;  4QL7 A;  2X8H A;  2LUS A;  2M46 A;  3LG6 A;  3QCP A;  3HYP A;  4EXJ A;  2LRN A;  2R3X A;  5D9T A;  17GS A;  4HZ2 A;  4P3Y B;  3ZIV A;  1PN9 A;  1B8X A;  2YAN A;  5GZZ B;  3IRA A;  5ECL B;  1F3A A;  2M72 A;  4ECI A;  1DE1 A;  13GS A;  2GST A;  2FHE A;  3CYN A;  3APS A;  4ZXG A;  4F2I A;  3VPT A;  4F03 A;  2H19 A;  4IGJ A;  1ZGN A;  3QDN A;  5A4W A;  1B48 A;  3CXG A;  3W8S A;  4MJE A;  2VLV A;  4IP6 A;  4PUA A;  2REM A;  1B9X C;  2RM5 A;  4OCF A;  2KUC A;  1GSU A;  1TJD A;  5G1K A;  3ZZX A;  1R7H A;  2CAQ A;  2PBJ A;  2BJX A;  4N10 A;  5INY A;  5EVO A;  5D9X A;  1XWA A;  3FYG A;  7GSS A;  3QAW A;  4NWY A;  5KN2 A;  3DRN A;  1GSY A;  1TK8 B;  1YKC A;  2GQL A;  2HZE A;  3EU4 A;  2PUK C;  2V1M A;  2V6O A;  1EP7 A;  4XRD A;  1AQV A;  1XOA A;  2R2J A;  3C73 A;  3LEF A;  3D4T A;  3DVX A;  2RM6 A;  3TKS C;  2R37 A;  1GP1 A;  4IKH A;  5ECI B;  1WWJ A;  1OC9 A;  1EV9 A;  2L5O A;  2YPM A;  2IFQ B;  2GVP A;  2F3M A;  3H1N A;  2V6K A;  2ZNM A;  5JWR B;  4CDO A;  5E4W A;  4YAV A;  3GN3 A;  5DAL B;  2E2G A;  3EMP A;  4ECC A;  3LXZ A;  3CSH A;  5G2Z A;  3VI7 A;  4GWR A;  4ECJ A;  4LLR A;  2HRF A;  4TR0 A;  1ZMA A;  1A2L A;  3UBK A;  4PGT A;  3GIX A;  1GUK A;  4JU5 A;  4OD7 A;  1V58 A;  4XS4 A;  5ECR B;  3ISO A;  4PX1 A;  1V57 A;  3GSS A;  1TU7 A;  5HQP A;  1U88 A;  4TKY A;  4KA0 A;  1YEX A;  1GSQ A;  5ECN B;  2WUL A;  3GL3 A;  4TR4 A;  4TXV A;  1ZYE A;  3A3T A;  3TKS E;  1THX A;  4BWQ A;  1PRX A;  4F9Z A;  2PMT A;  3LOR A;  4ML1 A;  1GUL A;  3Q74 A;  2V41 A;  2R6K A;  1ST9 A;  5FWG A;  3C7M A;  1M9A A;  5AN1 A;  4QL9 A;  1HNC A;  4DSR A;  19GS A;  1O7U A;  1FO5 A;  2AYT A;  11GS A;  1MD3 A;  1K0M A;  2RUF A;  2FA8 A;  2HYX A;  3P2A A;  5F05 A;  2D2Z A;  6GSS A;  3FZA A;  3FR3 A;  10GS A;  3KD0 A;  2B5Y A;  1TW9 A;  4MA9 A;  2E0Q A;  1A2M A;  1PKZ A;  4OO4 A;  4K0N A;  4FYU A;  3IV4 A;  2H70 A;  2H1A A;  4D73 A;  1VF4 A;  2F8A A;  2B5X A;  1GSS A;  2B6M A;  2OAC A;  3A2X A;  3FR6 A;  5IMD A;  1O85 A;  4X43 A;  1Z9H A;  3VFI A;  2YWM A;  4K6X A;  5J41 A;  4JRR A;  2JSZ A;  2RUE A;  2GSS A;  2H71 A;  3L9U A;  2XHF A;  2NPB A;  2HFD A;  3FW2 A;  3ZL5 A;  1QXH A;  4OWY A;  1ERV A;  2H30 A;  4MJB A;  2XPD A;  4I5Q A;  3E3E A;  1J0F A;  4J57 E;  1N8J A;  3LYP A;  2IIY A;  3CSI A;  2PPT A;  1SL1 B;  1HD2 A;  4WEY A;  1NHY A;  2FWE A;  1M2D A;  1VRS D;  1XWC A;  3GKK A;  4GCI A;  3Q6O A;  5ENU A;  1XW6 A;  4ZBB A;  4IHU A;  5IO0 A;  1UA5 A;  3CTF A;  2V32 A;  3ZRD A;  4BL7 A;  1TK0 B;  4H86 A;  4NHW A;  3IAS 2;  1CQH A;  5F07 A;  6GSU A;  1X5D A;  3UL3 A;  4NAX A;  2AB6 A;  2TIR A;  1ERW A;  2CA8 A;  2H01 A;  4MZC A;  4AF2 A;  3VI5 A;  3SBC A;  5IMC A;  1BJX A;  1EGR A;  3MWH A;  4FYB A;  4O7H A;  3VK9 A;  5KEJ A;  4HS1 A;  1YKA A;  3MSZ A;  2HE3 A;  2VUP A;  4PUR A;  5CRD A;  1TI3 A;  2XBQ A;  3D6I A;  2DLX A;  1GWC A;  1J08 A;  5G30 A;  4NV5 A;  3J7Y k;  1R5A A;  1EV4 A;  1EGO A;  4N0V A;  3H4K A;  1ERU A;  2WDU A;  5DJL A;  3DKS A;  1GTU A;  3GKM A;  2VLT A;  2IY2 A;  5ECS A;  1KNG A;  3HZ4 A;  2J23 A;  3ERF A;  2B7K A;  1X0R A;  4K8M A;  5IPH A;  4HOJ A;  4RQR A;  3HJO A;  1SKW B;  1QQ2 A;  3ERG A;  2KP2 A;  1NM3 A;  4RQX A;  3S9F A;  5JWO B;  4PUF C;  2HT9 A;  1SK0 A;  2GQM A;  4WR4 A;  5HR2 A;  5G5F A;  2OE1 A;  1ACV A;  3TKR A;  3M0F A;  3VWU A;  5ECP B;  1T4Z A;  2I81 A;  3TJG A;  1JFU A;  18GS A;  5H5Q A;  1XVQ A;  3O3T A;  2VCX A;  2NVL A;  4WF5 A;  3HVV A;  4HU9 A;  2GDR A;  2YJH A;  1SKS B;  1FB0 A;  1ZCP A;  1T3B A;  1XWG A;  3GV1 A;  3UVT A;  4L5L A;  5HR1 A;  1Z6N A;  3ERW A;  2JZT A;  1JZO A;  3PIN A;  2BTO T;  3LWA A;  3SWL A;  1SD9 A;  5G1L A;  3VUR A;  5IMZ A;  1ON4 A;  5B8B A;  3KZQ A;  2E2M A;  2VLU A;  4LA1 A;  1ZL9 A;  1GRX A;  2LRT A;  2C0E A;  3UMA A;  4JZQ A;  2IJY A;  5IMA A;  2QKE A;  2QC7 A;  1T1V A;  3H79 A;  4IEL A;  1TRW A;  2M80 A;  2LQO A;  1R26 A;  5CRH A;  4PQH A;  3RBT A;  1HQO A;  2GGT A;  1F3B A;  3F9U A;  3HVS A;  2XPE A;  4MF5 A;  2H6Y A;  3D22 A;  1FB6 A;  3RPP A;  4GQC A;  4MCU A;  3FRC A;  4N0Z A;  2H72 A;  4Q5Q A;  5JCU A;  5J3R A;  1PMT A;  1BED A;  4O92 A;  4DSQ A;  1SL0 B;  3P90 A;  3ME7 A;  3KH7 A;  3M9J A;  5LD0 A;  3UAP A;  1S3D A;  1DSB A;  5DCH A;  2F51 A;  1Q4J A;  3HDC A;  4PQI A;  1AC1 A;  1Z7P A;  5EL8 A;  3KIJ A;  2ON5 A;  4IP1 A;  4ZL7 A;  3C1S A;  3F4R A;  3WT2 A;  1CQG A;  2CAI A;  4EVM A;  5G5E A;  1K3L A;  3VWW A;  2X8C A;  4MZB A;  1PQN A;  5CRW A;  3RPN A;  2VAF A;  4NXI A;  4Q5N A;  4LMV A;  3TJJ A;  1EOG A;  1OKD A;  2OE3 A;  3ZIJ A;  2CV4 A;  1W4V A;  4QQ7 A;  1YF0 A;  2YV9 A;  3WGE A;  2TRX A;  3FZ5 A;  2P0G A;  1M2B A;  3UOM A;  3DD3 A;  3TOU A;  5B6M A;  2JU5 A;  1G0T A;  1VF1 A;  1AW9 A;  3IA1 A;  5B7C A;  4DEJ A;  4FIW A;  3DGQ A;  1JHB A;  5DVB A;  1WOU A;  1ZOF A;  2C0F A;  3ZRE A;  1Z3E A;  1UC7 A;  1PL2 A;  4EDY A;  2IMK A;  20GS A;  1AQW A;  4RUV A;  2AAW A;  4HDE A;  5J4U A;  2GZZ A;  2IFQ A;  3CTG A;  1BAY A;  2H6X A;  3TRQ A;  1A2J A;  5IPG A;  5IM9 A;  1AXD A;  3EUR A;  3NZN A;  1OC8 A;  5DAL A;  5ELG A;  3TUE A;  3ZML A;  1HYU A;  4GF0 A;  3F6F A;  3IK7 A;  2L6C A;  1XXU A;  5JCW A;  2A2R A;  1MD4 A;  4FO5 A;  1O8W A;  4Q5F A;  2X64 A;  2LJA A;  3NOF A;  1A0F A;  2LV3 A;  1M2A A;  5KN0 A;  4MK3 A;  3A2W A;  5CNW A;  4GXZ A;  4XS6 A;  1PL1 A;  3UIW A;  2WFC A;  1SK2 A;  1M99 A;  5H5S A;  4EL1 A;  5CP1 A;  1NSW A;  1TP9 A;  5ID2 B;  4GQF A;  3L9S A;  3KCM A;  4TR1 B;  1BQ7 A;  2NBS A;  1KTE A;  1T4Y A;  3CRT A;  4G19 A;  4BWS A;  4EUY A;  4KX4 A;  3AY8 A;  2VCT A;  3CMI A;  3F4S A;  5HFI A;  22GS A;  5E59 A;  3GYK A;  3LQ7 A;  4ILF A;  1T00 A;  1PKW A;  3US3 A;  4E8H A;  1Y6E A;  3LJR A;  3RHC A;  1WPI A;  4OCE A;  3V1W A;  2DIY A;  4TRX A;  2GSQ A;  2KHP A;  4O32 A;  1J9B A;  3OR5 A;  5AGY A;  2VCZ A;  2L57 A;  1XVW A;  3RAZ A;  5H5R A;  3BCI A;  4J56 E;  3TOT A;  2MMN A;  3L0H A;  1QMV A;  1TOF A;  2CVB A;  1MDJ A;  1A23 A;  4X0X A;  5D93 A;  2WJU A;  4IBP A;  3I9V 2;  2J9H A;  3N9J A;  1G7E A;  1XZO A;  1X9S B;  5IO2 A;  1PX6 A;  1MDI A;  5C00 A;  2GSR A;  1TU8 A;  1WJK A;  1FAA A;  2MMA A;  1GTB A;  3F8U A;  5GSS A;  2WGR A;  3DML A;  1E6B A;  1GUM A;  1O6J A;  3UAR A;  2YCD A;  1OKT A;  3D21 A;  4EKZ A;  2LEG A;  3GX0 A;  3EWL A;  4MF7 A;  5J9C A;  5DAK B;  5CAX A;  1M9B A;  4L0U A;  3HY2 A;  4ZIJ A;  2CZ2 A;  2NTO A;  3KJY A;  3DVW A;  3O76 A;  2KOK A;  3L78 A;  1QGV A;  2FWF A;  1F37 A;  4KW6 A;  1B9Y C;  3IHQ A;  1YDK A;  3QFA C;  1OE7 A;  4O5R A;  4XTS A;  1F6M C;  2RLI A;  4IJ3 A;  2K9F A;  4K1F A;  1WRY A;  3VWV A;  2I9H A;  3A2V A;  3F6D A;  1A24 A;  3TJF A;  3N5O A;  4AJ6 A;  1WE0 A;  3GST A;  1O8X A;  3GKN A;  1O73 A;  3ZYW A;  4F0B A;  3EYT A;  4JR4 A;  1MDK A;  5AIV A;  6GSV A;  4MPG A;  3KMO A;  2OA7 A;  3IK9 A;  4MMM A;  4L0W A;  3LYK A;  1XW5 A;  1Z5Y E;  3R2Q A;  1F9M A;  3IPZ A;  4DSS B;  1UVZ A;  3EIN A;  4ZB8 A;  4BA7 A;  3KTL A;  3FEU A;  1WMJ A;  3FZ9 A;  4TOP A;  1TTZ A;  12GS A;  3WYW A;  4K9Z A;  1PX7 A;  2VL2 A;  2H74 A;  3RDW A;  1XW9 A;  4PQ1 A;  3FHK A;  2I1U A;  1GNE A;  2C0D A;  4JED A;  2YZH A;  4MP4 A;  5EY6 A;  2E7P A;  1EEJ A;  3U6V A;  2YJ7 A;  3IDV A;  3QMX A;  1EZK A;  1TXX A;  4K2D A;  2FUG 2;  2GQK A;  3UJ1 A;  5B8A A;  3EVI A;  1GH2 A;  2L5L A;  3D5J A;  4ID0 A;  2YOI A;  4Q5R A;  1TRU A;  3GTU B;  1I5G A;  3TCO A;  1YZX A;  2DC5 A;  1WP0 A;  4IW9 A;  3VWX A;  3QD9 A;  3G9B A;  2R5G A;  5F0G A;  1N2A A;  3IE3 A;  4N11 A;  3FR9 A;  4HQZ A;  5J9B A;  2VCV A;  3VPQ A;  4EC0 A;  1SJ6 A;  5DCG A;  5JWQ B;  1URM A;  9GSS A;  1NHO A;  2B7J A;  4BPY A;  2CVD A;  3TRX A;  6GSY A;  2PER A;  4YQV A;  2L6D A;  3WGX A;  1ML6 A;  3TRP A;  3U5R E;  1M7T A;  3M1G A;  4Z7X A;  4NPB A;  1YQ1 A;  2DJ0 A;  2WRT A;  1K3Y A;  2B1K A;  3Q18 A;  1KBN A;  1U3I A;  3BJ5 A;  3ME8 A;  4YQM A;  5F8B A;  1XWK A;  2IMI A;  3H93 A;  3QOU A;  4ISD A;  1UN2 A;  4GSS A;  2EIO A;  3G7I A;  4PNG A;  2YV7 A;  4AJ7 A;  2JAC A;  5LCZ A;  1JLV A;  2VD1 A;  4XCS A;  1FW1 A;  3IBH A;  2DJ2 A;  3D0Z A;  5A5K A;  3F3R A;  1JZW A;  2QGV A;  2ZCT A;  3EE2 A;  4IJI A;  5DBQ A;  2ES7 A;  2IMF A;  3GA4 A;  3GH9 A;  2G2Q A;  2HSH A;  5CRE A;  3BOA A;  4GRF A;  4HU7 A;  2A4V A;  2OJL A; 
#chains in the Genus database with same CATH topology
 1O7W B;  2BMX A;  4PXO A;  2YN1 A;  1BYE A;  1K0C A;  1X9W B;  2MMO A;  1EEM A;  1Q40 B;  2XR8 B;  3M3M A;  4N3V A;  3J7Y b;  2TRC P;  1FVJ A;  1SL2 B;  3Q90 A;  5KN3 A;  1T5Y A;  1XFL A;  2YP6 A;  1BIR A;  1GLQ A;  4POL A;  1D6Z A;  1SAR A;  2K54 A;  4GSN A;  4MJC A;  1E2Y A;  3N9H A;  2MYG A;  3D3L A;  2DBC A;  2VM1 A;  1AR0 A;  1DMM A;  5A4V A;  5HOH A;  4WF4 A;  16GS A;  1F2E A;  4Z2T A;  3X41 A;  4GLT A;  3WOE B;  3M9K A;  1DET A;  2CFW A;  2FWH A;  3KP9 A;  1RN4 A;  1V40 A;  5C04 A;  2LTK A;  3NIV A;  1JZD A;  3CME 3;  4CCV A;  3KCH A;  5BRT A;  1N9E A;  4BTX A;  1GTI A;  1T8E B;  4HSC X;  4EIP A;  3BNE A;  2XEP A;  3DGY A;  2OKA A;  3DZL A;  4V1A p;  3MG2 A;  2X99 A;  1EKM A;  2Z9S A;  1Y25 A;  3JUN A;  5JBS A;  2P5R A;  1GYB A;  3B4O A;  2VM2 A;  3B7C A;  4CY8 A;  5IMF A;  3C8E A;  1IQ8 A;  2GT6 A;  2V2G A;  4E8E A;  2BMQ B;  2WZ9 A;  2A4H A;  2WCI A;  4G10 A;  2IWT A;  1Z7R A;  1BRK A;  5DQS A;  2ZDJ A;  1O7N B;  2O85 A;  4WKW A;  4WYK B;  3FZ4 A;  5HFG A;  4OK0 A;  2L4C A;  2W9Q A;  4XRA A;  4KSM A;  4K7O A;  1EP8 A;  1BSC A;  3DGL A;  2P05 A;  2CZ3 A;  4FYC A;  2VO4 A;  3WHO A;  2H0I A;  5KP4 A;  4XHM A;  1MWU A;  4R80 A;  4DKI A;  3F3Q A;  5DQY A;  1C72 A;  3BCK A;  4LYL B;  4XBY A;  4LL1 B;  1JBR A;  4TN8 A;  1MNL A;  1OVN A;  1H75 A;  2DML A;  3VSY A;  1A8L A;  1X1U A;  2F86 B;  4YKF A;  2H73 A;  3KFQ C;  1K9M 4;  1SK1 A;  2FD3 A;  4NHZ A;  2DJJ A;  4V2L A;  2R41 A;  2HRK A;  2O8V B;  2IMJ A;  4XDV A;  3TKS A;  3HVN A;  5HR3 A;  3UL5 A;  3LTA A;  3G71 3;  3G7J A;  1OF5 A;  5D82 A;  1U87 A;  2HXK A;  3AMO A;  4K7N A;  2PNC A;  2EC4 A;  5L71 A;  4FCM A;  1JBS A;  2KP1 A;  3EB8 A;  1G7O A;  1STD A;  1CYV A;  3DH2 A;  3NV0 B;  4LMW A;  2PWJ A;  3ZTL A;  1TFO A;  4TXO B;  3KMN A;  1X1W A;  1IYI A;  4BVY B;  4WBR D;  2WGQ A;  3UNL A;  5ID2 A;  4CPK A;  5IER A;  1BRS A;  5IEP A;  1HYF A;  1YJW 3;  2YWO A;  1ABA A;  4IVF A;  1LOX A;  4JBB A;  2KCD A;  4YQU A;  4TR1 A;  1B2M A;  2B3S A;  2CX0 A;  1I9D A;  3DXO A;  1KSI A;  1BSB A;  3TGZ A;  4Z2R A;  5LC6 A;  1EOH A;  1XBS A;  2OOV A;  1BNF A;  3L0R A;  1ERT A;  1OAZ A;  3TKP A;  1GNW A;  3EN1 B;  3EX9 A;  2INX A;  2YZU A;  3LSZ A;  1YIT 3;  5GAN D;  1NW2 A;  4MLY A;  3FK8 A;  3KSE D;  2P31 A;  2EIR A;  1K0D A;  4NHF A;  1NB3 I;  3N54 B;  2RNT A;  3O8Y A;  1A8Y A;  1PSQ A;  2R0P A;  5COH A;  1R5P A;  2IPA A;  2H76 A;  1H4O A;  4N6T A;  2C3N A;  1FVK A;  1XPV A;  1TDI A;  3KM6 A;  5ELA A;  1RK4 A;  2B1L A;  4KAE A;  3GNJ A;  3R3E A;  1FYS A;  2LQQ A;  3F0I A;  3OW2 2;  3I6A A;  1VQP 3;  5RNT A;  1JN5 B;  3IOS A;  4AJ8 A;  1USB A;  3CBU A;  5ABR A;  5IMV A;  3HA9 A;  1K0O A;  1S72 3;  1LQG C;  2RII A;  2MBT A;  1IT8 A;  3KKG A;  1TKD B;  1RKY A;  2B5E A;  1GD4 A;  4X2H A;  4F82 A;  4OFM A;  4BVX A;  3IJE B;  2JSY A;  2C4B A;  3K5T A;  1X9M B;  2OQE A;  3SXX A;  1RNB A;  5B6N A;  3H8Q A;  3ZVJ D;  3V92 A;  3CRU A;  4KDX A;  5ECM B;  3NUV A;  1S3A A;  3MDK A;  3HX8 A;  1QVF 2;  2AUV A;  2LKU A;  3Q3F A;  1RCL A;  3GZX B;  4LMI A;  1GOY A;  3HJP A;  3GZR A;  3N8B A;  1IU7 A;  2CQ9 A;  1ROA A;  4HBR A;  2CX4 A;  4F0C A;  1N8Q A;  2HRN A;  1FW7 A;  3NBB A;  3ZVJ A;  4N6U A;  3KH9 A;  3KGK A;  1B2X A;  2HMO B;  3GHA A;  3HKR A;  4MF6 A;  3UL6 A;  4RI7 A;  1Q81 4;  2GU3 A;  3WMD A;  1DMN A;  3DWV A;  3HD5 A;  4TR3 A;  4I8B A;  3CNX A;  4HM5 B;  2RSX A;  2WOF A;  3CMA 3;  3WGD A;  5IW9 A;  3DXB A;  1ISK A;  3FCS B;  1B4P A;  2HNL A;  4KB3 A;  3F63 A;  4MDC A;  5AIX A;  3ZMK A;  2E2V A;  2LS5 A;  3GUS A;  3ZLP A;  3AGO A;  2VOC A;  1UGH I;  2H6Z A;  2UX0 A;  1GSF A;  2KF6 A;  2R4V A;  3P7X A;  2LJR A;  1UUV B;  1YJ6 A;  1TK5 B;  3PGT A;  1O7M B;  5M1A A;  4V1A g;  3C71 A;  5DAK A;  4XS1 A;  1YF1 A;  1FOV A;  1BX9 A;  5M19 A;  1GUH A;  3IC8 A;  2CFG A;  1W5Z A;  2LNS A;  2XC2 A;  2ZHX B;  3IR4 A;  3KEB A;  3QFB C;  4GST A;  4BL3 A;  3WT1 A;  1DUG A;  1C7H A;  1U5O A;  2F4Y A;  4ZBD A;  2C1Y A;  2O3O A;  4HJ2 A;  1NO3 A;  2FLS A;  4EDZ A;  1JKG B;  4ZB6 A;  4HM7 B;  1RW1 A;  4CJN A;  2HLS A;  2ON7 A;  4BTW A;  6RNT A;  1SD8 A;  4OO5 A;  7RNT A;  1X5C A;  3K0Z A;  3F4T A;  1YVB I;  1LJR A;  4MH3 A;  2FWG A;  1GMQ A;  5JCG A;  2O7K A;  4EXR A;  4FMA A;  2IL3 A;  2GBW B;  3LTD A;  1IVX A;  3Q19 A;  1I2E A;  2HI7 A;  1LU4 A;  4G2E A;  2DJK A;  2B1X B;  2KF5 A;  3BND A;  2HZE B;  2H1B A;  4HJM A;  4KE3 A;  1W7C A;  2N5B A;  2YNX A;  2J8X B;  2L4V A;  1IV7 A;  4KCE A;  1O81 A;  5D9W A;  1A2P A;  5IIZ A;  2OBI A;  5GAP D;  1KWI A;  4KSO A;  1IYH A;  4MJA A;  5KOW A;  5HFK A;  4R4K A;  3FZW A;  3ROB A;  1OC9 B;  4V2M A;  1KEB A;  1CYU A;  1AAZ A;  4N6N B;  3LXU X;  1TRS A;  3GMF A;  1ZZY A;  1T7P B;  3NX0 A;  2I3Y A;  1BAN A;  1DMQ A;  2FNO A;  1OYJ A;  1BOX A;  2F8F A;  2K8V A;  4DSS A;  2PVO C;  1FHE A;  1I8V A;  2CH9 A;  1GD3 A;  2GBX B;  2Z6B A;  1IYY A;  1PA3 A;  3E9J B;  5G31 A;  1TTO A;  3D4M A;  4GTU A;  3W6G A;  2V1L A;  1FOH A;  2I4A A;  2I9W A;  1K0A A;  4L8E A;  5ECH B;  5F06 A;  3HXS A;  1U6T A;  1OGX A;  1LNI A;  2YWN A;  2F99 A;  2PGT A;  5LNK e;  2C4J A;  1PD2 1;  3G4S 3;  4KDU A;  1GLP A;  4ZBA A;  4N30 A;  3J7Y d;  1QAF A;  1OE8 A;  2MMZ A;  2OCT A;  4FMB A;  3SX1 A;  3ZIT A;  1BUJ A;  3ZFZ A;  4IN0 A;  4JRF A;  1BG5 A;  3QR6 A;  4XS4 B;  3OX9 A;  4DVC A;  1EWX A;  4K0G A;  1DYU A;  4KH7 A;  5D81 A;  5JPU A;  1MGR A;  3MSO A;  2C0G A;  2DKH A;  2IN3 A;  3KE7 A;  1XCC A;  3GUR A;  5IQY A;  1RCK A;  5D73 A;  3Q2P A;  1BSA A;  3FG3 A;  4AEQ A;  6GST A;  3T8N A;  1I0X A;  3TB2 A;  2VCW A;  2QSI A;  1QFN A;  2K3D A;  2HZF A;  3I69 A;  4I97 A;  5BU4 A;  1ULI B;  3PXM A;  2GS3 A;  1OC3 A;  3UBL A;  3GTU A;  2HML B;  3PH9 A;  1MEK A;  2F9S A;  4CW9 A;  1U3A A;  5HR0 A;  1EA2 A;  1AQX A;  1QUW A;  2Z7A A;  3CPO A;  2VD0 A;  2VIM A;  2HMK B;  4WWU C;  2CFL A;  3DIE A;  2IA7 A;  2LYX A;  5GST A;  2H1G A;  3HOH A;  3TJB A;  3L9V A;  4G9H A;  2DMM A;  2IMD A;  1YY7 A;  1YJ9 3;  3FKA A;  4FQU A;  4BU4 A;  1HNA A;  4IS0 A;  3JUQ A;  5ECO B;  3QAG A;  4JF8 A;  4ECB A;  3FH1 A;  4ACS A;  1SKR B;  4HKV B;  4IQ1 A;  2C80 A;  2JZR A;  1D6U A;  1Y4K A;  2JZS A;  4POM A;  3GL5 A;  2Z76 A;  4KUN A;  1PGT A;  1IQX A;  4HM1 B;  3NXJ A;  4ULX A;  2GZP A;  4IQA A;  3HI7 A;  4MZW A;  5A4U A;  3I43 A;  2DJ1 A;  3S67 A;  1OH0 A;  2PZV A;  4L8O A;  2AHE A;  1XG8 A;  2H66 A;  4J2F A;  2VL3 A;  2N5F A;  2XFT A;  2LRC A;  4ZIL A;  1V74 A;  1YGE A;  2H8L A;  1SU9 A;  2K18 A;  2VL9 A;  4D73 B;  2EIQ A;  3EC3 A;  2CVK A;  4HUA A;  1TRV A;  2C3T A;  4ML6 A;  3APQ A;  4CHS A;  1UGI A;  3EU3 A;  1ZS7 A;  4EW5 A;  3GX8 A;  2K6V A;  3G7Y A;  1SII A;  2PU9 C;  1RQM A;  4RI6 A;  2OAD A;  4L5O A;  3A76 A;  4YAP A;  3WOF B;  3GFK A;  2FGX A;  1RJO A;  3VLN A;  4L7K A;  2FY6 A;  1JRQ A;  2H0G A;  3KXO A;  3ZG0 A;  3E0U A;  2O87 A;  1B2S A;  1JB5 A;  1VF3 A;  3CCL 3;  2IME A;  1WNH A;  2CW9 A;  4HAA A;  1RGL A;  3UVH A;  4V2N A;  3HHV A;  3A5W A;  5ECK B;  2NDO A;  4KCA A;  1UI8 A;  2P38 A;  4WR5 A;  3KII A;  2H75 A;  1VQ7 3;  2HSM A;  1LOV A;  3MAK A;  3W8J A;  1M1K 4;  1QK8 A;  1S5A A;  1AIU A;  2MBS A;  3WD6 A;  3ZFB A;  1M0U A;  3GH6 A;  3NM2 A;  5CYY A;  4KDY A;  1K3O A;  1W89 A;  5IEO A;  2WB9 A;  2O89 A;  1SEN A;  2DIZ A;  2W03 A;  3BU4 A;  4IT7 A;  1A67 A;  2AAD A;  1Q40 A;  4ZB9 A;  1AY7 A;  1DE2 A;  5IOW A;  1R4W A;  1Z6M A;  3UEM A;  3F40 A;  3TKQ A;  1A0R P;  2AV4 A;  2H0H A;  3G16 A;  2R0C A;  4WBJ A;  4BL7 B;  2P0X A;  4TW5 A;  4G1M B;  1BAO A;  3WOD G;  1JLW A;  3HCZ A;  3DYR A;  3LT8 A;  1UCK A;  1HNB A;  2AJQ B;  2BNG A;  1RRL A;  2GTU A;  1X1X A;  2CT6 A;  2IYJ A;  4XDW A;  1ZYQ B;  1GSP A;  1V98 A;  2HRA A;  3PR8 A;  1JB2 A;  1LXE A;  1BRJ A;  1RGA A;  1TFK A;  2DSA A;  1KC8 4;  2GLR A;  2CX3 A;  1PN0 A;  1SYX A;  2X8G A;  1IK3 A;  1BNE A;  1S3C A;  2OTJ 3;  2N5A A;  1STF I;  2JAD A;  1TIJ A;  2P5Q A;  5GSP A;  2XBI A;  2LNT A;  5A0O B;  4NV2 A;  2L59 A;  3LFL A;  5KN1 A;  5CRG A;  4EE0 A;  3MG1 A;  3SLU A;  2ALB A;  1V9W A;  3FY7 A;  2VL2 C;  2K8S A;  2QIY A;  5CLK A;  1XIY A;  3MNG A;  4J5K A;  2IUJ A;  4AKZ A;  1RGE A;  4KFD A;  1YNV X;  6GSW A;  4HEA 2;  2MZC A;  3TDG A;  4ZL8 A;  4I2U A;  3ECF A;  1EUI C;  3EMX A;  4WXT A;  5AYR B;  4MPF A;  2H1D A;  3RHB A;  4I6X A;  3M8N A;  14GS A;  4X1U A;  5CF1 A;  2FA4 A;  4KGI A;  3CSJ A;  4FCJ A;  1RGF A;  1SJZ A;  2Y73 A;  1SQW A;  4WYK A;  3WA3 A;  4JE1 A;  5FT3 A;  4EF0 A;  1O7G B;  5EPF A;  3X42 A;  1LBK A;  4NRE A;  5D8I A;  1B4Q A;  2CFD A;  2A2S A;  4HI7 A;  1DBY A;  3IAM 2;  1VGL A;  4K7I A;  4PNF A;  2KLX A;  1MTC A;  3BIR A;  1G6Y A;  3K8N A;  1WIK A;  3V99 A;  3A5E A;  4RZM A;  3URP A;  4R9K A;  1QJG A;  1ILO A;  1SPU A;  5AIS A;  3DM8 A;  1M3J A;  3IXR A;  3HK4 A;  3CC4 3;  3IC4 A;  5CK6 A;  2RFR A;  2ZL8 A;  6GSX A;  2QGU A;  2CIU A;  4RBN A;  1AV4 A;  3GRD A;  3KSP A;  3FKF A;  3C1R A;  3H51 A;  2WS2 A;  5IOX A;  3CC2 3;  1BRN L;  3ED3 A;  5CO3 A;  2HSY A;  5LC7 A;  7GSP A;  1GL8 A;  1K41 A;  1VF2 A;  1O7H B;  4FH8 A;  3P8W A;  3DGN A;  8GSS A;  2L4Q A;  2OE0 A;  3S5C A;  1UUW B;  3QPM A;  4KND A;  4TVE A;  1TU5 A;  3S29 A;  4ICY A;  2C3Q A;  4WET A;  2OWP A;  1SJI A;  3NV0 A;  3ZFL A;  3PGB A;  2PN8 A;  5FHI A;  3CCU 3;  4TXO A;  2LJK A;  3LGC A;  4K61 A;  4XIH A;  3GKX A;  1QMA A;  3D5G A;  4BVY A;  3HZ8 A;  4I4K A;  4MH2 A;  2G0F A;  1YJN 3;  1X1Y A;  4HQS A;  3HVX A;  4HM0 B;  1IVU A;  3BD2 A;  5J5N A;  1GSE A;  4LZI A;  1LOW A;  2QEX 3;  1X5E A;  2YFI B;  5ELJ A;  5DDL A;  4I2T A;  3HII A;  3PCS A;  1KQS 2;  3HJM A;  5FGO A;  3D5I A;  1AUC A;  1PFO A;  3QAV A;  4YH2 A;  3KTB A;  1JZR A;  1Q98 A;  1US1 A;  1YEP A;  1A2K A;  1ZGX A;  1TI1 A;  4POB A;  1K0N A;  3LXT A;  1N8R 4;  2FCH A;  4POK A;  2C8U A;  2ZUP A;  1ZX2 A;  5G2G A;  3BBY A;  2JL4 A;  4HM3 B;  1GSD A;  4JR6 A;  4ZL9 A;  1XOB A;  5CXO A;  2KF4 A;  3DEX A;  1GTA A;  1SYR A;  1LOY A;  3F8X A;  4MAB A;  3APO A;  1XWB A;  4LL4 B;  1WTH A;  1K0B A;  1GOU A;  3L4N A;  1V2A A;  4LGQ A;  1JN5 A;  1OGZ A;  1BNJ A;  3CU3 A;  4HZ4 A;  4AGS A;  3JCM L;  2GT5 A;  4YKG A;  4OMV A;  1SJW A;  3IPT A;  2PVQ A;  1VQ4 3;  2E2T A;  2GZY A;  3KP8 A;  1M9G A;  1QVG 2;  2BMR B;  3I56 3;  4HM2 B;  4NMU A;  2GU1 A;  5D9V A;  1BNR A;  3GRX A;  2DJ3 A;  5DJM A;  2OBK A;  2BHM A;  3X40 A;  4EO3 A;  2BMO B;  5ECQ B;  5D96 A;  4EYC A;  4MNN A;  2WOH A;  1THO A;  2VCQ A;  2YWI A;  4EBG A;  1Q86 4;  4J5G A;  3O6T A;  4OFN A;  3TJK A;  2LST A;  1G6W A;  4WHA A;  1FG4 A;  1YGW A;  4OFT A;  4QL7 A;  2X8H A;  2LUS A;  2ML5 A;  2HMN B;  2M46 A;  3LG6 A;  3QCP A;  2F5W A;  4FR9 A;  3HYP A;  1E97 A;  1RGG A;  2D42 A;  4EXJ A;  2LRN A;  1VQO 3;  2R3X A;  5D9T A;  3Q1C A;  1Q9E A;  17GS A;  4HZ2 A;  4P3Y B;  3ZIV A;  1FGQ A;  2P0M A;  1PN9 A;  3JVC A;  3FG1 A;  4L8P A;  1HKX A;  1B8X A;  1O7P B;  2YAN A;  5GZZ B;  3IRA A;  5ECL B;  1F3A A;  2M72 A;  4ECI A;  1DE1 A;  13GS A;  2GST A;  2CG0 A;  1YIJ 3;  4CDL A;  2FHE A;  3CYN A;  3JUM A;  1ZYN A;  3APS A;  5AIG A;  4G0I A;  4ZXG A;  3VPT A;  4F03 A;  4F2I A;  1BRG A;  2H19 A;  4IGJ A;  1ZGN A;  3KZT A;  3QDN A;  1EQK A;  5A4W A;  1B48 A;  3FGY A;  3M8C A;  1PY3 A;  3CXG A;  3W8S A;  4MJE A;  2VLV A;  1GY6 A;  4IP6 A;  4PUA A;  1JKG A;  1B9X C;  2REM A;  1UW1 A;  2RM5 A;  4OCF A;  2KUC A;  3CQF A;  1GSU A;  1TJD A;  5G1K A;  3ZZX A;  1R7H A;  2CAQ A;  2PBJ A;  2BJX A;  4N10 A;  5INY A;  5EVO A;  5D9X A;  4IIA A;  1XWA A;  3FYG A;  7GSS A;  2A2P A;  3QAW A;  4NWY A;  1VQ8 3;  5KN2 A;  3DRN A;  1GSY A;  1ULJ B;  2CX1 A;  1BRI A;  1FGT A;  1TK8 B;  1YKC A;  2GQL A;  2HZE A;  3EU4 A;  2PUK C;  3F7S A;  2V1M A;  2V6O A;  1GS3 A;  1VQL 3;  1EP7 A;  4XRD A;  1R4C A;  2FNQ A;  1AQV A;  1XOA A;  2R2J A;  3C73 A;  3LEF A;  3D4T A;  3DVX A;  2JDI H;  2BT3 A;  4G0K A;  2RM6 A;  3TKS C;  3T8U A;  2WGO A;  2R37 A;  1M3I A;  3MIX A;  4HOH A;  1GP1 A;  1Z1S A;  3FSD A;  3RNT A;  3FLJ A;  4IKH A;  1TRQ A;  1WWJ A;  1OC9 A;  3SED A;  2BU4 A;  1EV9 A;  5ECI B;  2L5O A;  2YPM A;  2IFQ B;  2GVP A;  1Q82 4;  2F3M A;  3H1N A;  2V6K A;  2ZNM A;  5JWR B;  4CDO A;  3DGO A;  5E4W A;  4YAV A;  3GN3 A;  5DAL B;  1EG9 B;  2E2G A;  3EMP A;  3LXZ A;  4ECC A;  3CSH A;  2W56 B;  3GZY B;  3SOY A;  5G2Z A;  3VI7 A;  4GWR A;  1MGW A;  3F9S A;  4ECJ A;  3GWR A;  4LLR A;  1W6Y A;  2LQV A;  2HRF A;  4TR0 A;  1ZMA A;  3UJM A;  1A2L A;  3UBK A;  4PGT A;  3GIX A;  4G0L A;  1GUK A;  4JU5 A;  1V58 A;  4OD7 A;  4XS4 A;  5ECR B;  2OOV C;  3ISO A;  4PX1 A;  8CHO A;  1V57 A;  3GSS A;  2FXT A;  1TU7 A;  5KP1 A;  1VZZ A;  3CXC 2;  5HQP A;  1U88 A;  2WO0 A;  4TKY A;  4KA0 A;  1YEX A;  2XFS A;  1GSQ A;  5ECN B;  2WUL A;  2GXF A;  3GL3 A;  4TR4 A;  4TXV A;  1ZYE A;  3A3T A;  3TKS E;  1THX A;  4BWQ A;  1PRX A;  1UI7 A;  1T2I A;  4F9Z A;  4BIK A;  2PMT A;  4GB5 A;  3LOR A;  2OTL 3;  2SBL A;  4ML1 A;  1GUL A;  3Q74 A;  1AVL A;  2XH9 A;  2V41 A;  2CG1 A;  2P09 A;  4N6L A;  2R6K A;  1ST9 A;  5FWG A;  3C7M A;  1M9A A;  5AN1 A;  5KOX A;  4QL9 A;  2YX9 A;  1HNC A;  4DSR A;  2OQE C;  19GS A;  1O7U A;  3LW9 A;  4KT3 B;  1FO5 A;  2AYT A;  11GS A;  1MD3 A;  1K0M A;  3GAX A;  2RUF A;  1MWT A;  2FA8 A;  3X3Y A;  2HYX A;  3P2A A;  5F05 A;  2D2Z A;  1K8A 4;  6GSS A;  3FZA A;  3FR3 A;  10GS A;  3KD0 A;  3CNM A;  1BSE A;  2B5Y A;  1TW9 A;  4MA9 A;  2E0Q A;  1UUG B;  4H61 A;  1A2M A;  1PKZ A;  4OO4 A;  4K0N A;  4FYU A;  3IV4 A;  2H70 A;  2H1A A;  3D79 A;  3F14 A;  2CWU A;  4D73 A;  2W6J H;  1U8C B;  1VF4 A;  2F8A A;  2GEY A;  2B5X A;  1BNG A;  1B20 A;  1GSS A;  2B6M A;  2XRX B;  2OAC A;  3A2X A;  3FR6 A;  5IMD A;  1LVN A;  1O85 A;  5FW5 A;  4X43 A;  1LQM B;  1Z9H A;  3VFI A;  1RSN A;  2YWM A;  4K6X A;  1W00 A;  5J41 A;  4JRR A;  5BVB A;  3S27 A;  2JSZ A;  4RNT A;  2RUE A;  2GSS A;  4HYZ A;  2H71 A;  3L9U A;  2XHF A;  4RNZ A;  3LML A;  2NPB A;  2HFD A;  3FW2 A;  3ZL5 A;  1QXH A;  4MMZ B;  4OWY A;  1ERV A;  1N5H A;  2H30 A;  4EIQ A;  1M1X B;  1I2G A;  3SVA A;  4MJB A;  2XPD A;  4EV5 A;  4I5Q A;  3E3E A;  4K5S A;  1J0F A;  4J57 E;  1N8J A;  3LYP A;  1TRP A;  5AIH A;  4K90 B;  2IIY A;  3CSI A;  2PPT A;  1SL1 B;  2F56 A;  1HD2 A;  4WEY A;  1ZYP A;  1NHY A;  4STD A;  3UB1 A;  1M2D A;  2FWE A;  1WMN A;  3EJV A;  1VRS D;  1XWC A;  3GKK A;  4GCI A;  3Q6O A;  3DMC A;  4OVM A;  5ENU A;  1XW6 A;  4ZBB A;  2MF7 A;  4IHU A;  1YHQ 3;  3LOY A;  5IO0 A;  1GOV A;  3CCM 3;  1UA5 A;  3AGN A;  1NJI 4;  2V32 A;  3CTF A;  3ZRD A;  4BL7 A;  1TK0 B;  4H86 A;  4NHW A;  3IAS 2;  3SOA A;  1CQH A;  5AIF A;  2B24 B;  4USS A;  2IUK A;  5F07 A;  2XSO B;  6GSU A;  5IG4 A;  3DY5 A;  1X5D A;  3UL3 A;  1JJ2 2;  4NAX A;  2AB6 A;  2TIR A;  1UCI A;  4N6V 0;  4KZ1 A;  4BIR A;  6STD A;  1JB4 A;  1ERW A;  2CA8 A;  2H01 A;  4MZC A;  4AF2 A;  3VI5 A;  2GSP A;  5HGR A;  3SBC A;  5IMC A;  2W2C A;  1BJX A;  3RGR A;  3X3Z A;  1EGR A;  3MWH A;  5KP3 A;  4PEJ A;  4ORL A;  4FYB A;  1FUW A;  4O7H A;  3VK9 A;  2CWV A;  1JV2 B;  5KEJ A;  4MJD A;  4HS1 A;  5TGN A;  5BMU A;  1YKA A;  3MSZ A;  2HE3 A;  2VUP A;  4PUR A;  5CRD A;  1TI3 A;  3G0K A;  3U1W A;  2XBQ A;  1D6Y A;  2XSH B;  4K1V A;  3CCS 3;  2KAA A;  2YFJ B;  3D6I A;  3QK9 A;  4O8S A;  4LSO A;  1GWC A;  5AYS C;  1GY7 A;  5IG5 A;  2DLX A;  1PU4 A;  1J08 A;  1VQM 3;  5G30 A;  3EN8 A;  3ER7 A;  1HZ1 A;  3S28 A;  4NV5 A;  2CHC A;  1FZU A;  3J7Y k;  1R5A A;  1EV4 A;  4EV2 A;  1EGO A;  3WR2 A;  2CC3 A;  2W9P A;  1GY5 A;  4X4J A;  4N0V A;  3H4K A;  1FUT A;  1ERU A;  2WDU A;  5DJL A;  3DKS A;  1GTU A;  3GKM A;  2VLT A;  2IY2 A;  3ALA A;  5ECS A;  1VQK 3;  1KNG A;  1UCJ A;  3CC7 3;  4HZ9 B;  3HZ4 A;  1QAK A;  2J23 A;  1B3S A;  4FMC A;  3VF1 A;  3ERF A;  2B7K A;  1B27 A;  1X0R A;  4K8M A;  4RNY A;  4HOJ A;  4RQR A;  5IPH A;  3HJO A;  1FUS A;  1W01 A;  3H3H A;  3X3X A;  2QA1 A;  4O5Q A;  1ROV A;  1SKW B;  3LTB A;  1QQ2 A;  3ERG A;  5STD A;  2KP2 A;  1NM3 A;  2C11 A;  3EBY A;  4RQX A;  3S9F A;  5JWO B;  1G02 A;  1Q42 A;  4PUF C;  1IT7 A;  1UDI I;  2HT9 A;  1SK0 A;  1TP6 A;  2CK3 H;  2GQM A;  4WR4 A;  5HR2 A;  5G5F A;  2OE1 A;  1ACV A;  3TKR A;  5BXQ A;  1I0V A;  2UZ8 A;  3M0F A;  3VWU A;  5ECP B;  1T4Z A;  1AQZ A;  2I81 A;  3TJG A;  2MC8 A;  1JFU A;  4KFE A;  18GS A;  3FG4 A;  5H5Q A;  3K9M C;  1XVQ A;  3O3T A;  1HU9 A;  2VCX A;  2NVL A;  4HM4 B;  4WF5 A;  3HVV A;  1Q7H A;  3CCR 3;  4HU9 A;  4O02 B;  2GDR A;  2JQ5 A;  2R0G A;  2YJH A;  1SKS B;  4XB5 A;  1FB0 A;  1ZCP A;  1T3B A;  2YFL B;  3BLZ A;  1XWG A;  3GV1 A;  3UVT A;  3E99 A;  4L5L A;  5HR1 A;  2HMM B;  3NQY A;  1Z6N A;  3ERW A;  2JZT A;  1JZO A;  3PIN A;  3OWU A;  4J9A A;  2BTO T;  3LWA A;  1JBT A;  3SWL A;  3ZG5 A;  1SD9 A;  3AHW A;  9RNT A;  1W6C A;  2FGT A;  1C54 A;  5G1L A;  3VUR A;  3PCR A;  3EE1 A;  5IMZ A;  4N6O B;  1ON4 A;  5B8B A;  1FGR A;  1I3F A;  4HM6 B;  1BU4 A;  3KZQ A;  2E2M A;  2VLU A;  3PYJ A;  3BNC A;  4LA1 A;  1ZL9 A;  1GRX A;  2LRT A;  1IVV A;  2C0E A;  4EC6 A;  3UMA A;  4JZQ A;  2IJY A;  5IMA A;  2QKE A;  2QC7 A;  1G96 A;  3STD A;  1T1V A;  1PYL A;  3H79 A;  5IEN A;  2SAR A;  1DVD A;  4IEL A;  1TRW A;  1R4Y A;  2M80 A;  2LQO A;  1R26 A;  3CCJ 3;  5CRH A;  4PQH A;  3RBT A;  1HQO A;  2GGT A;  1F3B A;  3F9U A;  3HVS A;  2XPE A;  4MF5 A;  2H6Y A;  3NBJ A;  4K5R A;  3D22 A;  1YVS A;  1RRH A;  1FB6 A;  3VGN A;  3RGA A;  3RPP A;  2HMJ B;  4GQC A;  4K2X A;  4MCU A;  4R1K A;  3FRC A;  4N0Z A;  1PFP A;  2H72 A;  4Q5Q A;  1JNQ A;  5AII A;  1VQQ A;  4GHO A;  5JCU A;  5J3R A;  1PMT A;  4AKY A;  1BED A;  4O92 A;  4GL6 A;  3LH4 A;  4DSQ A;  1SL0 B;  2RGQ A;  4XBT A;  3P90 A;  3ME7 A;  3KH7 A;  3M9J A;  5LD0 A;  3SYU A;  1NU3 A;  2AAE A;  3LT9 A;  3UAP A;  1S3D A;  1DSB A;  4N6M A;  5DCH A;  3F8H A;  2F51 A;  1Q4J A;  3HDC A;  2CWT A;  1AC1 A;  1Z7P A;  4PQI A;  3KIJ A;  5EL8 A;  1BNI A;  2ON5 A;  3EHC A;  1OCV A;  4IP1 A;  4ZL7 A;  1DE3 A;  1IQY A;  3K7C A;  3NBR A;  3C1S A;  3F4R A;  3WT2 A;  2Z77 A;  4CY6 A;  1CQG A;  2CAI A;  1W02 A;  4PTS A;  4EVM A;  5G5E A;  1K3L A;  3VWW A;  1FGM A;  2X8C A;  1GMR A;  6GSP A;  3OWY A;  4MZB A;  1PQN A;  5CRW A;  3RPN A;  5IF6 A;  2VAF A;  4NXI A;  4QWT A;  4LMV A;  4Q5N A;  3TJJ A;  1EOG A;  1OKD A;  2OE3 A;  1NNV A;  3ZIJ A;  2CV4 A;  4MMY B;  5DRV A;  4KF9 A;  1W4V A;  4A5P A;  4QQ7 A;  1FA3 A;  1BVI A;  3MYD A;  1YF0 A;  2YV9 A;  1DVC A;  3WGE A;  2TRX A;  1W2B 2;  1MWS A;  4GSP A;  1W6G A;  3FZ5 A;  2P0G A;  1M2B A;  4HZB B;  3UOM A;  3DD3 A;  1RDS A;  3TOU A;  5B6M A;  2JU5 A;  1NB5 I;  1G0T A;  1VF1 A;  1AW9 A;  3IA1 A;  1S3R A;  5B7C A;  4DEJ A;  4BL2 A;  3IMA B;  5IG0 A;  4FIW A;  2K0M A;  3DGQ A;  4BTY A;  5DVB A;  1JHB A;  2ML6 A;  1WOU A;  1ZOF A;  2C0F A;  3ZRE A;  1Z3E A;  1UC7 A;  1PL2 A;  4EDY A;  1CQS A;  3MG3 A;  2IMK A;  20GS A;  1AQW A;  2R4I A;  3PPU A;  4RUV A;  2AAW A;  2CFK A;  4HDE A;  2QA4 3;  2Q07 A;  5J4U A;  2GZZ A;  3NM7 A;  2IFQ A;  2W04 A;  2ZA4 A;  3OXA A;  2CKF B;  1M90 4;  2C10 A;  4MMX B;  3V98 A;  3CTG A;  1BAY A;  2H6X A;  3TRQ A;  1A2J A;  2D1W A;  5IPG A;  2F5M A;  5IM9 A;  1AXD A;  3EUR A;  3NZN A;  1OC8 A;  1B21 A;  3MKI A;  5DAL A;  5ELG A;  3TUE A;  1OPY A;  1J2B A;  3ZML A;  1I3I A;  3CD6 3;  1HYU A;  1IDP A;  3F7X A;  3F6F A;  2W56 A;  4GF0 A;  1RGC A;  3IK7 A;  3CCQ 3;  4J8T A;  2L6C A;  2BIR A;  5JPP A;  1N5P A;  1XXU A;  5JCW A;  2A2R A;  1WQL B;  1OAC A;  1MD4 A;  4FO5 A;  4KVH A;  1O8W A;  4Q5F A;  1WMO A;  2LJA A;  2X64 A;  1A0F A;  3NOF A;  3MHE A;  3EBT A;  2LV3 A;  1M2A A;  5KN0 A;  1OF5 B;  2BO9 B;  3HIG A;  4MK3 A;  3A2W A;  3AMO B;  1MWR A;  5CNW A;  3I0Y A;  2Y74 A;  4GXZ A;  4XS6 A;  1PL1 A;  3UIW A;  4HJL B;  2WFC A;  1SK2 A;  1M99 A;  3G8Z A;  5H5S A;  4EL1 A;  1I70 A;  5CP1 A;  1NSW A;  1TP9 A;  5ID2 B;  4K1U A;  4GQF A;  1OHP A;  3GSP A;  3L9S A;  1B2Z A;  1IVW A;  3KCM A;  4TR1 B;  3DGM A;  1WMP A;  1BQ7 A;  1RHL A;  2NBS A;  1KTE A;  1T4Y A;  3CRT A;  4G19 A;  4BWS A;  4EUY A;  4KX4 A;  1E3V A;  3AY8 A;  3MWZ A;  1W4N A;  1OHS A;  2VCT A;  1VQ9 3;  1F8N A;  3CMI A;  4XM4 A;  1AVK A;  3B8L A;  3F4S A;  4R9L A;  5HFI A;  1YI2 3;  22GS A;  5EVH A;  5IG3 A;  1RN7 A;  1RTU A;  3JUP A;  5E59 A;  3GYK A;  3LQ7 A;  4ILF A;  1T00 A;  1PKW A;  3US3 A;  1ASK A;  4E8H A;  1Y6E A;  3LJR A;  3RHC A;  4Z2U A;  1WPI A;  4OCE A;  3CCV 3;  3V1W A;  2DIY A;  4TRX A;  4O3V A;  2GSQ A;  1N9J A;  2KHP A;  2UUG C;  8RNT A;  4O32 A;  1J9B A;  3OR5 A;  3JUO A;  4BVX B;  2M7O A;  1VQN 3;  5AGY A;  2VCZ A;  2L57 A;  2QA2 A;  3EF8 A;  5CF2 A;  1Q7Y 4;  1XVW A;  3RAZ A;  5H5R A;  3OV4 A;  3BCI A;  4J56 E;  3TOT A;  2MMN A;  3L0H A;  1QMV A;  1UCL A;  3HZP A;  1TOF A;  1I2F A;  2CVB A;  1MDJ A;  1A23 A;  4X0X A;  5D93 A;  3LYG A;  2DKI A;  2WJU A;  4IBP A;  1BNS A;  3I9V 2;  2J9H A;  4O2H A;  3N9J A;  1G7E A;  1XZO A;  1X9S B;  5IO2 A;  1PX6 A;  2L1S A;  1MDI A;  3EPT A;  3NQZ A;  5C00 A;  2GSR A;  4XBX A;  1TU8 A;  1WJK A;  3NHX A;  2XGL A;  1FAA A;  1K73 4;  2MMA A;  1GTB A;  3F8U A;  5GSS A;  2WGR A;  3DML A;  1E6B A;  1GUM A;  1GMP A;  1O6J A;  1LNH A;  3UAR A;  1LRA A;  4ZM8 A;  2YCD A;  4HVN A;  1FGO A;  5BIR A;  4O5U A;  1OKT A;  3D21 A;  4EKZ A;  1BGS A;  2LEG A;  3GX0 A;  1QAL A;  3EWL A;  4MF7 A;  5J9C A;  5DAK B;  5CAX A;  4U13 A;  1M9B A;  4L0U A;  3HY2 A;  4ZIJ A;  2CZ2 A;  2NTO A;  1RGH A;  3KJY A;  2KRT A;  3RDE A;  4HM8 B;  5AI1 A;  3DVW A;  3O76 A;  2KOK A;  3L78 A;  1QGV A;  2FWF A;  3B4P A;  1F37 A;  4KW6 A;  1B9Y C;  3IHQ A;  1YDK A;  1B2U A;  2W0Q A;  3QFA C;  1OE7 A;  2A15 A;  4O5R A;  4XTS A;  4OUQ A;  1F6M C;  4TX4 A;  2RLI A;  4IJ3 A;  2K9F A;  4K1F A;  1WRY A;  3VWV A;  2I9H A;  3A2V A;  4WP5 A;  3T0U A;  3F6D A;  1A24 A;  3TJF A;  3QRD A;  3N5O A;  4AJ6 A;  1WE0 A;  3GST A;  3EC9 A;  1O8X A;  1BSD A;  1RLS A;  3GKN A;  1IV9 A;  5AEW B;  1O73 A;  2RBI A;  3MYT A;  1NWW A;  1ZO2 A;  3ZYW A;  4F0B A;  3EYT A;  4JR4 A;  4FCZ A;  3K63 A;  1MDK A;  5AIV A;  6GSV A;  4MPG A;  3KMO A;  2OA7 A;  3IK9 A;  4MMM A;  4L0W A;  3G6E 3;  3LYK A;  1XW5 A;  3EQQ B;  2O9U X;  2E2U A;  1Z5Y E;  3R2Q A;  1F9M A;  7STD A;  3IPZ A;  4DSS B;  1E3R A;  1UVZ A;  3EIN A;  4ZB8 A;  2GEX A;  3KTL A;  4BA7 A;  1KD1 4;  3FEU A;  3OWS A;  1WMJ A;  3FZ9 A;  4TOP A;  1TTZ A;  12GS A;  1K28 A;  3WYW A;  4K9Z A;  1OHO A;  3CPW 2;  1PX7 A;  2VL2 A;  3KN4 A;  2HOH A;  2H74 A;  3RDW A;  2RCD A;  1XW9 A;  4PQ1 A;  3FHK A;  2I1U A;  1GNE A;  1RN1 A;  5EEO A;  1VQ6 3;  2C0D A;  5D83 A;  4WFO A;  4JED A;  2YZH A;  4FMD A;  4Q53 A;  5EQL A;  4MP4 A;  5EY6 A;  1RNT A;  4KFF A;  2E7P A;  1EEJ A;  3U6V A;  3MPH A;  1NDO B;  2YJ7 A;  3IDV A;  3QMX A;  1EZK A;  3CCE 3;  3GZB A;  1TXX A;  4K2D A;  2FUG 2;  2GQK A;  3UJ1 A;  2UGI A;  3A5I A;  5B8A A;  3EVI A;  1GH2 A;  2L5L A;  3D5J A;  4ID0 A;  2YOI A;  1W2Z A;  4Q5R A;  1TRU A;  1L5G B;  3GTU B;  1I5G A;  3TCO A;  1YZX A;  2DC5 A;  1WP0 A;  4IW9 A;  3VWX A;  3QD9 A;  1RMS A;  3G9B A;  3BB9 A;  2R5G A;  5F0G A;  1N2A A;  3IE3 A;  4N11 A;  1CH0 A;  3FR9 A;  4HQZ A;  5J9B A;  1CEW I;  2VCV A;  3VPQ A;  4EC0 A;  1BUQ A;  3I55 3;  4MEI A;  1SJ6 A;  5DCG A;  2F98 A;  5JWQ B;  3LZA A;  1URM A;  1VQ5 3;  9GSS A;  1NHO A;  2B7J A;  4BPY A;  3PS8 A;  3PZW A;  1SIH A;  2CVD A;  5I97 A;  3TRX A;  3FF2 A;  1OUN A;  5ELU A;  6GSY A;  2PER A;  4YQV A;  2L6D A;  3WGX A;  1ML6 A;  3TRP A;  3U5R E;  1M7T A;  3WDG B;  3M1G A;  4Z7X A;  4NPB A;  1RGK A;  1YQ1 A;  1A2V A;  2DJ0 A;  1MOL A;  3WA2 X;  2WRT A;  2X4A A;  1TUH A;  2STD A;  3LTC A;  1K3Y A;  2B1K A;  3Q18 A;  1KBN A;  1BRH A;  1U3I A;  3BJ5 A;  3ME8 A;  1T2H A;  2KXG A;  4YQM A;  5M18 A;  5F8B A;  1XWK A;  3DUK A;  2IMI A;  3H93 A;  3QOU A;  4ISD A;  1UN2 A;  3D9R A;  4GSS A;  3AHS A;  2EIO A;  3G7I A;  4PNG A;  2YV7 A;  1A90 A;  4AJ7 A;  3FMW A;  4IPB A;  4X2O A;  2JAC A;  2KF3 A;  5DRE A;  4H3U A;  5LCZ A;  1JLV A;  2VD1 A;  4XCS A;  1FW1 A;  3IBH A;  2DJ2 A;  3D0Z A;  5A5K A;  3F3R A;  2XF3 A;  5AEU B;  1JZW A;  2QGV A;  2ZCT A;  3EE2 A;  4IJI A;  4LEH A;  2XGN A;  3D4A A;  3FF0 A;  5DBQ A;  2ES7 A;  2IMF A;  3GA4 A;  2X49 A;  3GH9 A;  2G2Q A;  2HSH A;  5CRE A;  3BOA A;  3BNB A;  4GRF A;  4HU7 A;  2A4V A;  3U97 A;  3IHG A;  2OJL A; 
#chains in the Genus database with same CATH homology
 2BMX A;  4PXO A;  2YN1 A;  1BYE A;  1K0C A;  1X9W B;  2MMO A;  1EEM A;  3M3M A;  3J7Y b;  2TRC P;  1FVJ A;  1SL2 B;  5KN3 A;  1XFL A;  2YP6 A;  1GLQ A;  4POL A;  4GSN A;  4MJC A;  1E2Y A;  2MYG A;  2DBC A;  2VM1 A;  5A4V A;  4WF4 A;  16GS A;  1F2E A;  4Z2T A;  4GLT A;  3M9K A;  2FWH A;  3KP9 A;  1V40 A;  5C04 A;  2LTK A;  3NIV A;  1JZD A;  5BRT A;  1GTI A;  1T8E B;  4EIP A;  4V1A p;  2OKA A;  2X99 A;  2Z9S A;  1Y25 A;  2P5R A;  2VM2 A;  4CY8 A;  5IMF A;  3C8E A;  2GT6 A;  2V2G A;  4E8E A;  2WZ9 A;  2A4H A;  2WCI A;  4G10 A;  2IWT A;  1Z7R A;  5DQS A;  2O85 A;  4WKW A;  3FZ4 A;  5HFG A;  2L4C A;  4XRA A;  4KSM A;  4K7O A;  1EP8 A;  2CZ3 A;  4FYC A;  2VO4 A;  2H0I A;  4XHM A;  3F3Q A;  5DQY A;  1C72 A;  3BCK A;  4LL1 B;  4TN8 A;  1OVN A;  1H75 A;  2DML A;  1A8L A;  4YKF A;  2H73 A;  1SK1 A;  2FD3 A;  4NHZ A;  2DJJ A;  4V2L A;  2HRK A;  2O8V B;  3TKS A;  5HR3 A;  3G7J A;  1U87 A;  2HXK A;  4K7N A;  2EC4 A;  5L71 A;  2KP1 A;  1G7O A;  4LMW A;  3ZTL A;  2PWJ A;  4TXO B;  3KMN A;  1IYI A;  4BVY B;  4WBR D;  5ID2 A;  2YWO A;  1ABA A;  4IVF A;  4JBB A;  4YQU A;  4TR1 A;  2B3S A;  1I9D A;  3TGZ A;  4Z2R A;  1EOH A;  1XBS A;  1ERT A;  1OAZ A;  3TKP A;  1GNW A;  2YZU A;  5GAN D;  3LSZ A;  1NW2 A;  4MLY A;  3FK8 A;  2P31 A;  2EIR A;  1K0D A;  1A8Y A;  1PSQ A;  2R0P A;  5COH A;  1R5P A;  2IPA A;  2H76 A;  1H4O A;  2C3N A;  1FVK A;  1XPV A;  1TDI A;  3KM6 A;  5ELA A;  1RK4 A;  2B1L A;  4KAE A;  3GNJ A;  3R3E A;  2LQQ A;  3F0I A;  3I6A A;  3IOS A;  4AJ8 A;  1USB A;  3CBU A;  5ABR A;  5IMV A;  3HA9 A;  1K0O A;  2RII A;  2MBT A;  1TKD B;  2B5E A;  4F82 A;  4OFM A;  4BVX A;  2JSY A;  1X9M B;  5B6N A;  3H8Q A;  3ZVJ D;  3CRU A;  4KDX A;  5ECM B;  3MDK A;  1S3A A;  2AUV A;  2LKU A;  3HJP A;  2CQ9 A;  2CX4 A;  4F0C A;  2HRN A;  3ZVJ A;  3KH9 A;  3KGK A;  3GHA A;  3HKR A;  4MF6 A;  4RI7 A;  3DWV A;  3HD5 A;  4TR3 A;  4I8B A;  3WGD A;  3DXB A;  1B4P A;  2HNL A;  4KB3 A;  3F63 A;  4MDC A;  5AIX A;  3ZMK A;  2LS5 A;  3GUS A;  3ZLP A;  2VOC A;  2H6Z A;  1GSF A;  2R4V A;  3P7X A;  2LJR A;  1YJ6 A;  1TK5 B;  3PGT A;  4V1A g;  3C71 A;  5DAK A;  4XS1 A;  1YF1 A;  1FOV A;  1BX9 A;  1GUH A;  3IC8 A;  2XC2 A;  2LNS A;  3IR4 A;  3KEB A;  3QFB C;  4GST A;  3WT1 A;  1DUG A;  4ZBD A;  2C1Y A;  4HJ2 A;  2FLS A;  4EDZ A;  4ZB6 A;  1RW1 A;  2HLS A;  2ON7 A;  1SD8 A;  4OO5 A;  1X5C A;  3F4T A;  1LJR A;  4MH3 A;  2FWG A;  5JCG A;  2O7K A;  2IL3 A;  3Q19 A;  2HI7 A;  1LU4 A;  4G2E A;  2DJK A;  2HZE B;  2H1B A;  4HJM A;  4KE3 A;  2N5B A;  2YNX A;  4KCE A;  1O81 A;  5D9W A;  5IIZ A;  2OBI A;  5GAP D;  4KSO A;  1IYH A;  4MJA A;  5KOW A;  5HFK A;  1OC9 B;  4V2M A;  1KEB A;  1AAZ A;  1TRS A;  3GMF A;  1ZZY A;  1T7P B;  2I3Y A;  2FNO A;  1OYJ A;  2F8F A;  2K8V A;  4DSS A;  2PVO C;  1FHE A;  1PA3 A;  5G31 A;  3E9J B;  3D4M A;  4GTU A;  3W6G A;  1FOH A;  2I4A A;  1K0A A;  4L8E A;  5ECH B;  5F06 A;  3HXS A;  1U6T A;  2YWN A;  2PGT A;  5LNK e;  2C4J A;  1PD2 1;  4KDU A;  1GLP A;  4ZBA A;  4N30 A;  1OE8 A;  2MMZ A;  3ZIT A;  4IN0 A;  1BG5 A;  3QR6 A;  4XS4 B;  4DVC A;  1EWX A;  4K0G A;  4KH7 A;  2C0G A;  2DKH A;  2IN3 A;  1XCC A;  3GUR A;  5IQY A;  5D73 A;  6GST A;  3TB2 A;  2VCW A;  2QSI A;  1QFN A;  2HZF A;  4I97 A;  3I69 A;  2GS3 A;  1OC3 A;  3UBL A;  3GTU A;  3PH9 A;  1MEK A;  2F9S A;  4CW9 A;  1U3A A;  5HR0 A;  1AQX A;  1QUW A;  2VD0 A;  2VIM A;  3DIE A;  5GST A;  2H1G A;  3TJB A;  3L9V A;  4G9H A;  2DMM A;  2IMD A;  1YY7 A;  4FQU A;  1HNA A;  4IS0 A;  5ECO B;  3QAG A;  4ECB A;  4ACS A;  1SKR B;  4IQ1 A;  2C80 A;  2JZR A;  2JZS A;  4POM A;  3GL5 A;  4KUN A;  1PGT A;  4ULX A;  2GZP A;  4IQA A;  4MZW A;  5A4U A;  3I43 A;  2DJ1 A;  2AHE A;  2H66 A;  4J2F A;  2VL3 A;  2N5F A;  4ZIL A;  2LRC A;  2H8L A;  1SU9 A;  2K18 A;  2VL9 A;  4D73 B;  2EIQ A;  3EC3 A;  2CVK A;  4HUA A;  1TRV A;  2C3T A;  4ML6 A;  3APQ A;  4CHS A;  3EU3 A;  3GX8 A;  2K6V A;  3G7Y A;  2PU9 C;  1RQM A;  4RI6 A;  2OAD A;  4L5O A;  4YAP A;  3GFK A;  2FGX A;  3VLN A;  2FY6 A;  2H0G A;  3KXO A;  3E0U A;  2O87 A;  1VF3 A;  2IME A;  3UVH A;  4V2N A;  3HHV A;  3A5W A;  5ECK B;  2NDO A;  4KCA A;  4WR5 A;  2H75 A;  2HSM A;  3MAK A;  3W8J A;  1QK8 A;  1AIU A;  2MBS A;  3WD6 A;  3ZFB A;  1M0U A;  3GH6 A;  5CYY A;  4KDY A;  1K3O A;  1W89 A;  2WB9 A;  2O89 A;  1SEN A;  2DIZ A;  4ZB9 A;  1DE2 A;  5IOW A;  1R4W A;  1Z6M A;  3UEM A;  3TKQ A;  1A0R P;  2AV4 A;  2H0H A;  2R0C A;  4WBJ A;  4BL7 B;  4TW5 A;  1JLW A;  3HCZ A;  3DYR A;  1HNB A;  2AJQ B;  2GTU A;  2CT6 A;  2IYJ A;  1ZYQ B;  1V98 A;  2HRA A;  3PR8 A;  2DSA A;  2GLR A;  2CX3 A;  1PN0 A;  1SYX A;  2X8G A;  1S3C A;  2N5A A;  2JAD A;  2P5Q A;  2XBI A;  2LNT A;  4NV2 A;  2L59 A;  3LFL A;  5KN1 A;  5CRG A;  4EE0 A;  2ALB A;  1V9W A;  3FY7 A;  2VL2 C;  2K8S A;  1XIY A;  3MNG A;  6GSW A;  4HEA 2;  2MZC A;  3TDG A;  4ZL8 A;  4I2U A;  4WXT A;  3EMX A;  4MPF A;  2H1D A;  3RHB A;  4I6X A;  3M8N A;  14GS A;  4X1U A;  2FA4 A;  4KGI A;  3CSJ A;  1SJZ A;  4JE1 A;  5FT3 A;  4EF0 A;  5EPF A;  1LBK A;  5D8I A;  1B4Q A;  2A2S A;  4HI7 A;  1DBY A;  3IAM 2;  1VGL A;  4K7I A;  4PNF A;  2KLX A;  1MTC A;  1G6Y A;  3K8N A;  1WIK A;  1ILO A;  5AIS A;  3IXR A;  3IC4 A;  6GSX A;  3FKF A;  3C1R A;  2WS2 A;  5IOX A;  3ED3 A;  5CO3 A;  2HSY A;  1GL8 A;  1VF2 A;  4FH8 A;  3P8W A;  8GSS A;  2L4Q A;  2OE0 A;  3QPM A;  4TVE A;  4KND A;  4ICY A;  2C3Q A;  4WET A;  1SJI A;  3ZFL A;  2PN8 A;  5FHI A;  4TXO A;  2LJK A;  3LGC A;  4XIH A;  3GKX A;  4BVY A;  3HZ8 A;  4MH2 A;  2G0F A;  4HQS A;  3HVX A;  3BD2 A;  5J5N A;  1GSE A;  1X5E A;  5DDL A;  4I2T A;  3HJM A;  1AUC A;  3QAV A;  4YH2 A;  3KTB A;  1JZR A;  1Q98 A;  1YEP A;  1TI1 A;  4POB A;  1K0N A;  3LXT A;  2FCH A;  4POK A;  2C8U A;  2ZUP A;  3BBY A;  2JL4 A;  1GSD A;  4JR6 A;  4ZL9 A;  1XOB A;  3DEX A;  1GTA A;  1SYR A;  4MAB A;  3APO A;  1XWB A;  4LL4 B;  1K0B A;  3L4N A;  1V2A A;  4HZ4 A;  4AGS A;  3JCM L;  2GT5 A;  4YKG A;  4OMV A;  2PVQ A;  2GZY A;  3KP8 A;  4NMU A;  5D9V A;  3GRX A;  2DJ3 A;  5DJM A;  2OBK A;  4EO3 A;  5ECQ B;  5D96 A;  4MNN A;  1THO A;  2VCQ A;  2YWI A;  3O6T A;  4OFN A;  3TJK A;  2LST A;  1G6W A;  1FG4 A;  4OFT A;  4QL7 A;  2X8H A;  2LUS A;  2M46 A;  3LG6 A;  3QCP A;  3HYP A;  4EXJ A;  2LRN A;  2R3X A;  5D9T A;  17GS A;  4HZ2 A;  4P3Y B;  3ZIV A;  1PN9 A;  1B8X A;  2YAN A;  5GZZ B;  3IRA A;  5ECL B;  1F3A A;  2M72 A;  4ECI A;  1DE1 A;  13GS A;  2GST A;  2FHE A;  3CYN A;  3APS A;  1ZYN A;  4G0I A;  4ZXG A;  3VPT A;  4F03 A;  4F2I A;  2H19 A;  4IGJ A;  1ZGN A;  3QDN A;  5A4W A;  1B48 A;  3CXG A;  3W8S A;  4MJE A;  2VLV A;  4IP6 A;  4PUA A;  2REM A;  1B9X C;  2RM5 A;  4OCF A;  2KUC A;  1GSU A;  1TJD A;  5G1K A;  3ZZX A;  1R7H A;  2CAQ A;  2PBJ A;  2BJX A;  4N10 A;  5INY A;  5EVO A;  5D9X A;  1XWA A;  3FYG A;  7GSS A;  2A2P A;  3QAW A;  4NWY A;  5KN2 A;  3DRN A;  1GSY A;  1TK8 B;  1YKC A;  2GQL A;  2HZE A;  3EU4 A;  2PUK C;  2V1M A;  2V6O A;  1EP7 A;  4XRD A;  1AQV A;  1XOA A;  2R2J A;  3C73 A;  3LEF A;  3D4T A;  3DVX A;  4G0K A;  2RM6 A;  3TKS C;  2R37 A;  3MIX A;  1GP1 A;  4IKH A;  5ECI B;  1WWJ A;  1OC9 A;  1EV9 A;  2L5O A;  2YPM A;  2IFQ B;  2GVP A;  2F3M A;  3H1N A;  2V6K A;  2ZNM A;  5JWR B;  4CDO A;  5E4W A;  4YAV A;  3GN3 A;  5DAL B;  2E2G A;  3EMP A;  4ECC A;  3LXZ A;  3CSH A;  5G2Z A;  3VI7 A;  4GWR A;  4ECJ A;  4LLR A;  2HRF A;  4TR0 A;  1ZMA A;  1A2L A;  3UBK A;  4PGT A;  3GIX A;  4G0L A;  1GUK A;  4JU5 A;  4OD7 A;  1V58 A;  4XS4 A;  5ECR B;  3ISO A;  4PX1 A;  1V57 A;  3GSS A;  1TU7 A;  5HQP A;  1U88 A;  4TKY A;  4KA0 A;  1YEX A;  1GSQ A;  5ECN B;  2WUL A;  3GL3 A;  4TR4 A;  4TXV A;  1ZYE A;  3A3T A;  3TKS E;  1THX A;  4BWQ A;  1PRX A;  4F9Z A;  2PMT A;  3LOR A;  4ML1 A;  1GUL A;  3Q74 A;  2V41 A;  2R6K A;  1ST9 A;  5FWG A;  3C7M A;  1M9A A;  5AN1 A;  5KOX A;  4QL9 A;  1HNC A;  4DSR A;  19GS A;  1O7U A;  3LW9 A;  1FO5 A;  2AYT A;  11GS A;  1MD3 A;  1K0M A;  2RUF A;  2FA8 A;  2HYX A;  3P2A A;  5F05 A;  2D2Z A;  6GSS A;  3FZA A;  3FR3 A;  10GS A;  3KD0 A;  2B5Y A;  1TW9 A;  4MA9 A;  2E0Q A;  1A2M A;  1PKZ A;  4OO4 A;  4K0N A;  4FYU A;  3IV4 A;  2H70 A;  2H1A A;  4D73 A;  1VF4 A;  2F8A A;  2B5X A;  1GSS A;  2B6M A;  2OAC A;  3A2X A;  3FR6 A;  5IMD A;  1O85 A;  4X43 A;  1Z9H A;  3VFI A;  2YWM A;  4K6X A;  5J41 A;  4JRR A;  2JSZ A;  2RUE A;  2GSS A;  2H71 A;  3L9U A;  2XHF A;  2NPB A;  2HFD A;  3FW2 A;  3ZL5 A;  1QXH A;  4OWY A;  1ERV A;  2H30 A;  4EIQ A;  4MJB A;  2XPD A;  4I5Q A;  3E3E A;  4K5S A;  1J0F A;  4J57 E;  1N8J A;  3LYP A;  2IIY A;  3CSI A;  2PPT A;  1SL1 B;  1HD2 A;  4WEY A;  1ZYP A;  1NHY A;  2FWE A;  1M2D A;  1VRS D;  1XWC A;  3GKK A;  4GCI A;  3Q6O A;  5ENU A;  1XW6 A;  4ZBB A;  4IHU A;  5IO0 A;  1UA5 A;  3CTF A;  2V32 A;  3ZRD A;  4BL7 A;  1TK0 B;  4H86 A;  4NHW A;  3IAS 2;  1CQH A;  4USS A;  5F07 A;  6GSU A;  1X5D A;  3UL3 A;  4NAX A;  2AB6 A;  2TIR A;  1ERW A;  2CA8 A;  2H01 A;  4MZC A;  4AF2 A;  3VI5 A;  3SBC A;  5IMC A;  1BJX A;  1EGR A;  3MWH A;  4FYB A;  4O7H A;  3VK9 A;  5KEJ A;  4HS1 A;  5BMU A;  1YKA A;  3MSZ A;  2HE3 A;  2VUP A;  4PUR A;  5CRD A;  1TI3 A;  2XBQ A;  3D6I A;  2DLX A;  1GWC A;  1J08 A;  5G30 A;  4NV5 A;  3J7Y k;  1R5A A;  1EV4 A;  1EGO A;  4X4J A;  4N0V A;  3H4K A;  1ERU A;  2WDU A;  5DJL A;  3DKS A;  1GTU A;  3GKM A;  2VLT A;  2IY2 A;  5ECS A;  1KNG A;  3HZ4 A;  2J23 A;  3ERF A;  2B7K A;  1X0R A;  4K8M A;  5IPH A;  4HOJ A;  4RQR A;  3HJO A;  2QA1 A;  4O5Q A;  1SKW B;  1QQ2 A;  3ERG A;  2KP2 A;  1NM3 A;  4RQX A;  3S9F A;  5JWO B;  4PUF C;  2HT9 A;  1SK0 A;  2GQM A;  4WR4 A;  5HR2 A;  5G5F A;  2OE1 A;  1ACV A;  3TKR A;  2UZ8 A;  3M0F A;  3VWU A;  5ECP B;  1T4Z A;  2I81 A;  3TJG A;  1JFU A;  18GS A;  5H5Q A;  1XVQ A;  3O3T A;  2VCX A;  2NVL A;  4WF5 A;  3HVV A;  4HU9 A;  2GDR A;  2R0G A;  2YJH A;  1SKS B;  1FB0 A;  1ZCP A;  1T3B A;  1XWG A;  3GV1 A;  3UVT A;  4L5L A;  5HR1 A;  1Z6N A;  3ERW A;  2JZT A;  1JZO A;  3PIN A;  2BTO T;  3LWA A;  3SWL A;  1SD9 A;  5G1L A;  3VUR A;  5IMZ A;  1ON4 A;  5B8B A;  3KZQ A;  2E2M A;  2VLU A;  4LA1 A;  1ZL9 A;  1GRX A;  2LRT A;  2C0E A;  3UMA A;  4JZQ A;  2IJY A;  5IMA A;  2QKE A;  2QC7 A;  1T1V A;  3H79 A;  4IEL A;  1TRW A;  2M80 A;  2LQO A;  1R26 A;  5CRH A;  4PQH A;  3RBT A;  1HQO A;  2GGT A;  1F3B A;  3F9U A;  3HVS A;  2XPE A;  4MF5 A;  2H6Y A;  4K5R A;  3D22 A;  1FB6 A;  3RPP A;  4GQC A;  4K2X A;  4MCU A;  3FRC A;  4N0Z A;  2H72 A;  4Q5Q A;  5JCU A;  5J3R A;  1PMT A;  1BED A;  4O92 A;  4DSQ A;  1SL0 B;  3P90 A;  3ME7 A;  3KH7 A;  3M9J A;  5LD0 A;  3UAP A;  1S3D A;  1DSB A;  5DCH A;  2F51 A;  1Q4J A;  3HDC A;  4PQI A;  1AC1 A;  1Z7P A;  3KIJ A;  5EL8 A;  2ON5 A;  4IP1 A;  4ZL7 A;  3C1S A;  3F4R A;  3WT2 A;  4CY6 A;  1CQG A;  2CAI A;  4PTS A;  4EVM A;  5G5E A;  1K3L A;  3VWW A;  2X8C A;  4MZB A;  1PQN A;  5CRW A;  3RPN A;  2VAF A;  4NXI A;  4Q5N A;  4LMV A;  3TJJ A;  1EOG A;  1OKD A;  2OE3 A;  3ZIJ A;  2CV4 A;  4KF9 A;  4A5P A;  1W4V A;  4QQ7 A;  3MYD A;  1YF0 A;  2YV9 A;  3WGE A;  2TRX A;  3FZ5 A;  2P0G A;  1M2B A;  3UOM A;  3DD3 A;  3TOU A;  5B6M A;  2JU5 A;  1G0T A;  1VF1 A;  1AW9 A;  3IA1 A;  5B7C A;  4DEJ A;  4FIW A;  3DGQ A;  1JHB A;  5DVB A;  1WOU A;  1ZOF A;  2C0F A;  3ZRE A;  1Z3E A;  1UC7 A;  1PL2 A;  4EDY A;  2IMK A;  20GS A;  1AQW A;  3PPU A;  4RUV A;  2AAW A;  4HDE A;  5J4U A;  2GZZ A;  2IFQ A;  3CTG A;  1BAY A;  2H6X A;  3TRQ A;  1A2J A;  5IPG A;  5IM9 A;  1AXD A;  3EUR A;  3NZN A;  1OC8 A;  5DAL A;  5ELG A;  3TUE A;  3ZML A;  1HYU A;  4GF0 A;  3F6F A;  3IK7 A;  2L6C A;  1XXU A;  5JCW A;  2A2R A;  1MD4 A;  4FO5 A;  1O8W A;  4Q5F A;  2X64 A;  2LJA A;  3NOF A;  1A0F A;  2LV3 A;  1M2A A;  5KN0 A;  4MK3 A;  3A2W A;  5CNW A;  4GXZ A;  4XS6 A;  1PL1 A;  3UIW A;  2WFC A;  1SK2 A;  1M99 A;  5H5S A;  4EL1 A;  5CP1 A;  1NSW A;  1TP9 A;  5ID2 B;  4GQF A;  3L9S A;  3KCM A;  4TR1 B;  1BQ7 A;  2NBS A;  1KTE A;  1T4Y A;  3CRT A;  4G19 A;  4BWS A;  4EUY A;  4KX4 A;  3AY8 A;  2VCT A;  3CMI A;  3F4S A;  5HFI A;  22GS A;  5E59 A;  3GYK A;  3LQ7 A;  4ILF A;  1T00 A;  1PKW A;  3US3 A;  4E8H A;  1Y6E A;  3LJR A;  3RHC A;  4Z2U A;  1WPI A;  4OCE A;  3V1W A;  2DIY A;  4TRX A;  2GSQ A;  2KHP A;  4O32 A;  1J9B A;  3OR5 A;  4BVX B;  5AGY A;  2VCZ A;  2L57 A;  2QA2 A;  1XVW A;  3RAZ A;  5H5R A;  3BCI A;  4J56 E;  3TOT A;  2MMN A;  3L0H A;  1QMV A;  1TOF A;  2CVB A;  1MDJ A;  1A23 A;  4X0X A;  5D93 A;  2DKI A;  2WJU A;  4IBP A;  3I9V 2;  2J9H A;  3N9J A;  1G7E A;  1XZO A;  1X9S B;  5IO2 A;  1PX6 A;  1MDI A;  3EPT A;  5C00 A;  2GSR A;  1TU8 A;  1WJK A;  1FAA A;  2MMA A;  1GTB A;  3F8U A;  5GSS A;  2WGR A;  3DML A;  1E6B A;  1GUM A;  1O6J A;  3UAR A;  2YCD A;  4O5U A;  1OKT A;  3D21 A;  4EKZ A;  2LEG A;  3GX0 A;  3EWL A;  4MF7 A;  5J9C A;  5DAK B;  5CAX A;  1M9B A;  4L0U A;  3HY2 A;  4ZIJ A;  2CZ2 A;  2NTO A;  3KJY A;  3DVW A;  3O76 A;  2KOK A;  3L78 A;  1QGV A;  2FWF A;  1F37 A;  4KW6 A;  1B9Y C;  3IHQ A;  1YDK A;  3QFA C;  1OE7 A;  4O5R A;  4XTS A;  1F6M C;  2RLI A;  4IJ3 A;  2K9F A;  4K1F A;  1WRY A;  3VWV A;  2I9H A;  3A2V A;  3F6D A;  1A24 A;  3TJF A;  3N5O A;  4AJ6 A;  1WE0 A;  3GST A;  1O8X A;  3GKN A;  1O73 A;  3ZYW A;  4F0B A;  3EYT A;  4JR4 A;  1MDK A;  5AIV A;  6GSV A;  4MPG A;  3KMO A;  2OA7 A;  3IK9 A;  4MMM A;  4L0W A;  3LYK A;  1XW5 A;  1Z5Y E;  3R2Q A;  1F9M A;  3IPZ A;  4DSS B;  1UVZ A;  3EIN A;  4ZB8 A;  4BA7 A;  3KTL A;  3FEU A;  1WMJ A;  3FZ9 A;  4TOP A;  1TTZ A;  12GS A;  3WYW A;  4K9Z A;  1PX7 A;  2VL2 A;  2H74 A;  3RDW A;  1XW9 A;  4PQ1 A;  3FHK A;  2I1U A;  1GNE A;  2C0D A;  4JED A;  2YZH A;  4MP4 A;  5EY6 A;  2E7P A;  1EEJ A;  3U6V A;  2YJ7 A;  3IDV A;  3QMX A;  1EZK A;  1TXX A;  4K2D A;  2FUG 2;  2GQK A;  3UJ1 A;  3A5I A;  5B8A A;  3EVI A;  1GH2 A;  2L5L A;  3D5J A;  4ID0 A;  2YOI A;  4Q5R A;  1TRU A;  3GTU B;  1I5G A;  3TCO A;  1YZX A;  2DC5 A;  1WP0 A;  4IW9 A;  3VWX A;  3QD9 A;  3G9B A;  2R5G A;  5F0G A;  1N2A A;  3IE3 A;  4N11 A;  3FR9 A;  4HQZ A;  5J9B A;  2VCV A;  3VPQ A;  4EC0 A;  1SJ6 A;  5DCG A;  5JWQ B;  1URM A;  9GSS A;  1NHO A;  2B7J A;  4BPY A;  2CVD A;  3TRX A;  6GSY A;  2PER A;  4YQV A;  2L6D A;  3WGX A;  1ML6 A;  3TRP A;  3U5R E;  1M7T A;  3M1G A;  4Z7X A;  4NPB A;  1YQ1 A;  2DJ0 A;  2WRT A;  2X4A A;  1K3Y A;  2B1K A;  3Q18 A;  1KBN A;  1U3I A;  3BJ5 A;  3ME8 A;  4YQM A;  5F8B A;  1XWK A;  2IMI A;  4ISD A;  3H93 A;  3QOU A;  1UN2 A;  4GSS A;  2EIO A;  3G7I A;  4PNG A;  2YV7 A;  4AJ7 A;  3FMW A;  2JAC A;  5LCZ A;  1JLV A;  2VD1 A;  4XCS A;  1FW1 A;  3IBH A;  2DJ2 A;  3D0Z A;  5A5K A;  3F3R A;  1JZW A;  2QGV A;  2ZCT A;  3EE2 A;  4IJI A;  5DBQ A;  2ES7 A;  2IMF A;  3GA4 A;  2X49 A;  3GH9 A;  2G2Q A;  2HSH A;  5CRE A;  3BOA A;  4GRF A;  4HU7 A;  2A4V A;  3IHG A;  2OJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...