2H0IA

Crystal structure of dsbg v216m mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
229
structure length
229
Chain Sequence
b'ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAMGLPDQKTLNIIMGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 65
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0iA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0iA02
2HNLA 4JR6A 4P3YB 1EWXA 4RQRA 4FYUA 5IO2A 1QXHA 1EV4A 1XWKA 3TB2A 2X8CA 5ECPB 4I5QA 4MF5A 2FA4A 2VIMA 2IJYA 2P31A 3L9VA 5KN2A 5ELAA 1OE7A 4XS4A 2C3NA 3GSSA 1V40A 5GAPD 1FW1A 3IXRA 1FB0A 4WR5A 1YKAA 3A2WA 2H75A 5HFGA 3D0ZA 1DE1A 3E3EA 2PN8A 2LJRA 2VL9A 5HFIA 2G2QA 4MABA 2AB6A 2XHFA 5D9TA 1O7UA 2H1BA 4I8BA 1F37A 2VLVA 1MD3A 1NSWA 1WE0A 3QFBC 1THOA 4V2NA 4FH8A 22GSA 1T4ZA 4KA0A 5CNWA 3EU3A 1XWCA 2FCHA 2L5OA 1A2MA 3HJOA 6GSWA 1Y6EA 1V2AA 4IVFA 2PBJA 2DJ1A 1O8XA 1X5CA 1Y25A 1RK4A 1XWAA 4EC0A 3ERFA 3QR6A 3C71A 2L57A 1Z7RA 2IFQA 4AJ7A 2V6OA 4LLRA 1TK8B 2R6KA 4OFMA 2AJQB 4GSTA 2NVLA 3TDGA 2GZYA 1JZOA 5CRHA 3ZVJD 5E59A 2IPAA 1JZWA 4MF6A 3GTUB 1SJIA 4Q5RA 1K0OA 2YP6A 2IWTA 5IMVA 2RIIA 5DALA 1ILOA 1PGTA 2DSAA 3KIJA 2ZNMA 4QL9A 3EURA 2R3XA 3GH6A 4ML1A 2K18A 3ED3A 1SU9A 1OC3A 1VF3A 3H93A 4D73B 3Q6OA 4KUNA 5A5KA 4Z7XA 2KP2A 4ACSA 3DD3A 1O73A 1LU4A 5DQYA 2CZ3A 2HLSA 2FWFA 1USBA 4IBPA 1DE2A 3D21A 1I5GA 1M2DA 3FW2A 3P7XA 3PINA 3HKRA 4J56E 5CAXA 1TKDB 3KTLA 2TRXA 1GSSA 4BVYA 4OO4A 5CRGA 1XXUA 5J9BA 5CRDA 2FGXA 2RUFA 4DSSA 2BJXA 4L5LA 3ERWA 5IMDA 2OKAA 2RM5A 3DXBA 1U3IA 2HZEA 1Z6MA 2DMMA 2E7PA 2YWOA 5ECOB 3TCOA 1GUHA 4POKA 1U88A 3HY2A 1T3BA 2OBIA 4RI7A 1UA5A 4KDXA 4ZB9A 2OBKA 5DQSA 1KBNA 3GFKA 1FG4A 1X9SB 2R5GA 1FO5A 1A8YA 2I81A 1PKZA 4DVCA 5ID2A 4N11A 1NM3A 2EIQA 1PA3A 2WFCA 3P90A 1GLPA 2LNTA 2MBSA 1GRXA 1SJ6A 4XRAA 2H1AA 3GH9A 2AYTA 1O81A 2B5YA 2A4VA 3L78A 2BMXA 3IV4A 1UC7A 4F9ZA 3APQA 2WRTA 3H4KA 1RW1A 1XW9A 4MJEA 1B4QA 5G30A 4HU7A 1MTCA 3F4SA 2WS2A 2WJUA 4POBA 1F3AA 4F0BA 1EV9A 4F03A 2DMLA 1OC9A 5ECKB 1X5DA 3N9JA 2HT9A 2JZSA 4RI6A 5ECMB 1Z6NA 2A2RA 2VL3A 3HXSA 4XS1A 1R26A 5H5SA 1UN2A 2MYGA 5IM9A 4GXZA 1GSEA 4ZBBA 3M3MA 4GF0A 3H1NA 4K2DA 4XTSA 1HNAA 3WYWA 1NHOA 18GSA 3QPMA 4CHSA 1XW5A 5B6MA 2LKUA 2I1UA 4K8MA 3BJ5A 3Q74A 5AISA 1OKTA 2LJAA 1SKSB 2CAIA 3L9SA 1G6YA 5DJMA 4G10A 3UMAA 4WBRD 3F4RA 2IMFA 4NXIA 3VWXA 4AGSA 1PL2A 3APOA 2IMEA 4N0VA 2H1DA 1A23A 1K0AA 4WBJA 2WDUA 4CW9A 3TKSE 4DEJA 3LQ7A 4IGJA 2MMAA 4POMA 3TRQA 1I9DA 1NW2A 1VGLA 4XHMA 1YEPA 2GSQA 3KP9A 2L4CA 4QQ7A 1JLVA 2YWIA 4DSQA 3GMFA 1S3AA 1ZL9A 4XIHA 2IIYA 3GTUA 3VWVA 4LMWA 1T8EB 1U6TA 3L4NA 1M0UA 5CRWA 2K9FA 4ILFA 1WOUA 3HZ8A 1Q98A 4MMMA 4PNFA 3GV1A 2PGTA 1PX6A 3A2XA 3IHQA 1DBYA 4D73A 2IMIA 1GL8A 1XPVA 2C0GA 4OFTA 2MBTA 3TRPA 4NHZA 2L5LA 4KDUA 2LNSA 4I97A 1WJKA 5EY6A 4TXVA 4KB3A 2OACA 1YF0A 4TR1B 2H0IA 2TIRA 2A2SA 4MZCA 2IY2A 4CDOA 5H5RA 1GSDA 3V1WA 1O8WA 4YAPA 3FR6A 4BVXA 4HI7A 2QGVA 2GVPA 4LL4B 2WB9A 3IE3A 1FAAA 4ZB6A 3LXTA 3F4TA 3LORA 3EVIA 4IP1A 2ES7A 3PGTA 4V1Ag 1TXXA 2CVKA 3GKKA 3ZLPA 3C1SA 2JSZA 3UJ1A 4GLTA 1B8XA 2DJ3A 1XZOA 5DJLA 3TKSA 1YKCA 3ZYWA 3KCMA 1PRXA 3BD2A 3K8NA 1BG5A 3FKFA 3W6GA 5IQYA 2LSTA 2P5RA 5ECQB 1GNEA 5DDLA 5HQPA 2L4QA 2V6KA 2B6MA 1EZKA 2HFDA 5J41A 4ZL8A 1YDKA 4IQ1A 3KEBA 4KX4A 2HSYA 6GSYA 1Z7PA 3P8WA 3KJYA 2CVDA 5FHIA 3ZFBA 3TUEA 1LJRA 2GT5A 2IMKA 1OVNA 4TKYA 1FVKA 4MJCA 3EU4A 3HJPA 5AGYA 3D6IA 1SKWB 2VM1A 3F0IA 4ML6A 5G1KA 2F51A 1K3YA 3F6FA 2F8FA 1GSFA 1QFNA 5F0GA 1WRYA 5ECNB 3M9JA 1GSYA 5F05A 2H01A 2N5FA 2NPBA 1YQ1A 1T4YA 4BWQA 5L71A 1Z3EA 2I4AA 4EF0A 1GLQA 2XPDA 3CSHA 2MZCA 3ZFLA 3VK9A 4EUYA 11GSA 4KAEA 4FYBA 1EEJA 1QUWA 2E2MA 4O92A 4L8EA 4YAVA 5G5FA 4KSMA 3HVXA 2V32A 1E2YA 2PUKC 2FLSA 2JU5A 3DEXA 3UOMA 2V2GA 4G9HA 2VCVA 4IKHA 4BPYA 4GQCA 2IYJA 1C72A 4JZQA 2DC5A 3EC3A 3HJMA 3MNGA 1WWJA 3LFLA 3LGCA 2O87A 4HS1A 2KUCA 20GSA 2KHPA 1M2AA 4KCAA 1PMTA 1OE8A 3IAM2 5GZZB 2HE3A 2H6YA 1ZCPA 4Q5QA 4GTUA 2N5BA 1XIYA 1X5EA 3VPQA 2YZHA 3NZNA 5FWGA 4K7OA 2FWGA 1ZOFA 2AV4A 5HFKA 1DSBA 5D73A 5ABRA 1S3DA 2HRNA 2HZFA 4NHWA 3C7MA 5IPHA 4H86A 2M46A 2H70A 2RLIA 4MDCA 3TOUA 4MZBA 2GS3A 1AQXA 3HZ4A 2FHEA 3MWHA 1TRVA 4MCUA 2X8HA 2F3MA 2H66A 2JZTA 2LS5A 2CA8A 2N5AA 1TU7A 3ZMKA 2MMNA 2GZPA 1ON4A 1EP8A 1TJDA 4HQZA 1K0CA 3US3A 2C0FA 3G7JA 2YCDA 2C3QA 3WT2A 1ZZYA 3CBUA 2EIOA 2VCTA 3E0UA 2HI7A 4ZBDA 1TOFA 1TRUA 2TRCP 4IHUA 4TR1A 3TJJA 5GAND 3SBCA 4E8HA 1GNWA 1SD9A 3WGXA 2VOCA 2GLRA 1X9WB 1SJZA 3I6AA 2LV3A 4HJMA 5G31A 3BOAA 4ECCA 2QC7A 1ERUA 3IAS2 16GSA 1PQNA 3KXOA 5C00A 4PNGA 1PSQA 2PVQA 5A4WA 1AUCA 3Q18A 1V9WA 3CYNA 2KLXA 7GSSA 4TR3A 2GZZA 3CTGA 4YQVA 3GRXA 1FOVA 3DKSA 2C0EA 3ZMLA 3HHVA 1H75A 5CYYA 4ZXGA 3WD6A 2VD0A 3A5WA 5AN1A 1K0BA 1X0RA 3FZ5A 3VI7A 2V1MA 2AAWA 19GSA 4AJ8A 2H72A 1FVJA 3ZTLA 2WGRA 1PL1A 2DJ2A 2FUG2 3IK7A 2B7JA 5ENUA 4ZILA 2H1GA 2M80A 3GX0A 1WP0A 2YN1A 5KN3A 3EE2A 1XFLA 4MF7A 1PX7A 1R5AA 3D4MA 1GSUA 4HJ2A 2O85A 3I43A 4ZBAA 2YNXA 1F9MA 3UIWA 2PERA 5IMFA 3GUSA 2C3TA 4XS6A 1GTAA 2GQLA 1W4VA 1QK8A 1A2JA 1SYXA 4YQMA 1HYUA 2ZUPA 1GWCA 5JCUA 2DJ0A 4PQIA 1AIUA 3DIEA 4I2TA 2JL4A 3M0FA 6GSUA 2XC2A 3C1RA 4O7HA 5G2ZA 2D2ZA 1GTBA 2VM2A 1TP9A 4EE0A 4PQHA 5IOXA 5CREA 4IJ3A 2DJKA 3UAPA 3LXZA 1PD21 3RAZA 4PGTA 1GULA 5J9CA 3UEMA 3IDVA 4JRRA 3JCML 1JZDA 2C8UA 1DUGA 5HR2A 1YEXA 3VPTA 3F63A 4EDYA 2R4VA 4X43A 3W8JA 2B1LA 2B3SA 2B7KA 3M1GA 1V98A 3EMXA 1SK2A 4RQXA 1V57A 1QQ2A 1F6MC 4DSRA 3ERGA 4IS0A 3KGKA 3RBTA 3TKRA 4GRFA 3EMPA 5DAKB 4TOPA 5LD0A 4NMUA 1BEDA 3KMOA 1PN9A 4NV5A 3F3QA 5G5EA 5HR3A 4BL7A 5CO3A 4X0XA 3QD9A 4HUAA 3U6VA 1IYIA 9GSSA 2PU9C 5ECHB 2NDOA 4MPGA 2DIYA 2V41A 3D4TA 3WGEA 5H5QA 1CQHA 4K6XA 2HRFA 5CP1A 2OJLA 4WXTA 4L5OA 1UVZA 3EYTA 4K9ZA 2MMOA 5A4VA 2E0QA 3GURA 2CT6A 5D9WA 5D9VA 3M8NA 4MJBA 4PURA 3M9KA 3FZAA 4FO5A 1B9YC 2VAFA 5G1LA 2F9SA 5F8BA 3WGDA 2VL2C 3IRAA 3QOUA 4XRDA 6GSXA 3KZQA 3CSJA 2HXKA 1AXDA 1ERWA 2O7KA 2H6XA 2H0HA 2YANA 2M72A 4EO3A 4NPBA 4NAXA 4TVEA 3VLNA 3FYGA 1TI1A 2JACA 6GSTA 1AW9A 4JU5A 3MDKA 4KE3A 1XW6A 3ZIJA 2KP1A 8GSSA 4MP4A 1KNGA 1FB6A 3H79A 3DRNA 1G6WA 1S3CA 1VF2A 1ERTA 2VCZA 3QDNA 3GIXA 5A4UA 4KCEA 1BJXA 3VI5A 5LNKe 2XBQA 1E6BA 4WF4A 3APSA 3IR4A 3LWAA 1EGRA 2C1YA 4ECJA 3FZ9A 3O3TA 4MZWA 1Z9HA 1GTIA 1YJ6A 4I6XA 4LL1B 4PUAA 5HR1A 3DGQA 3ME8A 3KH7A 3TOTA 2HSHA 2FD3A 2H30A 2XBIA 1ZGNA 3CRUA 1AQVA 2YV7A 3IA1A 2VLTA 3HVSA 3L0HA 3P2AA 4G19A 1M9AA 4TR4A 3BCIA 3UBKA 4GQFA 4HU9A 1Z5YE 3IOSA 1B4PA 1K3LA 3FHKA 1U3AA 1GUKA 4OCEA 4RUVA 4KH7A 2JSYA 1XCCA 4WETA 2LRCA 2B5EA 1EGOA 3UVTA 2LUSA 4OD7A 1MDJA 10GSA 4GCIA 4LMVA 5JCGA 2DIZA 3L9UA 5DVBA 2H71A 1A0RP 2H19A 4OCFA 1TK0B 3DWVA 17GSA 4TR0A 1J08A 4ECBA 1G7OA 1HNCA 2L59A 3GN3A 4HQSA 2LJKA 1WIKA 3BBYA 2GT6A 4TXOB 1AAZA 4HZ4A 2K6VA 3GHAA 3E9JB 4IJIA 3LSZA 5INYA 2DLXA 2H76A 5F06A 3CRTA 5ECSA 4Q5NA 3GL3A 4KDYA 4AF2A 5D8IA 3F6DA 3GA4A 3FZ4A 2QKEA 2PMTA 4IELA 1LBKA 3QFAC 3TKPA 3HD5A 2CV4A 2X64A 4EKZA 2KOKA 4KGIA 4NWYA 1F2EA 4X1UA 3C8EA 3LEFA 4HZ2A 5DAKA 3VWWA 2VCWA 3SWLA 1SYRA 1GUMA 3UARA 3NOFA 5IMZA 2H74A 1CQGA 2K8SA 1XBSA 4ISDA 1BQ7A 4V2MA 3S9FA 5IMAA 2NTOA 3AY8A 2EIRA 4AJ6A 3RPPA 5JCWA 4OWYA 3UBLA 1ACVA 5IOWA 3A2VA 4JR4A 3GYKA 5D93A 1MEKA 2OADA 1SL2B 2ZCTA 3FK8A 4HOJA 1A24A 1HNBA 2WZ9A 4N30A 2GTUA 2PWJA 3Q19A 2WCIA 1MDIA 5D9XA 2J23A 4K0NA 3QMXA 1H4OA 13GSA 1IYHA 1XVWA 1W89A 3GNJA 3ME7A 5B7CA 2WULA 1ZYQB 2B1KA 4LA1A 2FWEA 5ECIB 1K0MA 2H0GA 2H8LA 3GL5A 5IIZA 1OC8A 1SD8A 3TJBA 1ERVA 3GKMA 2RUEA 5JWRB 1X9MB 1GTUA 2VCXA 1T1VA 5DCGA 1XWGA 3J7Yk 2CVBA 1RQMA 3VFIA 3ZZXA 5J3RA 3IC4A 4TN8A 3HA9A 1TRWA 3KH9A 1SL0B 3VURA 4OMVA 3HCZA 3ZREA 2LRTA 1M7TA 1OYJA 2LQOA 3HVVA 2K8VA 1EOHA 4KW6A 2VCQA 3LYPA 4HEA2 5DBQA 3RDWA 5JWQB 3F9UA 2C0DA 1R7HA 3G7IA 1XWBA 2E2GA 1J9BA 5ECLB 1A0FA 1OAZA 1T7PB 3LJRA 4J2FA 5EPFA 4E8EA 3FEUA 4JEDA 4WKWA 4ULXA 12GSA 4EDZA 4ZL9A 3KMNA 5HR0A 3IBHA 4PX1A 4EL1A 4GSSA 3KD0A 3GX8A 5ELGA 1JLWA 1ZYEA 1SK0A 3ZIVA 2MMZA 3GKNA 1N8JA 4N10A 3UL3A 2H73A 1F3BA 3HDCA 2O89A 2YJ7A 2R2JA 4Q5FA 3KTBA 2GQKA 2XPEA 4G2EA 3J7Yb 2CQ9A 2AHEA 2VD1A 4F2IA 2I9HA 4POLA 2C4JA 2FNOA 2CAQA 2ON5A 4O5RA 3FR3A 4I2UA 4HDEA 1OKDA 4BWSA 3O76A 2BTOT 3LYKA 1BYEA 3IPZA 4TXOA 1J0FA 1JHBA 3OR5A 1O6JA 2OE0A 1XOAA 5ECRB 4K7NA 1HQOA 2LQQA 3R2QA 3D22A 2REMA 3RHCA 4KNDA 1VF1A 3CMIA 1BX9A 1M9BA 2YJHA 1SKRB 5DCHA 4QL7A 3ZVJA 3CTFA 2CZ2A 3IK9A 3U5RE 1SK1A 1R4WA 1FHEA 4YQUA 3DMLA 3DVWA 4F82A 2GSRA 2QSIA 1BAYA 1QMVA 1G0TA 3F3RA 4K7IA 2EC4A 3RPNA 2GSTA 2GGTA 1K0DA 4XS4B 4XCSA 3TKQA 1MD4A 2IMDA 4MPFA 2Z9SA 3EWLA 3EINA 6GSSA 14GSA 1YF1A 4ZL7A 1TTZA 4MJAA 1PKWA 1TI3A 4OO5A 4EVMA 3D5JA 2G0FA 5KN1A 2PPTA 2JZRA 1TK5B 3BCKA 3WT1A 3H8QA 2CX4A 2HYXA 3G7YA 3PR8A 1JZRA 2J9HA 3FRCA 4KSOA 1K3OA 5F07A 4PXOA 4FYCA 2IN3A 2YPMA 3KP8A 4MH3A 2ON7A 5COHA 2FY6A 4K0GA 1NHYA 2VLUA 3QAGA 4FIWA 2L6CA 3KM6A 1AC1A 3ISOA 3ZITA 2L6DA 2FA8A 1ZMAA 4IW9A 1B48A 3QAWA 5KN0A 2IFQB 5D96A 2YWNA 3TRXA 3O6TA 1YZXA 1R5PA 3DVXA 3A3TA 4O32A 2OE1A 1G7EA 1M2BA 2CX3A 2X8GA 4ID0A 5B8AA 2F8AA 2YWMA 1EP7A 4WEYA 2LEGA 3TKSC 5DALB 5C04A 2OE3A 4MLYA 1N2AA 4V2LA 2GSSA 3QCPA 1QGVA 3FR9A 3RHBA 5JWOB 4JBBA 4IQAA 1JFUA 1V58A 2RM6A 3C73A 3MAKA 3PH9A 2PVOC 5AIXA 2AUVA 3TJKA 3F8UA 3VWUA 4IP6A 5FT3A 4OFNA 4MK3A 3DYRA 2R37A 2VO4A 4MA9A 4EXJA 1AQWA 5AIVA 2IL3A 1Q4JA 3G9BA 1EOGA 3NIVA 5IO0A 1MDKA 5B6NA 3CSIA 3CXGA 2GQMA 2LTKA 1A8LA 2VL2A 4ZB8A 4DSSB 1KTEA 4WR4A 1ABAA 4TW5A 3ZRDA 2LRNA 4N0ZA 4JE1A 4IN0A 3GKXA 2GDRA 4YH2A 5IPGA 3TGZA 4NV2A 2HZEB 2YOIA 1TRSA 1TW9A 5GSTA 2O8VB 4ZIJA 3UVHA 1XOBA 2P5QA 4WF5A 4BA7A 4PUFC 4L0WA 3TJFA 3N5OA 1VRSD 1WMJA 3W8SA 5IMCA 4F0CA 3GSTA 5E4WA 4K1FA 1THXA 1T00A 1KEBA 2C80A 5GSSA 2DBCA 2VUPA 1GSQA 3LG6A 1GP1A 4PQ1A 5EVOA 5KEJA 1K0NA 2FWHA 2DJJA 5EL8A 2YV9A 3TJGA 1ML6A 1O85A 5ID2B 2P0GA 4GWRA 3QAVA 1ST9A 1B9XC 5B8BA 1A2LA 3ZL5A 2I3YA 1URMA 3I9V2 1WPIA 4L0UA 1GH2A 4ECIA 6GSVA 1XVQA 1VF4A 2X99A 1YY7A 1SL1B 4GSNA 5J5NA 1TU8A 1M99A 1U87A 2YZUA 2ALBA 3MSZA 2NBSA 1HD2A 4TRXA 1TDIA 2B5XA 5J4UA 2OA7A 1EEMA 2H6ZA 1OC9B 3FY7A 3HYPA 3I69A 4J57E 5LCZA 4MH2A 4V1Ap 2JADA 1SENA
chains in the Genus database with same CATH superfamily
5FGOA 7RNTA 2HNLA 4JR6A 3FLJA 4P3YB 3LH4A 3EF8A 1EWXA 4RQRA 4FYUA 5IO2A 5D83A 3PZWA 1VQN3 1M3JA 1QXHA 1EV4A 1XWKA 3TB2A 2X8CA 5ECPB 4I5QA 4MF5A 2FA4A 2VIMA 2IJYA 2P31A 3L9VA 1WMOA 5ELAA 5KN2A 3PCSA 1OE7A 1OHOA 4RZMA 4XS4A 2RCDA 2XFTA 3BNEA 2C3NA 4HZ9B 3GSSA 3LT9A 1V40A 5GAPD 1FW1A 4HYZA 1UUVB 2CG0A 2CX1A 3IXRA 4OK0A 1FB0A 4WR5A 1YKAA 2WOHA 1O7PB 3A2WA 2H75A 5HFGA 3D0ZA 5IEOA 1DE1A 3E3EA 3FG1A 2PN8A 2LJRA 2VL9A 5HFIA 2G2QA 4MABA 3I563 2XGNA 2AB6A 2XHFA 5D9TA 1O7UA 4USSA 2H1BA 1VQM3 4I8BA 1F37A 2VLVA 1MD3A 1NSWA 1WE0A 3QFBC 1THOA 1MGWA 4V2NA 2BU4A 4FH8A 22GSA 1T4ZA 4KA0A 5CNWA 2CFLA 1TP6A 1PN0A 3LOYA 2RNTA 3CU3A 3EU3A 4HBRA 5BXQA 2P0XA 1XWCA 2DKHA 2CFDA 4MJDA 3V92A 2FCHA 2L5OA 1A2MA 2CWUA 3HJOA 3CPOA 6GSWA 4OVMA 1Y6EA 1R4YA 1V2AA 4IVFA 2PBJA 1S3RA 4GB5A 2DJ1A 1O8XA 1X5CA 1Y25A 1RK4A 1RRHA 1XWAA 4EC0A 1BAOA 3ERFA 3QR6A 5IG5A 3C71A 2L57A 1Z7RA 3FZWA 3F8XA 2IFQA 4AJ7A 2V6OA 4LLRA 1TK8B 2R6KA 3MHEA 4OFMA 1ULJB 4NREA 1JB2A 4GSTA 2AJQB 3CQFA 2BO9B 3TDGA 2GZYA 2NVLA 1JZOA 1UCJA 3CME3 5CRHA 3ZVJD 3LW9A 2CFWA 5E59A 2IPAA 1JZWA 4MF6A 3GTUB 1UCKA 1SJIA 4Q5RA 1K0OA 5IERA 2YP6A 2IWTA 5RNTA 5IMVA 1B21A 4OUQA 2RIIA 5DALA 1ILOA 1PGTA 2DSAA 3ECFA 2WGQA 5AIGA 3KIJA 2ZNMA 4QL9A 1B20A 3EURA 2R3XA 3GH6A 4ML1A 2K18A 1RTUA 3ED3A 4O5QA 1SU9A 2BMRB 1OC3A 1VF3A 1GD3A 3H93A 4D73B 1LOYA 3T8UA 3Q6OA 4KUNA 5A5KA 2F5MA 4Z7XA 3EX9A 2KP2A 1ZO2A 4ACSA 3DD3A 1O73A 1LU4A 2BIRA 5DQYA 2CZ3A 2HLSA 2FWFA 1NB5I 1USBA 4IBPA 1DE2A 4DKIA 3D21A 1I5GA 1M2DA 3FW2A 3X42A 3P7XA 1JNQA 3PINA 1W6CA 1JN5B 3HKRA 1E3RA 4J56E 1T2IA 4BIRA 4IPBA 5CAXA 3JUMA 1BUJA 1TKDB 4WHAA 2ML5A 3KTLA 2TRXA 1GSSA 2UZ8A 4BVYA 4OO4A 5CRGA 1XXUA 1BSDA 4CJNA 5J9BA 5CRDA 1QAFA 2FGXA 2RUFA 4HZBB 4N6MA 4DSSA 2BJXA 4XBYA 4L5LA 1BNIA 1RGAA 3ERWA 5IMDA 4Q53A 3HK4A 2OKAA 2RM5A 3DXBA 1GMQA 1U3IA 2HZEA 1Z6MA 2DMMA 4BU4A 2E7PA 3A76A 2W56A 2YWOA 5ECOB 3Q2PA 3TCOA 1BNSA 1LXEA 2W2CA 1FGTA 1GUHA 1RN7A 1ROVA 4POKA 3NBBA 1U88A 3HY2A 1T3BA 3BNCA 4HM3B 2OBIA 4RI7A 1UA5A 4KDXA 4ZB9A 2OBKA 5DQSA 1KBNA 3GFKA 1FG4A 1X9SB 2R5GA 4K5RA 1FO5A 3NM2A 1A8YA 3Q1CA 2I81A 1PKZA 4DVCA 3EC9A 1CQSA 5ID2A 4N11A 2OQEA 8RNTA 1NM3A 2EIQA 3WOFB 1PA3A 2WFCA 3P90A 1GLPA 2LNTA 2MBSA 2XSHB 1GRXA 1ZYPA 1SJ6A 4XRAA 5D81A 4RNZA 3Q3FA 2XGLA 1HKXA 1BNJA 2H1AA 6RNTA 3GH9A 2AYTA 1O81A 2B5YA 2A4VA 3SX1A 3L78A 2BMXA 2FNQA 3IV4A 1UC7A 2HMMB 4F9ZA 3NXJA 3APQA 2WRTA 3H4KA 1OGXA 1RW1A 1XW9A 4MJEA 1EQKA 1PY3A 1B4QA 5G30A 1TU5A 2BHMA 4HU7A 1MTCA 3F4SA 2WS2A 1F8NA 2WJUA 1K28A 3QK9A 2K3DA 4POBA 1F3AA 4MMYB 4F0BA 3X40A 1EV9A 4F03A 2DMLA 1OC9A 5ECKB 1LNHA 1QAKA 1X5DA 2HT9A 3N9JA 3CC23 2JZSA 4HM1B 1ULIB 4RI6A 1FZUA 3GZXB 1RKYA 2F98A 5ECMB 4JF8A 1Z6NA 2A2RA 2VL3A 3HXSA 4XS1A 1R26A 3FF0A 5H5SA 1UN2A 2MYGA 5IM9A 5CLKA 4GXZA 1GSEA 4ZBBA 1CEWI 4X2HA 3M3MA 4GF0A 4H61A 3H1NA 1VZZA 4K2DA 2R0CA 4XTSA 2W0QA 3F40A 5EEOA 1HNAA 1IQXA 3WYWA 1NHOA 18GSA 3QPMA 4CHSA 1UI7A 1XW5A 1OACA 1IK3A 4MMZB 5B6MA 1E3VA 1QJGA 2I1UA 2LKUA 3LTDA 3ZFZA 4K8MA 2W9QA 3BJ5A 3Q74A 3EHCA 2A2PA 2ZA4A 4IT7A 5AISA 2WGOA 1OKTA 2LJAA 1SKSB 5ELUA 1IYYA 4YKGA 1DMNA 2GXFA 1BNRA 2CAIA 4Z2UA 3L9SA 1DVCA 1W4NA 1G6YA 1RGGA 4G10A 5DJMA 3UMAA 4WBRD 3F4RA 3NQZA 1D6ZA 5IW9A 3K9MC 2IMFA 4NXIA 3VWXA 3IJEB 3X3XA 4AGSA 1PL2A 3APOA 2IMEA 3FGYA 4N0VA 2H1DA 2ZL8A 1A23A 1K0AA 4WBJA 2WDUA 4CW9A 3TKSE 4DEJA 3LQ7A 1OCVA 2SBLA 4IGJA 2MMAA 4POMA 3TRQA 1I9DA 2HMJB 1NW2A 1VGLA 2RSXA 4XHMA 1YEPA 2GSQA 1YIT3 3KP9A 2L4CA 3LYGA 5BIRA 4QQ7A 1JLVA 1NB3I 3RGAA 1JV2B 3JVCA 1WMNA 2YWIA 3GMFA 4DSQA 3I553 1S3AA 3U1WA 1ZL9A 4XIHA 2IIYA 3M8CA 3GTUA 3MIXA 4KF9A 3KCHA 1MWTA 3VWVA 4LMWA 1T8EB 3HOHA 1U6TA 3L4NA 1M0UA 5CRWA 1N8R4 3LMLA 2K9FA 4ILFA 3I0YA 1GMRA 4O8SA 1IV7A 1WOUA 1BNFA 1I2GA 4K1VA 3HZ8A 1Q98A 4K90B 4MMMA 4PNFA 1OUNA 2F5WA 3GV1A 2PGTA 1K9M4 1PX6A 3A2XA 2GU1A 1IU7A 3IHQA 1DBYA 4D73A 2IMIA 1GL8A 4PTSA 1XPVA 2C0GA 3OW22 4OFTA 1JBTA 2MBTA 3TRPA 1HYFA 4NHZA 2L5LA 4KDUA 2LNSA 1RJOA 3EBYA 4I97A 1WJKA 5EY6A 4TXVA 4KB3A 2OACA 1YF0A 4TR1B 2H0IA 1VQ93 1RGFA 3GZBA 1QVG2 2TIRA 4J9AA 1W6GA 3A5EA 2A2SA 4MZCA 2IY2A 2GEYA 1JN5A 4CDOA 1GMPA 2W6JH 1UCIA 1B2UA 1GSDA 3X3ZA 5H5RA 1A2KA 1YNVX 2C10A 3V1WA 3N54B 3S28A 2FGTA 3WODG 1O8WA 4YAPA 3FR6A 1CH0A 4HI7A 4BVXA 2QGVA 2GVPA 4LL4B 1KWIA 1L5GB 3R3EA 3V99A 2WB9A 1UGHI 4GL6A 3IE3A 1FAAA 4ZB6A 2BMQB 1XG8A 3LXTA 3F4TA 3LORA 3EVIA 4IP1A 3WR2A 1N8QA 2ES7A 3PGTA 4PEJA 4V1Ag 1TXXA 2CVKA 4BL3A 3GRDA 3GKKA 3ZLPA 1ASKA 3LT8A 3C1SA 1RLSA 2JSZA 3UJ1A 4GLTA 1LQGC 1B8XA 2O9UX 2DJ3A 1XZOA 3B7CA 5DJLA 3TKSA 1YKCA 3ZYWA 3DGNA 3KCMA 2B24B 2OTL3 1PRXA 3BD2A 4BTXA 1SIIA 3UL5A 2V1LA 5BU4A 1BG5A 3K8NA 2R0GA 3FKFA 3CC43 3W6GA 5IQYA 1WMPA 2CKFB 5AEUB 2LSTA 4HKVB 2P5RA 5ECQB 1GNEA 1IT7A 3CCQ3 1GOVA 5DDLA 5HQPA 2L4QA 2V6KA 2B6MA 1EZKA 2HFDA 5J41A 1C54A 1YDKA 4IQ1A 3KEBA 4ZL8A 2HOHA 4NHFA 5LC7A 2WOFA 1RN4A 4KX4A 4EV5A 2HSYA 6GSYA 1Z7PA 3P8WA 1JBSA 3KJYA 1JB5A 3KFQC 2CVDA 5FHIA 3ZFBA 2INXA 3TUEA 1TFKA 1LJRA 1A2PA 3MG2A 1OVNA 2GT5A 2IMKA 4WFOA 3A5IA 4TKYA 2IUKA 4EXRA 1FVKA 3EU4A 3HJPA 4MJCA 5AGYA 1IVUA 3D6IA 5AYSC 1VQ43 1SKWB 3JUOA 2VM1A 3F0IA 4ML6A 5G1KA 2F51A 1RMSA 1B2XA 1PYLA 1U8CB 1K3YA 3IPTA 3F6FA 2F8FA 1I8VA 1GSFA 1I3FA 1QFNA 5F0GA 5IG0A 3JUNA 2LQVA 1WRYA 4AEQA 5ECNB 3M9JA 1GSYA 5F05A 2H01A 4CY8A 2N5FA 6GSPA 2NPBA 4LMIA 1YQ1A 5JBSA 1T4YA 4BWQA 5L71A 4HVNA 2YFLB 1IT8A 1Z3EA 1SARA 2I4AA 4EF0A 3AHSA 1GLQA 2XPDA 1Y4KA 5GSPA 3CSHA 4FMAA 5HOHA 4H3UA 1BUQA 1M3IA 3WHOA 2MZCA 3ZFLA 3VK9A 4EUYA 11GSA 1TUHA 1SQWA 4KAEA 5KOWA 4FYBA 1BIRA 1A67A 1TFOA 3NBRA 1EEJA 3FF2A 1QUWA 3AHWA 3ZG0A 2E2MA 4ORLA 4O92A 4L8OA 4L8EA 4YAVA 5G5FA 4KSMA 3HVXA 2V32A 2W04A 1E2YA 2C4BA 5A0OB 2PUKC 2FLSA 2JU5A 3DEXA 3UOMA 2V2GA 4G9HA 2KCDA 2VCVA 4IKHA 4BPYA 3WMDA 1AQZA 4GQCA 1LVNA 2IYJA 1C72A 4JZQA 2DC5A 3EC3A 3HJMA 3MNGA 1WWJA 3LFLA 3LGCA 2O87A 4HS1A 2KUCA 20GSA 2KHPA 1M2AA 5DREA 4KCAA 1PMTA 4XDWA 3B4OA 2HSMA 3ROBA 1OE8A 3IAM2 5BVBA 5GZZB 2HE3A 2H6YA 1ZCPA 4Q5QA 1GY6A 2N5BA 4GTUA 3DUKA 1XIYA 1X5EA 1VQ53 3FH1A 4HM5B 3VPQA 3D4AA 4BL7B 4GHOA 1ISKA 2YZHA 3NZNA 5ELJA 5FWGA 4K7OA 2B1XB 3PCRA 2YFJB 1M1K4 2FWGA 3BNDA 5AI1A 1ZOFA 1FGRA 2AV4A 4R9KA 4O02B 5HFKA 1DSBA 5D73A 5ABRA 1S3DA 2HRNA 2HZFA 4NHWA 3C7MA 5IPHA 4H86A 3EE1A 2M46A 2H70A 4HM2B 2RLIA 2A15A 1GOYA 3WA2X 3HI7A 4MDCA 3TOUA 3FMWA 4MZBA 2GS3A 3RNTA 1AQXA 3HZ4A 2FHEA 3MWHA 1TRVA 4MCUA 5STDA 1BRHA 2X8HA 3PYJA 2F3MA 2HMNB 2JQ5A 1UW1A 2H66A 4FR9A 3QRDA 2JZTA 2LS5A 2CA8A 1FUWA 2N5AA 1TU7A 3ZMKA 5CF1A 2MMNA 2GZPA 1ON4A 5IENA 1EP8A 1TJDA 4AKYA 3HX8A 1R4CA 4HQZA 1K0CA 3US3A 2C0FA 3G7JA 2YCDA 2C3QA 3G8ZA 3WT2A 1ZZYA 5BMUA 3CBUA 1NJI4 3BIRA 2EIOA 2VCTA 3E0UA 4HM8B 2HI7A 4ZBDA 1TOFA 1TRUA 2TRCP 3F14A 4IHUA 4TR1A 3TJJA 5CXOA 5GAND 3DMCA 4CCVA 3SBCA 4E8HA 1W02A 1LOVA 1GNWA 5CK6A 1SD9A 3WGXA 2VOCA 5KP3A 2GLRA 1X9WB 2M7OA 2A4HA 1MOLA 1UI8A 3LTAA 1SJZA 3I6AA 2LV3A 4HJMA 2KAAA 1OH0A 2OTJ3 5G31A 4STDA 3BOAA 4ECCA 2QC7A 1ERUA 3IAS2 16GSA 1PQNA 3KXOA 5C00A 4PNGA 1PSQA 2PVQA 5A4WA 1AUCA 1O7MB 3Q18A 1V9WA 1MGRA 1VQO3 3SXXA 3CYNA 3NBJA 2KLXA 4G0LA 2XF3A 7GSSA 4TR3A 3AMOB 2GZZA 3CTGA 4YQVA 2GU3A 3GRXA 1FOVA 3DKSA 3MSOA 2C0EA 3ZMLA 3HHVA 1H75A 5CYYA 4FCJA 2C11A 4ZXGA 3WD6A 3CCL3 3EN1B 2VD0A 3A5WA 5JPUA 3CMA3 5AN1A 2QIYA 1K0BA 1X0RA 3FZ5A 2X49A 3VI7A 2V1MA 2AAWA 1RGKA 19GSA 1YGWA 4AJ8A 2H72A 1US1A 2W03A 1FVJA 3ZTLA 2WGRA 4A5PA 1BRKA 1E97A 1EA2A 3LZAA 2XFSA 1PL1A 3EBTA 1UUWB 2DJ2A 2FUG2 3IK7A 5DRVA 2B7JA 5ENUA 4ZILA 2H1GA 2M80A 1EUIC 3GX0A 1WP0A 2YN1A 5KN3A 3EE2A 1XFLA 2RBIA 4MF7A 1PX7A 2BNGA 1R5AA 3D4MA 1GSUA 4HJ2A 5AEWB 2O85A 2QA2A 3I43A 4ZBAA 2W9PA 4K61A 2YNXA 1F9MA 3HIGA 3G713 3UIWA 3HIIA 2PERA 5IMFA 3GUSA 3G0KA 3MWZA 1B2SA 1KD14 4XB5A 2XR8B 2C3TA 4XS6A 3CD63 3F7XA 1GTAA 2GQLA 3AGOA 1W4VA 1B27A 1QK8A 3DH2A 1A2JA 1SYXA 2KXGA 1Q9EA 3EB8A 4YQMA 3LTCA 1HYUA 2ZUPA 4L7KA 1GWCA 5JCUA 2BT3A 2DJ0A 4PQIA 2O3OA 1AIUA 2CHCA 3DIEA 2OOVC 4I2TA 2JL4A 3M0FA 3WA3A 1MWRA 6GSUA 2XC2A 1Q7HA 3C1RA 4EBGA 4O7HA 4EYCA 5G2ZA 1TRPA 2D2ZA 1AY7A 1FGMA 4LGQA 1GTBA 2VM2A 1TP9A 2PZVA 5AYRB 4EE0A 4LYLB 4PQHA 5IOXA 4J8TA 5CREA 4IJ3A 2DJKA 2Z76A 3UAPA 3LXZA 4EC6A 5IG3A 4MEIA 1PD21 3RAZA 4PGTA 1GULA 5J9CA 3UEMA 3IDVA 4JRRA 3JCML 1JZDA 2C8UA 1DUGA 3NHXA 5HR2A 1YEXA 3VPTA 1GD4A 1DMMA 4RBNA 3F63A 4EDYA 3JUPA 4WP5A 2R4VA 4X43A 3W8JA 3OXAA 2CC3A 1AR0A 2Q07A 3DGMA 2B1LA 2B3SA 1WTHA 3IMAB 2B7KA 3M1GA 3SOAA 4L8PA 1V98A 1VQL3 3EMXA 1SK2A 3CCJ3 4RQXA 1KSIA 1V57A 1QQ2A 1F6MC 4DSRA 3ERGA 4IS0A 1DE3A 3NX0A 3KGKA 3RBTA 3TKRA 4GRFA 2F99A 1Q814 3EMPA 5DAKB 5KP1A 4TOPA 5LD0A 4NMUA 1IDPA 1BEDA 1YVSA 7STDA 2ZDJA 3KMOA 3SEDA 3K5TA 1PN9A 2QA1A 2WO0A 4NV5A 3GZRA 3F3QA 5G5EA 1BU4A 5HR3A 4BL7A 2CIUA 1Q864 3KN4A 4X0XA 1RGHA 5CO3A 1X1UA 2F56A 3QD9A 4HUAA 3U6VA 4G0KA 1IYIA 1YHQ3 2PU9C 9GSSA 5ECHB 2NDOA 4MPGA 2DIYA 1WNHA 2V41A 3D4TA 3WGEA 3G16A 3MKIA 5H5QA 1CQHA 3OWUA 4K6XA 2HRFA 5CP1A 1O7GB 2KF5A 2OJLA 1K8A4 1JB4A 3SLUA 4WXTA 1GOUA 4L5OA 2XEPA 1UVZA 3EYTA 5KP4A 4K9ZA 2MMOA 5A4VA 2E0QA 3GURA 2CT6A 3MG3A 5D9VA 5D9WA 3M8NA 4MJBA 1A2VA 3BU4A 4PURA 3M9KA 1I0VA 1UGIA 3SOYA 3FZAA 1NDOB 4FO5A 4FCMA 1B9YC 2VAFA 5G1LA 4XBTA 2F9SA 5F8BA 5LC6A 2CWVA 3S5CA 3WGDA 4QWTA 3ER7A 2VL2C 3IRAA 3QOUA 4XRDA 6GSXA 3UJMA 1RGLA 1RRLA 3EPTA 4Z2RA 3KZQA 3CSJA 2HXKA 1AXDA 1ERWA 2O7KA 2ML6A 4RNYA 1SJWA 2H6XA 2H0HA 2YANA 2M72A 1VQQA 4O5UA 4EO3A 4NPBA 4NAXA 4TVEA 3VLNA 3FYGA 1BNGA 2IMJA 1TI1A 3GZYB 3KE7A 2E2TA 2JACA 5HGRA 6GSTA 1AW9A 4JU5A 3FG3A 2KF4A 3MDKA 4KE3A 1XW6A 3G4S3 3ZIJA 2KP1A 8GSSA 4MP4A 1RN1A 4FQUA 1KNGA 1FB6A 3H79A 1Q42A 3DRNA 1G6WA 3PGBA 4G0IA 1S3CA 1VF2A 2KRTA 1ERTA 2VCZA 3PPUA 3QDNA 3GIXA 5A4UA 1S5AA 4KCEA 1BJXA 3VI5A 5IEPA 5LNKe 2XBQA 1E6BA 3AMOA 4WF4A 3APSA 3IR4A 3LWAA 5IF6A 5M18A 1EGRA 2C1YA 2GBWB 4ECJA 4O3VA 3DY5A 2HMKB 1UCLA 2DKIA 3FZ9A 3O3TA 4R1KA 1RGEA 1D6YA 4TX4A 4MZWA 1Z9HA 3S27A 1GTIA 1YJ6A 4I6XA 4LL1B 4PUAA 1CYUA 5HR1A 3DGQA 3ME8A 1Q824 1GY7A 8CHOA 3KH7A 1VQK3 2HSHA 3TOTA 2FD3A 2H30A 3T0UA 2XBIA 1JBRA 1ZGNA 3CRUA 1AQVA 2YV7A 3KKGA 3H3HA 1EKMA 3IA1A 2VLTA 1O7NB 3HVSA 2E2VA 2HMOB 3L0HA 1TIJA 3P2AA 4G19A 1M9AA 4TR4A 3BCIA 3UBKA 2UX0A 5KOXA 4GQFA 4HU9A 1OHPA 1DMQA 1Z5YE 1IVWA 4IIAA 1STFI 3IOSA 1B4PA 1VQP3 1K3LA 3FHKA 1U3AA 1BRSA 4EW5A 1GUKA 2HMLB 3FSDA 4OCEA 2PNCA 4RUVA 2AAEA 4KH7A 1OF5B 2JSYA 1XCCA 2X4AA 4WETA 2UUGC 2LRCA 2B5EA 1EGOA 3UVTA 2LUSA 4OD7A 4EIQA 1MDJA 4K1UA 10GSA 3D79A 1GYBA 4GCIA 4LMVA 5JCGA 2DIZA 3L9UA 5DVBA 2H71A 4HJLB 3FG4A 1A0RP 2H19A 2RFRA 4OCFA 1TK0B 3D5IA 3DWVA 9RNTA 17GSA 4TR0A 2P09A 1J08A 4ECBA 1G7OA 1HNCA 1OPYA 2L59A 1BRJA 5JPPA 3GN3A 4HQSA 2LJKA 1LNIA 1IV9A 2Y73A 1WIKA 3BBYA 1Q40B 2UGIA 2GT6A 4N6V0 4TXOB 1AAZA 4HZ4A 1NO3A 1FOHA 2Z77A 2XRXB 2K6VA 3GHAA 3GSPA 3E9JB 1FYSA 4IJIA 1M9GA 3LSZA 5INYA 4HSCX 2DLXA 2H76A 2HRKA 2Z6BA 5F06A 3CRTA 1TRQA 2J8XB 3CNXA 5ECSA 4Q5NA 4CPKA 3GL3A 4KDYA 4AF2A 5D8IA 3F6DA 3GA4A 3FZ4A 2QKEA 3O8YA 1IVXA 2PMTA 4IELA 1LBKA 4WWUC 3QFAC 3TKPA 3HD5A 2CV4A 4XM4A 2X64A 4EKZA 2KOKA 2GSPA 1FUTA 3NV0B 4KGIA 1ROAA 1PFPA 5I97A 4NWYA 1F2EA 4X1UA 3C8EA 3LEFA 1I2EA 2QGUA 4HZ2A 1W00A 5DAKA 3VWWA 2VCWA 1FW7A 4EIPA 3SWLA 3EQQB 3S29A 1SYRA 1GUMA 1MWSA 5TGNA 3UARA 2R4IA 3NOFA 5IMZA 2H74A 3KZTA 1RHLA 3GAXA 1W2ZA 2K8SA 1CQGA 1WQLB 1XBSA 4ISDA 3VF1A 4HAAA 1T2HA 1FUSA 1BQ7A 4V2MA 1RSNA 1LOWA 3VSYA 3MPHA 3S9FA 3KSED 5IMAA 2NTOA 4ICYA 4MNNA 3AY8A 3D9RA 2L4VA 2EIRA 4X2OA 4AJ6A 3RPPA 5JCWA 4OWYA 3UBLA 1QVF2 1C7HA 1X1YA 3DZLA 1ACVA 5IOWA 3A2VA 1B3SA 1ZX2A 4JR4A 1QALA 3GYKA 3MYDA 1MEKA 5D93A 2FXTA 2OADA 1SL2B 4KT3B 2ZCTA 3FK8A 4HOJA 1A24A 1HNBA 1GSPA 3IC8A 4N6OB 2WZ9A 4N30A 2GTUA 1JJ22 2K54A 2PWJA 3UB1A 4WYKB 3Q19A 2WCIA 4FMBA 1MDIA 5D9XA 2J23A 4K0NA 4HM4B 3QMXA 3URPA 3X3YA 1H4OA 2P05A 1KC84 13GSA 1IYHA 2K0MA 3NUVA 1XVWA 1W89A 3GNJA 3ME7A 5FW5A 5B7CA 4K5SA 2D1WA 2SARA 2WULA 3SYUA 1ZYQB 1OHSA 2B1KA 4LA1A 2FWEA 5ECIB 1W6YA 1K0MA 2H0GA 1FA3A 2H8LA 1YGEA 3GL5A 2OCTA 5IIZA 3HVNA 1VQ63 2R0PA 1OC8A 1SD8A 1W7CA 4G1MB 3TJBA 1ERVA 3PXMA 3GKMA 3STDA 2ZHXB 2RUEA 5JWRB 1X9MB 1GY5A 4N6NB 1GTUA 2VCXA 3F8HA 4GSPA 1T1VA 4JRFA 1W2B2 3K63A 5M1AA 5DCGA 1XWGA 3J7Yk 1BGSA 2CVBA 1RQMA 3VFIA 3ZZXA 1Z1SA 5J3RA 2CH9A 3IHGA 1NU3A 3IC4A 1I3IA 3KSPA 4TN8A 1M904 3HA9A 2CWTA 1TRWA 5AIHA 3KH9A 1SL0B 3VURA 3PS8A 4OMVA 3HCZA 3ZREA 2LRTA 1M7TA 2OQEC 3OV4A 3JUQA 1OYJA 4Z2TA 2LQOA 3DXOA 3HVVA 2K8VA 1EOHA 4KW6A 2VCQA 3LYPA 4HEA2 4N6LA 5DBQA 1I2FA 3J7Yd 3RDWA 5JWQB 3F9UA 4K2XA 5CF2A 2C0DA 1R7HA 3G7IA 1XWBA 4BVXB 2E2GA 1J9BA 5ECLB 1A0FA 1OAZA 3ALAA 1T7PB 5AIFA 1QMAA 3LJRA 4J2FA 1YVBI 2AADA 5EPFA 4E8EA 3FEUA 4JEDA 3D3LA 3N9HA 5EQLA 4WKWA 1YJW3 3GWRA 4ULXA 3S67A 2IUJA 12GSA 4EDZA 4ZL9A 3KMNA 5HR0A 3DGLA 1BVIA 3L0RA 3IBHA 2XSOB 4PX1A 4EL1A 2E2UA 1SIHA 5IG4A 4GSSA 3KD0A 1IQYA 3GX8A 1G96A 5ELGA 3OWSA 1JLWA 1MNLA 1B2MA 3MYTA 1J2BA 1AVLA 1ZYEA 4LSOA 1SK0A 3ZIVA 1OF5A 2MMZA 5G2GA 3GKNA 1N8JA 4N10A 1N5HA 2LYXA 4KFDA 3UL3A 2H73A 1F3BA 3HDCA 3DGYA 3BLZA 2QEX3 1YIJ3 3CCU3 2CFGA 2STDA 1S723 2O89A 2YJ7A 2R2JA 4Q5FA 2CK3H 3KTBA 3LXUX 3RGRA 4N6UA 2GQKA 5EVHA 2XPEA 4G2EA 3F7SA 3J7Yb 2CQ9A 2AHEA 2VD1A 4LEHA 4F2IA 2I9HA 1STDA 4POLA 2C4JA 2FNOA 1OGZA 1LOXA 2CAQA 1RNTA 2ON5A 4O5RA 3CCM3 2GEXA 3FR3A 4I2UA 3CPW2 4HDEA 1OKDA 4BWSA 3K7CA 3O76A 4HM6B 2MF7A 2BTOT 1Q40A 3LYKA 1BYEA 1Q7Y4 3IPZA 3FCSB 4TXOA 1J0FA 1JHBA 3OR5A 1O6JA 3CCE3 2F4YA 2OE0A 1CYVA 1RGCA 3BB9A 1XOAA 5ECRB 4K7NA 1BRIA 1BSAA 1HQOA 4X4JA 2LQQA 2CX0A 1K734 1UDII 3R2QA 1VQ73 3D22A 2REMA 4HOHA 1I70A 3UNLA 3CCR3 2KF3A 1W5ZA 1JKGB 3RHCA 4KNDA 1VF1A 3CMIA 1RCKA 2Y74A 3EJVA 1BX9A 1M9BA 1BRNL 2YJHA 2YX9A 1AV4A 4R9LA 1SKRB 3SVAA 5DCHA 4QL7A 3ZVJA 4R4KA 3CTFA 1HZ1A 5D82A 2CZ2A 3IK9A 3U5RE 1SK1A 4ZM8A 1R4WA 3NV0A 1FHEA 4YQUA 3B8LA 3DMLA 3DVWA 4F82A 4O2HA 2GSRA 2QSIA 1VQ83 1BAYA 1QMVA 1G0TA 3F3RA 4K7IA 3NQYA 1RCLA 1N5PA 4RNTA 1G02A 2EC4A 3RPNA 2GSTA 2GGTA 3CCV3 1K0DA 4XS4B 4XCSA 2IA7A 1MD4A 3K0ZA 3TKQA 2IMDA 4MPFA 1ZYNA 2Z9SA 3EWLA 3EINA 6GSSA 14GSA 1YF1A 4ZL7A 1TTZA 1GS3A 3RDEA 4MJAA 4MMXB 1PKWA 1TI3A 4OO5A 3N8BA 4EVMA 3D5JA 2G0FA 5KN1A 2RGQA 1O7WB 2PPTA 4BTWA 2JZRA 1TK5B 3BCKA 3WT1A 2OOVA 3H8QA 2CW9A 1B2ZA 1N9EA 1T5YA 2CX4A 1DETA 3V98A 3KIIA 2HYXA 3G7YA 4YKFA 3G6E3 3PR8A 1JZRA 2J9HA 3FRCA 4FMDA 4KSOA 3B4PA 1NWWA 1K3OA 5F07A 3FKAA 2Z7AA 3X41A 2MC8A 4PXOA 4FYCA 2IN3A 2YPMA 2HRAA 3KP8A 4FMCA 2YFIB 4MH3A 2ON7A 1I0XA 4KFFA 1BANA 2JDIH 5COHA 4WYKA 2FY6A 1BSBA 4K0GA 1NHYA 2VLUA 4KZ1A 3QAGA 4FIWA 2L6CA 3KM6A 1AC1A 3ISOA 4U13A 1NNVA 3ZITA 3VGNA 2L6DA 2FA8A 1ZMAA 4IW9A 1EG9B 1B48A 3QAWA 5KN0A 2OWPA 2IFQB 1IVVA 5D96A 2YWNA 1LQMB 4R80A 3TRXA 3O6TA 1YZXA 1R5PA 3D5GA 2CG1A 4HM0B 3DVXA 4CY6A 4EV2A 3A3TA 4O32A 2OE1A 4HM7B 1G7EA 1M2BA 2CX3A 2X8GA 4ID0A 5B8AA 1HU9A 3H51A 1N9JA 2F8AA 2YWMA 2QA43 1EP7A 4WEYA 2LEGA 3TKSC 5DALB 5C04A 2OE3A 4MLYA 1O7HB 2P38A 1N2AA 1BOXA 4V2LA 5BRTA 2GSSA 3AGNA 3QCPA 1LRAA 1QGVA 1TTOA 3FR9A 3RHBA 5JWOB 4JBBA 4IQAA 1JFUA 1V58A 6STDA 4XBXA 2RM6A 3C73A 2KF6A 5M19A 3UL6A 3MAKA 4BIKA 3PH9A 3DM8A 2PVOC 5AIXA 2AUVA 1U5OA 1PU4A 3TJKA 3CC73 3F8UA 3VWUA 4IP6A 4XDVA 5FT3A 4MK3A 4OFNA 3DYRA 2R37A 2VO4A 1MWUA 4MA9A 4EXJA 4AKZA 1AQWA 5AIVA 3HZPA 4KVHA 1DYUA 1ZGXA 2IL3A 1Q4JA 3G9BA 1EOGA 3NIVA 3OX9A 5IO0A 1MDKA 2XH9A 5B6NA 3CSIA 3Q90A 3CXGA 1ZS7A 2GQMA 4BVYB 1D6UA 2LTKA 1A90A 4BL2A 1A8LA 2VL2A 4ZB8A 1KQS2 1YJ93 1KTEA 4WR4A 4DSSB 3OWYA 1ABAA 4TW5A 3ZRDA 3WOEB 2BMOB 2P0MA 2LRNA 4JE1A 4N0ZA 4IN0A 3GKXA 2GDRA 1PFOA 4YH2A 2L1SA 5IPGA 3TGZA 3DGOA 1YJN3 2I9WA 4NV2A 2HZEB 2YOIA 1X1XA 2W56B 1TRSA 1TW9A 5GSTA 2D42A 1K41A 2O8VB 4ZIJA 3UVHA 1SPUA 1XOBA 2P5QA 4WF5A 1BRGA 4BA7A 4PUFC 4L0WA 2F86B 1V74A 3TJFA 3N5OA 1VRSD 4KFEA 1WMJA 5AIIA 3W8SA 3CXC2 5IMCA 4F0CA 3T8NA 3GSTA 5E4WA 3F9SA 4J5KA 4K1FA 1THXA 4FCZA 1T00A 7GSPA 1KEBA 2C80A 5GSSA 1YI23 2DBCA 2VUPA 4N3VA 1GSQA 4LZIA 1GP1A 3LG6A 4PQ1A 5EVOA 5KEJA 1K0NA 2FWHA 2DJJA 5EL8A 2YV9A 3TJGA 1ML6A 1O85A 5ID2B 2P0GA 4GWRA 3NM7A 1M1XB 3QAVA 3BNBA 1ST9A 1B9XC 5B8BA 1JRQA 1RDSA 1IQ8A 3LTBA 1A2LA 3ZL5A 2I3YA 1DVDA 4CDLA 2CFKA 3MG1A 1URMA 3I9V2 1WPIA 1X1WA 4L0UA 4I4KA 1GH2A 4ECIA 6GSVA 3E99A 4J5GA 1XVQA 1VF4A 2X99A 1YY7A 3U97A 2GBXB 1SL1B 4GSNA 5J5NA 1TU8A 1M99A 1U87A 2YZUA 2ALBA 3MSZA 3CNMA 2NBSA 1HD2A 3WDGB 1RNBA 3EN8A 4TRXA 1BNEA 1TDIA 2B5XA 1BSCA 5J4UA 3CCS3 2OA7A 3ZG5A 1EEMA 1AVKA 1FGOA 1FGQA 2H6ZA 1W01A 1JKGA 1OC9B 4N6TA 3FY7A 1UUGB 2R41A 3HYPA 3I69A 4J57E 5LCZA 1BSEA 4MH2A 4V1Ap 2JADA 1SENA 4BTYA
chains in the Genus database with same CATH topology
2HNLA 4JR6A 4P3YB 1EWXA 4RQRA 4FYUA 5IO2A 1QXHA 1EV4A 1XWKA 3TB2A 2X8CA 5ECPB 4I5QA 4MF5A 2FA4A 2VIMA 2IJYA 2P31A 3L9VA 5KN2A 5ELAA 1OE7A 4XS4A 2C3NA 3GSSA 1V40A 5GAPD 1FW1A 3IXRA 1FB0A 4WR5A 1YKAA 3A2WA 2H75A 5HFGA 3D0ZA 1DE1A 3E3EA 2PN8A 2LJRA 2VL9A 5HFIA 2G2QA 4MABA 2AB6A 2XHFA 5D9TA 1O7UA 4USSA 2H1BA 4I8BA 1F37A 2VLVA 1MD3A 1NSWA 1WE0A 3QFBC 1THOA 4V2NA 4FH8A 22GSA 1T4ZA 4KA0A 5CNWA 1PN0A 3EU3A 1XWCA 2DKHA 2FCHA 2L5OA 1A2MA 3HJOA 6GSWA 1Y6EA 1V2AA 4IVFA 2PBJA 2DJ1A 1O8XA 1X5CA 1Y25A 1RK4A 1XWAA 4EC0A 3ERFA 3QR6A 3C71A 2L57A 1Z7RA 2IFQA 4AJ7A 2V6OA 4LLRA 1TK8B 2R6KA 4OFMA 2AJQB 4GSTA 2NVLA 3TDGA 2GZYA 1JZOA 5CRHA 3ZVJD 3LW9A 5E59A 2IPAA 1JZWA 4MF6A 3GTUB 1SJIA 4Q5RA 1K0OA 2YP6A 2IWTA 5IMVA 2RIIA 5DALA 1ILOA 1PGTA 2DSAA 3KIJA 2ZNMA 4QL9A 3EURA 2R3XA 3GH6A 4ML1A 2K18A 3ED3A 4O5QA 1SU9A 1OC3A 1VF3A 3H93A 4D73B 3Q6OA 4KUNA 5A5KA 4Z7XA 2KP2A 4ACSA 3DD3A 1O73A 1LU4A 5DQYA 2CZ3A 2HLSA 2FWFA 1USBA 4IBPA 1DE2A 3D21A 1I5GA 1M2DA 3FW2A 3P7XA 3PINA 3HKRA 4J56E 5CAXA 1TKDB 3KTLA 2TRXA 1GSSA 2UZ8A 4BVYA 4OO4A 5CRGA 1XXUA 5J9BA 5CRDA 2FGXA 2RUFA 4DSSA 2BJXA 4L5LA 3ERWA 5IMDA 2OKAA 2RM5A 3DXBA 1U3IA 2HZEA 1Z6MA 2DMMA 2E7PA 2YWOA 5ECOB 3TCOA 1GUHA 4POKA 1U88A 3HY2A 1T3BA 2OBIA 4RI7A 1UA5A 4KDXA 4ZB9A 2OBKA 5DQSA 1KBNA 3GFKA 1FG4A 1X9SB 2R5GA 4K5RA 1FO5A 1A8YA 2I81A 1PKZA 4DVCA 5ID2A 4N11A 1NM3A 2EIQA 1PA3A 2WFCA 3P90A 1GLPA 2LNTA 2MBSA 1GRXA 1ZYPA 1SJ6A 4XRAA 2H1AA 3GH9A 2AYTA 1O81A 2B5YA 2A4VA 3L78A 2BMXA 3IV4A 1UC7A 4F9ZA 3APQA 2WRTA 3H4KA 1RW1A 1XW9A 4MJEA 1B4QA 5G30A 4HU7A 1MTCA 3F4SA 2WS2A 2WJUA 4POBA 1F3AA 4F0BA 1EV9A 4F03A 2DMLA 1OC9A 5ECKB 1X5DA 3N9JA 2HT9A 2JZSA 4RI6A 5ECMB 1Z6NA 2A2RA 2VL3A 3HXSA 4XS1A 1R26A 5H5SA 1UN2A 2MYGA 5IM9A 4GXZA 1GSEA 4ZBBA 3M3MA 4GF0A 3H1NA 4K2DA 2R0CA 4XTSA 1HNAA 3WYWA 1NHOA 18GSA 3QPMA 4CHSA 1XW5A 5B6MA 2LKUA 2I1UA 4K8MA 3BJ5A 3Q74A 2A2PA 5AISA 1OKTA 2LJAA 1SKSB 4YKGA 2CAIA 4Z2UA 3L9SA 1G6YA 5DJMA 4G10A 3UMAA 4WBRD 3F4RA 2IMFA 4NXIA 3VWXA 4AGSA 1PL2A 3APOA 2IMEA 4N0VA 2H1DA 1A23A 1K0AA 4WBJA 2WDUA 4CW9A 3TKSE 4DEJA 3LQ7A 4IGJA 2MMAA 4POMA 3TRQA 1I9DA 1NW2A 1VGLA 4XHMA 1YEPA 2GSQA 3KP9A 2L4CA 4QQ7A 1JLVA 2YWIA 4DSQA 3GMFA 1S3AA 1ZL9A 4XIHA 2IIYA 3GTUA 3MIXA 4KF9A 3VWVA 4LMWA 1T8EB 1U6TA 3L4NA 1M0UA 5CRWA 2K9FA 4ILFA 1WOUA 3HZ8A 1Q98A 4MMMA 4PNFA 3GV1A 2PGTA 1PX6A 3A2XA 3IHQA 1DBYA 4D73A 2IMIA 1GL8A 4PTSA 1XPVA 2C0GA 4OFTA 2MBTA 3TRPA 4NHZA 2L5LA 4KDUA 2LNSA 4I97A 1WJKA 5EY6A 4TXVA 4KB3A 2OACA 1YF0A 4TR1B 2H0IA 2TIRA 2A2SA 4MZCA 2IY2A 4CDOA 5H5RA 1GSDA 3V1WA 1O8WA 4YAPA 3FR6A 4BVXA 4HI7A 2QGVA 2GVPA 4LL4B 3R3EA 2WB9A 3IE3A 1FAAA 4ZB6A 3LXTA 3F4TA 3LORA 3EVIA 4IP1A 2ES7A 3PGTA 4V1Ag 1TXXA 2CVKA 3GKKA 3ZLPA 3C1SA 2JSZA 3UJ1A 4GLTA 1B8XA 2DJ3A 1XZOA 5DJLA 3TKSA 1YKCA 3ZYWA 3KCMA 1PRXA 3BD2A 3K8NA 1BG5A 2R0GA 3FKFA 3W6GA 5IQYA 2LSTA 2P5RA 5ECQB 1GNEA 5DDLA 5HQPA 2L4QA 2V6KA 2B6MA 1EZKA 2HFDA 5J41A 4ZL8A 1YDKA 4IQ1A 3KEBA 4KX4A 2HSYA 6GSYA 1Z7PA 3P8WA 3KJYA 2CVDA 5FHIA 3ZFBA 3TUEA 1LJRA 2GT5A 2IMKA 1OVNA 3A5IA 4TKYA 1FVKA 4MJCA 3EU4A 3HJPA 5AGYA 3D6IA 1SKWB 2VM1A 3F0IA 4ML6A 5G1KA 2F51A 1K3YA 3F6FA 2F8FA 1GSFA 1QFNA 5F0GA 1WRYA 5ECNB 3M9JA 1GSYA 5F05A 2H01A 4CY8A 2N5FA 2NPBA 1YQ1A 1T4YA 4BWQA 5L71A 1Z3EA 2I4AA 4EF0A 1GLQA 2XPDA 3CSHA 2MZCA 3ZFLA 3VK9A 4EUYA 11GSA 4KAEA 5KOWA 4FYBA 1EEJA 1QUWA 2E2MA 4O92A 4L8EA 4YAVA 5G5FA 4KSMA 3HVXA 2V32A 1E2YA 2PUKC 2FLSA 2JU5A 3DEXA 3UOMA 2V2GA 4G9HA 2VCVA 4IKHA 4BPYA 4GQCA 2IYJA 1C72A 4JZQA 2DC5A 3EC3A 3HJMA 3MNGA 1WWJA 3LFLA 3LGCA 2O87A 4HS1A 2KUCA 20GSA 2KHPA 1M2AA 4KCAA 1PMTA 2HSMA 1OE8A 3IAM2 5GZZB 2HE3A 2H6YA 1ZCPA 4Q5QA 4GTUA 2N5BA 1XIYA 1X5EA 3VPQA 4BL7B 2YZHA 3NZNA 5FWGA 4K7OA 2FWGA 1ZOFA 2AV4A 5HFKA 1DSBA 5D73A 5ABRA 1S3DA 2HRNA 2HZFA 4NHWA 3C7MA 5IPHA 4H86A 2M46A 2H70A 2RLIA 4MDCA 3TOUA 3FMWA 4MZBA 2GS3A 1AQXA 3HZ4A 2FHEA 3MWHA 1TRVA 4MCUA 2X8HA 2F3MA 2H66A 2JZTA 2LS5A 2CA8A 2N5AA 1TU7A 3ZMKA 2MMNA 2GZPA 1ON4A 1EP8A 1TJDA 4HQZA 1K0CA 3US3A 2C0FA 3G7JA 2YCDA 2C3QA 3WT2A 1ZZYA 5BMUA 3CBUA 2EIOA 2VCTA 3E0UA 2HI7A 4ZBDA 1TOFA 1TRUA 2TRCP 4IHUA 4TR1A 3TJJA 5GAND 3SBCA 4E8HA 1GNWA 1SD9A 3WGXA 2VOCA 2GLRA 1X9WB 2A4HA 1SJZA 3I6AA 2LV3A 4HJMA 5G31A 3BOAA 4ECCA 2QC7A 1ERUA 3IAS2 16GSA 1PQNA 3KXOA 5C00A 4PNGA 1PSQA 2PVQA 5A4WA 1AUCA 3Q18A 1V9WA 3CYNA 4G0LA 2KLXA 7GSSA 4TR3A 2GZZA 3CTGA 4YQVA 3GRXA 1FOVA 3DKSA 2C0EA 3ZMLA 3HHVA 1H75A 5CYYA 4ZXGA 3WD6A 2VD0A 3A5WA 5AN1A 1K0BA 1X0RA 3FZ5A 2X49A 3VI7A 2V1MA 2AAWA 19GSA 4AJ8A 2H72A 1FVJA 3ZTLA 2WGRA 4A5PA 1PL1A 2DJ2A 2FUG2 3IK7A 2B7JA 5ENUA 4ZILA 2H1GA 2M80A 3GX0A 1WP0A 2YN1A 5KN3A 3EE2A 1XFLA 4MF7A 1PX7A 1R5AA 3D4MA 1GSUA 4HJ2A 2O85A 2QA2A 3I43A 4ZBAA 2YNXA 1F9MA 3UIWA 2PERA 5IMFA 3GUSA 2C3TA 4XS6A 1GTAA 2GQLA 1W4VA 1QK8A 1A2JA 1SYXA 4YQMA 1HYUA 2ZUPA 1GWCA 5JCUA 2DJ0A 4PQIA 1AIUA 3DIEA 4I2TA 2JL4A 3M0FA 6GSUA 2XC2A 3C1RA 4O7HA 5G2ZA 2D2ZA 1GTBA 2VM2A 1TP9A 4EE0A 4PQHA 5IOXA 5CREA 4IJ3A 2DJKA 3UAPA 3LXZA 1PD21 3RAZA 4PGTA 1GULA 5J9CA 3UEMA 3IDVA 4JRRA 3JCML 1JZDA 2C8UA 1DUGA 5HR2A 1YEXA 3VPTA 3F63A 4EDYA 2R4VA 4X43A 3W8JA 2B1LA 2B3SA 2B7KA 3M1GA 1V98A 3EMXA 1SK2A 4RQXA 1V57A 1QQ2A 1F6MC 4DSRA 3ERGA 4IS0A 3KGKA 3RBTA 3TKRA 4GRFA 3EMPA 5DAKB 4TOPA 5LD0A 4NMUA 1BEDA 3KMOA 1PN9A 2QA1A 4NV5A 3F3QA 5G5EA 5HR3A 4BL7A 5CO3A 4X0XA 3QD9A 4HUAA 3U6VA 4G0KA 1IYIA 9GSSA 2PU9C 5ECHB 2NDOA 4MPGA 2DIYA 2V41A 3D4TA 3WGEA 5H5QA 1CQHA 4K6XA 2HRFA 5CP1A 2OJLA 4WXTA 4L5OA 1UVZA 3EYTA 4K9ZA 2MMOA 5A4VA 2E0QA 3GURA 2CT6A 5D9WA 5D9VA 3M8NA 4MJBA 4PURA 3M9KA 3FZAA 4FO5A 1B9YC 2VAFA 5G1LA 2F9SA 5F8BA 3WGDA 2VL2C 3IRAA 3QOUA 4XRDA 6GSXA 3EPTA 4Z2RA 3KZQA 3CSJA 2HXKA 1AXDA 1ERWA 2O7KA 2H6XA 2H0HA 2YANA 2M72A 4O5UA 4EO3A 4NPBA 4NAXA 4TVEA 3VLNA 3FYGA 1TI1A 2JACA 6GSTA 1AW9A 4JU5A 3MDKA 4KE3A 1XW6A 3ZIJA 2KP1A 8GSSA 4MP4A 4FQUA 1KNGA 1FB6A 3H79A 3DRNA 1G6WA 4G0IA 1S3CA 1VF2A 1ERTA 2VCZA 3PPUA 3QDNA 3GIXA 5A4UA 4KCEA 1BJXA 3VI5A 5LNKe 2XBQA 1E6BA 4WF4A 3APSA 3IR4A 3LWAA 1EGRA 2C1YA 4ECJA 2DKIA 3FZ9A 3O3TA 4MZWA 1Z9HA 1GTIA 1YJ6A 4I6XA 4LL1B 4PUAA 5HR1A 3DGQA 3ME8A 3KH7A 3TOTA 2HSHA 2FD3A 2H30A 2XBIA 1ZGNA 3CRUA 1AQVA 2YV7A 3IA1A 2VLTA 3HVSA 3L0HA 3P2AA 4G19A 1M9AA 4TR4A 3BCIA 3UBKA 5KOXA 4GQFA 4HU9A 1Z5YE 3IOSA 1B4PA 1K3LA 3FHKA 1U3AA 1GUKA 4OCEA 4RUVA 4KH7A 2JSYA 1XCCA 2X4AA 4WETA 2LRCA 2B5EA 1EGOA 3UVTA 2LUSA 4OD7A 4EIQA 1MDJA 10GSA 4GCIA 4LMVA 5JCGA 2DIZA 3L9UA 5DVBA 2H71A 1A0RP 2H19A 4OCFA 1TK0B 3DWVA 17GSA 4TR0A 1J08A 4ECBA 1G7OA 1HNCA 2L59A 3GN3A 4HQSA 2LJKA 1WIKA 3BBYA 2GT6A 4TXOB 1AAZA 4HZ4A 1FOHA 2K6VA 3GHAA 3E9JB 4IJIA 3LSZA 5INYA 2DLXA 2H76A 2HRKA 5F06A 3CRTA 5ECSA 4Q5NA 3GL3A 4KDYA 4AF2A 5D8IA 3F6DA 3GA4A 3FZ4A 2QKEA 2PMTA 4IELA 1LBKA 3QFAC 3TKPA 3HD5A 2CV4A 2X64A 4EKZA 2KOKA 4KGIA 4NWYA 1F2EA 4X1UA 3C8EA 3LEFA 4HZ2A 5DAKA 3VWWA 2VCWA 4EIPA 3SWLA 1SYRA 1GUMA 3UARA 3NOFA 5IMZA 2H74A 1CQGA 2K8SA 1XBSA 4ISDA 1BQ7A 4V2MA 3S9FA 5IMAA 2NTOA 4ICYA 4MNNA 3AY8A 2EIRA 4AJ6A 3RPPA 5JCWA 4OWYA 3UBLA 1ACVA 5IOWA 3A2VA 4JR4A 3GYKA 3MYDA 1MEKA 5D93A 2OADA 1SL2B 2ZCTA 3FK8A 4HOJA 1A24A 1HNBA 3IC8A 2WZ9A 4N30A 2GTUA 2PWJA 3Q19A 2WCIA 1MDIA 5D9XA 2J23A 4K0NA 3QMXA 1H4OA 13GSA 1IYHA 1XVWA 1W89A 3GNJA 3ME7A 5B7CA 4K5SA 2WULA 1ZYQB 2B1KA 4LA1A 2FWEA 5ECIB 1K0MA 2H0GA 2H8LA 3GL5A 5IIZA 2R0PA 1OC8A 1SD8A 3TJBA 1ERVA 3GKMA 2RUEA 5JWRB 1X9MB 1GTUA 2VCXA 1T1VA 5DCGA 1XWGA 3J7Yk 2CVBA 1RQMA 3VFIA 3ZZXA 5J3RA 3IHGA 3IC4A 4TN8A 3HA9A 1TRWA 3KH9A 1SL0B 3VURA 4OMVA 3HCZA 3ZREA 2LRTA 1M7TA 1OYJA 4Z2TA 2LQOA 3HVVA 2K8VA 1EOHA 4KW6A 2VCQA 3LYPA 4HEA2 5DBQA 3RDWA 5JWQB 3F9UA 4K2XA 2C0DA 1R7HA 3G7IA 1XWBA 4BVXB 2E2GA 1J9BA 5ECLB 1A0FA 1OAZA 1T7PB 3LJRA 4J2FA 5EPFA 4E8EA 3FEUA 4JEDA 4WKWA 4ULXA 12GSA 4EDZA 4ZL9A 3KMNA 5HR0A 3IBHA 4PX1A 4EL1A 4GSSA 3KD0A 3GX8A 5ELGA 1JLWA 1ZYEA 1SK0A 3ZIVA 2MMZA 3GKNA 1N8JA 4N10A 3UL3A 2H73A 1F3BA 3HDCA 2O89A 2YJ7A 2R2JA 4Q5FA 3KTBA 2GQKA 2XPEA 4G2EA 3J7Yb 2CQ9A 2AHEA 2VD1A 4F2IA 2I9HA 4POLA 2C4JA 2FNOA 2CAQA 2ON5A 4O5RA 3FR3A 4I2UA 4HDEA 1OKDA 4BWSA 3O76A 2BTOT 3LYKA 1BYEA 3IPZA 4TXOA 1J0FA 1JHBA 3OR5A 1O6JA 2OE0A 1XOAA 5ECRB 4K7NA 1HQOA 4X4JA 2LQQA 3R2QA 3D22A 2REMA 3RHCA 4KNDA 1VF1A 3CMIA 1BX9A 1M9BA 2YJHA 1SKRB 5DCHA 4QL7A 3ZVJA 3CTFA 2CZ2A 3IK9A 3U5RE 1SK1A 1R4WA 1FHEA 4YQUA 3DMLA 3DVWA 4F82A 2GSRA 2QSIA 1BAYA 1QMVA 1G0TA 3F3RA 4K7IA 2EC4A 3RPNA 2GSTA 2GGTA 1K0DA 4XS4B 4XCSA 3TKQA 1MD4A 2IMDA 4MPFA 1ZYNA 2Z9SA 3EWLA 3EINA 6GSSA 14GSA 1YF1A 4ZL7A 1TTZA 4MJAA 1PKWA 1TI3A 4OO5A 4EVMA 3D5JA 2G0FA 5KN1A 2PPTA 2JZRA 1TK5B 3BCKA 3WT1A 3H8QA 2CX4A 2HYXA 3G7YA 4YKFA 3PR8A 1JZRA 2J9HA 3FRCA 4KSOA 1K3OA 5F07A 4PXOA 4FYCA 2IN3A 2YPMA 2HRAA 3KP8A 4MH3A 2ON7A 5COHA 2FY6A 4K0GA 1NHYA 2VLUA 3QAGA 4FIWA 2L6CA 3KM6A 1AC1A 3ISOA 3ZITA 2L6DA 2FA8A 1ZMAA 4IW9A 1B48A 3QAWA 5KN0A 2IFQB 5D96A 2YWNA 3TRXA 3O6TA 1YZXA 1R5PA 3DVXA 4CY6A 3A3TA 4O32A 2OE1A 1G7EA 1M2BA 2CX3A 2X8GA 4ID0A 5B8AA 2F8AA 2YWMA 1EP7A 4WEYA 2LEGA 3TKSC 5DALB 5C04A 2OE3A 4MLYA 1N2AA 4V2LA 5BRTA 2GSSA 3QCPA 1QGVA 3FR9A 3RHBA 5JWOB 4JBBA 4IQAA 1JFUA 1V58A 2RM6A 3C73A 3MAKA 3PH9A 2PVOC 5AIXA 2AUVA 3TJKA 3F8UA 3VWUA 4IP6A 5FT3A 4OFNA 4MK3A 3DYRA 2R37A 2VO4A 4MA9A 4EXJA 1AQWA 5AIVA 2IL3A 1Q4JA 3G9BA 1EOGA 3NIVA 5IO0A 1MDKA 5B6NA 3CSIA 3CXGA 2GQMA 4BVYB 2LTKA 1A8LA 2VL2A 4ZB8A 4DSSB 1KTEA 4WR4A 1ABAA 4TW5A 3ZRDA 2LRNA 4N0ZA 4JE1A 4IN0A 3GKXA 2GDRA 4YH2A 5IPGA 3TGZA 4NV2A 2HZEB 2YOIA 1TRSA 1TW9A 5GSTA 2O8VB 4ZIJA 3UVHA 1XOBA 2P5QA 4WF5A 4BA7A 4PUFC 4L0WA 3TJFA 3N5OA 1VRSD 1WMJA 3W8SA 5IMCA 4F0CA 3GSTA 5E4WA 4K1FA 1THXA 1T00A 1KEBA 2C80A 5GSSA 2DBCA 2VUPA 1GSQA 3LG6A 1GP1A 4PQ1A 5EVOA 5KEJA 1K0NA 2FWHA 2DJJA 5EL8A 2YV9A 3TJGA 1ML6A 1O85A 5ID2B 2P0GA 4GWRA 3QAVA 1ST9A 1B9XC 5B8BA 1A2LA 3ZL5A 2I3YA 1URMA 3I9V2 1WPIA 4L0UA 1GH2A 4ECIA 6GSVA 1XVQA 1VF4A 2X99A 1YY7A 1SL1B 4GSNA 5J5NA 1TU8A 1M99A 1U87A 2YZUA 2ALBA 3MSZA 2NBSA 1HD2A 4TRXA 1TDIA 2B5XA 5J4UA 2OA7A 1EEMA 2H6ZA 1OC9B 3FY7A 3HYPA 3I69A 4J57E 5LCZA 4MH2A 4V1Ap 2JADA 1SENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HNL A;  4JR6 A;  4P3Y B;  1EWX A;  4RQR A;  4FYU A;  5IO2 A;  1QXH A;  1EV4 A;  1XWK A;  3TB2 A;  2X8C A;  5ECP B;  4I5Q A;  4MF5 A;  2FA4 A;  2VIM A;  2IJY A;  2P31 A;  3L9V A;  5KN2 A;  5ELA A;  1OE7 A;  4XS4 A;  2C3N A;  3GSS A;  1V40 A;  5GAP D;  1FW1 A;  3IXR A;  1FB0 A;  4WR5 A;  1YKA A;  3A2W A;  2H75 A;  5HFG A;  3D0Z A;  1DE1 A;  3E3E A;  2PN8 A;  2LJR A;  2VL9 A;  5HFI A;  2G2Q A;  4MAB A;  2AB6 A;  2XHF A;  5D9T A;  1O7U A;  2H1B A;  4I8B A;  1F37 A;  2VLV A;  1MD3 A;  1NSW A;  1WE0 A;  3QFB C;  1THO A;  4V2N A;  4FH8 A;  22GS A;  1T4Z A;  4KA0 A;  5CNW A;  3EU3 A;  1XWC A;  2FCH A;  2L5O A;  1A2M A;  3HJO A;  6GSW A;  1Y6E A;  1V2A A;  4IVF A;  2PBJ A;  2DJ1 A;  1O8X A;  1X5C A;  1Y25 A;  1RK4 A;  1XWA A;  4EC0 A;  3ERF A;  3QR6 A;  3C71 A;  2L57 A;  1Z7R A;  2IFQ A;  4AJ7 A;  2V6O A;  4LLR A;  1TK8 B;  2R6K A;  4OFM A;  2AJQ B;  4GST A;  2NVL A;  3TDG A;  2GZY A;  1JZO A;  5CRH A;  3ZVJ D;  5E59 A;  2IPA A;  1JZW A;  4MF6 A;  3GTU B;  1SJI A;  4Q5R A;  1K0O A;  2YP6 A;  2IWT A;  5IMV A;  2RII A;  5DAL A;  1ILO A;  1PGT A;  2DSA A;  3KIJ A;  2ZNM A;  4QL9 A;  3EUR A;  2R3X A;  3GH6 A;  4ML1 A;  2K18 A;  3ED3 A;  1SU9 A;  1OC3 A;  1VF3 A;  3H93 A;  4D73 B;  3Q6O A;  4KUN A;  5A5K A;  4Z7X A;  2KP2 A;  4ACS A;  3DD3 A;  1O73 A;  1LU4 A;  5DQY A;  2CZ3 A;  2HLS A;  2FWF A;  1USB A;  4IBP A;  1DE2 A;  3D21 A;  1I5G A;  1M2D A;  3FW2 A;  3P7X A;  3PIN A;  3HKR A;  4J56 E;  5CAX A;  1TKD B;  3KTL A;  2TRX A;  1GSS A;  4BVY A;  4OO4 A;  5CRG A;  1XXU A;  5J9B A;  5CRD A;  2FGX A;  2RUF A;  4DSS A;  2BJX A;  4L5L A;  3ERW A;  5IMD A;  2OKA A;  2RM5 A;  3DXB A;  1U3I A;  2HZE A;  1Z6M A;  2DMM A;  2E7P A;  2YWO A;  5ECO B;  3TCO A;  1GUH A;  4POK A;  1U88 A;  3HY2 A;  1T3B A;  2OBI A;  4RI7 A;  1UA5 A;  4KDX A;  4ZB9 A;  2OBK A;  5DQS A;  1KBN A;  3GFK A;  1FG4 A;  1X9S B;  2R5G A;  1FO5 A;  1A8Y A;  2I81 A;  1PKZ A;  4DVC A;  5ID2 A;  4N11 A;  1NM3 A;  2EIQ A;  1PA3 A;  2WFC A;  3P90 A;  1GLP A;  2LNT A;  2MBS A;  1GRX A;  1SJ6 A;  4XRA A;  2H1A A;  3GH9 A;  2AYT A;  1O81 A;  2B5Y A;  2A4V A;  3L78 A;  2BMX A;  3IV4 A;  1UC7 A;  4F9Z A;  3APQ A;  2WRT A;  3H4K A;  1RW1 A;  1XW9 A;  4MJE A;  1B4Q A;  5G30 A;  4HU7 A;  1MTC A;  3F4S A;  2WS2 A;  2WJU A;  4POB A;  1F3A A;  4F0B A;  1EV9 A;  4F03 A;  2DML A;  1OC9 A;  5ECK B;  1X5D A;  3N9J A;  2HT9 A;  2JZS A;  4RI6 A;  5ECM B;  1Z6N A;  2A2R A;  2VL3 A;  3HXS A;  4XS1 A;  1R26 A;  5H5S A;  1UN2 A;  2MYG A;  5IM9 A;  4GXZ A;  1GSE A;  4ZBB A;  3M3M A;  4GF0 A;  3H1N A;  4K2D A;  4XTS A;  1HNA A;  3WYW A;  1NHO A;  18GS A;  3QPM A;  4CHS A;  1XW5 A;  5B6M A;  2LKU A;  2I1U A;  4K8M A;  3BJ5 A;  3Q74 A;  5AIS A;  1OKT A;  2LJA A;  1SKS B;  2CAI A;  3L9S A;  1G6Y A;  5DJM A;  4G10 A;  3UMA A;  4WBR D;  3F4R A;  2IMF A;  4NXI A;  3VWX A;  4AGS A;  1PL2 A;  3APO A;  2IME A;  4N0V A;  2H1D A;  1A23 A;  1K0A A;  4WBJ A;  2WDU A;  4CW9 A;  3TKS E;  4DEJ A;  3LQ7 A;  4IGJ A;  2MMA A;  4POM A;  3TRQ A;  1I9D A;  1NW2 A;  1VGL A;  4XHM A;  1YEP A;  2GSQ A;  3KP9 A;  2L4C A;  4QQ7 A;  1JLV A;  2YWI A;  4DSQ A;  3GMF A;  1S3A A;  1ZL9 A;  4XIH A;  2IIY A;  3GTU A;  3VWV A;  4LMW A;  1T8E B;  1U6T A;  3L4N A;  1M0U A;  5CRW A;  2K9F A;  4ILF A;  1WOU A;  3HZ8 A;  1Q98 A;  4MMM A;  4PNF A;  3GV1 A;  2PGT A;  1PX6 A;  3A2X A;  3IHQ A;  1DBY A;  4D73 A;  2IMI A;  1GL8 A;  1XPV A;  2C0G A;  4OFT A;  2MBT A;  3TRP A;  4NHZ A;  2L5L A;  4KDU A;  2LNS A;  4I97 A;  1WJK A;  5EY6 A;  4TXV A;  4KB3 A;  2OAC A;  1YF0 A;  4TR1 B;  2H0I A;  2TIR A;  2A2S A;  4MZC A;  2IY2 A;  4CDO A;  5H5R A;  1GSD A;  3V1W A;  1O8W A;  4YAP A;  3FR6 A;  4BVX A;  4HI7 A;  2QGV A;  2GVP A;  4LL4 B;  2WB9 A;  3IE3 A;  1FAA A;  4ZB6 A;  3LXT A;  3F4T A;  3LOR A;  3EVI A;  4IP1 A;  2ES7 A;  3PGT A;  4V1A g;  1TXX A;  2CVK A;  3GKK A;  3ZLP A;  3C1S A;  2JSZ A;  3UJ1 A;  4GLT A;  1B8X A;  2DJ3 A;  1XZO A;  5DJL A;  3TKS A;  1YKC A;  3ZYW A;  3KCM A;  1PRX A;  3BD2 A;  3K8N A;  1BG5 A;  3FKF A;  3W6G A;  5IQY A;  2LST A;  2P5R A;  5ECQ B;  1GNE A;  5DDL A;  5HQP A;  2L4Q A;  2V6K A;  2B6M A;  1EZK A;  2HFD A;  5J41 A;  4ZL8 A;  1YDK A;  4IQ1 A;  3KEB A;  4KX4 A;  2HSY A;  6GSY A;  1Z7P A;  3P8W A;  3KJY A;  2CVD A;  5FHI A;  3ZFB A;  3TUE A;  1LJR A;  2GT5 A;  2IMK A;  1OVN A;  4TKY A;  1FVK A;  4MJC A;  3EU4 A;  3HJP A;  5AGY A;  3D6I A;  1SKW B;  2VM1 A;  3F0I A;  4ML6 A;  5G1K A;  2F51 A;  1K3Y A;  3F6F A;  2F8F A;  1GSF A;  1QFN A;  5F0G A;  1WRY A;  5ECN B;  3M9J A;  1GSY A;  5F05 A;  2H01 A;  2N5F A;  2NPB A;  1YQ1 A;  1T4Y A;  4BWQ A;  5L71 A;  1Z3E A;  2I4A A;  4EF0 A;  1GLQ A;  2XPD A;  3CSH A;  2MZC A;  3ZFL A;  3VK9 A;  4EUY A;  11GS A;  4KAE A;  4FYB A;  1EEJ A;  1QUW A;  2E2M A;  4O92 A;  4L8E A;  4YAV A;  5G5F A;  4KSM A;  3HVX A;  2V32 A;  1E2Y A;  2PUK C;  2FLS A;  2JU5 A;  3DEX A;  3UOM A;  2V2G A;  4G9H A;  2VCV A;  4IKH A;  4BPY A;  4GQC A;  2IYJ A;  1C72 A;  4JZQ A;  2DC5 A;  3EC3 A;  3HJM A;  3MNG A;  1WWJ A;  3LFL A;  3LGC A;  2O87 A;  4HS1 A;  2KUC A;  20GS A;  2KHP A;  1M2A A;  4KCA A;  1PMT A;  1OE8 A;  3IAM 2;  5GZZ B;  2HE3 A;  2H6Y A;  1ZCP A;  4Q5Q A;  4GTU A;  2N5B A;  1XIY A;  1X5E A;  3VPQ A;  2YZH A;  3NZN A;  5FWG A;  4K7O A;  2FWG A;  1ZOF A;  2AV4 A;  5HFK A;  1DSB A;  5D73 A;  5ABR A;  1S3D A;  2HRN A;  2HZF A;  4NHW A;  3C7M A;  5IPH A;  4H86 A;  2M46 A;  2H70 A;  2RLI A;  4MDC A;  3TOU A;  4MZB A;  2GS3 A;  1AQX A;  3HZ4 A;  2FHE A;  3MWH A;  1TRV A;  4MCU A;  2X8H A;  2F3M A;  2H66 A;  2JZT A;  2LS5 A;  2CA8 A;  2N5A A;  1TU7 A;  3ZMK A;  2MMN A;  2GZP A;  1ON4 A;  1EP8 A;  1TJD A;  4HQZ A;  1K0C A;  3US3 A;  2C0F A;  3G7J A;  2YCD A;  2C3Q A;  3WT2 A;  1ZZY A;  3CBU A;  2EIO A;  2VCT A;  3E0U A;  2HI7 A;  4ZBD A;  1TOF A;  1TRU A;  2TRC P;  4IHU A;  4TR1 A;  3TJJ A;  5GAN D;  3SBC A;  4E8H A;  1GNW A;  1SD9 A;  3WGX A;  2VOC A;  2GLR A;  1X9W B;  1SJZ A;  3I6A A;  2LV3 A;  4HJM A;  5G31 A;  3BOA A;  4ECC A;  2QC7 A;  1ERU A;  3IAS 2;  16GS A;  1PQN A;  3KXO A;  5C00 A;  4PNG A;  1PSQ A;  2PVQ A;  5A4W A;  1AUC A;  3Q18 A;  1V9W A;  3CYN A;  2KLX A;  7GSS A;  4TR3 A;  2GZZ A;  3CTG A;  4YQV A;  3GRX A;  1FOV A;  3DKS A;  2C0E A;  3ZML A;  3HHV A;  1H75 A;  5CYY A;  4ZXG A;  3WD6 A;  2VD0 A;  3A5W A;  5AN1 A;  1K0B A;  1X0R A;  3FZ5 A;  3VI7 A;  2V1M A;  2AAW A;  19GS A;  4AJ8 A;  2H72 A;  1FVJ A;  3ZTL A;  2WGR A;  1PL1 A;  2DJ2 A;  2FUG 2;  3IK7 A;  2B7J A;  5ENU A;  4ZIL A;  2H1G A;  2M80 A;  3GX0 A;  1WP0 A;  2YN1 A;  5KN3 A;  3EE2 A;  1XFL A;  4MF7 A;  1PX7 A;  1R5A A;  3D4M A;  1GSU A;  4HJ2 A;  2O85 A;  3I43 A;  4ZBA A;  2YNX A;  1F9M A;  3UIW A;  2PER A;  5IMF A;  3GUS A;  2C3T A;  4XS6 A;  1GTA A;  2GQL A;  1W4V A;  1QK8 A;  1A2J A;  1SYX A;  4YQM A;  1HYU A;  2ZUP A;  1GWC A;  5JCU A;  2DJ0 A;  4PQI A;  1AIU A;  3DIE A;  4I2T A;  2JL4 A;  3M0F A;  6GSU A;  2XC2 A;  3C1R A;  4O7H A;  5G2Z A;  2D2Z A;  1GTB A;  2VM2 A;  1TP9 A;  4EE0 A;  4PQH A;  5IOX A;  5CRE A;  4IJ3 A;  2DJK A;  3UAP A;  3LXZ A;  1PD2 1;  3RAZ A;  4PGT A;  1GUL A;  5J9C A;  3UEM A;  3IDV A;  4JRR A;  3JCM L;  1JZD A;  2C8U A;  1DUG A;  5HR2 A;  1YEX A;  3VPT A;  3F63 A;  4EDY A;  2R4V A;  4X43 A;  3W8J A;  2B1L A;  2B3S A;  2B7K A;  3M1G A;  1V98 A;  3EMX A;  1SK2 A;  4RQX A;  1V57 A;  1QQ2 A;  1F6M C;  4DSR A;  3ERG A;  4IS0 A;  3KGK A;  3RBT A;  3TKR A;  4GRF A;  3EMP A;  5DAK B;  4TOP A;  5LD0 A;  4NMU A;  1BED A;  3KMO A;  1PN9 A;  4NV5 A;  3F3Q A;  5G5E A;  5HR3 A;  4BL7 A;  5CO3 A;  4X0X A;  3QD9 A;  4HUA A;  3U6V A;  1IYI A;  9GSS A;  2PU9 C;  5ECH B;  2NDO A;  4MPG A;  2DIY A;  2V41 A;  3D4T A;  3WGE A;  5H5Q A;  1CQH A;  4K6X A;  2HRF A;  5CP1 A;  2OJL A;  4WXT A;  4L5O A;  1UVZ A;  3EYT A;  4K9Z A;  2MMO A;  5A4V A;  2E0Q A;  3GUR A;  2CT6 A;  5D9W A;  5D9V A;  3M8N A;  4MJB A;  4PUR A;  3M9K A;  3FZA A;  4FO5 A;  1B9Y C;  2VAF A;  5G1L A;  2F9S A;  5F8B A;  3WGD A;  2VL2 C;  3IRA A;  3QOU A;  4XRD A;  6GSX A;  3KZQ A;  3CSJ A;  2HXK A;  1AXD A;  1ERW A;  2O7K A;  2H6X A;  2H0H A;  2YAN A;  2M72 A;  4EO3 A;  4NPB A;  4NAX A;  4TVE A;  3VLN A;  3FYG A;  1TI1 A;  2JAC A;  6GST A;  1AW9 A;  4JU5 A;  3MDK A;  4KE3 A;  1XW6 A;  3ZIJ A;  2KP1 A;  8GSS A;  4MP4 A;  1KNG A;  1FB6 A;  3H79 A;  3DRN A;  1G6W A;  1S3C A;  1VF2 A;  1ERT A;  2VCZ A;  3QDN A;  3GIX A;  5A4U A;  4KCE A;  1BJX A;  3VI5 A;  5LNK e;  2XBQ A;  1E6B A;  4WF4 A;  3APS A;  3IR4 A;  3LWA A;  1EGR A;  2C1Y A;  4ECJ A;  3FZ9 A;  3O3T A;  4MZW A;  1Z9H A;  1GTI A;  1YJ6 A;  4I6X A;  4LL1 B;  4PUA A;  5HR1 A;  3DGQ A;  3ME8 A;  3KH7 A;  3TOT A;  2HSH A;  2FD3 A;  2H30 A;  2XBI A;  1ZGN A;  3CRU A;  1AQV A;  2YV7 A;  3IA1 A;  2VLT A;  3HVS A;  3L0H A;  3P2A A;  4G19 A;  1M9A A;  4TR4 A;  3BCI A;  3UBK A;  4GQF A;  4HU9 A;  1Z5Y E;  3IOS A;  1B4P A;  1K3L A;  3FHK A;  1U3A A;  1GUK A;  4OCE A;  4RUV A;  4KH7 A;  2JSY A;  1XCC A;  4WET A;  2LRC A;  2B5E A;  1EGO A;  3UVT A;  2LUS A;  4OD7 A;  1MDJ A;  10GS A;  4GCI A;  4LMV A;  5JCG A;  2DIZ A;  3L9U A;  5DVB A;  2H71 A;  1A0R P;  2H19 A;  4OCF A;  1TK0 B;  3DWV A;  17GS A;  4TR0 A;  1J08 A;  4ECB A;  1G7O A;  1HNC A;  2L59 A;  3GN3 A;  4HQS A;  2LJK A;  1WIK A;  3BBY A;  2GT6 A;  4TXO B;  1AAZ A;  4HZ4 A;  2K6V A;  3GHA A;  3E9J B;  4IJI A;  3LSZ A;  5INY A;  2DLX A;  2H76 A;  5F06 A;  3CRT A;  5ECS A;  4Q5N A;  3GL3 A;  4KDY A;  4AF2 A;  5D8I A;  3F6D A;  3GA4 A;  3FZ4 A;  2QKE A;  2PMT A;  4IEL A;  1LBK A;  3QFA C;  3TKP A;  3HD5 A;  2CV4 A;  2X64 A;  4EKZ A;  2KOK A;  4KGI A;  4NWY A;  1F2E A;  4X1U A;  3C8E A;  3LEF A;  4HZ2 A;  5DAK A;  3VWW A;  2VCW A;  3SWL A;  1SYR A;  1GUM A;  3UAR A;  3NOF A;  5IMZ A;  2H74 A;  1CQG A;  2K8S A;  1XBS A;  4ISD A;  1BQ7 A;  4V2M A;  3S9F A;  5IMA A;  2NTO A;  3AY8 A;  2EIR A;  4AJ6 A;  3RPP A;  5JCW A;  4OWY A;  3UBL A;  1ACV A;  5IOW A;  3A2V A;  4JR4 A;  3GYK A;  5D93 A;  1MEK A;  2OAD A;  1SL2 B;  2ZCT A;  3FK8 A;  4HOJ A;  1A24 A;  1HNB A;  2WZ9 A;  4N30 A;  2GTU A;  2PWJ A;  3Q19 A;  2WCI A;  1MDI A;  5D9X A;  2J23 A;  4K0N A;  3QMX A;  1H4O A;  13GS A;  1IYH A;  1XVW A;  1W89 A;  3GNJ A;  3ME7 A;  5B7C A;  2WUL A;  1ZYQ B;  2B1K A;  4LA1 A;  2FWE A;  5ECI B;  1K0M A;  2H0G A;  2H8L A;  3GL5 A;  5IIZ A;  1OC8 A;  1SD8 A;  3TJB A;  1ERV A;  3GKM A;  2RUE A;  5JWR B;  1X9M B;  1GTU A;  2VCX A;  1T1V A;  5DCG A;  1XWG A;  3J7Y k;  2CVB A;  1RQM A;  3VFI A;  3ZZX A;  5J3R A;  3IC4 A;  4TN8 A;  3HA9 A;  1TRW A;  3KH9 A;  1SL0 B;  3VUR A;  4OMV A;  3HCZ A;  3ZRE A;  2LRT A;  1M7T A;  1OYJ A;  2LQO A;  3HVV A;  2K8V A;  1EOH A;  4KW6 A;  2VCQ A;  3LYP A;  4HEA 2;  5DBQ A;  3RDW A;  5JWQ B;  3F9U A;  2C0D A;  1R7H A;  3G7I A;  1XWB A;  2E2G A;  1J9B A;  5ECL B;  1A0F A;  1OAZ A;  1T7P B;  3LJR A;  4J2F A;  5EPF A;  4E8E A;  3FEU A;  4JED A;  4WKW A;  4ULX A;  12GS A;  4EDZ A;  4ZL9 A;  3KMN A;  5HR0 A;  3IBH A;  4PX1 A;  4EL1 A;  4GSS A;  3KD0 A;  3GX8 A;  5ELG A;  1JLW A;  1ZYE A;  1SK0 A;  3ZIV A;  2MMZ A;  3GKN A;  1N8J A;  4N10 A;  3UL3 A;  2H73 A;  1F3B A;  3HDC A;  2O89 A;  2YJ7 A;  2R2J A;  4Q5F A;  3KTB A;  2GQK A;  2XPE A;  4G2E A;  3J7Y b;  2CQ9 A;  2AHE A;  2VD1 A;  4F2I A;  2I9H A;  4POL A;  2C4J A;  2FNO A;  2CAQ A;  2ON5 A;  4O5R A;  3FR3 A;  4I2U A;  4HDE A;  1OKD A;  4BWS A;  3O76 A;  2BTO T;  3LYK A;  1BYE A;  3IPZ A;  4TXO A;  1J0F A;  1JHB A;  3OR5 A;  1O6J A;  2OE0 A;  1XOA A;  5ECR B;  4K7N A;  1HQO A;  2LQQ A;  3R2Q A;  3D22 A;  2REM A;  3RHC A;  4KND A;  1VF1 A;  3CMI A;  1BX9 A;  1M9B A;  2YJH A;  1SKR B;  5DCH A;  4QL7 A;  3ZVJ A;  3CTF A;  2CZ2 A;  3IK9 A;  3U5R E;  1SK1 A;  1R4W A;  1FHE A;  4YQU A;  3DML A;  3DVW A;  4F82 A;  2GSR A;  2QSI A;  1BAY A;  1QMV A;  1G0T A;  3F3R A;  4K7I A;  2EC4 A;  3RPN A;  2GST A;  2GGT A;  1K0D A;  4XS4 B;  4XCS A;  3TKQ A;  1MD4 A;  2IMD A;  4MPF A;  2Z9S A;  3EWL A;  3EIN A;  6GSS A;  14GS A;  1YF1 A;  4ZL7 A;  1TTZ A;  4MJA A;  1PKW A;  1TI3 A;  4OO5 A;  4EVM A;  3D5J A;  2G0F A;  5KN1 A;  2PPT A;  2JZR A;  1TK5 B;  3BCK A;  3WT1 A;  3H8Q A;  2CX4 A;  2HYX A;  3G7Y A;  3PR8 A;  1JZR A;  2J9H A;  3FRC A;  4KSO A;  1K3O A;  5F07 A;  4PXO A;  4FYC A;  2IN3 A;  2YPM A;  3KP8 A;  4MH3 A;  2ON7 A;  5COH A;  2FY6 A;  4K0G A;  1NHY A;  2VLU A;  3QAG A;  4FIW A;  2L6C A;  3KM6 A;  1AC1 A;  3ISO A;  3ZIT A;  2L6D A;  2FA8 A;  1ZMA A;  4IW9 A;  1B48 A;  3QAW A;  5KN0 A;  2IFQ B;  5D96 A;  2YWN A;  3TRX A;  3O6T A;  1YZX A;  1R5P A;  3DVX A;  3A3T A;  4O32 A;  2OE1 A;  1G7E A;  1M2B A;  2CX3 A;  2X8G A;  4ID0 A;  5B8A A;  2F8A A;  2YWM A;  1EP7 A;  4WEY A;  2LEG A;  3TKS C;  5DAL B;  5C04 A;  2OE3 A;  4MLY A;  1N2A A;  4V2L A;  2GSS A;  3QCP A;  1QGV A;  3FR9 A;  3RHB A;  5JWO B;  4JBB A;  4IQA A;  1JFU A;  1V58 A;  2RM6 A;  3C73 A;  3MAK A;  3PH9 A;  2PVO C;  5AIX A;  2AUV A;  3TJK A;  3F8U A;  3VWU A;  4IP6 A;  5FT3 A;  4OFN A;  4MK3 A;  3DYR A;  2R37 A;  2VO4 A;  4MA9 A;  4EXJ A;  1AQW A;  5AIV A;  2IL3 A;  1Q4J A;  3G9B A;  1EOG A;  3NIV A;  5IO0 A;  1MDK A;  5B6N A;  3CSI A;  3CXG A;  2GQM A;  2LTK A;  1A8L A;  2VL2 A;  4ZB8 A;  4DSS B;  1KTE A;  4WR4 A;  1ABA A;  4TW5 A;  3ZRD A;  2LRN A;  4N0Z A;  4JE1 A;  4IN0 A;  3GKX A;  2GDR A;  4YH2 A;  5IPG A;  3TGZ A;  4NV2 A;  2HZE B;  2YOI A;  1TRS A;  1TW9 A;  5GST A;  2O8V B;  4ZIJ A;  3UVH A;  1XOB A;  2P5Q A;  4WF5 A;  4BA7 A;  4PUF C;  4L0W A;  3TJF A;  3N5O A;  1VRS D;  1WMJ A;  3W8S A;  5IMC A;  4F0C A;  3GST A;  5E4W A;  4K1F A;  1THX A;  1T00 A;  1KEB A;  2C80 A;  5GSS A;  2DBC A;  2VUP A;  1GSQ A;  3LG6 A;  1GP1 A;  4PQ1 A;  5EVO A;  5KEJ A;  1K0N A;  2FWH A;  2DJJ A;  5EL8 A;  2YV9 A;  3TJG A;  1ML6 A;  1O85 A;  5ID2 B;  2P0G A;  4GWR A;  3QAV A;  1ST9 A;  1B9X C;  5B8B A;  1A2L A;  3ZL5 A;  2I3Y A;  1URM A;  3I9V 2;  1WPI A;  4L0U A;  1GH2 A;  4ECI A;  6GSV A;  1XVQ A;  1VF4 A;  2X99 A;  1YY7 A;  1SL1 B;  4GSN A;  5J5N A;  1TU8 A;  1M99 A;  1U87 A;  2YZU A;  2ALB A;  3MSZ A;  2NBS A;  1HD2 A;  4TRX A;  1TDI A;  2B5X A;  5J4U A;  2OA7 A;  1EEM A;  2H6Z A;  1OC9 B;  3FY7 A;  3HYP A;  3I69 A;  4J57 E;  5LCZ A;  4MH2 A;  4V1A p;  2JAD A;  1SEN A; 
#chains in the Genus database with same CATH topology
 5FGO A;  7RNT A;  2HNL A;  4JR6 A;  3FLJ A;  4P3Y B;  3LH4 A;  3EF8 A;  1EWX A;  4RQR A;  4FYU A;  5IO2 A;  5D83 A;  3PZW A;  1VQN 3;  1M3J A;  1QXH A;  1EV4 A;  1XWK A;  3TB2 A;  2X8C A;  5ECP B;  4I5Q A;  4MF5 A;  2FA4 A;  2VIM A;  2IJY A;  2P31 A;  3L9V A;  1WMO A;  5ELA A;  5KN2 A;  3PCS A;  1OE7 A;  1OHO A;  4RZM A;  4XS4 A;  2RCD A;  2XFT A;  3BNE A;  2C3N A;  4HZ9 B;  3GSS A;  3LT9 A;  1V40 A;  5GAP D;  1FW1 A;  4HYZ A;  1UUV B;  2CG0 A;  2CX1 A;  3IXR A;  4OK0 A;  1FB0 A;  4WR5 A;  1YKA A;  2WOH A;  1O7P B;  3A2W A;  2H75 A;  5HFG A;  3D0Z A;  5IEO A;  1DE1 A;  3E3E A;  3FG1 A;  2PN8 A;  2LJR A;  2VL9 A;  5HFI A;  2G2Q A;  4MAB A;  3I56 3;  2XGN A;  2AB6 A;  2XHF A;  5D9T A;  1O7U A;  4USS A;  2H1B A;  1VQM 3;  4I8B A;  1F37 A;  2VLV A;  1MD3 A;  1NSW A;  1WE0 A;  3QFB C;  1THO A;  1MGW A;  4V2N A;  2BU4 A;  4FH8 A;  22GS A;  1T4Z A;  4KA0 A;  5CNW A;  2CFL A;  1TP6 A;  1PN0 A;  3LOY A;  2RNT A;  3CU3 A;  3EU3 A;  4HBR A;  5BXQ A;  2P0X A;  1XWC A;  2DKH A;  2CFD A;  4MJD A;  3V92 A;  2FCH A;  2L5O A;  1A2M A;  2CWU A;  3HJO A;  3CPO A;  6GSW A;  4OVM A;  1Y6E A;  1R4Y A;  1V2A A;  4IVF A;  2PBJ A;  1S3R A;  4GB5 A;  2DJ1 A;  1O8X A;  1X5C A;  1Y25 A;  1RK4 A;  1RRH A;  1XWA A;  4EC0 A;  1BAO A;  3ERF A;  3QR6 A;  5IG5 A;  3C71 A;  2L57 A;  1Z7R A;  3FZW A;  3F8X A;  2IFQ A;  4AJ7 A;  2V6O A;  4LLR A;  1TK8 B;  2R6K A;  3MHE A;  4OFM A;  1ULJ B;  4NRE A;  1JB2 A;  4GST A;  2AJQ B;  3CQF A;  2BO9 B;  3TDG A;  2GZY A;  2NVL A;  1JZO A;  1UCJ A;  3CME 3;  5CRH A;  3ZVJ D;  3LW9 A;  2CFW A;  5E59 A;  2IPA A;  1JZW A;  4MF6 A;  3GTU B;  1UCK A;  1SJI A;  4Q5R A;  1K0O A;  5IER A;  2YP6 A;  2IWT A;  5RNT A;  5IMV A;  1B21 A;  4OUQ A;  2RII A;  5DAL A;  1ILO A;  1PGT A;  2DSA A;  3ECF A;  2WGQ A;  5AIG A;  3KIJ A;  2ZNM A;  4QL9 A;  1B20 A;  3EUR A;  2R3X A;  3GH6 A;  4ML1 A;  2K18 A;  1RTU A;  3ED3 A;  4O5Q A;  1SU9 A;  2BMR B;  1OC3 A;  1VF3 A;  1GD3 A;  3H93 A;  4D73 B;  1LOY A;  3T8U A;  3Q6O A;  4KUN A;  5A5K A;  2F5M A;  4Z7X A;  3EX9 A;  2KP2 A;  1ZO2 A;  4ACS A;  3DD3 A;  1O73 A;  1LU4 A;  2BIR A;  5DQY A;  2CZ3 A;  2HLS A;  2FWF A;  1NB5 I;  1USB A;  4IBP A;  1DE2 A;  4DKI A;  3D21 A;  1I5G A;  1M2D A;  3FW2 A;  3X42 A;  3P7X A;  1JNQ A;  3PIN A;  1W6C A;  1JN5 B;  3HKR A;  1E3R A;  4J56 E;  1T2I A;  4BIR A;  4IPB A;  5CAX A;  3JUM A;  1BUJ A;  1TKD B;  4WHA A;  2ML5 A;  3KTL A;  2TRX A;  1GSS A;  2UZ8 A;  4BVY A;  4OO4 A;  5CRG A;  1XXU A;  1BSD A;  4CJN A;  5J9B A;  5CRD A;  1QAF A;  2FGX A;  2RUF A;  4HZB B;  4N6M A;  4DSS A;  2BJX A;  4XBY A;  4L5L A;  1BNI A;  1RGA A;  3ERW A;  5IMD A;  4Q53 A;  3HK4 A;  2OKA A;  2RM5 A;  3DXB A;  1GMQ A;  1U3I A;  2HZE A;  1Z6M A;  2DMM A;  4BU4 A;  2E7P A;  3A76 A;  2W56 A;  2YWO A;  5ECO B;  3Q2P A;  3TCO A;  1BNS A;  1LXE A;  2W2C A;  1FGT A;  1GUH A;  1RN7 A;  1ROV A;  4POK A;  3NBB A;  1U88 A;  3HY2 A;  1T3B A;  3BNC A;  4HM3 B;  2OBI A;  4RI7 A;  1UA5 A;  4KDX A;  4ZB9 A;  2OBK A;  5DQS A;  1KBN A;  3GFK A;  1FG4 A;  1X9S B;  2R5G A;  4K5R A;  1FO5 A;  3NM2 A;  1A8Y A;  3Q1C A;  2I81 A;  1PKZ A;  4DVC A;  3EC9 A;  1CQS A;  5ID2 A;  4N11 A;  2OQE A;  8RNT A;  1NM3 A;  2EIQ A;  3WOF B;  1PA3 A;  2WFC A;  3P90 A;  1GLP A;  2LNT A;  2MBS A;  2XSH B;  1GRX A;  1ZYP A;  1SJ6 A;  4XRA A;  5D81 A;  4RNZ A;  3Q3F A;  2XGL A;  1HKX A;  1BNJ A;  2H1A A;  6RNT A;  3GH9 A;  2AYT A;  1O81 A;  2B5Y A;  2A4V A;  3SX1 A;  3L78 A;  2BMX A;  2FNQ A;  3IV4 A;  1UC7 A;  2HMM B;  4F9Z A;  3NXJ A;  3APQ A;  2WRT A;  3H4K A;  1OGX A;  1RW1 A;  1XW9 A;  4MJE A;  1EQK A;  1PY3 A;  1B4Q A;  5G30 A;  1TU5 A;  2BHM A;  4HU7 A;  1MTC A;  3F4S A;  2WS2 A;  1F8N A;  2WJU A;  1K28 A;  3QK9 A;  2K3D A;  4POB A;  1F3A A;  4MMY B;  4F0B A;  3X40 A;  1EV9 A;  4F03 A;  2DML A;  1OC9 A;  5ECK B;  1LNH A;  1QAK A;  1X5D A;  2HT9 A;  3N9J A;  3CC2 3;  2JZS A;  4HM1 B;  1ULI B;  4RI6 A;  1FZU A;  3GZX B;  1RKY A;  2F98 A;  5ECM B;  4JF8 A;  1Z6N A;  2A2R A;  2VL3 A;  3HXS A;  4XS1 A;  1R26 A;  3FF0 A;  5H5S A;  1UN2 A;  2MYG A;  5IM9 A;  5CLK A;  4GXZ A;  1GSE A;  4ZBB A;  1CEW I;  4X2H A;  3M3M A;  4GF0 A;  4H61 A;  3H1N A;  1VZZ A;  4K2D A;  2R0C A;  4XTS A;  2W0Q A;  3F40 A;  5EEO A;  1HNA A;  1IQX A;  3WYW A;  1NHO A;  18GS A;  3QPM A;  4CHS A;  1UI7 A;  1XW5 A;  1OAC A;  1IK3 A;  4MMZ B;  5B6M A;  1E3V A;  1QJG A;  2I1U A;  2LKU A;  3LTD A;  3ZFZ A;  4K8M A;  2W9Q A;  3BJ5 A;  3Q74 A;  3EHC A;  2A2P A;  2ZA4 A;  4IT7 A;  5AIS A;  2WGO A;  1OKT A;  2LJA A;  1SKS B;  5ELU A;  1IYY A;  4YKG A;  1DMN A;  2GXF A;  1BNR A;  2CAI A;  4Z2U A;  3L9S A;  1DVC A;  1W4N A;  1G6Y A;  1RGG A;  4G10 A;  5DJM A;  3UMA A;  4WBR D;  3F4R A;  3NQZ A;  1D6Z A;  5IW9 A;  3K9M C;  2IMF A;  4NXI A;  3VWX A;  3IJE B;  3X3X A;  4AGS A;  1PL2 A;  3APO A;  2IME A;  3FGY A;  4N0V A;  2H1D A;  2ZL8 A;  1A23 A;  1K0A A;  4WBJ A;  2WDU A;  4CW9 A;  3TKS E;  4DEJ A;  3LQ7 A;  1OCV A;  2SBL A;  4IGJ A;  2MMA A;  4POM A;  3TRQ A;  1I9D A;  2HMJ B;  1NW2 A;  1VGL A;  2RSX A;  4XHM A;  1YEP A;  2GSQ A;  1YIT 3;  3KP9 A;  2L4C A;  3LYG A;  5BIR A;  4QQ7 A;  1JLV A;  1NB3 I;  3RGA A;  1JV2 B;  3JVC A;  1WMN A;  2YWI A;  3GMF A;  4DSQ A;  3I55 3;  1S3A A;  3U1W A;  1ZL9 A;  4XIH A;  2IIY A;  3M8C A;  3GTU A;  3MIX A;  4KF9 A;  3KCH A;  1MWT A;  3VWV A;  4LMW A;  1T8E B;  3HOH A;  1U6T A;  3L4N A;  1M0U A;  5CRW A;  1N8R 4;  3LML A;  2K9F A;  4ILF A;  3I0Y A;  1GMR A;  4O8S A;  1IV7 A;  1WOU A;  1BNF A;  1I2G A;  4K1V A;  3HZ8 A;  1Q98 A;  4K90 B;  4MMM A;  4PNF A;  1OUN A;  2F5W A;  3GV1 A;  2PGT A;  1K9M 4;  1PX6 A;  3A2X A;  2GU1 A;  1IU7 A;  3IHQ A;  1DBY A;  4D73 A;  2IMI A;  1GL8 A;  4PTS A;  1XPV A;  2C0G A;  3OW2 2;  4OFT A;  1JBT A;  2MBT A;  3TRP A;  1HYF A;  4NHZ A;  2L5L A;  4KDU A;  2LNS A;  1RJO A;  3EBY A;  4I97 A;  1WJK A;  5EY6 A;  4TXV A;  4KB3 A;  2OAC A;  1YF0 A;  4TR1 B;  2H0I A;  1VQ9 3;  1RGF A;  3GZB A;  1QVG 2;  2TIR A;  4J9A A;  1W6G A;  3A5E A;  2A2S A;  4MZC A;  2IY2 A;  2GEY A;  1JN5 A;  4CDO A;  1GMP A;  2W6J H;  1UCI A;  1B2U A;  1GSD A;  3X3Z A;  5H5R A;  1A2K A;  1YNV X;  2C10 A;  3V1W A;  3N54 B;  3S28 A;  2FGT A;  3WOD G;  1O8W A;  4YAP A;  3FR6 A;  1CH0 A;  4HI7 A;  4BVX A;  2QGV A;  2GVP A;  4LL4 B;  1KWI A;  1L5G B;  3R3E A;  3V99 A;  2WB9 A;  1UGH I;  4GL6 A;  3IE3 A;  1FAA A;  4ZB6 A;  2BMQ B;  1XG8 A;  3LXT A;  3F4T A;  3LOR A;  3EVI A;  4IP1 A;  3WR2 A;  1N8Q A;  2ES7 A;  3PGT A;  4PEJ A;  4V1A g;  1TXX A;  2CVK A;  4BL3 A;  3GRD A;  3GKK A;  3ZLP A;  1ASK A;  3LT8 A;  3C1S A;  1RLS A;  2JSZ A;  3UJ1 A;  4GLT A;  1LQG C;  1B8X A;  2O9U X;  2DJ3 A;  1XZO A;  3B7C A;  5DJL A;  3TKS A;  1YKC A;  3ZYW A;  3DGN A;  3KCM A;  2B24 B;  2OTL 3;  1PRX A;  3BD2 A;  4BTX A;  1SII A;  3UL5 A;  2V1L A;  5BU4 A;  1BG5 A;  3K8N A;  2R0G A;  3FKF A;  3CC4 3;  3W6G A;  5IQY A;  1WMP A;  2CKF B;  5AEU B;  2LST A;  4HKV B;  2P5R A;  5ECQ B;  1GNE A;  1IT7 A;  3CCQ 3;  1GOV A;  5DDL A;  5HQP A;  2L4Q A;  2V6K A;  2B6M A;  1EZK A;  2HFD A;  5J41 A;  1C54 A;  1YDK A;  4IQ1 A;  3KEB A;  4ZL8 A;  2HOH A;  4NHF A;  5LC7 A;  2WOF A;  1RN4 A;  4KX4 A;  4EV5 A;  2HSY A;  6GSY A;  1Z7P A;  3P8W A;  1JBS A;  3KJY A;  1JB5 A;  3KFQ C;  2CVD A;  5FHI A;  3ZFB A;  2INX A;  3TUE A;  1TFK A;  1LJR A;  1A2P A;  3MG2 A;  1OVN A;  2GT5 A;  2IMK A;  4WFO A;  3A5I A;  4TKY A;  2IUK A;  4EXR A;  1FVK A;  3EU4 A;  3HJP A;  4MJC A;  5AGY A;  1IVU A;  3D6I A;  5AYS C;  1VQ4 3;  1SKW B;  3JUO A;  2VM1 A;  3F0I A;  4ML6 A;  5G1K A;  2F51 A;  1RMS A;  1B2X A;  1PYL A;  1U8C B;  1K3Y A;  3IPT A;  3F6F A;  2F8F A;  1I8V A;  1GSF A;  1I3F A;  1QFN A;  5F0G A;  5IG0 A;  3JUN A;  2LQV A;  1WRY A;  4AEQ A;  5ECN B;  3M9J A;  1GSY A;  5F05 A;  2H01 A;  4CY8 A;  2N5F A;  6GSP A;  2NPB A;  4LMI A;  1YQ1 A;  5JBS A;  1T4Y A;  4BWQ A;  5L71 A;  4HVN A;  2YFL B;  1IT8 A;  1Z3E A;  1SAR A;  2I4A A;  4EF0 A;  3AHS A;  1GLQ A;  2XPD A;  1Y4K A;  5GSP A;  3CSH A;  4FMA A;  5HOH A;  4H3U A;  1BUQ A;  1M3I A;  3WHO A;  2MZC A;  3ZFL A;  3VK9 A;  4EUY A;  11GS A;  1TUH A;  1SQW A;  4KAE A;  5KOW A;  4FYB A;  1BIR A;  1A67 A;  1TFO A;  3NBR A;  1EEJ A;  3FF2 A;  1QUW A;  3AHW A;  3ZG0 A;  2E2M A;  4ORL A;  4O92 A;  4L8O A;  4L8E A;  4YAV A;  5G5F A;  4KSM A;  3HVX A;  2V32 A;  2W04 A;  1E2Y A;  2C4B A;  5A0O B;  2PUK C;  2FLS A;  2JU5 A;  3DEX A;  3UOM A;  2V2G A;  4G9H A;  2KCD A;  2VCV A;  4IKH A;  4BPY A;  3WMD A;  1AQZ A;  4GQC A;  1LVN A;  2IYJ A;  1C72 A;  4JZQ A;  2DC5 A;  3EC3 A;  3HJM A;  3MNG A;  1WWJ A;  3LFL A;  3LGC A;  2O87 A;  4HS1 A;  2KUC A;  20GS A;  2KHP A;  1M2A A;  5DRE A;  4KCA A;  1PMT A;  4XDW A;  3B4O A;  2HSM A;  3ROB A;  1OE8 A;  3IAM 2;  5BVB A;  5GZZ B;  2HE3 A;  2H6Y A;  1ZCP A;  4Q5Q A;  1GY6 A;  2N5B A;  4GTU A;  3DUK A;  1XIY A;  1X5E A;  1VQ5 3;  3FH1 A;  4HM5 B;  3VPQ A;  3D4A A;  4BL7 B;  4GHO A;  1ISK A;  2YZH A;  3NZN A;  5ELJ A;  5FWG A;  4K7O A;  2B1X B;  3PCR A;  2YFJ B;  1M1K 4;  2FWG A;  3BND A;  5AI1 A;  1ZOF A;  1FGR A;  2AV4 A;  4R9K A;  4O02 B;  5HFK A;  1DSB A;  5D73 A;  5ABR A;  1S3D A;  2HRN A;  2HZF A;  4NHW A;  3C7M A;  5IPH A;  4H86 A;  3EE1 A;  2M46 A;  2H70 A;  4HM2 B;  2RLI A;  2A15 A;  1GOY A;  3WA2 X;  3HI7 A;  4MDC A;  3TOU A;  3FMW A;  4MZB A;  2GS3 A;  3RNT A;  1AQX A;  3HZ4 A;  2FHE A;  3MWH A;  1TRV A;  4MCU A;  5STD A;  1BRH A;  2X8H A;  3PYJ A;  2F3M A;  2HMN B;  2JQ5 A;  1UW1 A;  2H66 A;  4FR9 A;  3QRD A;  2JZT A;  2LS5 A;  2CA8 A;  1FUW A;  2N5A A;  1TU7 A;  3ZMK A;  5CF1 A;  2MMN A;  2GZP A;  1ON4 A;  5IEN A;  1EP8 A;  1TJD A;  4AKY A;  3HX8 A;  1R4C A;  4HQZ A;  1K0C A;  3US3 A;  2C0F A;  3G7J A;  2YCD A;  2C3Q A;  3G8Z A;  3WT2 A;  1ZZY A;  5BMU A;  3CBU A;  1NJI 4;  3BIR A;  2EIO A;  2VCT A;  3E0U A;  4HM8 B;  2HI7 A;  4ZBD A;  1TOF A;  1TRU A;  2TRC P;  3F14 A;  4IHU A;  4TR1 A;  3TJJ A;  5CXO A;  5GAN D;  3DMC A;  4CCV A;  3SBC A;  4E8H A;  1W02 A;  1LOV A;  1GNW A;  5CK6 A;  1SD9 A;  3WGX A;  2VOC A;  5KP3 A;  2GLR A;  1X9W B;  2M7O A;  2A4H A;  1MOL A;  1UI8 A;  3LTA A;  1SJZ A;  3I6A A;  2LV3 A;  4HJM A;  2KAA A;  1OH0 A;  2OTJ 3;  5G31 A;  4STD A;  3BOA A;  4ECC A;  2QC7 A;  1ERU A;  3IAS 2;  16GS A;  1PQN A;  3KXO A;  5C00 A;  4PNG A;  1PSQ A;  2PVQ A;  5A4W A;  1AUC A;  1O7M B;  3Q18 A;  1V9W A;  1MGR A;  1VQO 3;  3SXX A;  3CYN A;  3NBJ A;  2KLX A;  4G0L A;  2XF3 A;  7GSS A;  4TR3 A;  3AMO B;  2GZZ A;  3CTG A;  4YQV A;  2GU3 A;  3GRX A;  1FOV A;  3DKS A;  3MSO A;  2C0E A;  3ZML A;  3HHV A;  1H75 A;  5CYY A;  4FCJ A;  2C11 A;  4ZXG A;  3WD6 A;  3CCL 3;  3EN1 B;  2VD0 A;  3A5W A;  5JPU A;  3CMA 3;  5AN1 A;  2QIY A;  1K0B A;  1X0R A;  3FZ5 A;  2X49 A;  3VI7 A;  2V1M A;  2AAW A;  1RGK A;  19GS A;  1YGW A;  4AJ8 A;  2H72 A;  1US1 A;  2W03 A;  1FVJ A;  3ZTL A;  2WGR A;  4A5P A;  1BRK A;  1E97 A;  1EA2 A;  3LZA A;  2XFS A;  1PL1 A;  3EBT A;  1UUW B;  2DJ2 A;  2FUG 2;  3IK7 A;  5DRV A;  2B7J A;  5ENU A;  4ZIL A;  2H1G A;  2M80 A;  1EUI C;  3GX0 A;  1WP0 A;  2YN1 A;  5KN3 A;  3EE2 A;  1XFL A;  2RBI A;  4MF7 A;  1PX7 A;  2BNG A;  1R5A A;  3D4M A;  1GSU A;  4HJ2 A;  5AEW B;  2O85 A;  2QA2 A;  3I43 A;  4ZBA A;  2W9P A;  4K61 A;  2YNX A;  1F9M A;  3HIG A;  3G71 3;  3UIW A;  3HII A;  2PER A;  5IMF A;  3GUS A;  3G0K A;  3MWZ A;  1B2S A;  1KD1 4;  4XB5 A;  2XR8 B;  2C3T A;  4XS6 A;  3CD6 3;  3F7X A;  1GTA A;  2GQL A;  3AGO A;  1W4V A;  1B27 A;  1QK8 A;  3DH2 A;  1A2J A;  1SYX A;  2KXG A;  1Q9E A;  3EB8 A;  4YQM A;  3LTC A;  1HYU A;  2ZUP A;  4L7K A;  1GWC A;  5JCU A;  2BT3 A;  2DJ0 A;  4PQI A;  2O3O A;  1AIU A;  2CHC A;  3DIE A;  2OOV C;  4I2T A;  2JL4 A;  3M0F A;  3WA3 A;  1MWR A;  6GSU A;  2XC2 A;  1Q7H A;  3C1R A;  4EBG A;  4O7H A;  4EYC A;  5G2Z A;  1TRP A;  2D2Z A;  1AY7 A;  1FGM A;  4LGQ A;  1GTB A;  2VM2 A;  1TP9 A;  2PZV A;  5AYR B;  4EE0 A;  4LYL B;  4PQH A;  5IOX A;  4J8T A;  5CRE A;  4IJ3 A;  2DJK A;  2Z76 A;  3UAP A;  3LXZ A;  4EC6 A;  5IG3 A;  4MEI A;  1PD2 1;  3RAZ A;  4PGT A;  1GUL A;  5J9C A;  3UEM A;  3IDV A;  4JRR A;  3JCM L;  1JZD A;  2C8U A;  1DUG A;  3NHX A;  5HR2 A;  1YEX A;  3VPT A;  1GD4 A;  1DMM A;  4RBN A;  3F63 A;  4EDY A;  3JUP A;  4WP5 A;  2R4V A;  4X43 A;  3W8J A;  3OXA A;  2CC3 A;  1AR0 A;  2Q07 A;  3DGM A;  2B1L A;  2B3S A;  1WTH A;  3IMA B;  2B7K A;  3M1G A;  3SOA A;  4L8P A;  1V98 A;  1VQL 3;  3EMX A;  1SK2 A;  3CCJ 3;  4RQX A;  1KSI A;  1V57 A;  1QQ2 A;  1F6M C;  4DSR A;  3ERG A;  4IS0 A;  1DE3 A;  3NX0 A;  3KGK A;  3RBT A;  3TKR A;  4GRF A;  2F99 A;  1Q81 4;  3EMP A;  5DAK B;  5KP1 A;  4TOP A;  5LD0 A;  4NMU A;  1IDP A;  1BED A;  1YVS A;  7STD A;  2ZDJ A;  3KMO A;  3SED A;  3K5T A;  1PN9 A;  2QA1 A;  2WO0 A;  4NV5 A;  3GZR A;  3F3Q A;  5G5E A;  1BU4 A;  5HR3 A;  4BL7 A;  2CIU A;  1Q86 4;  3KN4 A;  4X0X A;  1RGH A;  5CO3 A;  1X1U A;  2F56 A;  3QD9 A;  4HUA A;  3U6V A;  4G0K A;  1IYI A;  1YHQ 3;  2PU9 C;  9GSS A;  5ECH B;  2NDO A;  4MPG A;  2DIY A;  1WNH A;  2V41 A;  3D4T A;  3WGE A;  3G16 A;  3MKI A;  5H5Q A;  1CQH A;  3OWU A;  4K6X A;  2HRF A;  5CP1 A;  1O7G B;  2KF5 A;  2OJL A;  1K8A 4;  1JB4 A;  3SLU A;  4WXT A;  1GOU A;  4L5O A;  2XEP A;  1UVZ A;  3EYT A;  5KP4 A;  4K9Z A;  2MMO A;  5A4V A;  2E0Q A;  3GUR A;  2CT6 A;  3MG3 A;  5D9V A;  5D9W A;  3M8N A;  4MJB A;  1A2V A;  3BU4 A;  4PUR A;  3M9K A;  1I0V A;  1UGI A;  3SOY A;  3FZA A;  1NDO B;  4FO5 A;  4FCM A;  1B9Y C;  2VAF A;  5G1L A;  4XBT A;  2F9S A;  5F8B A;  5LC6 A;  2CWV A;  3S5C A;  3WGD A;  4QWT A;  3ER7 A;  2VL2 C;  3IRA A;  3QOU A;  4XRD A;  6GSX A;  3UJM A;  1RGL A;  1RRL A;  3EPT A;  4Z2R A;  3KZQ A;  3CSJ A;  2HXK A;  1AXD A;  1ERW A;  2O7K A;  2ML6 A;  4RNY A;  1SJW A;  2H6X A;  2H0H A;  2YAN A;  2M72 A;  1VQQ A;  4O5U A;  4EO3 A;  4NPB A;  4NAX A;  4TVE A;  3VLN A;  3FYG A;  1BNG A;  2IMJ A;  1TI1 A;  3GZY B;  3KE7 A;  2E2T A;  2JAC A;  5HGR A;  6GST A;  1AW9 A;  4JU5 A;  3FG3 A;  2KF4 A;  3MDK A;  4KE3 A;  1XW6 A;  3G4S 3;  3ZIJ A;  2KP1 A;  8GSS A;  4MP4 A;  1RN1 A;  4FQU A;  1KNG A;  1FB6 A;  3H79 A;  1Q42 A;  3DRN A;  1G6W A;  3PGB A;  4G0I A;  1S3C A;  1VF2 A;  2KRT A;  1ERT A;  2VCZ A;  3PPU A;  3QDN A;  3GIX A;  5A4U A;  1S5A A;  4KCE A;  1BJX A;  3VI5 A;  5IEP A;  5LNK e;  2XBQ A;  1E6B A;  3AMO A;  4WF4 A;  3APS A;  3IR4 A;  3LWA A;  5IF6 A;  5M18 A;  1EGR A;  2C1Y A;  2GBW B;  4ECJ A;  4O3V A;  3DY5 A;  2HMK B;  1UCL A;  2DKI A;  3FZ9 A;  3O3T A;  4R1K A;  1RGE A;  1D6Y A;  4TX4 A;  4MZW A;  1Z9H A;  3S27 A;  1GTI A;  1YJ6 A;  4I6X A;  4LL1 B;  4PUA A;  1CYU A;  5HR1 A;  3DGQ A;  3ME8 A;  1Q82 4;  1GY7 A;  8CHO A;  3KH7 A;  1VQK 3;  2HSH A;  3TOT A;  2FD3 A;  2H30 A;  3T0U A;  2XBI A;  1JBR A;  1ZGN A;  3CRU A;  1AQV A;  2YV7 A;  3KKG A;  3H3H A;  1EKM A;  3IA1 A;  2VLT A;  1O7N B;  3HVS A;  2E2V A;  2HMO B;  3L0H A;  1TIJ A;  3P2A A;  4G19 A;  1M9A A;  4TR4 A;  3BCI A;  3UBK A;  2UX0 A;  5KOX A;  4GQF A;  4HU9 A;  1OHP A;  1DMQ A;  1Z5Y E;  1IVW A;  4IIA A;  1STF I;  3IOS A;  1B4P A;  1VQP 3;  1K3L A;  3FHK A;  1U3A A;  1BRS A;  4EW5 A;  1GUK A;  2HML B;  3FSD A;  4OCE A;  2PNC A;  4RUV A;  2AAE A;  4KH7 A;  1OF5 B;  2JSY A;  1XCC A;  2X4A A;  4WET A;  2UUG C;  2LRC A;  2B5E A;  1EGO A;  3UVT A;  2LUS A;  4OD7 A;  4EIQ A;  1MDJ A;  4K1U A;  10GS A;  3D79 A;  1GYB A;  4GCI A;  4LMV A;  5JCG A;  2DIZ A;  3L9U A;  5DVB A;  2H71 A;  4HJL B;  3FG4 A;  1A0R P;  2H19 A;  2RFR A;  4OCF A;  1TK0 B;  3D5I A;  3DWV A;  9RNT A;  17GS A;  4TR0 A;  2P09 A;  1J08 A;  4ECB A;  1G7O A;  1HNC A;  1OPY A;  2L59 A;  1BRJ A;  5JPP A;  3GN3 A;  4HQS A;  2LJK A;  1LNI A;  1IV9 A;  2Y73 A;  1WIK A;  3BBY A;  1Q40 B;  2UGI A;  2GT6 A;  4N6V 0;  4TXO B;  1AAZ A;  4HZ4 A;  1NO3 A;  1FOH A;  2Z77 A;  2XRX B;  2K6V A;  3GHA A;  3GSP A;  3E9J B;  1FYS A;  4IJI A;  1M9G A;  3LSZ A;  5INY A;  4HSC X;  2DLX A;  2H76 A;  2HRK A;  2Z6B A;  5F06 A;  3CRT A;  1TRQ A;  2J8X B;  3CNX A;  5ECS A;  4Q5N A;  4CPK A;  3GL3 A;  4KDY A;  4AF2 A;  5D8I A;  3F6D A;  3GA4 A;  3FZ4 A;  2QKE A;  3O8Y A;  1IVX A;  2PMT A;  4IEL A;  1LBK A;  4WWU C;  3QFA C;  3TKP A;  3HD5 A;  2CV4 A;  4XM4 A;  2X64 A;  4EKZ A;  2KOK A;  2GSP A;  1FUT A;  3NV0 B;  4KGI A;  1ROA A;  1PFP A;  5I97 A;  4NWY A;  1F2E A;  4X1U A;  3C8E A;  3LEF A;  1I2E A;  2QGU A;  4HZ2 A;  1W00 A;  5DAK A;  3VWW A;  2VCW A;  1FW7 A;  4EIP A;  3SWL A;  3EQQ B;  3S29 A;  1SYR A;  1GUM A;  1MWS A;  5TGN A;  3UAR A;  2R4I A;  3NOF A;  5IMZ A;  2H74 A;  3KZT A;  1RHL A;  3GAX A;  1W2Z A;  2K8S A;  1CQG A;  1WQL B;  1XBS A;  4ISD A;  3VF1 A;  4HAA A;  1T2H A;  1FUS A;  1BQ7 A;  4V2M A;  1RSN A;  1LOW A;  3VSY A;  3MPH A;  3S9F A;  3KSE D;  5IMA A;  2NTO A;  4ICY A;  4MNN A;  3AY8 A;  3D9R A;  2L4V A;  2EIR A;  4X2O A;  4AJ6 A;  3RPP A;  5JCW A;  4OWY A;  3UBL A;  1QVF 2;  1C7H A;  1X1Y A;  3DZL A;  1ACV A;  5IOW A;  3A2V A;  1B3S A;  1ZX2 A;  4JR4 A;  1QAL A;  3GYK A;  3MYD A;  1MEK A;  5D93 A;  2FXT A;  2OAD A;  1SL2 B;  4KT3 B;  2ZCT A;  3FK8 A;  4HOJ A;  1A24 A;  1HNB A;  1GSP A;  3IC8 A;  4N6O B;  2WZ9 A;  4N30 A;  2GTU A;  1JJ2 2;  2K54 A;  2PWJ A;  3UB1 A;  4WYK B;  3Q19 A;  2WCI A;  4FMB A;  1MDI A;  5D9X A;  2J23 A;  4K0N A;  4HM4 B;  3QMX A;  3URP A;  3X3Y A;  1H4O A;  2P05 A;  1KC8 4;  13GS A;  1IYH A;  2K0M A;  3NUV A;  1XVW A;  1W89 A;  3GNJ A;  3ME7 A;  5FW5 A;  5B7C A;  4K5S A;  2D1W A;  2SAR A;  2WUL A;  3SYU A;  1ZYQ B;  1OHS A;  2B1K A;  4LA1 A;  2FWE A;  5ECI B;  1W6Y A;  1K0M A;  2H0G A;  1FA3 A;  2H8L A;  1YGE A;  3GL5 A;  2OCT A;  5IIZ A;  3HVN A;  1VQ6 3;  2R0P A;  1OC8 A;  1SD8 A;  1W7C A;  4G1M B;  3TJB A;  1ERV A;  3PXM A;  3GKM A;  3STD A;  2ZHX B;  2RUE A;  5JWR B;  1X9M B;  1GY5 A;  4N6N B;  1GTU A;  2VCX A;  3F8H A;  4GSP A;  1T1V A;  4JRF A;  1W2B 2;  3K63 A;  5M1A A;  5DCG A;  1XWG A;  3J7Y k;  1BGS A;  2CVB A;  1RQM A;  3VFI A;  3ZZX A;  1Z1S A;  5J3R A;  2CH9 A;  3IHG A;  1NU3 A;  3IC4 A;  1I3I A;  3KSP A;  4TN8 A;  1M90 4;  3HA9 A;  2CWT A;  1TRW A;  5AIH A;  3KH9 A;  1SL0 B;  3VUR A;  3PS8 A;  4OMV A;  3HCZ A;  3ZRE A;  2LRT A;  1M7T A;  2OQE C;  3OV4 A;  3JUQ A;  1OYJ A;  4Z2T A;  2LQO A;  3DXO A;  3HVV A;  2K8V A;  1EOH A;  4KW6 A;  2VCQ A;  3LYP A;  4HEA 2;  4N6L A;  5DBQ A;  1I2F A;  3J7Y d;  3RDW A;  5JWQ B;  3F9U A;  4K2X A;  5CF2 A;  2C0D A;  1R7H A;  3G7I A;  1XWB A;  4BVX B;  2E2G A;  1J9B A;  5ECL B;  1A0F A;  1OAZ A;  3ALA A;  1T7P B;  5AIF A;  1QMA A;  3LJR A;  4J2F A;  1YVB I;  2AAD A;  5EPF A;  4E8E A;  3FEU A;  4JED A;  3D3L A;  3N9H A;  5EQL A;  4WKW A;  1YJW 3;  3GWR A;  4ULX A;  3S67 A;  2IUJ A;  12GS A;  4EDZ A;  4ZL9 A;  3KMN A;  5HR0 A;  3DGL A;  1BVI A;  3L0R A;  3IBH A;  2XSO B;  4PX1 A;  4EL1 A;  2E2U A;  1SIH A;  5IG4 A;  4GSS A;  3KD0 A;  1IQY A;  3GX8 A;  1G96 A;  5ELG A;  3OWS A;  1JLW A;  1MNL A;  1B2M A;  3MYT A;  1J2B A;  1AVL A;  1ZYE A;  4LSO A;  1SK0 A;  3ZIV A;  1OF5 A;  2MMZ A;  5G2G A;  3GKN A;  1N8J A;  4N10 A;  1N5H A;  2LYX A;  4KFD A;  3UL3 A;  2H73 A;  1F3B A;  3HDC A;  3DGY A;  3BLZ A;  2QEX 3;  1YIJ 3;  3CCU 3;  2CFG A;  2STD A;  1S72 3;  2O89 A;  2YJ7 A;  2R2J A;  4Q5F A;  2CK3 H;  3KTB A;  3LXU X;  3RGR A;  4N6U A;  2GQK A;  5EVH A;  2XPE A;  4G2E A;  3F7S A;  3J7Y b;  2CQ9 A;  2AHE A;  2VD1 A;  4LEH A;  4F2I A;  2I9H A;  1STD A;  4POL A;  2C4J A;  2FNO A;  1OGZ A;  1LOX A;  2CAQ A;  1RNT A;  2ON5 A;  4O5R A;  3CCM 3;  2GEX A;  3FR3 A;  4I2U A;  3CPW 2;  4HDE A;  1OKD A;  4BWS A;  3K7C A;  3O76 A;  4HM6 B;  2MF7 A;  2BTO T;  1Q40 A;  3LYK A;  1BYE A;  1Q7Y 4;  3IPZ A;  3FCS B;  4TXO A;  1J0F A;  1JHB A;  3OR5 A;  1O6J A;  3CCE 3;  2F4Y A;  2OE0 A;  1CYV A;  1RGC A;  3BB9 A;  1XOA A;  5ECR B;  4K7N A;  1BRI A;  1BSA A;  1HQO A;  4X4J A;  2LQQ A;  2CX0 A;  1K73 4;  1UDI I;  3R2Q A;  1VQ7 3;  3D22 A;  2REM A;  4HOH A;  1I70 A;  3UNL A;  3CCR 3;  2KF3 A;  1W5Z A;  1JKG B;  3RHC A;  4KND A;  1VF1 A;  3CMI A;  1RCK A;  2Y74 A;  3EJV A;  1BX9 A;  1M9B A;  1BRN L;  2YJH A;  2YX9 A;  1AV4 A;  4R9L A;  1SKR B;  3SVA A;  5DCH A;  4QL7 A;  3ZVJ A;  4R4K A;  3CTF A;  1HZ1 A;  5D82 A;  2CZ2 A;  3IK9 A;  3U5R E;  1SK1 A;  4ZM8 A;  1R4W A;  3NV0 A;  1FHE A;  4YQU A;  3B8L A;  3DML A;  3DVW A;  4F82 A;  4O2H A;  2GSR A;  2QSI A;  1VQ8 3;  1BAY A;  1QMV A;  1G0T A;  3F3R A;  4K7I A;  3NQY A;  1RCL A;  1N5P A;  4RNT A;  1G02 A;  2EC4 A;  3RPN A;  2GST A;  2GGT A;  3CCV 3;  1K0D A;  4XS4 B;  4XCS A;  2IA7 A;  1MD4 A;  3K0Z A;  3TKQ A;  2IMD A;  4MPF A;  1ZYN A;  2Z9S A;  3EWL A;  3EIN A;  6GSS A;  14GS A;  1YF1 A;  4ZL7 A;  1TTZ A;  1GS3 A;  3RDE A;  4MJA A;  4MMX B;  1PKW A;  1TI3 A;  4OO5 A;  3N8B A;  4EVM A;  3D5J A;  2G0F A;  5KN1 A;  2RGQ A;  1O7W B;  2PPT A;  4BTW A;  2JZR A;  1TK5 B;  3BCK A;  3WT1 A;  2OOV A;  3H8Q A;  2CW9 A;  1B2Z A;  1N9E A;  1T5Y A;  2CX4 A;  1DET A;  3V98 A;  3KII A;  2HYX A;  3G7Y A;  4YKF A;  3G6E 3;  3PR8 A;  1JZR A;  2J9H A;  3FRC A;  4FMD A;  4KSO A;  3B4P A;  1NWW A;  1K3O A;  5F07 A;  3FKA A;  2Z7A A;  3X41 A;  2MC8 A;  4PXO A;  4FYC A;  2IN3 A;  2YPM A;  2HRA A;  3KP8 A;  4FMC A;  2YFI B;  4MH3 A;  2ON7 A;  1I0X A;  4KFF A;  1BAN A;  2JDI H;  5COH A;  4WYK A;  2FY6 A;  1BSB A;  4K0G A;  1NHY A;  2VLU A;  4KZ1 A;  3QAG A;  4FIW A;  2L6C A;  3KM6 A;  1AC1 A;  3ISO A;  4U13 A;  1NNV A;  3ZIT A;  3VGN A;  2L6D A;  2FA8 A;  1ZMA A;  4IW9 A;  1EG9 B;  1B48 A;  3QAW A;  5KN0 A;  2OWP A;  2IFQ B;  1IVV A;  5D96 A;  2YWN A;  1LQM B;  4R80 A;  3TRX A;  3O6T A;  1YZX A;  1R5P A;  3D5G A;  2CG1 A;  4HM0 B;  3DVX A;  4CY6 A;  4EV2 A;  3A3T A;  4O32 A;  2OE1 A;  4HM7 B;  1G7E A;  1M2B A;  2CX3 A;  2X8G A;  4ID0 A;  5B8A A;  1HU9 A;  3H51 A;  1N9J A;  2F8A A;  2YWM A;  2QA4 3;  1EP7 A;  4WEY A;  2LEG A;  3TKS C;  5DAL B;  5C04 A;  2OE3 A;  4MLY A;  1O7H B;  2P38 A;  1N2A A;  1BOX A;  4V2L A;  5BRT A;  2GSS A;  3AGN A;  3QCP A;  1LRA A;  1QGV A;  1TTO A;  3FR9 A;  3RHB A;  5JWO B;  4JBB A;  4IQA A;  1JFU A;  1V58 A;  6STD A;  4XBX A;  2RM6 A;  3C73 A;  2KF6 A;  5M19 A;  3UL6 A;  3MAK A;  4BIK A;  3PH9 A;  3DM8 A;  2PVO C;  5AIX A;  2AUV A;  1U5O A;  1PU4 A;  3TJK A;  3CC7 3;  3F8U A;  3VWU A;  4IP6 A;  4XDV A;  5FT3 A;  4MK3 A;  4OFN A;  3DYR A;  2R37 A;  2VO4 A;  1MWU A;  4MA9 A;  4EXJ A;  4AKZ A;  1AQW A;  5AIV A;  3HZP A;  4KVH A;  1DYU A;  1ZGX A;  2IL3 A;  1Q4J A;  3G9B A;  1EOG A;  3NIV A;  3OX9 A;  5IO0 A;  1MDK A;  2XH9 A;  5B6N A;  3CSI A;  3Q90 A;  3CXG A;  1ZS7 A;  2GQM A;  4BVY B;  1D6U A;  2LTK A;  1A90 A;  4BL2 A;  1A8L A;  2VL2 A;  4ZB8 A;  1KQS 2;  1YJ9 3;  1KTE A;  4WR4 A;  4DSS B;  3OWY A;  1ABA A;  4TW5 A;  3ZRD A;  3WOE B;  2BMO B;  2P0M A;  2LRN A;  4JE1 A;  4N0Z A;  4IN0 A;  3GKX A;  2GDR A;  1PFO A;  4YH2 A;  2L1S A;  5IPG A;  3TGZ A;  3DGO A;  1YJN 3;  2I9W A;  4NV2 A;  2HZE B;  2YOI A;  1X1X A;  2W56 B;  1TRS A;  1TW9 A;  5GST A;  2D42 A;  1K41 A;  2O8V B;  4ZIJ A;  3UVH A;  1SPU A;  1XOB A;  2P5Q A;  4WF5 A;  1BRG A;  4BA7 A;  4PUF C;  4L0W A;  2F86 B;  1V74 A;  3TJF A;  3N5O A;  1VRS D;  4KFE A;  1WMJ A;  5AII A;  3W8S A;  3CXC 2;  5IMC A;  4F0C A;  3T8N A;  3GST A;  5E4W A;  3F9S A;  4J5K A;  4K1F A;  1THX A;  4FCZ A;  1T00 A;  7GSP A;  1KEB A;  2C80 A;  5GSS A;  1YI2 3;  2DBC A;  2VUP A;  4N3V A;  1GSQ A;  4LZI A;  1GP1 A;  3LG6 A;  4PQ1 A;  5EVO A;  5KEJ A;  1K0N A;  2FWH A;  2DJJ A;  5EL8 A;  2YV9 A;  3TJG A;  1ML6 A;  1O85 A;  5ID2 B;  2P0G A;  4GWR A;  3NM7 A;  1M1X B;  3QAV A;  3BNB A;  1ST9 A;  1B9X C;  5B8B A;  1JRQ A;  1RDS A;  1IQ8 A;  3LTB A;  1A2L A;  3ZL5 A;  2I3Y A;  1DVD A;  4CDL A;  2CFK A;  3MG1 A;  1URM A;  3I9V 2;  1WPI A;  1X1W A;  4L0U A;  4I4K A;  1GH2 A;  4ECI A;  6GSV A;  3E99 A;  4J5G A;  1XVQ A;  1VF4 A;  2X99 A;  1YY7 A;  3U97 A;  2GBX B;  1SL1 B;  4GSN A;  5J5N A;  1TU8 A;  1M99 A;  1U87 A;  2YZU A;  2ALB A;  3MSZ A;  3CNM A;  2NBS A;  1HD2 A;  3WDG B;  1RNB A;  3EN8 A;  4TRX A;  1BNE A;  1TDI A;  2B5X A;  1BSC A;  5J4U A;  3CCS 3;  2OA7 A;  3ZG5 A;  1EEM A;  1AVK A;  1FGO A;  1FGQ A;  2H6Z A;  1W01 A;  1JKG A;  1OC9 B;  4N6T A;  3FY7 A;  1UUG B;  2R41 A;  3HYP A;  3I69 A;  4J57 E;  5LCZ A;  1BSE A;  4MH2 A;  4V1A p;  2JAD A;  1SEN A;  4BTY A; 
#chains in the Genus database with same CATH homology
 2HNL A;  4JR6 A;  4P3Y B;  1EWX A;  4RQR A;  4FYU A;  5IO2 A;  1QXH A;  1EV4 A;  1XWK A;  3TB2 A;  2X8C A;  5ECP B;  4I5Q A;  4MF5 A;  2FA4 A;  2VIM A;  2IJY A;  2P31 A;  3L9V A;  5KN2 A;  5ELA A;  1OE7 A;  4XS4 A;  2C3N A;  3GSS A;  1V40 A;  5GAP D;  1FW1 A;  3IXR A;  1FB0 A;  4WR5 A;  1YKA A;  3A2W A;  2H75 A;  5HFG A;  3D0Z A;  1DE1 A;  3E3E A;  2PN8 A;  2LJR A;  2VL9 A;  5HFI A;  2G2Q A;  4MAB A;  2AB6 A;  2XHF A;  5D9T A;  1O7U A;  4USS A;  2H1B A;  4I8B A;  1F37 A;  2VLV A;  1MD3 A;  1NSW A;  1WE0 A;  3QFB C;  1THO A;  4V2N A;  4FH8 A;  22GS A;  1T4Z A;  4KA0 A;  5CNW A;  1PN0 A;  3EU3 A;  1XWC A;  2DKH A;  2FCH A;  2L5O A;  1A2M A;  3HJO A;  6GSW A;  1Y6E A;  1V2A A;  4IVF A;  2PBJ A;  2DJ1 A;  1O8X A;  1X5C A;  1Y25 A;  1RK4 A;  1XWA A;  4EC0 A;  3ERF A;  3QR6 A;  3C71 A;  2L57 A;  1Z7R A;  2IFQ A;  4AJ7 A;  2V6O A;  4LLR A;  1TK8 B;  2R6K A;  4OFM A;  2AJQ B;  4GST A;  2NVL A;  3TDG A;  2GZY A;  1JZO A;  5CRH A;  3ZVJ D;  3LW9 A;  5E59 A;  2IPA A;  1JZW A;  4MF6 A;  3GTU B;  1SJI A;  4Q5R A;  1K0O A;  2YP6 A;  2IWT A;  5IMV A;  2RII A;  5DAL A;  1ILO A;  1PGT A;  2DSA A;  3KIJ A;  2ZNM A;  4QL9 A;  3EUR A;  2R3X A;  3GH6 A;  4ML1 A;  2K18 A;  3ED3 A;  4O5Q A;  1SU9 A;  1OC3 A;  1VF3 A;  3H93 A;  4D73 B;  3Q6O A;  4KUN A;  5A5K A;  4Z7X A;  2KP2 A;  4ACS A;  3DD3 A;  1O73 A;  1LU4 A;  5DQY A;  2CZ3 A;  2HLS A;  2FWF A;  1USB A;  4IBP A;  1DE2 A;  3D21 A;  1I5G A;  1M2D A;  3FW2 A;  3P7X A;  3PIN A;  3HKR A;  4J56 E;  5CAX A;  1TKD B;  3KTL A;  2TRX A;  1GSS A;  2UZ8 A;  4BVY A;  4OO4 A;  5CRG A;  1XXU A;  5J9B A;  5CRD A;  2FGX A;  2RUF A;  4DSS A;  2BJX A;  4L5L A;  3ERW A;  5IMD A;  2OKA A;  2RM5 A;  3DXB A;  1U3I A;  2HZE A;  1Z6M A;  2DMM A;  2E7P A;  2YWO A;  5ECO B;  3TCO A;  1GUH A;  4POK A;  1U88 A;  3HY2 A;  1T3B A;  2OBI A;  4RI7 A;  1UA5 A;  4KDX A;  4ZB9 A;  2OBK A;  5DQS A;  1KBN A;  3GFK A;  1FG4 A;  1X9S B;  2R5G A;  4K5R A;  1FO5 A;  1A8Y A;  2I81 A;  1PKZ A;  4DVC A;  5ID2 A;  4N11 A;  1NM3 A;  2EIQ A;  1PA3 A;  2WFC A;  3P90 A;  1GLP A;  2LNT A;  2MBS A;  1GRX A;  1ZYP A;  1SJ6 A;  4XRA A;  2H1A A;  3GH9 A;  2AYT A;  1O81 A;  2B5Y A;  2A4V A;  3L78 A;  2BMX A;  3IV4 A;  1UC7 A;  4F9Z A;  3APQ A;  2WRT A;  3H4K A;  1RW1 A;  1XW9 A;  4MJE A;  1B4Q A;  5G30 A;  4HU7 A;  1MTC A;  3F4S A;  2WS2 A;  2WJU A;  4POB A;  1F3A A;  4F0B A;  1EV9 A;  4F03 A;  2DML A;  1OC9 A;  5ECK B;  1X5D A;  3N9J A;  2HT9 A;  2JZS A;  4RI6 A;  5ECM B;  1Z6N A;  2A2R A;  2VL3 A;  3HXS A;  4XS1 A;  1R26 A;  5H5S A;  1UN2 A;  2MYG A;  5IM9 A;  4GXZ A;  1GSE A;  4ZBB A;  3M3M A;  4GF0 A;  3H1N A;  4K2D A;  2R0C A;  4XTS A;  1HNA A;  3WYW A;  1NHO A;  18GS A;  3QPM A;  4CHS A;  1XW5 A;  5B6M A;  2LKU A;  2I1U A;  4K8M A;  3BJ5 A;  3Q74 A;  2A2P A;  5AIS A;  1OKT A;  2LJA A;  1SKS B;  4YKG A;  2CAI A;  4Z2U A;  3L9S A;  1G6Y A;  5DJM A;  4G10 A;  3UMA A;  4WBR D;  3F4R A;  2IMF A;  4NXI A;  3VWX A;  4AGS A;  1PL2 A;  3APO A;  2IME A;  4N0V A;  2H1D A;  1A23 A;  1K0A A;  4WBJ A;  2WDU A;  4CW9 A;  3TKS E;  4DEJ A;  3LQ7 A;  4IGJ A;  2MMA A;  4POM A;  3TRQ A;  1I9D A;  1NW2 A;  1VGL A;  4XHM A;  1YEP A;  2GSQ A;  3KP9 A;  2L4C A;  4QQ7 A;  1JLV A;  2YWI A;  4DSQ A;  3GMF A;  1S3A A;  1ZL9 A;  4XIH A;  2IIY A;  3GTU A;  3MIX A;  4KF9 A;  3VWV A;  4LMW A;  1T8E B;  1U6T A;  3L4N A;  1M0U A;  5CRW A;  2K9F A;  4ILF A;  1WOU A;  3HZ8 A;  1Q98 A;  4MMM A;  4PNF A;  3GV1 A;  2PGT A;  1PX6 A;  3A2X A;  3IHQ A;  1DBY A;  4D73 A;  2IMI A;  1GL8 A;  4PTS A;  1XPV A;  2C0G A;  4OFT A;  2MBT A;  3TRP A;  4NHZ A;  2L5L A;  4KDU A;  2LNS A;  4I97 A;  1WJK A;  5EY6 A;  4TXV A;  4KB3 A;  2OAC A;  1YF0 A;  4TR1 B;  2H0I A;  2TIR A;  2A2S A;  4MZC A;  2IY2 A;  4CDO A;  5H5R A;  1GSD A;  3V1W A;  1O8W A;  4YAP A;  3FR6 A;  4BVX A;  4HI7 A;  2QGV A;  2GVP A;  4LL4 B;  3R3E A;  2WB9 A;  3IE3 A;  1FAA A;  4ZB6 A;  3LXT A;  3F4T A;  3LOR A;  3EVI A;  4IP1 A;  2ES7 A;  3PGT A;  4V1A g;  1TXX A;  2CVK A;  3GKK A;  3ZLP A;  3C1S A;  2JSZ A;  3UJ1 A;  4GLT A;  1B8X A;  2DJ3 A;  1XZO A;  5DJL A;  3TKS A;  1YKC A;  3ZYW A;  3KCM A;  1PRX A;  3BD2 A;  3K8N A;  1BG5 A;  2R0G A;  3FKF A;  3W6G A;  5IQY A;  2LST A;  2P5R A;  5ECQ B;  1GNE A;  5DDL A;  5HQP A;  2L4Q A;  2V6K A;  2B6M A;  1EZK A;  2HFD A;  5J41 A;  4ZL8 A;  1YDK A;  4IQ1 A;  3KEB A;  4KX4 A;  2HSY A;  6GSY A;  1Z7P A;  3P8W A;  3KJY A;  2CVD A;  5FHI A;  3ZFB A;  3TUE A;  1LJR A;  2GT5 A;  2IMK A;  1OVN A;  3A5I A;  4TKY A;  1FVK A;  4MJC A;  3EU4 A;  3HJP A;  5AGY A;  3D6I A;  1SKW B;  2VM1 A;  3F0I A;  4ML6 A;  5G1K A;  2F51 A;  1K3Y A;  3F6F A;  2F8F A;  1GSF A;  1QFN A;  5F0G A;  1WRY A;  5ECN B;  3M9J A;  1GSY A;  5F05 A;  2H01 A;  4CY8 A;  2N5F A;  2NPB A;  1YQ1 A;  1T4Y A;  4BWQ A;  5L71 A;  1Z3E A;  2I4A A;  4EF0 A;  1GLQ A;  2XPD A;  3CSH A;  2MZC A;  3ZFL A;  3VK9 A;  4EUY A;  11GS A;  4KAE A;  5KOW A;  4FYB A;  1EEJ A;  1QUW A;  2E2M A;  4O92 A;  4L8E A;  4YAV A;  5G5F A;  4KSM A;  3HVX A;  2V32 A;  1E2Y A;  2PUK C;  2FLS A;  2JU5 A;  3DEX A;  3UOM A;  2V2G A;  4G9H A;  2VCV A;  4IKH A;  4BPY A;  4GQC A;  2IYJ A;  1C72 A;  4JZQ A;  2DC5 A;  3EC3 A;  3HJM A;  3MNG A;  1WWJ A;  3LFL A;  3LGC A;  2O87 A;  4HS1 A;  2KUC A;  20GS A;  2KHP A;  1M2A A;  4KCA A;  1PMT A;  2HSM A;  1OE8 A;  3IAM 2;  5GZZ B;  2HE3 A;  2H6Y A;  1ZCP A;  4Q5Q A;  4GTU A;  2N5B A;  1XIY A;  1X5E A;  3VPQ A;  4BL7 B;  2YZH A;  3NZN A;  5FWG A;  4K7O A;  2FWG A;  1ZOF A;  2AV4 A;  5HFK A;  1DSB A;  5D73 A;  5ABR A;  1S3D A;  2HRN A;  2HZF A;  4NHW A;  3C7M A;  5IPH A;  4H86 A;  2M46 A;  2H70 A;  2RLI A;  4MDC A;  3TOU A;  3FMW A;  4MZB A;  2GS3 A;  1AQX A;  3HZ4 A;  2FHE A;  3MWH A;  1TRV A;  4MCU A;  2X8H A;  2F3M A;  2H66 A;  2JZT A;  2LS5 A;  2CA8 A;  2N5A A;  1TU7 A;  3ZMK A;  2MMN A;  2GZP A;  1ON4 A;  1EP8 A;  1TJD A;  4HQZ A;  1K0C A;  3US3 A;  2C0F A;  3G7J A;  2YCD A;  2C3Q A;  3WT2 A;  1ZZY A;  5BMU A;  3CBU A;  2EIO A;  2VCT A;  3E0U A;  2HI7 A;  4ZBD A;  1TOF A;  1TRU A;  2TRC P;  4IHU A;  4TR1 A;  3TJJ A;  5GAN D;  3SBC A;  4E8H A;  1GNW A;  1SD9 A;  3WGX A;  2VOC A;  2GLR A;  1X9W B;  2A4H A;  1SJZ A;  3I6A A;  2LV3 A;  4HJM A;  5G31 A;  3BOA A;  4ECC A;  2QC7 A;  1ERU A;  3IAS 2;  16GS A;  1PQN A;  3KXO A;  5C00 A;  4PNG A;  1PSQ A;  2PVQ A;  5A4W A;  1AUC A;  3Q18 A;  1V9W A;  3CYN A;  4G0L A;  2KLX A;  7GSS A;  4TR3 A;  2GZZ A;  3CTG A;  4YQV A;  3GRX A;  1FOV A;  3DKS A;  2C0E A;  3ZML A;  3HHV A;  1H75 A;  5CYY A;  4ZXG A;  3WD6 A;  2VD0 A;  3A5W A;  5AN1 A;  1K0B A;  1X0R A;  3FZ5 A;  2X49 A;  3VI7 A;  2V1M A;  2AAW A;  19GS A;  4AJ8 A;  2H72 A;  1FVJ A;  3ZTL A;  2WGR A;  4A5P A;  1PL1 A;  2DJ2 A;  2FUG 2;  3IK7 A;  2B7J A;  5ENU A;  4ZIL A;  2H1G A;  2M80 A;  3GX0 A;  1WP0 A;  2YN1 A;  5KN3 A;  3EE2 A;  1XFL A;  4MF7 A;  1PX7 A;  1R5A A;  3D4M A;  1GSU A;  4HJ2 A;  2O85 A;  2QA2 A;  3I43 A;  4ZBA A;  2YNX A;  1F9M A;  3UIW A;  2PER A;  5IMF A;  3GUS A;  2C3T A;  4XS6 A;  1GTA A;  2GQL A;  1W4V A;  1QK8 A;  1A2J A;  1SYX A;  4YQM A;  1HYU A;  2ZUP A;  1GWC A;  5JCU A;  2DJ0 A;  4PQI A;  1AIU A;  3DIE A;  4I2T A;  2JL4 A;  3M0F A;  6GSU A;  2XC2 A;  3C1R A;  4O7H A;  5G2Z A;  2D2Z A;  1GTB A;  2VM2 A;  1TP9 A;  4EE0 A;  4PQH A;  5IOX A;  5CRE A;  4IJ3 A;  2DJK A;  3UAP A;  3LXZ A;  1PD2 1;  3RAZ A;  4PGT A;  1GUL A;  5J9C A;  3UEM A;  3IDV A;  4JRR A;  3JCM L;  1JZD A;  2C8U A;  1DUG A;  5HR2 A;  1YEX A;  3VPT A;  3F63 A;  4EDY A;  2R4V A;  4X43 A;  3W8J A;  2B1L A;  2B3S A;  2B7K A;  3M1G A;  1V98 A;  3EMX A;  1SK2 A;  4RQX A;  1V57 A;  1QQ2 A;  1F6M C;  4DSR A;  3ERG A;  4IS0 A;  3KGK A;  3RBT A;  3TKR A;  4GRF A;  3EMP A;  5DAK B;  4TOP A;  5LD0 A;  4NMU A;  1BED A;  3KMO A;  1PN9 A;  2QA1 A;  4NV5 A;  3F3Q A;  5G5E A;  5HR3 A;  4BL7 A;  5CO3 A;  4X0X A;  3QD9 A;  4HUA A;  3U6V A;  4G0K A;  1IYI A;  9GSS A;  2PU9 C;  5ECH B;  2NDO A;  4MPG A;  2DIY A;  2V41 A;  3D4T A;  3WGE A;  5H5Q A;  1CQH A;  4K6X A;  2HRF A;  5CP1 A;  2OJL A;  4WXT A;  4L5O A;  1UVZ A;  3EYT A;  4K9Z A;  2MMO A;  5A4V A;  2E0Q A;  3GUR A;  2CT6 A;  5D9W A;  5D9V A;  3M8N A;  4MJB A;  4PUR A;  3M9K A;  3FZA A;  4FO5 A;  1B9Y C;  2VAF A;  5G1L A;  2F9S A;  5F8B A;  3WGD A;  2VL2 C;  3IRA A;  3QOU A;  4XRD A;  6GSX A;  3EPT A;  4Z2R A;  3KZQ A;  3CSJ A;  2HXK A;  1AXD A;  1ERW A;  2O7K A;  2H6X A;  2H0H A;  2YAN A;  2M72 A;  4O5U A;  4EO3 A;  4NPB A;  4NAX A;  4TVE A;  3VLN A;  3FYG A;  1TI1 A;  2JAC A;  6GST A;  1AW9 A;  4JU5 A;  3MDK A;  4KE3 A;  1XW6 A;  3ZIJ A;  2KP1 A;  8GSS A;  4MP4 A;  4FQU A;  1KNG A;  1FB6 A;  3H79 A;  3DRN A;  1G6W A;  4G0I A;  1S3C A;  1VF2 A;  1ERT A;  2VCZ A;  3PPU A;  3QDN A;  3GIX A;  5A4U A;  4KCE A;  1BJX A;  3VI5 A;  5LNK e;  2XBQ A;  1E6B A;  4WF4 A;  3APS A;  3IR4 A;  3LWA A;  1EGR A;  2C1Y A;  4ECJ A;  2DKI A;  3FZ9 A;  3O3T A;  4MZW A;  1Z9H A;  1GTI A;  1YJ6 A;  4I6X A;  4LL1 B;  4PUA A;  5HR1 A;  3DGQ A;  3ME8 A;  3KH7 A;  3TOT A;  2HSH A;  2FD3 A;  2H30 A;  2XBI A;  1ZGN A;  3CRU A;  1AQV A;  2YV7 A;  3IA1 A;  2VLT A;  3HVS A;  3L0H A;  3P2A A;  4G19 A;  1M9A A;  4TR4 A;  3BCI A;  3UBK A;  5KOX A;  4GQF A;  4HU9 A;  1Z5Y E;  3IOS A;  1B4P A;  1K3L A;  3FHK A;  1U3A A;  1GUK A;  4OCE A;  4RUV A;  4KH7 A;  2JSY A;  1XCC A;  2X4A A;  4WET A;  2LRC A;  2B5E A;  1EGO A;  3UVT A;  2LUS A;  4OD7 A;  4EIQ A;  1MDJ A;  10GS A;  4GCI A;  4LMV A;  5JCG A;  2DIZ A;  3L9U A;  5DVB A;  2H71 A;  1A0R P;  2H19 A;  4OCF A;  1TK0 B;  3DWV A;  17GS A;  4TR0 A;  1J08 A;  4ECB A;  1G7O A;  1HNC A;  2L59 A;  3GN3 A;  4HQS A;  2LJK A;  1WIK A;  3BBY A;  2GT6 A;  4TXO B;  1AAZ A;  4HZ4 A;  1FOH A;  2K6V A;  3GHA A;  3E9J B;  4IJI A;  3LSZ A;  5INY A;  2DLX A;  2H76 A;  2HRK A;  5F06 A;  3CRT A;  5ECS A;  4Q5N A;  3GL3 A;  4KDY A;  4AF2 A;  5D8I A;  3F6D A;  3GA4 A;  3FZ4 A;  2QKE A;  2PMT A;  4IEL A;  1LBK A;  3QFA C;  3TKP A;  3HD5 A;  2CV4 A;  2X64 A;  4EKZ A;  2KOK A;  4KGI A;  4NWY A;  1F2E A;  4X1U A;  3C8E A;  3LEF A;  4HZ2 A;  5DAK A;  3VWW A;  2VCW A;  4EIP A;  3SWL A;  1SYR A;  1GUM A;  3UAR A;  3NOF A;  5IMZ A;  2H74 A;  1CQG A;  2K8S A;  1XBS A;  4ISD A;  1BQ7 A;  4V2M A;  3S9F A;  5IMA A;  2NTO A;  4ICY A;  4MNN A;  3AY8 A;  2EIR A;  4AJ6 A;  3RPP A;  5JCW A;  4OWY A;  3UBL A;  1ACV A;  5IOW A;  3A2V A;  4JR4 A;  3GYK A;  3MYD A;  1MEK A;  5D93 A;  2OAD A;  1SL2 B;  2ZCT A;  3FK8 A;  4HOJ A;  1A24 A;  1HNB A;  3IC8 A;  2WZ9 A;  4N30 A;  2GTU A;  2PWJ A;  3Q19 A;  2WCI A;  1MDI A;  5D9X A;  2J23 A;  4K0N A;  3QMX A;  1H4O A;  13GS A;  1IYH A;  1XVW A;  1W89 A;  3GNJ A;  3ME7 A;  5B7C A;  4K5S A;  2WUL A;  1ZYQ B;  2B1K A;  4LA1 A;  2FWE A;  5ECI B;  1K0M A;  2H0G A;  2H8L A;  3GL5 A;  5IIZ A;  2R0P A;  1OC8 A;  1SD8 A;  3TJB A;  1ERV A;  3GKM A;  2RUE A;  5JWR B;  1X9M B;  1GTU A;  2VCX A;  1T1V A;  5DCG A;  1XWG A;  3J7Y k;  2CVB A;  1RQM A;  3VFI A;  3ZZX A;  5J3R A;  3IHG A;  3IC4 A;  4TN8 A;  3HA9 A;  1TRW A;  3KH9 A;  1SL0 B;  3VUR A;  4OMV A;  3HCZ A;  3ZRE A;  2LRT A;  1M7T A;  1OYJ A;  4Z2T A;  2LQO A;  3HVV A;  2K8V A;  1EOH A;  4KW6 A;  2VCQ A;  3LYP A;  4HEA 2;  5DBQ A;  3RDW A;  5JWQ B;  3F9U A;  4K2X A;  2C0D A;  1R7H A;  3G7I A;  1XWB A;  4BVX B;  2E2G A;  1J9B A;  5ECL B;  1A0F A;  1OAZ A;  1T7P B;  3LJR A;  4J2F A;  5EPF A;  4E8E A;  3FEU A;  4JED A;  4WKW A;  4ULX A;  12GS A;  4EDZ A;  4ZL9 A;  3KMN A;  5HR0 A;  3IBH A;  4PX1 A;  4EL1 A;  4GSS A;  3KD0 A;  3GX8 A;  5ELG A;  1JLW A;  1ZYE A;  1SK0 A;  3ZIV A;  2MMZ A;  3GKN A;  1N8J A;  4N10 A;  3UL3 A;  2H73 A;  1F3B A;  3HDC A;  2O89 A;  2YJ7 A;  2R2J A;  4Q5F A;  3KTB A;  2GQK A;  2XPE A;  4G2E A;  3J7Y b;  2CQ9 A;  2AHE A;  2VD1 A;  4F2I A;  2I9H A;  4POL A;  2C4J A;  2FNO A;  2CAQ A;  2ON5 A;  4O5R A;  3FR3 A;  4I2U A;  4HDE A;  1OKD A;  4BWS A;  3O76 A;  2BTO T;  3LYK A;  1BYE A;  3IPZ A;  4TXO A;  1J0F A;  1JHB A;  3OR5 A;  1O6J A;  2OE0 A;  1XOA A;  5ECR B;  4K7N A;  1HQO A;  4X4J A;  2LQQ A;  3R2Q A;  3D22 A;  2REM A;  3RHC A;  4KND A;  1VF1 A;  3CMI A;  1BX9 A;  1M9B A;  2YJH A;  1SKR B;  5DCH A;  4QL7 A;  3ZVJ A;  3CTF A;  2CZ2 A;  3IK9 A;  3U5R E;  1SK1 A;  1R4W A;  1FHE A;  4YQU A;  3DML A;  3DVW A;  4F82 A;  2GSR A;  2QSI A;  1BAY A;  1QMV A;  1G0T A;  3F3R A;  4K7I A;  2EC4 A;  3RPN A;  2GST A;  2GGT A;  1K0D A;  4XS4 B;  4XCS A;  3TKQ A;  1MD4 A;  2IMD A;  4MPF A;  1ZYN A;  2Z9S A;  3EWL A;  3EIN A;  6GSS A;  14GS A;  1YF1 A;  4ZL7 A;  1TTZ A;  4MJA A;  1PKW A;  1TI3 A;  4OO5 A;  4EVM A;  3D5J A;  2G0F A;  5KN1 A;  2PPT A;  2JZR A;  1TK5 B;  3BCK A;  3WT1 A;  3H8Q A;  2CX4 A;  2HYX A;  3G7Y A;  4YKF A;  3PR8 A;  1JZR A;  2J9H A;  3FRC A;  4KSO A;  1K3O A;  5F07 A;  4PXO A;  4FYC A;  2IN3 A;  2YPM A;  2HRA A;  3KP8 A;  4MH3 A;  2ON7 A;  5COH A;  2FY6 A;  4K0G A;  1NHY A;  2VLU A;  3QAG A;  4FIW A;  2L6C A;  3KM6 A;  1AC1 A;  3ISO A;  3ZIT A;  2L6D A;  2FA8 A;  1ZMA A;  4IW9 A;  1B48 A;  3QAW A;  5KN0 A;  2IFQ B;  5D96 A;  2YWN A;  3TRX A;  3O6T A;  1YZX A;  1R5P A;  3DVX A;  4CY6 A;  3A3T A;  4O32 A;  2OE1 A;  1G7E A;  1M2B A;  2CX3 A;  2X8G A;  4ID0 A;  5B8A A;  2F8A A;  2YWM A;  1EP7 A;  4WEY A;  2LEG A;  3TKS C;  5DAL B;  5C04 A;  2OE3 A;  4MLY A;  1N2A A;  4V2L A;  5BRT A;  2GSS A;  3QCP A;  1QGV A;  3FR9 A;  3RHB A;  5JWO B;  4JBB A;  4IQA A;  1JFU A;  1V58 A;  2RM6 A;  3C73 A;  3MAK A;  3PH9 A;  2PVO C;  5AIX A;  2AUV A;  3TJK A;  3F8U A;  3VWU A;  4IP6 A;  5FT3 A;  4OFN A;  4MK3 A;  3DYR A;  2R37 A;  2VO4 A;  4MA9 A;  4EXJ A;  1AQW A;  5AIV A;  2IL3 A;  1Q4J A;  3G9B A;  1EOG A;  3NIV A;  5IO0 A;  1MDK A;  5B6N A;  3CSI A;  3CXG A;  2GQM A;  4BVY B;  2LTK A;  1A8L A;  2VL2 A;  4ZB8 A;  4DSS B;  1KTE A;  4WR4 A;  1ABA A;  4TW5 A;  3ZRD A;  2LRN A;  4N0Z A;  4JE1 A;  4IN0 A;  3GKX A;  2GDR A;  4YH2 A;  5IPG A;  3TGZ A;  4NV2 A;  2HZE B;  2YOI A;  1TRS A;  1TW9 A;  5GST A;  2O8V B;  4ZIJ A;  3UVH A;  1XOB A;  2P5Q A;  4WF5 A;  4BA7 A;  4PUF C;  4L0W A;  3TJF A;  3N5O A;  1VRS D;  1WMJ A;  3W8S A;  5IMC A;  4F0C A;  3GST A;  5E4W A;  4K1F A;  1THX A;  1T00 A;  1KEB A;  2C80 A;  5GSS A;  2DBC A;  2VUP A;  1GSQ A;  3LG6 A;  1GP1 A;  4PQ1 A;  5EVO A;  5KEJ A;  1K0N A;  2FWH A;  2DJJ A;  5EL8 A;  2YV9 A;  3TJG A;  1ML6 A;  1O85 A;  5ID2 B;  2P0G A;  4GWR A;  3QAV A;  1ST9 A;  1B9X C;  5B8B A;  1A2L A;  3ZL5 A;  2I3Y A;  1URM A;  3I9V 2;  1WPI A;  4L0U A;  1GH2 A;  4ECI A;  6GSV A;  1XVQ A;  1VF4 A;  2X99 A;  1YY7 A;  1SL1 B;  4GSN A;  5J5N A;  1TU8 A;  1M99 A;  1U87 A;  2YZU A;  2ALB A;  3MSZ A;  2NBS A;  1HD2 A;  4TRX A;  1TDI A;  2B5X A;  5J4U A;  2OA7 A;  1EEM A;  2H6Z A;  1OC9 B;  3FY7 A;  3HYP A;  3I69 A;  4J57 E;  5LCZ A;  4MH2 A;  4V1A p;  2JAD A;  1SEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...