2H0IA

Crystal structure of dsbg v216m mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAMGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 65
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0iA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0iA02
2B6MA 4G19A 3WT1A 3ED3A 1G0TA 2LUSA 1Z5YE 2OADA 2YV7A 1HNAA 3KMOA 5G1LA 2KOKA 3HDCA 4I5QA 1F2EA 1FW1A 2YJ7A 3QOUA 2YWOA 3GV1A 3GSSA 4MJCA 1VF4A 1SYXA 3HKRA 2H1GA 4E8EA 1ZYEA 3BD2A 2GSSA 1OE8A 3ZLPA 5ECIB 2N5FA 2ZUPA 4K7OA 5ECKB 1TK8B 1K3YA 3HZ4A 2LRTA 3ZRDA 3IR4A 1V98A 1TU8A 3APQA 3GYKA 2DSAA 1V9WA 2LV3A 5DVBA 1GSSA 2RUFA 4ZXGA 4G2EA 1XXUA 1XWKA 3LGCA 4OO5A 3HZ8A 2VCZA 3C1RA 1F3AA 1X9SB 4WEYA 1TDIA 3TCOA 3IC4A 4HZ2A 1T7PB 5D8IA 4KW6A 2X64A 4K0GA 2DMMA 4IBPA 3FK8A 2B5YA 4BWQA 2CT6A 5D96A 8GSSA 3G7IA 1M9AA 3AY8A 4WF4A 3C73A 2P0GA 3L0HA 1YKCA 4GQFA 5CP1A 3FYGA 3QAVA 5A4UA 5KN2A 1SYRA 3FRCA 2N5BA 4POMA 4F03A 4PNFA 1XW9A 3LSZA 2VL9A 1G7EA 2V6KA 1TRWA 2ES7A 1WPIA 3D0ZA 1F9MA 1SL0B 2AJQB 4WBRD 2HZEB 3FR3A 3GMFA 4N10A 1BAYA 2C0GA 5HR0A 2DIYA 2ZNMA 4LMVA 2X8GA 4K6XA 5B8AA 1DE1A 3LQ7A 1PKZA 3TUEA 4X0XA 4IP6A 4DSSA 2PVQA 2L6DA 3O76A 2H6YA 2NDOA 2PWJA 1PQNA 4I97A 1JHBA 3H4KA 3M3MA 2EIQA 3UL3A 1T1VA 2R37A 3CYNA 5GAND 1FAAA 4MH2A 4Q5NA 5ENUA 4EKZA 3IPZA 4MJAA 2GTUA 1ZL9A 5DALA 1PRXA 2OA7A 3MDKA 3C7MA 2I1UA 4X43A 4LL4B 2WULA 3I6AA 6GSSA 3LEFA 1AUCA 2K18A 3ZTLA 4FYBA 1OAZA 3WT2A 3MWHA 1W89A 1EOGA 2P5QA 1O6JA 3GH9A 5IO2A 4OD7A 2VM2A 3ERGA 2H0GA 2TRXA 1TW9A 3OR5A 1H75A 5J5NA 3MNGA 2R6KA 2L5OA 4IS0A 5J9CA 2LNTA 1XW5A 4O92A 1X0RA 2CZ2A 3EVIA 3HJPA 3RHCA 4N30A 3TKSA 3HHVA 3SBCA 1DE2A 4DSRA 3GNJA 1JFUA 1EZKA 2O8VB 4IW9A 5C00A 3EU4A 1U6TA 5J4UA 1M0UA 2H1AA 2ALBA 3C1SA 3H93A 5ECNB 4MK3A 3GKKA 1WRYA 1VGLA 5G2ZA 5IMVA 1EV4A 3FZ4A 11GSA 3LYPA 1QMVA 4PQ1A 1GL8A 4IQ1A 3VURA 1SD8A 5G1KA 4GRFA 2NVLA 1PL1A 1SL1B 4RI6A 2DJ3A 3FZ5A 1YY7A 1JZDA 3Q18A 4BL7A 5IOXA 2PBJA 2VCXA 1YQ1A 3D22A 1S3DA 2WCIA 2H19A 3U6VA 2O87A 5AGYA 5JWRB 1R4WA 2Z9SA 1FVJA 2L6CA 2DMLA 3GFKA 2B7JA 2IMEA 5IPHA 4KB3A 4PGTA 4ML6A 1GTUA 4JRRA 1EEJA 1ILOA 2XC2A 4EVMA 4WXTA 3BCIA 1GLQA 4G9HA 3UVHA 2MMZA 5F05A 4E8HA 2B5EA 1ERVA 1U88A 2LJKA 4ILFA 3EMPA 5CRHA 1R7HA 1YDKA 2IPAA 2VM1A 1IYIA 1XCCA 4XRDA 2RIIA 4IP1A 2H70A 3FKFA 3IK7A 1AQXA 1SU9A 3MAKA 4J57E 3KIJA 3IBHA 3LFLA 2PPTA 1K0BA 2MMNA 2D2ZA 2VLTA 2YPMA 2H73A 5DCHA 2WJUA 1O8XA 4GWRA 5JCGA 2F3MA 2HNLA 2LTKA 4BVXA 4LL1B 4HJ2A 5H5QA 2C4JA 1T4YA 2ON7A 2XPEA 5LCZA 3DMLA 2L5LA 4RUVA 4JE1A 5ELGA 4ZB8A 4FYUA 4MZWA 3GKXA 2VCWA 3WGDA 2QC7A 1AQVA 3FEUA 3CXGA 20GSA 2R3XA 3G7JA 2V1MA 1V2AA 4Z7XA 1OC8A 5CAXA 4FYCA 5DBQA 3D5JA 3L9SA 3GIXA 1M2DA 3Q74A 3VI5A 2C0DA 2RM5A 3F3QA 3H1NA 1YKAA 1K0CA 4KDXA 2R4VA 4EE0A 1PD21 1VRSD 2VCTA 2FD3A 2FUG2 2AB6A 1QK8A 3GSTA 1JLWA 5IMAA 1Z6NA 3F9UA 2DLXA 2VLUA 1OC3A 1QQ2A 3ZFLA 1RQMA 1VF1A 3VPTA 4MF5A 3M9JA 3GKMA 2YWIA 1ERUA 4O32A 1VF2A 3HA9A 1XVWA 2L4QA 4QQ7A 3P2AA 2X8CA 2B7KA 5JWOB 3TJFA 3E0UA 3SWLA 1EOHA 2YOIA 3QMXA 5IPGA 4KGIA 1I9DA 1KNGA 1PGTA 2IY2A 2VOCA 3PGTA 4JU5A 3E9JB 1PN9A 2HLSA 4POBA 4CDOA 4BPYA 4EF0A 4RQRA 3IE3A 1BX9A 3FZAA 1GUMA 4WR5A 3ZIVA 1SJZA 1GLPA 3UBLA 3CSJA 5IMCA 3H79A 3IA1A 2C80A 2VL2C 1ML6A 3UARA 1SD9A 2CVBA 6GSYA 5GZZB 1K0MA 3EE2A 4QL7A 2XPDA 4O7HA 6GSVA 1XVQA 5EL8A 1TOFA 1PKWA 4JZQA 2YN1A 4BA7A 2F51A 1FOVA 1NSWA 1B4QA 2MBSA 1N8JA 2CAQA 4TR1A 3A5WA 6GSUA 2IFQA 5ELAA 4ZIJA 2REMA 2FA4A 3QDNA 3EU3A 5HR1A 3KM6A 2C0EA 4TVEA 2IWTA 10GSA 2PERA 1TXXA 4TR0A 1WMJA 3KEBA 1V40A 1XBSA 4WR4A 4KX4A 4BWSA 5J3RA 3CTGA 1TK0B 4F9ZA 1KBNA 1LU4A 5IO0A 5D73A 3TKPA 2GQMA 4ZBAA 1PA3A 2OE3A 3KH9A 4AJ6A 3D21A 2VD0A 2OKAA 2K6VA 3Q6OA 4D73A 3QFAC 3QD9A 4FO5A 5GSSA 1UA5A 4QL9A 2VO4A 4Q5FA 4PQIA 1TJDA 4XHMA 2VIMA 2IMIA 3DGQA 3M8NA 4NHWA 2B1LA 1O7UA 2DJ2A 3P7XA 3A2VA 5DQYA 4WKWA 1TI1A 4IHUA 3DVWA 4NWYA 2PU9C 2K9FA 3EURA 4IELA 3ZYWA 1Y6EA 5J9BA 4MDCA 5FT3A 4YQUA 2QSIA 5JCUA 3ZL5A 2GZZA 3EC3A 3TRQA 1OE7A 4J2FA 4PX1A 4V1Ag 5AIVA 4L5LA 1ZZYA 1X5EA 1NW2A 1XWAA 4NXIA 2P31A 3FY7A 2NTOA 4JEDA 3NZNA 4TR3A 3TOTA 2A2SA 2I9HA 2GSQA 1XWBA 2HSYA 5ECRB 3LXTA 3TOUA 4K8MA 4F82A 4JBBA 2OACA 1IYHA 6GSWA 2X8HA 2LSTA 3WGEA 1XW6A 2A2RA 3RBTA 1QGVA 2WDUA 3QFBC 3NOFA 5ECMB 2IN3A 4I8BA 3DVXA 4TOPA 13GSA 4FIWA 3F4RA 1Q98A 1GTBA 4ZBDA 2KUCA 1M7TA 5COHA 22GSA 2C8UA 3S9FA 4AGSA 1OKTA 2XHFA 4OFTA 1B8XA 3VPQA 2HI7A 4MF7A 4ZL9A 3KCMA 1GUKA 2LJRA 5A4WA 1FO5A 1S3CA 5G5EA 4PUFC 4JR4A 2VLVA 5LNKe 1AAZA 3A3TA 1K0AA 3M9KA 3L4NA 2CVDA 4NAXA 3ISOA 2LKUA 2JADA 3GX8A 1AXDA 4GTUA 1J08A 2E2GA 1YEXA 4TXVA 3C8EA 1A8LA 1OVNA 4V2MA 4LA1A 1OYJA 4K0NA 2YANA 3LYKA 4TKYA 3GURA 2NPBA 1MEKA 3VI7A 3HD5A 2KLXA 3F0IA 4OWYA 4OFNA 1B9XC 2AUVA 2GT5A 3GRXA 1GSDA 4L5OA 4EXJA 1AQWA 1T00A 5ABRA 4K7IA 3ZVJA 2FNOA 2FWFA 2LQQA 1PX6A 4MZCA 2H76A 3KTBA 1FG4A 1GH2A 3GTUB 4HQZA 2O89A 4L8EA 1B48A 4TN8A 2L4CA 1YF1A 1A0FA 5F0GA 5HFKA 1EWXA 4YQVA 3W6GA 1ZMAA 4TR1B 2IJYA 1K0NA 1F37A 2EC4A 1DUGA 3EMXA 2WRTA 2YJHA 1GTAA 2G0FA 1GULA 3O3TA 2YZUA 1TRVA 5E59A 3PR8A 4IVFA 2MZCA 4K2DA 2AHEA 9GSSA 1QUWA 2FLSA 4N0VA 2H0HA 1HNCA 3WD6A 4HZ4A 3KMNA 1B9YC 5CREA 3HJOA 4YH2A 1AC1A 3CRTA 2TIRA 1F6MC 4F2IA 3ZMLA 12GSA 3RDWA 5HFGA 2H01A 2OBIA 3IAM2 3J7Yk 3KGKA 3KJYA 3GKNA 2LJAA 3ZITA 1SKWB 3A2WA 1EGRA 5EPFA 2H72A 2FWGA 5DJLA 5CYYA 2OE0A 1MD3A 4EUYA 2DBCA 5JCWA 3DXBA 3V1WA 4WF5A 4POLA 2LNSA 3W8JA 2JU5A 3LG6A 1SL2B 2GZPA 2YP6A 4YQMA 3VLNA 1R26A 1Z3EA 5HQPA 4I6XA 3CSIA 2B5XA 3IK9A 4KA0A 1MTCA 4V1Ap 1DSBA 1ZGNA 1H4OA 1BYEA 4GQCA 2V32A 2EIOA 7GSSA 4HUAA 2YWMA 2IMDA 4ULXA 4PUAA 3UAPA 1BJXA 1ERWA 1MDIA 5D93A 1USBA 1THOA 5C04A 1KEBA 4OMVA 5A4VA 4HQSA 3FR9A 3N9JA 3G7YA 1GSEA 1N2AA 2GSRA 2I4AA 5B6MA 2OBKA 19GSA 1WJKA 5ECQB 4XS1A 5CRGA 4V2NA 1K3OA 1E6BA 3IOSA 4DSSB 2CVKA 4GSSA 1NHOA 2VAFA 4RQXA 1WIKA 2ON5A 3FW2A 2FGXA 2CZ3A 3GH6A 3WGXA 4KAEA 3US3A 2WB9A 4ECCA 2H74A 4IJIA 5ID2A 4TRXA 2I3YA 2P5RA 2V6OA 2H6ZA 5CRDA 4EDZA 2XBIA 2QGVA 1YEPA 4OO4A 4XS4A 3VWWA 3UIWA 5CNWA 1TU7A 4AJ7A 4LLRA 4IQAA 2B3SA 2F8AA 1HD2A 2HXKA 2IIYA 3Q19A 3DD3A 3GUSA 4MABA 2WZ9A 5DALB 1RK4A 4HEA2 2HZEA 5IM9A 1MD4A 1NHYA 3TB2A 3KH7A 4GCIA 1OKDA 1GSUA 2M72A 1T3BA 3ZMKA 3L9UA 3GA4A 4KCEA 4XRAA 3TJKA 5J41A 2GQLA 1XOAA 5KN3A 3BCKA 1RW1A 1EEMA 3VWUA 4AF2A 4DSQA 1M2BA 3QR6A 1EP8A 3W8SA 1TRUA 1JZWA 1S3AA 3D6IA 5KN0A 1HNBA 1ON4A 2KHPA 2CX4A 3ERFA 2FWHA 4Q5QA 4CW9A 3DIEA 1UN2A 1THXA 2H71A 5ECPB 3I9V2 1K0DA 2CAIA 4ZB6A 5HFIA 4KDYA 6GSXA 3UBKA 3I43A 1O8WA 3F4SA 4HI7A 4ZILA 5LD0A 4MF6A 1T4ZA 1F3BA 5F07A 1ST9A 1A2MA 2HZFA 4FH8A 1PMTA 4L0UA 3BOAA 1O81A 3UVTA 2JZTA 1M9BA 3I69A 1O73A 2F9SA 3UMAA 3IV4A 3HVVA 3ZREA 1WE0A 1ABAA 1GRXA 1XZOA 2WGRA 4ACSA 3O6TA 5D9TA 1EGOA 2X99A 3M0FA 2E7PA 5D9XA 2R2JA 2RM6A 5ECSA 2OJLA 1WOUA 1A0RP 1X5DA 2FHEA 3KP8A 16GSA 4N0ZA 2IYJA 3DRNA 3TKSC 1JZRA 2GT6A 5AN1A 2L59A 3RPNA 1XWGA 2C1YA 4O5RA 4ECIA 2H8LA 2XBQA 1SK0A 5IMDA 1JLVA 1FHEA 2H1DA 5H5RA 2E2MA 3APSA 2YWNA 2H30A 2GGTA 3L78A 4CHSA 4GXZA 4ID0A 3A2XA 3LJRA 1PSQA 3TKQA 3VWVA 2FWEA 2MMOA 1B4PA 2YCDA 4LMWA 1PL2A 2IL3A 3DEXA 1WWJA 2CA8A 5CRWA 2DC5A 1UVZA 1VF3A 3IRAA 5HR3A 3GL5A 1OC9A 4DVCA 2LRNA 1HQOA 5GAPD 2YZHA 4X1UA 14GSA 4GLTA 1X5CA 1M2AA 1SKRB 3K8NA 5D9VA 2GVPA 1Q4JA 5H5SA 4TW5A 1K0OA 3KTLA 1XIYA 5D9WA 4ML1A 3TJJA 1ZCPA 4ZBBA 2LEGA 1GSFA 1URMA 3E3EA 2JZRA 2LRCA 4XS6A 4J56E 5ECLB 4KDUA 4YAVA 5F06A 4KE3A 4IN0A 1GNEA 2BJXA 1U3IA 2LQOA 3M1GA 4HJMA 3GHAA 4WBJA 5G5FA 5AISA 1BQ7A 2AV4A 1YF0A 1EP7A 2PGTA 4KUNA 1LBKA 5DAKA 5ID2B 18GSA 5IMFA 1XPVA 5INYA 4K7NA 2KP2A 2J23A 3PINA 4TXOA 4RI7A 1SK1A 3QPMA 3TRPA 4NPBA 4XS4B 1DBYA 1A23A 4MP4A 2FA8A 2K8SA 2V2GA 4P3YB 1GUHA 2YNXA 4TR4A 2DJ1A 1XOBA 3ME7A 2BTOT 4NV5A 5JWQB 3LXZA 4PQHA 4XTSA 3HJMA 2VD1A 3IDVA 4V2LA 4K9ZA 2V41A 3R2QA 2WFCA 2DJKA 5EY6A 3TRXA 3F3RA 3KZQA 1AW9A 5KEJA 4HU9A 1SJIA 4MJEA 4ECBA 1A2LA 2JSYA 1J9BA 3FHKA 4F0BA 2I81A 17GSA 3JCML 1M99A 3ZVJD 3G9BA 4HDEA 3BJ5A 3D4MA 1CQGA 2RLIA 4HOJA 1HYUA 1WP0A 1U87A 1SKSB 2JACA 1EV9A 2VL2A 2JSZA 1BEDA 5F8BA 3MSZA 1BG5A 4PNGA 3ZIJA 1A24A 2PN8A 5AIXA 3P8WA 2B1KA 5KN1A 3ERWA 4MLYA 2DJJA 4L0WA 2PVOC 1MDKA 5A5KA 4EC0A 1W4VA 3F4TA 2QKEA 2IFQB 1Z9HA 5B6NA 1TP9A 3QAGA 3DKSA 1X9WB 1ZYQB 3PH9A 3LORA 2FCHA 4ZL8A 1I5GA 3CSHA 3QCPA 4EDYA 3EWLA 2H75A 1ZOFA 1Z7RA 2H1BA 3BBYA 2VUPA 2GDRA 2KP1A 5IMZA 3RAZA 1G6WA 3TKRA 2N5AA 4H86A 5DCGA 4GSTA 2M80A 5B7CA 4IJ3A 1GTIA 5DQSA 6GSTA 1X9MB 1O85A 5FHIA 1TTZA 4IKHA 3LWAA 4D73B 1E2YA 1OC9B 1FB0A 1G7OA 3CRUA 4NHZA 2FY6A 4N11A 2MYGA 3UEMA 2JL4A 2MBTA 3C71A 3L9VA 3IHQA 1UC7A 1K3LA 3N5OA 3HXSA 3NIVA 4MPFA 2HSHA 5DJMA 2RUEA 3P90A 1V57A 2H66A 1V58A 1LJRA 1SENA 2OE1A 3RPPA 3F8UA 1SK2A 2WS2A 2IMKA 1GWCA 5IIZA 3F6DA 2E0QA 3F6FA 2C3QA 5HR2A 3DYRA 1YJ6A 3VWXA 3EINA 2H0IA 2C0FA 3RHBA 1FB6A 1U3AA 1FVKA 1JZOA 1C72A 4MMMA 4OCEA 1T8EB 4I2UA 2H6XA 2O7KA 3TJBA 3VK9A 3FZ9A 1AIUA 2HRFA 2CV4A 2GSTA 1R5AA 1TKDB 5DAKB 3HY2A 4F0CA 2A4VA 1GSYA 4TXOB 3J7Yb 5ECOB 1QXHA 2PMTA 3GL3A 3KXOA 5E4WA 1A8YA 2M46A 3D4TA 3TDGA 4GSNA 2NBSA 3KD0A 3APOA 5IQYA 2CQ9A 2BMXA 1MDJA 3DWVA 2C3TA 2JZSA 2ZCTA 2GS3A 4I2TA 4NV2A 5DDLA 3CBUA 1ACVA 5CO3A 4MPGA 3QAWA 5IOWA 1TRSA 3HVXA 2HYXA 2MMAA 2YV9A 4EL1A 1A2JA 2PUKC 3TGZA 1YZXA 1R5PA 3FR6A 5EVOA 4EO3A 3CMIA 4MZBA 4YAPA 4OCFA 4NMUA 4KCAA 2HT9A 1KTEA 1Z6MA 4KH7A 2EIRA 2GQKA 5B8BA 4G10A 1GNWA 3H8QA 3VFIA 3HCZA 4AJ8A 5ECHB 2IMFA 4DEJA 1ERTA 3HYPA 3GN3A 4BVYA 2CX3A 4HU7A 3IAS2 2O85A 3WYWA 1XFLA 4MJBA 1GP1A 4KSOA 3F63A 5G30A 4XCSA 5FWGA 2VL3A 3GX0A 2DJ0A 4MCUA 4PURA 3ME8A 2F8FA 4KNDA 4ISDA 3EYTA 4WETA 2TRCP 2K8VA 3KP9A 3UJ1A 1Z7PA 2L57A 4POKA 1QFNA 5GSTA 1TK5B 4ZL7A 5L71A 4GF0A 1G6YA 4Q5RA 3UOMA 2HRNA 3TJGA 3CTFA 1TI3A 3ZZXA 1SJ6A 1NM3A 2C3NA 4K1FA 5G31A 4JR6A 1XWCA 2GLRA 3TKSE 3U5RE 4XIHA 4MA9A 4ECJA 4OFMA 3IXRA 4KSMA 4MH3A 2DIZA 4IGJA 3HVSA 2LS5A 2AYTA 1J0FA 2HFDA 2J9HA 1CQHA 2AAWA 3ZFBA 4PXOA 2R5GA 4HS1A 2VCVA 3GTUA 2HE3A 2GZYA 4ZB9A 1GSQA 2VCQA 1PX7A 2G2QA 1Y25A
chains in the Genus database with same CATH superfamily
2B6MA 4G19A 3WT1A 3ED3A 1G0TA 3LT8A 2LUSA 1Z5YE 1Y4KA 2OCTA 2OADA 2YV7A 4PTSA 1HNAA 3KMOA 5G1LA 2KOKA 1UCLA 4I5QA 3HDCA 2LQVA 1F2EA 3KIIA 1FW1A 2YJ7A 1FYSA 5KP3A 3QOUA 2YWOA 3GV1A 3GSSA 5LC7A 4MJCA 1OPYA 1VF4A 1SYXA 1TU5A 3HKRA 2H1GA 1BOXA 3KCHA 1A90A 4E8EA 1ZYEA 4MMZB 1NU3A 3BD2A 1TFOA 2GSSA 1OE8A 3ZLPA 5ECIB 2N5FA 3RGAA 2ZUPA 5TGNA 2W04A 2YFLB 2HRKA 1RRHA 4K7OA 3PPUA 5ECKB 1TK8B 1K3YA 1PFPA 5FGOA 3HZ4A 1BRSA 2LRTA 1FGRA 3ZRDA 3IR4A 1CH0A 4XBTA 4N6TA 1V98A 1TU8A 3APQA 3GYKA 2DSAA 1ULIB 1V9WA 2LV3A 5DVBA 1GSSA 4CPKA 2RUFA 4ZXGA 4G2EA 1XXUA 1XWKA 3LGCA 4OO5A 1GY6A 3FGYA 2QEX3 3LYGA 3HZ8A 2VCZA 3LMLA 2L1SA 3C1RA 1F3AA 1X9SB 1MWTA 4WEYA 1RGAA 1TDIA 3TCOA 5EQLA 1BANA 3IC4A 4HZ2A 1T7PB 3B4PA 2ZL8A 4X4JA 3FKAA 5D8IA 4KW6A 4XB5A 2X64A 5AYRB 4MEIA 4K0GA 1RN7A 2AADA 2DMMA 4IBPA 3FK8A 2B5YA 5KOXA 4BWQA 2OWPA 2QA43 3Q3FA 4BIRA 2CT6A 5D96A 8GSSA 4WFOA 3G7IA 1M9AA 3AY8A 4WF4A 3C73A 2P0GA 3L0HA 1IQ8A 1YKCA 2WGQA 3DUKA 4GQFA 5CP1A 3T8NA 3FYGA 3QAVA 3BNEA 5A4UA 5KN2A 1SYRA 3UJMA 3SYUA 3O8YA 3FRCA 4O5QA 3U1WA 2N5BA 4POMA 1Q864 5IEOA 4F03A 2P38A 3D5IA 4J5KA 1XW9A 2A15A 4PNFA 3LSZA 2VL9A 1G7EA 2V6KA 1TRWA 2ES7A 1WPIA 3D0ZA 5D81A 1F9MA 1SL0B 2AJQB 1OHOA 4WBRD 1IQYA 4XDWA 2HZEB 3FR3A 3GMFA 4N10A 1BAYA 2C0GA 5HR0A 2DIYA 2ZNMA 4LMVA 2X8GA 4K6XA 5B8AA 1DE1A 2L4VA 3LQ7A 1JJ22 1KD14 2CWVA 2OQEC 1PKZA 3TUEA 4X0XA 2KF6A 4BVYB 4IP6A 3FG1A 4DSSA 2PVQA 2L6DA 3O76A 1GMPA 1BRIA 3U97A 5AIGA 1B27A 3GAXA 2H6YA 1FGTA 2NDOA 2PWJA 1CQSA 5G2GA 1K734 1PQNA 3S67A 1JN5A 4I97A 1JHBA 3H4KA 2P05A 3M3MA 2EIQA 2FXTA 3UL3A 1T1VA 1MWSA 1IV7A 5BXQA 2R37A 3CYNA 3LTBA 3DGNA 5GAND 2XFSA 1FAAA 4MH2A 2CG1A 3Q1CA 4OVMA 2HMKB 4Q5NA 1Q42A 1O7WB 1IU7A 3AHWA 5ENUA 4EKZA 2WOHA 3KKGA 3CCJ3 1A67A 1EQKA 2OTL3 3IPZA 4MJAA 2GTUA 1ZL9A 5DALA 3FZWA 1PRXA 2OA7A 3MDKA 3DH2A 3C7MA 2I1UA 4X43A 3Q2PA 4LL4B 2WULA 3I6AA 2F56A 6GSSA 3K0ZA 1AUCA 2K18A 3LEFA 3ZTLA 2O9UX 4FYBA 3AMOA 5JPPA 1OAZA 1R4YA 3WT2A 3L0RA 3MWHA 1W89A 1EOGA 2P5QA 5CK6A 1O6JA 1D6YA 3GH9A 5IO2A 3MIXA 3WA3A 4OD7A 2VM2A 3ER7A 3GZRA 3ERGA 2H0GA 3BB9A 2TRXA 1TW9A 3OR5A 4EBGA 3VSYA 1GY5A 4BL2A 1H75A 5J5NA 3MNGA 2R6KA 3HIGA 2L5OA 4IS0A 3AHSA 1X1UA 2LNTA 5J9CA 1XW5A 4O92A 1X0RA 2CZ2A 3EVIA 3HJPA 1RMSA 3RHCA 4N30A 3TKSA 3HHVA 3QRDA 4N6NB 3JUMA 3SBCA 1DE2A 4DSRA 5EVHA 3GNJA 1JFUA 1EZKA 2O8VB 4IW9A 5C00A 3EU4A 4WYKB 1BSBA 1U6TA 1W00A 4NHFA 5J4UA 1M0UA 2AAEA 2H1AA 2ALBA 3C1SA 3H93A 5KP1A 4I4KA 5ECNB 4MK3A 1UI8A 3GKKA 1WRYA 3UL5A 1VGLA 4KT3B 5G2ZA 5IMVA 1EV4A 3FZ4A 2JDIH 2XH9A 3EBTA 11GSA 3LYPA 1QMVA 3PCSA 4PQ1A 1GL8A 4IQ1A 3VURA 1UGHI 1SD8A 5G1KA 4Q53A 4GRFA 2NVLA 1PL1A 1LOYA 3MKIA 4N6MA 3CCL3 1W01A 1SL1B 4RI6A 2DJ3A 3MYTA 4FMDA 3FZ5A 2CKFB 4H3UA 1YY7A 2SARA 1JZDA 1LVNA 3Q18A 2BIRA 4BL7A 5IOXA 1RN4A 2PBJA 2VCXA 1YQ1A 3D22A 1S3DA 2WCIA 2H19A 1JV2B 3U6VA 2O87A 5AGYA 5JWRB 1R4WA 2Z9SA 1FVJA 1RGLA 2MC8A 3ECFA 2L6CA 1YVBI 3GWRA 2DMLA 3GFKA 1D6UA 2B7JA 1QALA 2IMEA 1UUVB 2GSPA 1X1XA 5IPHA 4KB3A 4PGTA 4ML6A 1GTUA 4JRRA 1EEJA 3FG3A 1ILOA 2XC2A 4EVMA 1M1XB 1BIRA 4WXTA 3BCIA 4GB5A 1GLQA 4G9HA 3UVHA 2W03A 2MMZA 5F05A 4R9KA 2ML5A 1GSPA 4E8HA 2B5EA 1ERVA 1DMMA 1M9GA 1U88A 2LJKA 4ILFA 3KSPA 3EMPA 3PS8A 5CRHA 1R7HA 1E97A 1YDKA 3RDEA 2IPAA 2VM1A 4HBRA 4XM4A 1IYIA 4R4KA 1XCCA 4XRDA 1A2KA 3GRDA 2RIIA 2P0MA 4IP1A 4O02B 5CXOA 2H70A 3FKFA 4PEJA 1U5OA 4FCMA 3IK7A 4LEHA 1AQXA 1SU9A 2YX9A 3HK4A 3MAKA 4J57E 3KIJA 3IBHA 1VQ43 3LFLA 2W9PA 2PPTA 1K0BA 2MMNA 2D2ZA 2VLTA 3S28A 3PCRA 2YPMA 4RZMA 2H73A 4MJDA 5DCHA 1VQL3 1RSNA 2WJUA 3B8LA 5BU4A 4R1KA 1O8XA 4GWRA 5JCGA 1BNGA 2F3MA 3OV4A 3X3YA 2HNLA 3WDGB 2LTKA 2W2CA 4BVXA 5IEPA 4LL1B 1BNRA 1YJN3 3EPTA 4HJ2A 5H5QA 2CFLA 2C4JA 1T4YA 2ON7A 2XPEA 5LCZA 3DMLA 1UDII 2L5LA 4RUVA 1IQXA 4JE1A 5ELGA 4ZB8A 4FYUA 4MZWA 3CC23 3GKXA 5D83A 2VCWA 3WGDA 3NQZA 2QC7A 1RKYA 1W2ZA 1AQVA 3FEUA 2KF3A 1WQLB 1SQWA 3CXGA 20GSA 5STDA 2R3XA 3G7JA 2V1MA 1V2AA 4Z7XA 4WP5A 1OC8A 3M8CA 5CAXA 4FYCA 5DBQA 2CHCA 2XSHB 1GD4A 3D5JA 3L9SA 3GIXA 1M2DA 3E99A 3Q74A 1RGEA 3VI5A 2C0DA 1GOYA 2RM5A 3F3QA 4EW5A 3KFQC 3H1NA 1YKAA 3ALAA 1GOUA 2GXFA 1K0CA 4KDXA 3BNDA 4QWTA 2R4VA 1PD21 4EE0A 1VRSD 5FW5A 2VCTA 1IK3A 2FD3A 2FUG2 2AB6A 1QK8A 3GSTA 1RN1A 1JLWA 1YIJ3 3NQYA 5IMAA 1DMNA 1Z6NA 3F9UA 2DLXA 2VLUA 1OC3A 1NWWA 1QQ2A 2CC3A 4N3VA 2YFJB 3ZFLA 1RQMA 1VF1A 4L7KA 3VPTA 4MF5A 3M9JA 2I9WA 3GKMA 2YWIA 1WNHA 1ERUA 1DVDA 1UCIA 2OTJ3 4O32A 3K5TA 1VQ73 1VF2A 3HA9A 1JB4A 1IDPA 1XVWA 3GZBA 3JVCA 1SIHA 3K7CA 2L4QA 4QQ7A 3P2AA 2X8CA 1N9JA 4G0LA 4XBYA 2CG0A 2B7KA 5JWOB 3TJFA 3E0UA 3SWLA 1EOHA 2YOIA 3QMXA 5IPGA 3EQQB 1ISKA 4KGIA 1X1YA 1I9DA 1KNGA 1PGTA 1RDSA 1DVCA 1T2HA 2IY2A 2VOCA 3PGTA 1GS3A 4K5RA 3NBRA 4JU5A 3E9JB 1PN9A 2HLSA 4POBA 4CDOA 4BPYA 1NJI4 4EF0A 4Z2UA 4H61A 4RQRA 1VQP3 1R4CA 1RNBA 3G6E3 1KQS2 3IE3A 1BX9A 3CXC2 3FZAA 3KE7A 1PU4A 1GUMA 4WR5A 3F8HA 3ZIVA 1SJZA 1GLPA 3UBLA 3ZG0A 3G8ZA 3CSJA 1B2SA 1IT8A 2GBXB 5CF1A 1RRLA 5IF6A 1VQQA 5IMCA 3H79A 3IA1A 3EX9A 2D1WA 2C80A 2VL2C 1ML6A 4LMIA 2QA2A 3UARA 1BVIA 1I3FA 1SD9A 4K1VA 2CVBA 6GSYA 3DY5A 5CF2A 5GZZB 1O7PB 2YFIB 2WOFA 3BNBA 3EN8A 1K0MA 3FSDA 3EE2A 2WO0A 4QL7A 4CCVA 1BRNL 3NUVA 2XPDA 4O7HA 1W2B2 6GSVA 3MHEA 1XVQA 3I563 5EL8A 3F7SA 1TOFA 3F14A 1PKWA 4JZQA 2YN1A 2BMOB 5M1AA 2F51A 1NSWA 4BA7A 4HKVB 1FOVA 1Z1SA 4BL7B 1B4QA 1G96A 2MBSA 5IENA 2CWTA 2OOVC 1N8JA 3ZG5A 2CAQA 4TR1A 3A5WA 3CPW2 1QVG2 4JF8A 6GSUA 4BTXA 2IFQA 1HYFA 5ELAA 4RNTA 2WGOA 1TRPA 3DM8A 3DXOA 4ZIJA 2REMA 2FA4A 3FF2A 3QDNA 3EU3A 3H51A 1BRJA 5HR1A 3KM6A 2DKHA 2XSOB 2C0EA 5M18A 1KWIA 4TVEA 1MGRA 3X3XA 2XGNA 2IWTA 10GSA 1BSCA 2PERA 1TXXA 3IC8A 4KZ1A 4TR0A 1WMJA 4IIAA 1DMQA 3KEBA 1V40A 1XBSA 3DGYA 5LC6A 4WR4A 7RNTA 4KX4A 4BWSA 1N5HA 5J3RA 3CTGA 1TK0B 1V74A 1D6ZA 4F9ZA 1VQM3 1KBNA 1LU4A 4G0IA 5IO0A 5D73A 3TKPA 1OF5A 2GQMA 4ZBAA 2RCDA 1PA3A 4MMYB 3AGNA 2OE3A 3KH9A 4AJ6A 5AYSC 3D21A 2VD0A 1WTHA 2OKAA 2K6VA 1OCVA 3Q6OA 5IG5A 4D73A 3QFAC 3QD9A 4FO5A 5GSSA 1TIJA 1O7GB 1NO3A 4EV2A 2QIYA 1UA5A 4QL9A 2VO4A 4R9LA 4Q5FA 4PQIA 2SBLA 1TJDA 1LOWA 3JUNA 4XHMA 2VIMA 1Y25A 3MYDA 2IMIA 3DGQA 3M8NA 3EF8A 4NHWA 2B1LA 1O7UA 2DJ2A 3P7XA 3A2VA 2CFGA 4EXRA 3FMWA 4WKWA 1TI1A 1RGFA 3BIRA 4IHUA 3DVWA 4NWYA 4HM8B 2PU9C 2XF3A 2K9FA 3EURA 3I0YA 4IELA 7STDA 3ZYWA 2XFTA 1Y6EA 5J9BA 3CCQ3 1Q814 1B2MA 1OHPA 3KSED 4BVXB 1T2IA 4MDCA 5FT3A 4YQUA 2QSIA 3STDA 5JCUA 4FQUA 2GZZA 3EC3A 3ZL5A 3TRQA 1A2VA 4KFEA 1OE7A 4J2FA 4PX1A 4V1Ag 1M1K4 5AIVA 4L5LA 1ZZYA 1X5EA 3G0KA 1LOXA 3A5IA 1NW2A 1XWAA 4NXIA 1BNFA 2P31A 3FY7A 2NTOA 4JEDA 1VQO3 3NZNA 4TR3A 3OWUA 1CYUA 1TTOA 3TOTA 2A2SA 2I9HA 2GSQA 1XWBA 1LQGC 2HSYA 5ECRB 3LXTA 3TOUA 1B2UA 4K8MA 3PYJA 4F82A 4JBBA 1GY7A 3S5CA 1ZX2A 2OACA 1MGWA 1IYHA 6GSWA 2X8HA 2LSTA 3WGEA 2R0CA 3DZLA 1XW6A 2A2RA 3RBTA 1QGVA 2WDUA 3QFBC 3NV0A 4MMXB 2A4HA 3NOFA 1RTUA 5ECMB 4HYZA 1OHSA 2IN3A 4ICYA 3I553 4I8BA 3DVXA 1JBRA 4TOPA 2HMLB 1YIT3 1N8QA 13GSA 4FIWA 3F4RA 2E2VA 1GTBA 1Q98A 2KUCA 1M7TA 4ZBDA 5COHA 3ROBA 22GSA 1B2ZA 2C8UA 3S9FA 1SJWA 4AGSA 1JKGA 1OKTA 2XHFA 4OFTA 3WMDA 1I0VA 1B8XA 1ZYPA 3VPQA 2HI7A 4MF7A 4ZL9A 4HM5B 4KFDA 3FCSB 1YJW3 3KCMA 1GUKA 1GMRA 2LJRA 5A4WA 1FO5A 1DE3A 1S3CA 5G5EA 3N9HA 3NX0A 4PUFC 2F98A 2G2QA 1AVLA 4JR4A 2VLVA 1I0XA 4LGQA 5LNKe 1AAZA 3A3TA 3VF1A 5IG0A 1SARA 3IJEB 1K0AA 1HKXA 2K54A 3M9KA 2PZVA 3L4NA 2CVDA 4NAXA 2ZA4A 3ISOA 2LKUA 2JADA 3MG1A 3GX8A 3CME3 4HM0B 1AXDA 1FA3A 1VQ53 4GTUA 1J08A 4RNYA 2E2GA 1YEXA 4TXVA 3C8EA 2D42A 1A8LA 1OVNA 4V2MA 1DETA 2KXGA 1CYVA 4BU4A 1OYJA 4K0NA 4LA1A 2YANA 3LYKA 4TKYA 3GURA 2NPBA 3NM7A 1MEKA 3SEDA 3VI7A 1OUNA 3CPOA 3HD5A 2KLXA 3F0IA 4OWYA 2BU4A 4OFNA 1PY3A 1B9XC 2AUVA 2GT5A 2P0XA 3URPA 3GRXA 1GSDA 4L8PA 1PFOA 4L5OA 4EXJA 1ROVA 3D5GA 1AQWA 1T00A 5ABRA 4K7IA 3ZVJA 2FNOA 2FWFA 2LQQA 1PX6A 4MZCA 3X40A 2H76A 3KTBA 1FG4A 1GH2A 3GTUB 4HQZA 2O89A 4L8EA 1B48A 2Z6BA 3WOEB 1IVWA 4L8OA 1B3SA 4DKIA 4TN8A 3V98A 2L4CA 1YF1A 1A0FA 5F0GA 1TRQA 5HFKA 1EWXA 2E2TA 2KF4A 1O7HB 2STDA 4YQVA 1OGXA 3W6GA 5AEUB 1ZMAA 2IJYA 4TR1B 1K0NA 4Z2RA 1F37A 4TX4A 5IERA 3EN1B 2EC4A 1DUGA 2C10A 2BMQB 3EMXA 2WRTA 2YJHA 1GTAA 4KFFA 4O2HA 2G0FA 1F8NA 1GULA 3O3TA 2YZUA 1CEWI 1VQK3 1TRVA 5E59A 2HMNB 3PR8A 4IVFA 2MZCA 5IW9A 4BL3A 4K2DA 2AHEA 9GSSA 1QUWA 1QAKA 2FLSA 4N0VA 2H0HA 1NB5I 1HNCA 1W4NA 3WD6A 4HZ4A 1G02A 3KMNA 1Q40A 1B9YC 5CREA 2JQ5A 3HJOA 4YH2A 1AC1A 3CRTA 4G1MB 3CC73 1OF5B 2TIRA 1F6MC 4F2IA 3AGOA 3ZMLA 2PNCA 12GSA 3IPTA 3RDWA 5HFGA 2H01A 4IT7A 2OBIA 2BO9B 1YGWA 3IAM2 3J7Yk 3KGKA 3LT9A 3KJYA 3GKNA 2LJAA 3ZITA 1BRHA 1SKWB 3A2WA 2BNGA 1EGRA 2RFRA 5EPFA 3S29A 6STDA 2H72A 4BTYA 2FWGA 5DJLA 2CFWA 5CYYA 3JUOA 2OE0A 2INXA 1MD3A 1AY7A 4EUYA 2DBCA 5JCWA 3D3LA 4HJLB 3DXBA 1UCJA 2CFDA 3V1WA 3RGRA 4WF5A 4POLA 4LSOA 2LNSA 4J9AA 1ZYNA 4K1UA 1IVUA 3W8JA 2JU5A 1W6YA 1HU9A 1JBTA 3LG6A 1LXEA 3G16A 3NBJA 1SL2B 1S3RA 2W56A 3VGNA 2GZPA 2YP6A 1LQMB 4YQMA 2XR8B 3VLNA 1R26A 3JUQA 1Z3EA 5HQPA 1YNVX 1K41A 4CY6A 4I6XA 4J5GA 3CSIA 8RNTA 1I2EA 2V1LA 2B5XA 4N6LA 3IK9A 4KA0A 1MTCA 1RCLA 2Y74A 4V1Ap 4HAAA 1DSBA 1SIIA 1ZGNA 1H4OA 1BYEA 4GQCA 2HMMB 2V32A 2EIOA 7GSSA 2CW9A 4HUAA 4FR9A 2YWMA 2GU1A 3SOAA 2IMDA 4K2XA 4ULXA 2UX0A 4HZ9B 4PUAA 3UAPA 1BJXA 1ERWA 1MDIA 5D93A 1USBA 3A76A 1THOA 5C04A 1B2XA 3F8XA 4ORLA 2W9QA 1KEBA 4OMVA 2RBIA 1KC84 5A4VA 3HI7A 4HQSA 3FR9A 3N9JA 2OQEA 3G7YA 1GSEA 1N2AA 2GSRA 2I4AA 4N6OB 5B6MA 2OBKA 19GSA 1WJKA 5ECQB 4XS1A 3CCV3 4V2NA 5CRGA 1K3OA 1E6BA 3F7XA 3IOSA 1JNQA 3DGOA 4DSSB 2CVKA 4GSSA 3GSPA 2E2UA 4MNNA 1RLSA 4FMBA 3UB1A 1NHOA 2VAFA 4RQXA 1WIKA 1FGMA 2ON5A 4STDA 3FW2A 3NHXA 2FGXA 1UCKA 2CZ3A 3GH6A 1WMOA 1C7HA 1JN5B 3WGXA 2KCDA 3PZWA 4KAEA 3FH1A 3US3A 2WB9A 4ECCA 2H74A 4IJIA 5ID2A 4FCJA 2I3YA 4TRXA 2P5RA 2C4BA 2V6OA 2H6ZA 5CRDA 3PXMA 2XBIA 4EDZA 2QGVA 1YEPA 4OO4A 4XS4A 3VWWA 1VQN3 1S723 2CWUA 3UIWA 5CNWA 2KF5A 4EIQA 1TU7A 4AKYA 5D82A 3R3EA 4AJ7A 4LLRA 4IQAA 2B3SA 3NBBA 2F8AA 1HD2A 2HXKA 3EE1A 4N6UA 3V99A 2IIYA 3Q19A 3DD3A 3GUSA 5DREA 2BMRB 4MABA 1BUQA 4XDVA 2WZ9A 5DALB 1RK4A 1EG9B 4HEA2 1JB2A 2HZEA 5IM9A 1MD4A 1NHYA 1ZS7A 3TB2A 3KH7A 4GCIA 4O3VA 1OKDA 3K63A 1GSUA 2M72A 3AMOB 1TUHA 3S27A 1T3BA 3ZMKA 1AQZA 3L9UA 3GA4A 4KCEA 3FG4A 1I70A 4XRAA 3TJKA 2GQLA 5J41A 1ZGXA 1XOAA 2DKIA 4WWUC 5A0OB 5KN3A 3BCKA 1M3IA 1RW1A 1E3VA 3CD63 3H3HA 3BNCA 1EEMA 3VWUA 4AF2A 4DSQA 1M2BA 1L5GB 2GEYA 1A2PA 3QR6A 2C11A 1EP8A 2XRXB 3W8SA 2ZDJA 1TRUA 1JZWA 2Z76A 4HM1B 1S3AA 3D6IA 5KN0A 3OW22 3CNXA 1HNBA 1ON4A 2KHPA 2CX4A 3CC43 3ERFA 2M7OA 2RNTA 2FWHA 5AI1A 4BTWA 3EB8A 4Q5QA 1TP6A 4CW9A 4YKGA 1EUIC 3DIEA 1W5ZA 1UN2A 1THXA 2H71A 5ECPB 2J8XB 3I9V2 3SLUA 1QJGA 1K0DA 2CAIA 4ZB6A 5HFIA 4FCZA 2Z7AA 4KDYA 6GSXA 3UBKA 3I43A 1O8WA 3F4SA 4K90B 4HI7A 4ZILA 3G713 3LTAA 4HZBB 1MWRA 4RNZA 5LD0A 2HMJB 4MF6A 1T4ZA 1F3BA 3A5EA 1WMNA 5F07A 1ST9A 1A2MA 2HZFA 4FH8A 1PMTA 3X41A 3BLZA 4L0UA 3BOAA 1Q40B 1O81A 3UVTA 3B4OA 2JZTA 2HSMA 1STFI 1M9BA 3I69A 1O73A 3GZXB 2BHMA 2F9SA 3BU4A 3UMAA 3IV4A 3HVVA 3ZREA 3T0UA 1WE0A 1ABAA 1GRXA 3G4S3 3IMAB 1RJOA 1XZOA 2WGRA 4ACSA 1FZUA 1YI23 3O6TA 5D9TA 1EGOA 4JRFA 2X99A 1Q824 3M0FA 2E7PA 5D9XA 2R2JA 4K61A 2RM6A 5ECSA 4A5PA 4CDLA 2F86B 1A0RP 2Q07A 1WOUA 1X5DA 2FHEA 2OJLA 4AKZA 1EKMA 3KP8A 16GSA 4N0ZA 2IYJA 3DRNA 4EYCA 2K3DA 1JZRA 3TKSC 2UGIA 2GT6A 5AN1A 2L59A 4WYKA 3RPNA 1XWGA 2C1YA 4O5RA 4ECIA 2H8LA 2XBQA 1VQ93 1SK0A 1LNIA 5IMDA 5AIHA 1JLVA 1FHEA 2H1DA 1GOVA 5H5RA 2E2MA 1NNVA 1UGIA 3APSA 4HM3B 2YWNA 2H30A 2GGTA 3L78A 4CHSA 4GXZA 1FOHA 3A2XA 3LJRA 4ID0A 1PSQA 1PN0A 3TKQA 2FWEA 3VWVA 2MMOA 1B4PA 5AIFA 2YCDA 2W56B 1PL2A 2IL3A 3DEXA 4LMWA 1WWJA 2CA8A 5CRWA 1BU4A 2DC5A 2GBWB 4R80A 3X42A 1OACA 4O8SA 1UVZA 1VF3A 3IRAA 5HR3A 2HMOB 3GL5A 1OC9A 4USSA 1XG8A 1FGQA 1QMAA 1VQ63 1I2FA 4DVCA 3OWYA 3NM2A 2K0MA 2LRNA 1HQOA 5GAPD 2YZHA 4X1UA 3OXAA 14GSA 4GLTA 3WHOA 1X5CA 3EHCA 1M2AA 1SPUA 1SKRB 2FGTA 3K8NA 1KSIA 3SXXA 2R0PA 4K5SA 5D9VA 5JPUA 2GVPA 1Q4JA 2R41A 1C54A 4EC6A 5H5SA 1AR0A 1BNJA 4TW5A 1K0OA 1RGGA 1OH0A 3KTLA 1XIYA 5D9WA 4IPBA 4ML1A 1ZCPA 4ZBBA 3TJJA 2LEGA 2KAAA 1GSFA 1URMA 3E3EA 2JZRA 2LRCA 4XS6A 4J56E 2A2PA 4BIKA 5ECLB 4KDUA 3D9RA 4YAVA 5F06A 4X2OA 3HZPA 4KE3A 4IN0A 1GNEA 2BJXA 2QGUA 1U3IA 2LQOA 1MNLA 1N5PA 2CFKA 3M1GA 1X1WA 4HJMA 3GHAA 4WBJA 5G5FA 5AISA 4KVHA 1BQ7A 2AV4A 1YF0A 2IUKA 1FUSA 1EP7A 2PGTA 4KUNA 1LBKA 5DAKA 5GSPA 5ID2B 18GSA 5IMFA 1Q9EA 1XPVA 5INYA 4K7NA 3DMCA 2KP2A 3UNLA 2J23A 3PINA 4TXOA 4RI7A 1SK1A 3QPMA 3TRPA 4NPBA 5JBSA 2R4IA 4XS4B 1DBYA 2W0QA 1A23A 4MP4A 3RNTA 2FA8A 2K8SA 2IMJA 2V2GA 4P3YB 3HVNA 1GUHA 1OGZA 5KOWA 2YNXA 4TR4A 1JBSA 2DJ1A 1XOBA 3ME7A 1PYLA 2BTOT 5IG4A 4NV5A 5JWQB 1NDOB 3LXZA 1K8A4 4PQHA 2Y73A 4XTSA 3HJMA 4GL6A 2VD1A 1RGCA 3IDVA 4XBXA 4V2LA 2CK3H 1MOLA 4K9ZA 2V41A 3R2QA 2CX1A 2WFCA 5ELUA 3UL6A 2DJKA 2RGQA 5EY6A 3F3RA 3KZQA 3TRXA 1AW9A 1UUWB 2KRTA 1YGEA 8CHOA 1ZO2A 3GZYB 5KEJA 1T5YA 4HU9A 1RNTA 1SJIA 4MJEA 4ECBA 2UZ8A 3EBYA 4RBNA 5KP4A 1A2LA 5DQYA 2JSYA 1J9BA 3FHKA 4F0BA 2I81A 1DYUA 3JCML 1M99A 3ZVJD 3G9BA 5AIIA 1K28A 3CCM3 1Q7HA 3B7CA 2IUJA 1BNIA 4HDEA 3BJ5A 3D4MA 1CQGA 1W02A 2RLIA 4HOJA 4WHAA 2QA1A 1HYUA 1WP0A 1U87A 2LYXA 1SKSB 2JACA 1EV9A 2VL2A 2JSZA 3X3ZA 1BEDA 3LTCA 2W6JH 1I3IA 5F8BA 4EIPA 3MSZA 1UUGB 1BUJA 1BG5A 4PNGA 4N6V0 3ZIJA 1A24A 4LZIA 2PN8A 1MWUA 4X2HA 5DRVA 5AIXA 2B24B 1GD3A 3P8WA 3SOYA 2B1KA 5KN1A 1AV4A 3N54B 3ERWA 4MLYA 3F9SA 3OX9A 3J7Yd 2DJJA 4AEQA 3MPHA 1EA2A 4L0WA 1UW1A 5CLKA 1BGSA 1N9EA 6GSPA 3IHGA 2PVOC 1VZZA 4EV5A 1ASKA 2OOVA 1MDKA 1RGHA 7GSPA 5A5KA 4EC0A 1W4VA 3F4TA 2QKEA 2IFQB 1Z9HA 5B6NA 1M3JA 3LXUX 3LH4A 1TP9A 3MG3A 3SVAA 3QAGA 1FUTA 3DKSA 3EJVA 1X9WB 3ZFZA 4KF9A 1ZYQB 3PH9A 3LORA 1FW7A 2FCHA 4ZL8A 4HM4B 1I2GA 1I5GA 3CSHA 3QCPA 1FGOA 4EDYA 3NXJA 4FMCA 3EWLA 2H75A 4G0KA 1ZOFA 5AEWB 1Z7RA 2H1BA 5BIRA 3BBYA 1QVF2 4HSCX 2VUPA 2F4YA 4J8TA 2GDRA 2CIUA 2KP1A 5IMZA 3RAZA 4HM2B 1G6WA 4GSPA 1YJ93 3TKRA 2N5AA 4H86A 5DCGA 4GSTA 2M80A 1JB5A 5B7CA 4IJ3A 1GTIA 5DQSA 6GSTA 1X9MB 3T8UA 3KN4A 1O85A 1STDA 5FHIA 1TTZA 5BMUA 4IKHA 3LWAA 4D73B 1LOVA 1E2YA 1OC9B 4GHOA 1FB0A 1RHLA 2GEXA 1G7OA 3CRUA 4NHZA 2FY6A 4N11A 6RNTA 2MYGA 3UEMA 2JL4A 2MBTA 3C71A 3DGMA 4HOHA 3L9VA 3IHQA 3MSOA 2ZHXB 1UC7A 1K3LA 2F99A 3N5OA 3WODG 3HXSA 3NIVA 4MPFA 2HSHA 5DJMA 3CCE3 2RUEA 3P90A 1V57A 2H66A 1V58A 1LJRA 3DGLA 1SENA 2OE1A 3RPPA 3F8UA 1SK2A 3CMA3 2WS2A 2IMKA 1GWCA 1QAFA 5HGRA 5IIZA 2RSXA 2FNQA 3F6DA 2E0QA 3F6FA 2C3QA 2R0GA 5HR2A 3DYRA 1YJ6A 3VWXA 1B20A 3EINA 9RNTA 2H0IA 2C0FA 3RHBA 1IVVA 4NREA 1FB6A 2XGLA 3N8BA 1N8R4 1U3AA 1BSDA 5ELJA 1FVKA 1JZOA 1C72A 4MMMA 4OCEA 1T8EB 4I2UA 2H6XA 2O7KA 3TJBA 3VK9A 3FZ9A 1AIUA 5BVBA 2HRFA 2CV4A 2GSTA 1R5AA 1TKDB 5DAKB 3PGBA 4LYLB 3HY2A 4F0CA 2A4VA 1GSYA 4TXOB 3J7Yb 1RGKA 3NV0B 5ECOB 1QXHA 2PMTA 3GL3A 5I97A 5IG3A 3KXOA 1BNEA 5E4WA 1W7CA 1A8YA 4YKFA 3CQFA 1BNSA 2M46A 3D4TA 3TDGA 4GSNA 2NBSA 2XEPA 3KD0A 1WMPA 3SX1A 3APOA 2P09A 5IQYA 3CU3A 1B21A 2CQ9A 2BMXA 1JKGB 1MDJA 3DWVA 4OK0A 2C3TA 2JZSA 2ZCTA 2GS3A 4I2TA 1US1A 4NV2A 3JUPA 5DDLA 3HOHA 3CBUA 1ACVA 5HOHA 1BRGA 4ZM8A 5CO3A 4MPGA 3QAWA 1UI7A 5IOWA 1TRSA 3HVXA 2HYXA 1O7MB 2MMAA 1M904 1ULJB 2YV9A 4EL1A 1BAOA 2B1XB 1A2JA 2PUKC 1W6CA 3TGZA 1YZXA 1R5PA 3FR6A 5EVOA 2UUGC 4EO3A 3CMIA 3F40A 4MZBA 3QK9A 4YAPA 3WR2A 1BSEA 4OCFA 1NB3I 4NMUA 4KCAA 2HT9A 1KTEA 2X49A 1Z6MA 4KH7A 5RNTA 1LNHA 2EIRA 2GQKA 3LZAA 5B8BA 4G10A 3KZTA 1GNWA 3H8QA 3VFIA 4U13A 1U8CB 1YVSA 3HCZA 4HM7B 4AJ8A 5EEOA 5ECHB 2IMFA 4DEJA 1ERTA 3HYPA 3GN3A 4BVYA 2CX3A 4HU7A 3IAS2 2ML6A 2O85A 2F5MA 2CH9A 2CX0A 3WYWA 1XFLA 4MJBA 1GP1A 2BT3A 4KSOA 3F63A 1IVXA 5G30A 4XCSA 5FWGA 2VL3A 3CCR3 2DJ0A 1LRAA 3Q90A 3GX0A 3MWZA 5M19A 4MCUA 2HOHA 4PURA 3ME8A 2F8FA 4KNDA 4ISDA 3EYTA 2Z77A 4WETA 1S5AA 1O7NB 2TRCP 2K8VA 2F5WA 3KP9A 3UJ1A 1ROAA 1W6GA 1Z7PA 4FMAA 1Q7Y4 1GMQA 2L57A 1IT7A 4POKA 3FF0A 3LTDA 2X4AA 5BRTA 4HM6B 1QFNA 1JRQA 5GSTA 3FLJA 1TK5B 4ZL7A 5L71A 4GF0A 1G6YA 4Q5RA 1TFKA 3D4AA 4CJNA 3UOMA 1GYBA 2HRNA 3TJGA 3CTFA 4O5UA 1TI3A 3EC9A 3LW9A 3D79A 3HX8A 3ZZXA 1SJ6A 1AVKA 1HZ1A 1NM3A 3WA2X 2C3NA 1K9M4 4K1FA 3HIIA 5G31A 3CCS3 4Z2TA 3OWSA 4CY8A 2MF7A 1IYYA 4JR6A 1XWCA 2GLRA 3TKSE 1J2BA 1VQ83 1E3RA 3CNMA 3U5RE 4XIHA 4MA9A 4ECJA 4OFMA 2IA7A 1RCKA 3IXRA 4KSMA 1BSAA 4MH3A 1I8VA 2DIZA 4IGJA 3K9MC 3HVSA 2LS5A 2GU3A 2AYTA 4OUQA 1IV9A 1J0FA 1YHQ3 2HFDA 2J9HA 3LOYA 1CQHA 3MG2A 2AAWA 3ZFBA 4PXOA 3V92A 3WOFB 2R5GA 4HS1A 4HVNA 2VCVA 3GTUA 3CCU3 2HE3A 2O3OA 2GZYA 4ZB9A 1BRKA 1GSQA 2VCQA 1PX7A 2HRAA 17GSA 1FUWA
chains in the Genus database with same CATH topology
2B6MA 4G19A 3WT1A 3ED3A 1G0TA 2LUSA 1Z5YE 2OADA 2YV7A 4PTSA 1HNAA 3KMOA 5G1LA 2KOKA 3HDCA 4I5QA 1F2EA 1FW1A 2YJ7A 3QOUA 2YWOA 3GV1A 3GSSA 4MJCA 1VF4A 1SYXA 3HKRA 2H1GA 4E8EA 1ZYEA 3BD2A 2GSSA 1OE8A 3ZLPA 5ECIB 2N5FA 2ZUPA 2HRKA 4K7OA 3PPUA 5ECKB 1TK8B 1K3YA 3HZ4A 2LRTA 3ZRDA 3IR4A 1V98A 1TU8A 3APQA 3GYKA 2DSAA 1V9WA 2LV3A 5DVBA 1GSSA 2RUFA 4ZXGA 4G2EA 1XXUA 1XWKA 3LGCA 4OO5A 3HZ8A 2VCZA 3C1RA 1F3AA 1X9SB 4WEYA 1TDIA 3TCOA 3IC4A 4HZ2A 1T7PB 4X4JA 5D8IA 4KW6A 2X64A 4K0GA 2DMMA 4IBPA 3FK8A 2B5YA 5KOXA 4BWQA 2CT6A 5D96A 8GSSA 3G7IA 1M9AA 3AY8A 4WF4A 3C73A 2P0GA 3L0HA 1YKCA 4GQFA 5CP1A 3FYGA 3QAVA 5A4UA 5KN2A 1SYRA 3FRCA 4O5QA 2N5BA 4POMA 4F03A 4PNFA 1XW9A 3LSZA 2VL9A 1G7EA 2V6KA 1TRWA 2ES7A 1WPIA 3D0ZA 1F9MA 1SL0B 2AJQB 4WBRD 2HZEB 3FR3A 3GMFA 4N10A 1BAYA 2C0GA 5HR0A 2DIYA 2ZNMA 4LMVA 2X8GA 4K6XA 5B8AA 1DE1A 3LQ7A 1PKZA 3TUEA 4X0XA 4BVYB 4IP6A 4DSSA 2PVQA 2L6DA 3O76A 2H6YA 2NDOA 2PWJA 1PQNA 4I97A 1JHBA 3H4KA 3M3MA 2EIQA 3UL3A 1T1VA 2R37A 3CYNA 5GAND 1FAAA 4MH2A 4Q5NA 5ENUA 4EKZA 3IPZA 4MJAA 2GTUA 1ZL9A 5DALA 1PRXA 2OA7A 3MDKA 3C7MA 2I1UA 4X43A 4LL4B 2WULA 3I6AA 6GSSA 3LEFA 1AUCA 2K18A 3ZTLA 4FYBA 1OAZA 3WT2A 3MWHA 1W89A 1EOGA 2P5QA 1O6JA 3GH9A 5IO2A 3MIXA 4OD7A 2VM2A 3ERGA 2H0GA 2TRXA 1TW9A 3OR5A 1H75A 5J5NA 3MNGA 2R6KA 2L5OA 4IS0A 5J9CA 2LNTA 1XW5A 4O92A 1X0RA 2CZ2A 3EVIA 3HJPA 3RHCA 4N30A 3TKSA 3HHVA 3SBCA 1DE2A 4DSRA 3GNJA 1JFUA 1EZKA 2O8VB 4IW9A 5C00A 3EU4A 1U6TA 5J4UA 1M0UA 2H1AA 2ALBA 3C1SA 3H93A 5ECNB 4MK3A 3GKKA 1WRYA 1VGLA 5G2ZA 5IMVA 1EV4A 3FZ4A 11GSA 3LYPA 1QMVA 4PQ1A 1GL8A 4IQ1A 3VURA 1SD8A 5G1KA 4GRFA 2NVLA 1PL1A 1SL1B 4RI6A 2DJ3A 3FZ5A 1YY7A 1JZDA 3Q18A 4BL7A 5IOXA 2PBJA 2VCXA 1YQ1A 3D22A 1S3DA 2WCIA 2H19A 3U6VA 2O87A 5AGYA 5JWRB 1R4WA 2Z9SA 1FVJA 2L6CA 2DMLA 3GFKA 2B7JA 2IMEA 5IPHA 4KB3A 4PGTA 4ML6A 1GTUA 4JRRA 1EEJA 1ILOA 2XC2A 4EVMA 4WXTA 3BCIA 1GLQA 4G9HA 3UVHA 2MMZA 5F05A 4E8HA 2B5EA 1ERVA 1U88A 2LJKA 4ILFA 3EMPA 5CRHA 1R7HA 1YDKA 2IPAA 2VM1A 1IYIA 1XCCA 4XRDA 2RIIA 4IP1A 2H70A 3FKFA 3IK7A 1AQXA 1SU9A 3MAKA 4J57E 3KIJA 3IBHA 3LFLA 2PPTA 1K0BA 2MMNA 2D2ZA 2VLTA 2YPMA 2H73A 5DCHA 2WJUA 1O8XA 4GWRA 5JCGA 2F3MA 2HNLA 2LTKA 4BVXA 4LL1B 4HJ2A 3EPTA 5H5QA 2C4JA 1T4YA 2ON7A 2XPEA 5LCZA 3DMLA 2L5LA 4RUVA 4JE1A 5ELGA 4ZB8A 4FYUA 4MZWA 3GKXA 2VCWA 3WGDA 2QC7A 1AQVA 3FEUA 3CXGA 20GSA 2R3XA 3G7JA 2V1MA 1V2AA 4Z7XA 1OC8A 5CAXA 4FYCA 5DBQA 3D5JA 3L9SA 3GIXA 1M2DA 3Q74A 3VI5A 2C0DA 2RM5A 3F3QA 3H1NA 1YKAA 1K0CA 4KDXA 2R4VA 4EE0A 1PD21 1VRSD 2VCTA 2FD3A 2FUG2 2AB6A 1QK8A 3GSTA 1JLWA 5IMAA 1Z6NA 3F9UA 2DLXA 2VLUA 1OC3A 1QQ2A 3ZFLA 1RQMA 1VF1A 3VPTA 4MF5A 3M9JA 3GKMA 2YWIA 1ERUA 4O32A 1VF2A 3HA9A 1XVWA 2L4QA 4QQ7A 3P2AA 2X8CA 4G0LA 2B7KA 5JWOB 3TJFA 3E0UA 3SWLA 1EOHA 2YOIA 3QMXA 5IPGA 4KGIA 1I9DA 1KNGA 1PGTA 2IY2A 2VOCA 3PGTA 4K5RA 4JU5A 3E9JB 1PN9A 2HLSA 4POBA 4CDOA 4BPYA 4EF0A 4Z2UA 4RQRA 3IE3A 1BX9A 3FZAA 1GUMA 4WR5A 3ZIVA 1SJZA 1GLPA 3UBLA 3CSJA 5IMCA 3H79A 3IA1A 2C80A 2VL2C 1ML6A 2QA2A 3UARA 1SD9A 2CVBA 6GSYA 5GZZB 1K0MA 3EE2A 4QL7A 2XPDA 4O7HA 6GSVA 1XVQA 5EL8A 1TOFA 1PKWA 4JZQA 2YN1A 4BA7A 2F51A 1FOVA 1NSWA 4BL7B 1B4QA 2MBSA 1N8JA 2CAQA 4TR1A 3A5WA 6GSUA 2IFQA 5ELAA 4ZIJA 2REMA 2FA4A 3QDNA 3EU3A 5HR1A 3KM6A 2DKHA 2C0EA 4TVEA 2IWTA 10GSA 2PERA 1TXXA 3IC8A 4TR0A 1WMJA 3KEBA 1V40A 1XBSA 4WR4A 4KX4A 4BWSA 5J3RA 3CTGA 1TK0B 4F9ZA 1KBNA 1LU4A 4G0IA 5IO0A 5D73A 3TKPA 2GQMA 4ZBAA 1PA3A 2OE3A 3KH9A 4AJ6A 3D21A 2VD0A 2OKAA 2K6VA 3Q6OA 4D73A 3QFAC 3QD9A 4FO5A 5GSSA 1UA5A 4QL9A 2VO4A 4Q5FA 4PQIA 1TJDA 4XHMA 2VIMA 3MYDA 2IMIA 3DGQA 3M8NA 4NHWA 2B1LA 1O7UA 2DJ2A 3P7XA 3A2VA 3FMWA 4WKWA 5DQYA 1TI1A 4IHUA 3DVWA 4NWYA 2PU9C 2K9FA 3EURA 4IELA 3ZYWA 1Y6EA 5J9BA 4BVXB 4MDCA 5FT3A 4YQUA 2QSIA 5JCUA 4FQUA 2GZZA 3EC3A 3ZL5A 3TRQA 1OE7A 4J2FA 4PX1A 4V1Ag 5AIVA 4L5LA 1ZZYA 1X5EA 3A5IA 1NW2A 1XWAA 4NXIA 2P31A 3FY7A 2NTOA 4JEDA 3NZNA 4TR3A 3TOTA 2A2SA 2I9HA 2GSQA 1XWBA 2HSYA 5ECRB 3LXTA 3TOUA 4K8MA 4F82A 4JBBA 2OACA 1IYHA 6GSWA 2X8HA 2LSTA 3WGEA 2R0CA 1XW6A 2A2RA 3RBTA 1QGVA 2WDUA 3QFBC 2A4HA 3NOFA 5ECMB 2IN3A 4ICYA 4I8BA 3DVXA 4TOPA 13GSA 4FIWA 3F4RA 1Q98A 1GTBA 4ZBDA 2KUCA 1M7TA 5COHA 22GSA 2C8UA 3S9FA 4AGSA 1OKTA 2XHFA 4OFTA 1B8XA 1ZYPA 3VPQA 2HI7A 4MF7A 4ZL9A 3KCMA 1GUKA 2LJRA 5A4WA 1FO5A 1S3CA 5G5EA 4PUFC 4JR4A 2VLVA 5LNKe 1AAZA 3A3TA 1K0AA 3M9KA 3L4NA 2CVDA 4NAXA 3ISOA 2LKUA 2JADA 3GX8A 1AXDA 4GTUA 1J08A 2E2GA 1YEXA 4TXVA 3C8EA 1A8LA 1OVNA 4V2MA 4LA1A 1OYJA 4K0NA 2YANA 3LYKA 4TKYA 3GURA 2NPBA 1MEKA 3VI7A 3HD5A 2KLXA 3F0IA 4OWYA 4OFNA 1B9XC 2AUVA 2GT5A 3GRXA 1GSDA 4L5OA 4EXJA 1AQWA 1T00A 5ABRA 4K7IA 3ZVJA 2FNOA 2FWFA 2LQQA 1PX6A 4MZCA 2H76A 3KTBA 1FG4A 1GH2A 3GTUB 4HQZA 2O89A 4L8EA 1B48A 4TN8A 2L4CA 1YF1A 1A0FA 5F0GA 5HFKA 1EWXA 4YQVA 3W6GA 1ZMAA 4TR1B 2IJYA 1K0NA 4Z2RA 1F37A 2EC4A 1DUGA 3EMXA 2WRTA 2YJHA 1GTAA 2G0FA 1GULA 3O3TA 2YZUA 1TRVA 5E59A 3PR8A 4IVFA 2MZCA 4K2DA 2AHEA 9GSSA 1QUWA 2FLSA 4N0VA 2H0HA 1HNCA 3WD6A 4HZ4A 3KMNA 1B9YC 5CREA 3HJOA 4YH2A 1AC1A 3CRTA 2TIRA 1F6MC 4F2IA 3ZMLA 12GSA 3RDWA 5HFGA 2H01A 2OBIA 3IAM2 3J7Yk 3KGKA 3KJYA 3GKNA 2LJAA 3ZITA 1SKWB 3A2WA 1EGRA 5EPFA 2H72A 2FWGA 5DJLA 5CYYA 2OE0A 1MD3A 4EUYA 2DBCA 5JCWA 3DXBA 3V1WA 4WF5A 4POLA 2LNSA 1ZYNA 3W8JA 2JU5A 3LG6A 1SL2B 2GZPA 2YP6A 4YQMA 3VLNA 1R26A 1Z3EA 5HQPA 4CY6A 4I6XA 3CSIA 2B5XA 3IK9A 4KA0A 1MTCA 4V1Ap 1DSBA 1ZGNA 1H4OA 1BYEA 4GQCA 2V32A 2EIOA 7GSSA 4HUAA 2YWMA 2IMDA 4K2XA 4ULXA 4PUAA 3UAPA 1BJXA 1ERWA 1MDIA 5D93A 1USBA 1THOA 5C04A 1KEBA 4OMVA 5A4VA 4HQSA 3FR9A 3N9JA 3G7YA 1GSEA 1N2AA 2GSRA 2I4AA 5B6MA 2OBKA 19GSA 1WJKA 5ECQB 4XS1A 5CRGA 4V2NA 1K3OA 1E6BA 3IOSA 4DSSB 2CVKA 4GSSA 4MNNA 1NHOA 2VAFA 4RQXA 1WIKA 2ON5A 3FW2A 2FGXA 2CZ3A 3GH6A 3WGXA 4KAEA 3US3A 2WB9A 4ECCA 2H74A 4IJIA 5ID2A 4TRXA 2I3YA 2P5RA 2V6OA 2H6ZA 5CRDA 4EDZA 2XBIA 2QGVA 1YEPA 4OO4A 4XS4A 3VWWA 3UIWA 5CNWA 4EIQA 1TU7A 3R3EA 4AJ7A 4LLRA 4IQAA 2B3SA 2F8AA 1HD2A 2HXKA 2IIYA 3Q19A 3DD3A 3GUSA 4MABA 2WZ9A 5DALB 1RK4A 4HEA2 2HZEA 5IM9A 1MD4A 1NHYA 3TB2A 3KH7A 4GCIA 1OKDA 1GSUA 2M72A 1T3BA 3ZMKA 3L9UA 3GA4A 4KCEA 4XRAA 3TJKA 5J41A 2GQLA 1XOAA 2DKIA 5KN3A 3BCKA 1RW1A 1EEMA 3VWUA 4AF2A 4DSQA 1M2BA 3QR6A 1EP8A 3W8SA 1TRUA 1JZWA 1S3AA 3D6IA 5KN0A 1HNBA 1ON4A 2KHPA 2CX4A 3ERFA 2FWHA 4Q5QA 4CW9A 4YKGA 3DIEA 1UN2A 1THXA 2H71A 5ECPB 3I9V2 1K0DA 2CAIA 4ZB6A 5HFIA 4KDYA 6GSXA 3UBKA 3I43A 1O8WA 3F4SA 4HI7A 4ZILA 5LD0A 4MF6A 1T4ZA 1F3BA 5F07A 1ST9A 1A2MA 2HZFA 4FH8A 1PMTA 4L0UA 3BOAA 1O81A 3UVTA 2JZTA 2HSMA 1M9BA 3I69A 1O73A 2F9SA 3UMAA 3IV4A 3HVVA 3ZREA 1WE0A 1ABAA 1GRXA 1XZOA 2WGRA 4ACSA 3O6TA 5D9TA 1EGOA 2X99A 3M0FA 2E7PA 5D9XA 2R2JA 2RM6A 5ECSA 4A5PA 2OJLA 1WOUA 1A0RP 1X5DA 2FHEA 3KP8A 16GSA 4N0ZA 2IYJA 3DRNA 3TKSC 1JZRA 2GT6A 5AN1A 2L59A 3RPNA 1XWGA 2C1YA 4O5RA 4ECIA 2H8LA 2XBQA 1SK0A 5IMDA 1JLVA 1FHEA 2H1DA 5H5RA 2E2MA 3APSA 2YWNA 2H30A 2GGTA 3L78A 4CHSA 4GXZA 1FOHA 3A2XA 3LJRA 4ID0A 1PSQA 1PN0A 3TKQA 2FWEA 3VWVA 2MMOA 1B4PA 2YCDA 4LMWA 1PL2A 2IL3A 3DEXA 1WWJA 2CA8A 5CRWA 2DC5A 1UVZA 1VF3A 3IRAA 5HR3A 3GL5A 1OC9A 4USSA 4DVCA 2LRNA 1HQOA 5GAPD 2YZHA 4X1UA 14GSA 4GLTA 1X5CA 1M2AA 1SKRB 3K8NA 2R0PA 4K5SA 5D9VA 2GVPA 1Q4JA 5H5SA 4TW5A 1K0OA 3KTLA 1XIYA 5D9WA 4ML1A 3TJJA 1ZCPA 4ZBBA 2LEGA 1GSFA 1URMA 3E3EA 2JZRA 2LRCA 4XS6A 4J56E 2A2PA 5ECLB 4KDUA 4YAVA 5F06A 4KE3A 4IN0A 1GNEA 2BJXA 1U3IA 2LQOA 3M1GA 4HJMA 3GHAA 4WBJA 5G5FA 5AISA 1BQ7A 2AV4A 1YF0A 1EP7A 2PGTA 4KUNA 1LBKA 5DAKA 5ID2B 18GSA 5IMFA 1XPVA 5INYA 4K7NA 2KP2A 2J23A 3PINA 4TXOA 4RI7A 1SK1A 3QPMA 3TRPA 4NPBA 4XS4B 1DBYA 1A23A 4MP4A 2FA8A 2K8SA 2V2GA 4P3YB 1GUHA 5KOWA 2YNXA 4TR4A 2DJ1A 1XOBA 3ME7A 2BTOT 4NV5A 5JWQB 3LXZA 4PQHA 4XTSA 3HJMA 2VD1A 3IDVA 4V2LA 4K9ZA 2V41A 3R2QA 2WFCA 2DJKA 5EY6A 3TRXA 3F3RA 3KZQA 1AW9A 5KEJA 4HU9A 1SJIA 4MJEA 4ECBA 2UZ8A 1A2LA 2JSYA 1J9BA 3FHKA 4F0BA 2I81A 17GSA 3JCML 1M99A 3ZVJD 3G9BA 4HDEA 3BJ5A 3D4MA 1CQGA 2RLIA 4HOJA 2QA1A 1HYUA 1WP0A 1U87A 1SKSB 2JACA 1EV9A 2VL2A 2JSZA 1BEDA 5F8BA 4EIPA 3MSZA 1BG5A 4PNGA 3ZIJA 1A24A 2PN8A 5AIXA 3P8WA 2B1KA 5KN1A 3ERWA 4MLYA 2DJJA 4L0WA 3IHGA 2PVOC 1MDKA 5A5KA 4EC0A 1W4VA 3F4TA 2QKEA 2IFQB 1Z9HA 5B6NA 1TP9A 3QAGA 3DKSA 1X9WB 4KF9A 1ZYQB 3PH9A 3LORA 2FCHA 4ZL8A 1I5GA 3CSHA 3QCPA 4EDYA 3EWLA 2H75A 4G0KA 1ZOFA 1Z7RA 2H1BA 3BBYA 2VUPA 2GDRA 2KP1A 5IMZA 3RAZA 1G6WA 3TKRA 2N5AA 4H86A 5DCGA 4GSTA 2M80A 5B7CA 4IJ3A 1GTIA 5DQSA 6GSTA 1X9MB 1O85A 5FHIA 1TTZA 5BMUA 4IKHA 3LWAA 4D73B 1E2YA 1OC9B 1FB0A 1G7OA 3CRUA 4NHZA 2FY6A 4N11A 2MYGA 3UEMA 2JL4A 2MBTA 3C71A 3L9VA 3IHQA 1UC7A 1K3LA 3N5OA 3HXSA 3NIVA 4MPFA 2HSHA 5DJMA 2RUEA 3P90A 1V57A 2H66A 1V58A 1LJRA 1SENA 2OE1A 3RPPA 3F8UA 1SK2A 2WS2A 2IMKA 1GWCA 5IIZA 3F6DA 2E0QA 3F6FA 2C3QA 2R0GA 5HR2A 3DYRA 1YJ6A 3VWXA 3EINA 2H0IA 2C0FA 3RHBA 1FB6A 1U3AA 1FVKA 1JZOA 1C72A 4MMMA 4OCEA 1T8EB 4I2UA 2H6XA 2O7KA 3TJBA 3VK9A 3FZ9A 1AIUA 2HRFA 2CV4A 2GSTA 1R5AA 1TKDB 5DAKB 3HY2A 4F0CA 2A4VA 1GSYA 4TXOB 3J7Yb 5ECOB 1QXHA 2PMTA 3GL3A 3KXOA 5E4WA 1A8YA 4YKFA 2M46A 3D4TA 3TDGA 4GSNA 2NBSA 3KD0A 3APOA 5IQYA 2CQ9A 2BMXA 1MDJA 3DWVA 2C3TA 2JZSA 2ZCTA 2GS3A 4I2TA 4NV2A 5DDLA 3CBUA 1ACVA 5CO3A 4MPGA 3QAWA 5IOWA 1TRSA 3HVXA 2HYXA 2MMAA 2YV9A 4EL1A 1A2JA 2PUKC 3TGZA 1YZXA 1R5PA 3FR6A 5EVOA 4EO3A 3CMIA 4MZBA 4YAPA 4OCFA 4NMUA 4KCAA 2HT9A 1KTEA 2X49A 1Z6MA 4KH7A 2EIRA 2GQKA 5B8BA 4G10A 1GNWA 3H8QA 3VFIA 3HCZA 4AJ8A 5ECHB 2IMFA 4DEJA 1ERTA 3HYPA 3GN3A 4BVYA 2CX3A 4HU7A 3IAS2 2O85A 3WYWA 1XFLA 4MJBA 1GP1A 4KSOA 3F63A 5G30A 4XCSA 5FWGA 2VL3A 3GX0A 2DJ0A 4MCUA 4PURA 3ME8A 2F8FA 4KNDA 4ISDA 3EYTA 4WETA 2TRCP 2K8VA 3KP9A 3UJ1A 1Z7PA 2L57A 4POKA 2X4AA 5BRTA 1QFNA 5GSTA 1TK5B 4ZL7A 5L71A 4GF0A 1G6YA 4Q5RA 3UOMA 2HRNA 3TJGA 3CTFA 4O5UA 1TI3A 3LW9A 3ZZXA 1SJ6A 1NM3A 2C3NA 4K1FA 5G31A 4Z2TA 4CY8A 4JR6A 1XWCA 2GLRA 3TKSE 3U5RE 4XIHA 4MA9A 4ECJA 4OFMA 3IXRA 4KSMA 4MH3A 2DIZA 4IGJA 3HVSA 2LS5A 2AYTA 1J0FA 2HFDA 2J9HA 1CQHA 2AAWA 3ZFBA 4PXOA 2R5GA 4HS1A 2VCVA 3GTUA 2HE3A 2GZYA 4ZB9A 1GSQA 2VCQA 1PX7A 2HRAA 2G2QA 1Y25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B6M A;  4G19 A;  3WT1 A;  3ED3 A;  1G0T A;  2LUS A;  1Z5Y E;  2OAD A;  2YV7 A;  1HNA A;  3KMO A;  5G1L A;  2KOK A;  3HDC A;  4I5Q A;  1F2E A;  1FW1 A;  2YJ7 A;  3QOU A;  2YWO A;  3GV1 A;  3GSS A;  4MJC A;  1VF4 A;  1SYX A;  3HKR A;  2H1G A;  4E8E A;  1ZYE A;  3BD2 A;  2GSS A;  1OE8 A;  3ZLP A;  5ECI B;  2N5F A;  2ZUP A;  4K7O A;  5ECK B;  1TK8 B;  1K3Y A;  3HZ4 A;  2LRT A;  3ZRD A;  3IR4 A;  1V98 A;  1TU8 A;  3APQ A;  3GYK A;  2DSA A;  1V9W A;  2LV3 A;  5DVB A;  1GSS A;  2RUF A;  4ZXG A;  4G2E A;  1XXU A;  1XWK A;  3LGC A;  4OO5 A;  3HZ8 A;  2VCZ A;  3C1R A;  1F3A A;  1X9S B;  4WEY A;  1TDI A;  3TCO A;  3IC4 A;  4HZ2 A;  1T7P B;  5D8I A;  4KW6 A;  2X64 A;  4K0G A;  2DMM A;  4IBP A;  3FK8 A;  2B5Y A;  4BWQ A;  2CT6 A;  5D96 A;  8GSS A;  3G7I A;  1M9A A;  3AY8 A;  4WF4 A;  3C73 A;  2P0G A;  3L0H A;  1YKC A;  4GQF A;  5CP1 A;  3FYG A;  3QAV A;  5A4U A;  5KN2 A;  1SYR A;  3FRC A;  2N5B A;  4POM A;  4F03 A;  4PNF A;  1XW9 A;  3LSZ A;  2VL9 A;  1G7E A;  2V6K A;  1TRW A;  2ES7 A;  1WPI A;  3D0Z A;  1F9M A;  1SL0 B;  2AJQ B;  4WBR D;  2HZE B;  3FR3 A;  3GMF A;  4N10 A;  1BAY A;  2C0G A;  5HR0 A;  2DIY A;  2ZNM A;  4LMV A;  2X8G A;  4K6X A;  5B8A A;  1DE1 A;  3LQ7 A;  1PKZ A;  3TUE A;  4X0X A;  4IP6 A;  4DSS A;  2PVQ A;  2L6D A;  3O76 A;  2H6Y A;  2NDO A;  2PWJ A;  1PQN A;  4I97 A;  1JHB A;  3H4K A;  3M3M A;  2EIQ A;  3UL3 A;  1T1V A;  2R37 A;  3CYN A;  5GAN D;  1FAA A;  4MH2 A;  4Q5N A;  5ENU A;  4EKZ A;  3IPZ A;  4MJA A;  2GTU A;  1ZL9 A;  5DAL A;  1PRX A;  2OA7 A;  3MDK A;  3C7M A;  2I1U A;  4X43 A;  4LL4 B;  2WUL A;  3I6A A;  6GSS A;  3LEF A;  1AUC A;  2K18 A;  3ZTL A;  4FYB A;  1OAZ A;  3WT2 A;  3MWH A;  1W89 A;  1EOG A;  2P5Q A;  1O6J A;  3GH9 A;  5IO2 A;  4OD7 A;  2VM2 A;  3ERG A;  2H0G A;  2TRX A;  1TW9 A;  3OR5 A;  1H75 A;  5J5N A;  3MNG A;  2R6K A;  2L5O A;  4IS0 A;  5J9C A;  2LNT A;  1XW5 A;  4O92 A;  1X0R A;  2CZ2 A;  3EVI A;  3HJP A;  3RHC A;  4N30 A;  3TKS A;  3HHV A;  3SBC A;  1DE2 A;  4DSR A;  3GNJ A;  1JFU A;  1EZK A;  2O8V B;  4IW9 A;  5C00 A;  3EU4 A;  1U6T A;  5J4U A;  1M0U A;  2H1A A;  2ALB A;  3C1S A;  3H93 A;  5ECN B;  4MK3 A;  3GKK A;  1WRY A;  1VGL A;  5G2Z A;  5IMV A;  1EV4 A;  3FZ4 A;  11GS A;  3LYP A;  1QMV A;  4PQ1 A;  1GL8 A;  4IQ1 A;  3VUR A;  1SD8 A;  5G1K A;  4GRF A;  2NVL A;  1PL1 A;  1SL1 B;  4RI6 A;  2DJ3 A;  3FZ5 A;  1YY7 A;  1JZD A;  3Q18 A;  4BL7 A;  5IOX A;  2PBJ A;  2VCX A;  1YQ1 A;  3D22 A;  1S3D A;  2WCI A;  2H19 A;  3U6V A;  2O87 A;  5AGY A;  5JWR B;  1R4W A;  2Z9S A;  1FVJ A;  2L6C A;  2DML A;  3GFK A;  2B7J A;  2IME A;  5IPH A;  4KB3 A;  4PGT A;  4ML6 A;  1GTU A;  4JRR A;  1EEJ A;  1ILO A;  2XC2 A;  4EVM A;  4WXT A;  3BCI A;  1GLQ A;  4G9H A;  3UVH A;  2MMZ A;  5F05 A;  4E8H A;  2B5E A;  1ERV A;  1U88 A;  2LJK A;  4ILF A;  3EMP A;  5CRH A;  1R7H A;  1YDK A;  2IPA A;  2VM1 A;  1IYI A;  1XCC A;  4XRD A;  2RII A;  4IP1 A;  2H70 A;  3FKF A;  3IK7 A;  1AQX A;  1SU9 A;  3MAK A;  4J57 E;  3KIJ A;  3IBH A;  3LFL A;  2PPT A;  1K0B A;  2MMN A;  2D2Z A;  2VLT A;  2YPM A;  2H73 A;  5DCH A;  2WJU A;  1O8X A;  4GWR A;  5JCG A;  2F3M A;  2HNL A;  2LTK A;  4BVX A;  4LL1 B;  4HJ2 A;  5H5Q A;  2C4J A;  1T4Y A;  2ON7 A;  2XPE A;  5LCZ A;  3DML A;  2L5L A;  4RUV A;  4JE1 A;  5ELG A;  4ZB8 A;  4FYU A;  4MZW A;  3GKX A;  2VCW A;  3WGD A;  2QC7 A;  1AQV A;  3FEU A;  3CXG A;  20GS A;  2R3X A;  3G7J A;  2V1M A;  1V2A A;  4Z7X A;  1OC8 A;  5CAX A;  4FYC A;  5DBQ A;  3D5J A;  3L9S A;  3GIX A;  1M2D A;  3Q74 A;  3VI5 A;  2C0D A;  2RM5 A;  3F3Q A;  3H1N A;  1YKA A;  1K0C A;  4KDX A;  2R4V A;  4EE0 A;  1PD2 1;  1VRS D;  2VCT A;  2FD3 A;  2FUG 2;  2AB6 A;  1QK8 A;  3GST A;  1JLW A;  5IMA A;  1Z6N A;  3F9U A;  2DLX A;  2VLU A;  1OC3 A;  1QQ2 A;  3ZFL A;  1RQM A;  1VF1 A;  3VPT A;  4MF5 A;  3M9J A;  3GKM A;  2YWI A;  1ERU A;  4O32 A;  1VF2 A;  3HA9 A;  1XVW A;  2L4Q A;  4QQ7 A;  3P2A A;  2X8C A;  2B7K A;  5JWO B;  3TJF A;  3E0U A;  3SWL A;  1EOH A;  2YOI A;  3QMX A;  5IPG A;  4KGI A;  1I9D A;  1KNG A;  1PGT A;  2IY2 A;  2VOC A;  3PGT A;  4JU5 A;  3E9J B;  1PN9 A;  2HLS A;  4POB A;  4CDO A;  4BPY A;  4EF0 A;  4RQR A;  3IE3 A;  1BX9 A;  3FZA A;  1GUM A;  4WR5 A;  3ZIV A;  1SJZ A;  1GLP A;  3UBL A;  3CSJ A;  5IMC A;  3H79 A;  3IA1 A;  2C80 A;  2VL2 C;  1ML6 A;  3UAR A;  1SD9 A;  2CVB A;  6GSY A;  5GZZ B;  1K0M A;  3EE2 A;  4QL7 A;  2XPD A;  4O7H A;  6GSV A;  1XVQ A;  5EL8 A;  1TOF A;  1PKW A;  4JZQ A;  2YN1 A;  4BA7 A;  2F51 A;  1FOV A;  1NSW A;  1B4Q A;  2MBS A;  1N8J A;  2CAQ A;  4TR1 A;  3A5W A;  6GSU A;  2IFQ A;  5ELA A;  4ZIJ A;  2REM A;  2FA4 A;  3QDN A;  3EU3 A;  5HR1 A;  3KM6 A;  2C0E A;  4TVE A;  2IWT A;  10GS A;  2PER A;  1TXX A;  4TR0 A;  1WMJ A;  3KEB A;  1V40 A;  1XBS A;  4WR4 A;  4KX4 A;  4BWS A;  5J3R A;  3CTG A;  1TK0 B;  4F9Z A;  1KBN A;  1LU4 A;  5IO0 A;  5D73 A;  3TKP A;  2GQM A;  4ZBA A;  1PA3 A;  2OE3 A;  3KH9 A;  4AJ6 A;  3D21 A;  2VD0 A;  2OKA A;  2K6V A;  3Q6O A;  4D73 A;  3QFA C;  3QD9 A;  4FO5 A;  5GSS A;  1UA5 A;  4QL9 A;  2VO4 A;  4Q5F A;  4PQI A;  1TJD A;  4XHM A;  2VIM A;  2IMI A;  3DGQ A;  3M8N A;  4NHW A;  2B1L A;  1O7U A;  2DJ2 A;  3P7X A;  3A2V A;  5DQY A;  4WKW A;  1TI1 A;  4IHU A;  3DVW A;  4NWY A;  2PU9 C;  2K9F A;  3EUR A;  4IEL A;  3ZYW A;  1Y6E A;  5J9B A;  4MDC A;  5FT3 A;  4YQU A;  2QSI A;  5JCU A;  3ZL5 A;  2GZZ A;  3EC3 A;  3TRQ A;  1OE7 A;  4J2F A;  4PX1 A;  4V1A g;  5AIV A;  4L5L A;  1ZZY A;  1X5E A;  1NW2 A;  1XWA A;  4NXI A;  2P31 A;  3FY7 A;  2NTO A;  4JED A;  3NZN A;  4TR3 A;  3TOT A;  2A2S A;  2I9H A;  2GSQ A;  1XWB A;  2HSY A;  5ECR B;  3LXT A;  3TOU A;  4K8M A;  4F82 A;  4JBB A;  2OAC A;  1IYH A;  6GSW A;  2X8H A;  2LST A;  3WGE A;  1XW6 A;  2A2R A;  3RBT A;  1QGV A;  2WDU A;  3QFB C;  3NOF A;  5ECM B;  2IN3 A;  4I8B A;  3DVX A;  4TOP A;  13GS A;  4FIW A;  3F4R A;  1Q98 A;  1GTB A;  4ZBD A;  2KUC A;  1M7T A;  5COH A;  22GS A;  2C8U A;  3S9F A;  4AGS A;  1OKT A;  2XHF A;  4OFT A;  1B8X A;  3VPQ A;  2HI7 A;  4MF7 A;  4ZL9 A;  3KCM A;  1GUK A;  2LJR A;  5A4W A;  1FO5 A;  1S3C A;  5G5E A;  4PUF C;  4JR4 A;  2VLV A;  5LNK e;  1AAZ A;  3A3T A;  1K0A A;  3M9K A;  3L4N A;  2CVD A;  4NAX A;  3ISO A;  2LKU A;  2JAD A;  3GX8 A;  1AXD A;  4GTU A;  1J08 A;  2E2G A;  1YEX A;  4TXV A;  3C8E A;  1A8L A;  1OVN A;  4V2M A;  4LA1 A;  1OYJ A;  4K0N A;  2YAN A;  3LYK A;  4TKY A;  3GUR A;  2NPB A;  1MEK A;  3VI7 A;  3HD5 A;  2KLX A;  3F0I A;  4OWY A;  4OFN A;  1B9X C;  2AUV A;  2GT5 A;  3GRX A;  1GSD A;  4L5O A;  4EXJ A;  1AQW A;  1T00 A;  5ABR A;  4K7I A;  3ZVJ A;  2FNO A;  2FWF A;  2LQQ A;  1PX6 A;  4MZC A;  2H76 A;  3KTB A;  1FG4 A;  1GH2 A;  3GTU B;  4HQZ A;  2O89 A;  4L8E A;  1B48 A;  4TN8 A;  2L4C A;  1YF1 A;  1A0F A;  5F0G A;  5HFK A;  1EWX A;  4YQV A;  3W6G A;  1ZMA A;  4TR1 B;  2IJY A;  1K0N A;  1F37 A;  2EC4 A;  1DUG A;  3EMX A;  2WRT A;  2YJH A;  1GTA A;  2G0F A;  1GUL A;  3O3T A;  2YZU A;  1TRV A;  5E59 A;  3PR8 A;  4IVF A;  2MZC A;  4K2D A;  2AHE A;  9GSS A;  1QUW A;  2FLS A;  4N0V A;  2H0H A;  1HNC A;  3WD6 A;  4HZ4 A;  3KMN A;  1B9Y C;  5CRE A;  3HJO A;  4YH2 A;  1AC1 A;  3CRT A;  2TIR A;  1F6M C;  4F2I A;  3ZML A;  12GS A;  3RDW A;  5HFG A;  2H01 A;  2OBI A;  3IAM 2;  3J7Y k;  3KGK A;  3KJY A;  3GKN A;  2LJA A;  3ZIT A;  1SKW B;  3A2W A;  1EGR A;  5EPF A;  2H72 A;  2FWG A;  5DJL A;  5CYY A;  2OE0 A;  1MD3 A;  4EUY A;  2DBC A;  5JCW A;  3DXB A;  3V1W A;  4WF5 A;  4POL A;  2LNS A;  3W8J A;  2JU5 A;  3LG6 A;  1SL2 B;  2GZP A;  2YP6 A;  4YQM A;  3VLN A;  1R26 A;  1Z3E A;  5HQP A;  4I6X A;  3CSI A;  2B5X A;  3IK9 A;  4KA0 A;  1MTC A;  4V1A p;  1DSB A;  1ZGN A;  1H4O A;  1BYE A;  4GQC A;  2V32 A;  2EIO A;  7GSS A;  4HUA A;  2YWM A;  2IMD A;  4ULX A;  4PUA A;  3UAP A;  1BJX A;  1ERW A;  1MDI A;  5D93 A;  1USB A;  1THO A;  5C04 A;  1KEB A;  4OMV A;  5A4V A;  4HQS A;  3FR9 A;  3N9J A;  3G7Y A;  1GSE A;  1N2A A;  2GSR A;  2I4A A;  5B6M A;  2OBK A;  19GS A;  1WJK A;  5ECQ B;  4XS1 A;  5CRG A;  4V2N A;  1K3O A;  1E6B A;  3IOS A;  4DSS B;  2CVK A;  4GSS A;  1NHO A;  2VAF A;  4RQX A;  1WIK A;  2ON5 A;  3FW2 A;  2FGX A;  2CZ3 A;  3GH6 A;  3WGX A;  4KAE A;  3US3 A;  2WB9 A;  4ECC A;  2H74 A;  4IJI A;  5ID2 A;  4TRX A;  2I3Y A;  2P5R A;  2V6O A;  2H6Z A;  5CRD A;  4EDZ A;  2XBI A;  2QGV A;  1YEP A;  4OO4 A;  4XS4 A;  3VWW A;  3UIW A;  5CNW A;  1TU7 A;  4AJ7 A;  4LLR A;  4IQA A;  2B3S A;  2F8A A;  1HD2 A;  2HXK A;  2IIY A;  3Q19 A;  3DD3 A;  3GUS A;  4MAB A;  2WZ9 A;  5DAL B;  1RK4 A;  4HEA 2;  2HZE A;  5IM9 A;  1MD4 A;  1NHY A;  3TB2 A;  3KH7 A;  4GCI A;  1OKD A;  1GSU A;  2M72 A;  1T3B A;  3ZMK A;  3L9U A;  3GA4 A;  4KCE A;  4XRA A;  3TJK A;  5J41 A;  2GQL A;  1XOA A;  5KN3 A;  3BCK A;  1RW1 A;  1EEM A;  3VWU A;  4AF2 A;  4DSQ A;  1M2B A;  3QR6 A;  1EP8 A;  3W8S A;  1TRU A;  1JZW A;  1S3A A;  3D6I A;  5KN0 A;  1HNB A;  1ON4 A;  2KHP A;  2CX4 A;  3ERF A;  2FWH A;  4Q5Q A;  4CW9 A;  3DIE A;  1UN2 A;  1THX A;  2H71 A;  5ECP B;  3I9V 2;  1K0D A;  2CAI A;  4ZB6 A;  5HFI A;  4KDY A;  6GSX A;  3UBK A;  3I43 A;  1O8W A;  3F4S A;  4HI7 A;  4ZIL A;  5LD0 A;  4MF6 A;  1T4Z A;  1F3B A;  5F07 A;  1ST9 A;  1A2M A;  2HZF A;  4FH8 A;  1PMT A;  4L0U A;  3BOA A;  1O81 A;  3UVT A;  2JZT A;  1M9B A;  3I69 A;  1O73 A;  2F9S A;  3UMA A;  3IV4 A;  3HVV A;  3ZRE A;  1WE0 A;  1ABA A;  1GRX A;  1XZO A;  2WGR A;  4ACS A;  3O6T A;  5D9T A;  1EGO A;  2X99 A;  3M0F A;  2E7P A;  5D9X A;  2R2J A;  2RM6 A;  5ECS A;  2OJL A;  1WOU A;  1A0R P;  1X5D A;  2FHE A;  3KP8 A;  16GS A;  4N0Z A;  2IYJ A;  3DRN A;  3TKS C;  1JZR A;  2GT6 A;  5AN1 A;  2L59 A;  3RPN A;  1XWG A;  2C1Y A;  4O5R A;  4ECI A;  2H8L A;  2XBQ A;  1SK0 A;  5IMD A;  1JLV A;  1FHE A;  2H1D A;  5H5R A;  2E2M A;  3APS A;  2YWN A;  2H30 A;  2GGT A;  3L78 A;  4CHS A;  4GXZ A;  4ID0 A;  3A2X A;  3LJR A;  1PSQ A;  3TKQ A;  3VWV A;  2FWE A;  2MMO A;  1B4P A;  2YCD A;  4LMW A;  1PL2 A;  2IL3 A;  3DEX A;  1WWJ A;  2CA8 A;  5CRW A;  2DC5 A;  1UVZ A;  1VF3 A;  3IRA A;  5HR3 A;  3GL5 A;  1OC9 A;  4DVC A;  2LRN A;  1HQO A;  5GAP D;  2YZH A;  4X1U A;  14GS A;  4GLT A;  1X5C A;  1M2A A;  1SKR B;  3K8N A;  5D9V A;  2GVP A;  1Q4J A;  5H5S A;  4TW5 A;  1K0O A;  3KTL A;  1XIY A;  5D9W A;  4ML1 A;  3TJJ A;  1ZCP A;  4ZBB A;  2LEG A;  1GSF A;  1URM A;  3E3E A;  2JZR A;  2LRC A;  4XS6 A;  4J56 E;  5ECL B;  4KDU A;  4YAV A;  5F06 A;  4KE3 A;  4IN0 A;  1GNE A;  2BJX A;  1U3I A;  2LQO A;  3M1G A;  4HJM A;  3GHA A;  4WBJ A;  5G5F A;  5AIS A;  1BQ7 A;  2AV4 A;  1YF0 A;  1EP7 A;  2PGT A;  4KUN A;  1LBK A;  5DAK A;  5ID2 B;  18GS A;  5IMF A;  1XPV A;  5INY A;  4K7N A;  2KP2 A;  2J23 A;  3PIN A;  4TXO A;  4RI7 A;  1SK1 A;  3QPM A;  3TRP A;  4NPB A;  4XS4 B;  1DBY A;  1A23 A;  4MP4 A;  2FA8 A;  2K8S A;  2V2G A;  4P3Y B;  1GUH A;  2YNX A;  4TR4 A;  2DJ1 A;  1XOB A;  3ME7 A;  2BTO T;  4NV5 A;  5JWQ B;  3LXZ A;  4PQH A;  4XTS A;  3HJM A;  2VD1 A;  3IDV A;  4V2L A;  4K9Z A;  2V41 A;  3R2Q A;  2WFC A;  2DJK A;  5EY6 A;  3TRX A;  3F3R A;  3KZQ A;  1AW9 A;  5KEJ A;  4HU9 A;  1SJI A;  4MJE A;  4ECB A;  1A2L A;  2JSY A;  1J9B A;  3FHK A;  4F0B A;  2I81 A;  17GS A;  3JCM L;  1M99 A;  3ZVJ D;  3G9B A;  4HDE A;  3BJ5 A;  3D4M A;  1CQG A;  2RLI A;  4HOJ A;  1HYU A;  1WP0 A;  1U87 A;  1SKS B;  2JAC A;  1EV9 A;  2VL2 A;  2JSZ A;  1BED A;  5F8B A;  3MSZ A;  1BG5 A;  4PNG A;  3ZIJ A;  1A24 A;  2PN8 A;  5AIX A;  3P8W A;  2B1K A;  5KN1 A;  3ERW A;  4MLY A;  2DJJ A;  4L0W A;  2PVO C;  1MDK A;  5A5K A;  4EC0 A;  1W4V A;  3F4T A;  2QKE A;  2IFQ B;  1Z9H A;  5B6N A;  1TP9 A;  3QAG A;  3DKS A;  1X9W B;  1ZYQ B;  3PH9 A;  3LOR A;  2FCH A;  4ZL8 A;  1I5G A;  3CSH A;  3QCP A;  4EDY A;  3EWL A;  2H75 A;  1ZOF A;  1Z7R A;  2H1B A;  3BBY A;  2VUP A;  2GDR A;  2KP1 A;  5IMZ A;  3RAZ A;  1G6W A;  3TKR A;  2N5A A;  4H86 A;  5DCG A;  4GST A;  2M80 A;  5B7C A;  4IJ3 A;  1GTI A;  5DQS A;  6GST A;  1X9M B;  1O85 A;  5FHI A;  1TTZ A;  4IKH A;  3LWA A;  4D73 B;  1E2Y A;  1OC9 B;  1FB0 A;  1G7O A;  3CRU A;  4NHZ A;  2FY6 A;  4N11 A;  2MYG A;  3UEM A;  2JL4 A;  2MBT A;  3C71 A;  3L9V A;  3IHQ A;  1UC7 A;  1K3L A;  3N5O A;  3HXS A;  3NIV A;  4MPF A;  2HSH A;  5DJM A;  2RUE A;  3P90 A;  1V57 A;  2H66 A;  1V58 A;  1LJR A;  1SEN A;  2OE1 A;  3RPP A;  3F8U A;  1SK2 A;  2WS2 A;  2IMK A;  1GWC A;  5IIZ A;  3F6D A;  2E0Q A;  3F6F A;  2C3Q A;  5HR2 A;  3DYR A;  1YJ6 A;  3VWX A;  3EIN A;  2H0I A;  2C0F A;  3RHB A;  1FB6 A;  1U3A A;  1FVK A;  1JZO A;  1C72 A;  4MMM A;  4OCE A;  1T8E B;  4I2U A;  2H6X A;  2O7K A;  3TJB A;  3VK9 A;  3FZ9 A;  1AIU A;  2HRF A;  2CV4 A;  2GST A;  1R5A A;  1TKD B;  5DAK B;  3HY2 A;  4F0C A;  2A4V A;  1GSY A;  4TXO B;  3J7Y b;  5ECO B;  1QXH A;  2PMT A;  3GL3 A;  3KXO A;  5E4W A;  1A8Y A;  2M46 A;  3D4T A;  3TDG A;  4GSN A;  2NBS A;  3KD0 A;  3APO A;  5IQY A;  2CQ9 A;  2BMX A;  1MDJ A;  3DWV A;  2C3T A;  2JZS A;  2ZCT A;  2GS3 A;  4I2T A;  4NV2 A;  5DDL A;  3CBU A;  1ACV A;  5CO3 A;  4MPG A;  3QAW A;  5IOW A;  1TRS A;  3HVX A;  2HYX A;  2MMA A;  2YV9 A;  4EL1 A;  1A2J A;  2PUK C;  3TGZ A;  1YZX A;  1R5P A;  3FR6 A;  5EVO A;  4EO3 A;  3CMI A;  4MZB A;  4YAP A;  4OCF A;  4NMU A;  4KCA A;  2HT9 A;  1KTE A;  1Z6M A;  4KH7 A;  2EIR A;  2GQK A;  5B8B A;  4G10 A;  1GNW A;  3H8Q A;  3VFI A;  3HCZ A;  4AJ8 A;  5ECH B;  2IMF A;  4DEJ A;  1ERT A;  3HYP A;  3GN3 A;  4BVY A;  2CX3 A;  4HU7 A;  3IAS 2;  2O85 A;  3WYW A;  1XFL A;  4MJB A;  1GP1 A;  4KSO A;  3F63 A;  5G30 A;  4XCS A;  5FWG A;  2VL3 A;  3GX0 A;  2DJ0 A;  4MCU A;  4PUR A;  3ME8 A;  2F8F A;  4KND A;  4ISD A;  3EYT A;  4WET A;  2TRC P;  2K8V A;  3KP9 A;  3UJ1 A;  1Z7P A;  2L57 A;  4POK A;  1QFN A;  5GST A;  1TK5 B;  4ZL7 A;  5L71 A;  4GF0 A;  1G6Y A;  4Q5R A;  3UOM A;  2HRN A;  3TJG A;  3CTF A;  1TI3 A;  3ZZX A;  1SJ6 A;  1NM3 A;  2C3N A;  4K1F A;  5G31 A;  4JR6 A;  1XWC A;  2GLR A;  3TKS E;  3U5R E;  4XIH A;  4MA9 A;  4ECJ A;  4OFM A;  3IXR A;  4KSM A;  4MH3 A;  2DIZ A;  4IGJ A;  3HVS A;  2LS5 A;  2AYT A;  1J0F A;  2HFD A;  2J9H A;  1CQH A;  2AAW A;  3ZFB A;  4PXO A;  2R5G A;  4HS1 A;  2VCV A;  3GTU A;  2HE3 A;  2GZY A;  4ZB9 A;  1GSQ A;  2VCQ A;  1PX7 A;  2G2Q A;  1Y25 A; 
#chains in the Genus database with same CATH topology
 2B6M A;  4G19 A;  3WT1 A;  3ED3 A;  1G0T A;  3LT8 A;  2LUS A;  1Z5Y E;  1Y4K A;  2OCT A;  2OAD A;  2YV7 A;  4PTS A;  1HNA A;  3KMO A;  5G1L A;  2KOK A;  1UCL A;  4I5Q A;  3HDC A;  2LQV A;  1F2E A;  3KII A;  1FW1 A;  2YJ7 A;  1FYS A;  5KP3 A;  3QOU A;  2YWO A;  3GV1 A;  3GSS A;  5LC7 A;  4MJC A;  1OPY A;  1VF4 A;  1SYX A;  1TU5 A;  3HKR A;  2H1G A;  1BOX A;  3KCH A;  1A90 A;  4E8E A;  1ZYE A;  4MMZ B;  1NU3 A;  3BD2 A;  1TFO A;  2GSS A;  1OE8 A;  3ZLP A;  5ECI B;  2N5F A;  3RGA A;  2ZUP A;  5TGN A;  2W04 A;  2YFL B;  2HRK A;  1RRH A;  4K7O A;  3PPU A;  5ECK B;  1TK8 B;  1K3Y A;  1PFP A;  5FGO A;  3HZ4 A;  1BRS A;  2LRT A;  1FGR A;  3ZRD A;  3IR4 A;  1CH0 A;  4XBT A;  4N6T A;  1V98 A;  1TU8 A;  3APQ A;  3GYK A;  2DSA A;  1ULI B;  1V9W A;  2LV3 A;  5DVB A;  1GSS A;  4CPK A;  2RUF A;  4ZXG A;  4G2E A;  1XXU A;  1XWK A;  3LGC A;  4OO5 A;  1GY6 A;  3FGY A;  2QEX 3;  3LYG A;  3HZ8 A;  2VCZ A;  3LML A;  2L1S A;  3C1R A;  1F3A A;  1X9S B;  1MWT A;  4WEY A;  1RGA A;  1TDI A;  3TCO A;  5EQL A;  1BAN A;  3IC4 A;  4HZ2 A;  1T7P B;  3B4P A;  2ZL8 A;  4X4J A;  3FKA A;  5D8I A;  4KW6 A;  4XB5 A;  2X64 A;  5AYR B;  4MEI A;  4K0G A;  1RN7 A;  2AAD A;  2DMM A;  4IBP A;  3FK8 A;  2B5Y A;  5KOX A;  4BWQ A;  2OWP A;  2QA4 3;  3Q3F A;  4BIR A;  2CT6 A;  5D96 A;  8GSS A;  4WFO A;  3G7I A;  1M9A A;  3AY8 A;  4WF4 A;  3C73 A;  2P0G A;  3L0H A;  1IQ8 A;  1YKC A;  2WGQ A;  3DUK A;  4GQF A;  5CP1 A;  3T8N A;  3FYG A;  3QAV A;  3BNE A;  5A4U A;  5KN2 A;  1SYR A;  3UJM A;  3SYU A;  3O8Y A;  3FRC A;  4O5Q A;  3U1W A;  2N5B A;  4POM A;  1Q86 4;  5IEO A;  4F03 A;  2P38 A;  3D5I A;  4J5K A;  1XW9 A;  2A15 A;  4PNF A;  3LSZ A;  2VL9 A;  1G7E A;  2V6K A;  1TRW A;  2ES7 A;  1WPI A;  3D0Z A;  5D81 A;  1F9M A;  1SL0 B;  2AJQ B;  1OHO A;  4WBR D;  1IQY A;  4XDW A;  2HZE B;  3FR3 A;  3GMF A;  4N10 A;  1BAY A;  2C0G A;  5HR0 A;  2DIY A;  2ZNM A;  4LMV A;  2X8G A;  4K6X A;  5B8A A;  1DE1 A;  2L4V A;  3LQ7 A;  1JJ2 2;  1KD1 4;  2CWV A;  2OQE C;  1PKZ A;  3TUE A;  4X0X A;  2KF6 A;  4BVY B;  4IP6 A;  3FG1 A;  4DSS A;  2PVQ A;  2L6D A;  3O76 A;  1GMP A;  1BRI A;  3U97 A;  5AIG A;  1B27 A;  3GAX A;  2H6Y A;  1FGT A;  2NDO A;  2PWJ A;  1CQS A;  5G2G A;  1K73 4;  1PQN A;  3S67 A;  1JN5 A;  4I97 A;  1JHB A;  3H4K A;  2P05 A;  3M3M A;  2EIQ A;  2FXT A;  3UL3 A;  1T1V A;  1MWS A;  1IV7 A;  5BXQ A;  2R37 A;  3CYN A;  3LTB A;  3DGN A;  5GAN D;  2XFS A;  1FAA A;  4MH2 A;  2CG1 A;  3Q1C A;  4OVM A;  2HMK B;  4Q5N A;  1Q42 A;  1O7W B;  1IU7 A;  3AHW A;  5ENU A;  4EKZ A;  2WOH A;  3KKG A;  3CCJ 3;  1A67 A;  1EQK A;  2OTL 3;  3IPZ A;  4MJA A;  2GTU A;  1ZL9 A;  5DAL A;  3FZW A;  1PRX A;  2OA7 A;  3MDK A;  3DH2 A;  3C7M A;  2I1U A;  4X43 A;  3Q2P A;  4LL4 B;  2WUL A;  3I6A A;  2F56 A;  6GSS A;  3K0Z A;  1AUC A;  2K18 A;  3LEF A;  3ZTL A;  2O9U X;  4FYB A;  3AMO A;  5JPP A;  1OAZ A;  1R4Y A;  3WT2 A;  3L0R A;  3MWH A;  1W89 A;  1EOG A;  2P5Q A;  5CK6 A;  1O6J A;  1D6Y A;  3GH9 A;  5IO2 A;  3MIX A;  3WA3 A;  4OD7 A;  2VM2 A;  3ER7 A;  3GZR A;  3ERG A;  2H0G A;  3BB9 A;  2TRX A;  1TW9 A;  3OR5 A;  4EBG A;  3VSY A;  1GY5 A;  4BL2 A;  1H75 A;  5J5N A;  3MNG A;  2R6K A;  3HIG A;  2L5O A;  4IS0 A;  3AHS A;  1X1U A;  2LNT A;  5J9C A;  1XW5 A;  4O92 A;  1X0R A;  2CZ2 A;  3EVI A;  3HJP A;  1RMS A;  3RHC A;  4N30 A;  3TKS A;  3HHV A;  3QRD A;  4N6N B;  3JUM A;  3SBC A;  1DE2 A;  4DSR A;  5EVH A;  3GNJ A;  1JFU A;  1EZK A;  2O8V B;  4IW9 A;  5C00 A;  3EU4 A;  4WYK B;  1BSB A;  1U6T A;  1W00 A;  4NHF A;  5J4U A;  1M0U A;  2AAE A;  2H1A A;  2ALB A;  3C1S A;  3H93 A;  5KP1 A;  4I4K A;  5ECN B;  4MK3 A;  1UI8 A;  3GKK A;  1WRY A;  3UL5 A;  1VGL A;  4KT3 B;  5G2Z A;  5IMV A;  1EV4 A;  3FZ4 A;  2JDI H;  2XH9 A;  3EBT A;  11GS A;  3LYP A;  1QMV A;  3PCS A;  4PQ1 A;  1GL8 A;  4IQ1 A;  3VUR A;  1UGH I;  1SD8 A;  5G1K A;  4Q53 A;  4GRF A;  2NVL A;  1PL1 A;  1LOY A;  3MKI A;  4N6M A;  3CCL 3;  1W01 A;  1SL1 B;  4RI6 A;  2DJ3 A;  3MYT A;  4FMD A;  3FZ5 A;  2CKF B;  4H3U A;  1YY7 A;  2SAR A;  1JZD A;  1LVN A;  3Q18 A;  2BIR A;  4BL7 A;  5IOX A;  1RN4 A;  2PBJ A;  2VCX A;  1YQ1 A;  3D22 A;  1S3D A;  2WCI A;  2H19 A;  1JV2 B;  3U6V A;  2O87 A;  5AGY A;  5JWR B;  1R4W A;  2Z9S A;  1FVJ A;  1RGL A;  2MC8 A;  3ECF A;  2L6C A;  1YVB I;  3GWR A;  2DML A;  3GFK A;  1D6U A;  2B7J A;  1QAL A;  2IME A;  1UUV B;  2GSP A;  1X1X A;  5IPH A;  4KB3 A;  4PGT A;  4ML6 A;  1GTU A;  4JRR A;  1EEJ A;  3FG3 A;  1ILO A;  2XC2 A;  4EVM A;  1M1X B;  1BIR A;  4WXT A;  3BCI A;  4GB5 A;  1GLQ A;  4G9H A;  3UVH A;  2W03 A;  2MMZ A;  5F05 A;  4R9K A;  2ML5 A;  1GSP A;  4E8H A;  2B5E A;  1ERV A;  1DMM A;  1M9G A;  1U88 A;  2LJK A;  4ILF A;  3KSP A;  3EMP A;  3PS8 A;  5CRH A;  1R7H A;  1E97 A;  1YDK A;  3RDE A;  2IPA A;  2VM1 A;  4HBR A;  4XM4 A;  1IYI A;  4R4K A;  1XCC A;  4XRD A;  1A2K A;  3GRD A;  2RII A;  2P0M A;  4IP1 A;  4O02 B;  5CXO A;  2H70 A;  3FKF A;  4PEJ A;  1U5O A;  4FCM A;  3IK7 A;  4LEH A;  1AQX A;  1SU9 A;  2YX9 A;  3HK4 A;  3MAK A;  4J57 E;  3KIJ A;  3IBH A;  1VQ4 3;  3LFL A;  2W9P A;  2PPT A;  1K0B A;  2MMN A;  2D2Z A;  2VLT A;  3S28 A;  3PCR A;  2YPM A;  4RZM A;  2H73 A;  4MJD A;  5DCH A;  1VQL 3;  1RSN A;  2WJU A;  3B8L A;  5BU4 A;  4R1K A;  1O8X A;  4GWR A;  5JCG A;  1BNG A;  2F3M A;  3OV4 A;  3X3Y A;  2HNL A;  3WDG B;  2LTK A;  2W2C A;  4BVX A;  5IEP A;  4LL1 B;  1BNR A;  1YJN 3;  3EPT A;  4HJ2 A;  5H5Q A;  2CFL A;  2C4J A;  1T4Y A;  2ON7 A;  2XPE A;  5LCZ A;  3DML A;  1UDI I;  2L5L A;  4RUV A;  1IQX A;  4JE1 A;  5ELG A;  4ZB8 A;  4FYU A;  4MZW A;  3CC2 3;  3GKX A;  5D83 A;  2VCW A;  3WGD A;  3NQZ A;  2QC7 A;  1RKY A;  1W2Z A;  1AQV A;  3FEU A;  2KF3 A;  1WQL B;  1SQW A;  3CXG A;  20GS A;  5STD A;  2R3X A;  3G7J A;  2V1M A;  1V2A A;  4Z7X A;  4WP5 A;  1OC8 A;  3M8C A;  5CAX A;  4FYC A;  5DBQ A;  2CHC A;  2XSH B;  1GD4 A;  3D5J A;  3L9S A;  3GIX A;  1M2D A;  3E99 A;  3Q74 A;  1RGE A;  3VI5 A;  2C0D A;  1GOY A;  2RM5 A;  3F3Q A;  4EW5 A;  3KFQ C;  3H1N A;  1YKA A;  3ALA A;  1GOU A;  2GXF A;  1K0C A;  4KDX A;  3BND A;  4QWT A;  2R4V A;  1PD2 1;  4EE0 A;  1VRS D;  5FW5 A;  2VCT A;  1IK3 A;  2FD3 A;  2FUG 2;  2AB6 A;  1QK8 A;  3GST A;  1RN1 A;  1JLW A;  1YIJ 3;  3NQY A;  5IMA A;  1DMN A;  1Z6N A;  3F9U A;  2DLX A;  2VLU A;  1OC3 A;  1NWW A;  1QQ2 A;  2CC3 A;  4N3V A;  2YFJ B;  3ZFL A;  1RQM A;  1VF1 A;  4L7K A;  3VPT A;  4MF5 A;  3M9J A;  2I9W A;  3GKM A;  2YWI A;  1WNH A;  1ERU A;  1DVD A;  1UCI A;  2OTJ 3;  4O32 A;  3K5T A;  1VQ7 3;  1VF2 A;  3HA9 A;  1JB4 A;  1IDP A;  1XVW A;  3GZB A;  3JVC A;  1SIH A;  3K7C A;  2L4Q A;  4QQ7 A;  3P2A A;  2X8C A;  1N9J A;  4G0L A;  4XBY A;  2CG0 A;  2B7K A;  5JWO B;  3TJF A;  3E0U A;  3SWL A;  1EOH A;  2YOI A;  3QMX A;  5IPG A;  3EQQ B;  1ISK A;  4KGI A;  1X1Y A;  1I9D A;  1KNG A;  1PGT A;  1RDS A;  1DVC A;  1T2H A;  2IY2 A;  2VOC A;  3PGT A;  1GS3 A;  4K5R A;  3NBR A;  4JU5 A;  3E9J B;  1PN9 A;  2HLS A;  4POB A;  4CDO A;  4BPY A;  1NJI 4;  4EF0 A;  4Z2U A;  4H61 A;  4RQR A;  1VQP 3;  1R4C A;  1RNB A;  3G6E 3;  1KQS 2;  3IE3 A;  1BX9 A;  3CXC 2;  3FZA A;  3KE7 A;  1PU4 A;  1GUM A;  4WR5 A;  3F8H A;  3ZIV A;  1SJZ A;  1GLP A;  3UBL A;  3ZG0 A;  3G8Z A;  3CSJ A;  1B2S A;  1IT8 A;  2GBX B;  5CF1 A;  1RRL A;  5IF6 A;  1VQQ A;  5IMC A;  3H79 A;  3IA1 A;  3EX9 A;  2D1W A;  2C80 A;  2VL2 C;  1ML6 A;  4LMI A;  2QA2 A;  3UAR A;  1BVI A;  1I3F A;  1SD9 A;  4K1V A;  2CVB A;  6GSY A;  3DY5 A;  5CF2 A;  5GZZ B;  1O7P B;  2YFI B;  2WOF A;  3BNB A;  3EN8 A;  1K0M A;  3FSD A;  3EE2 A;  2WO0 A;  4QL7 A;  4CCV A;  1BRN L;  3NUV A;  2XPD A;  4O7H A;  1W2B 2;  6GSV A;  3MHE A;  1XVQ A;  3I56 3;  5EL8 A;  3F7S A;  1TOF A;  3F14 A;  1PKW A;  4JZQ A;  2YN1 A;  2BMO B;  5M1A A;  2F51 A;  1NSW A;  4BA7 A;  4HKV B;  1FOV A;  1Z1S A;  4BL7 B;  1B4Q A;  1G96 A;  2MBS A;  5IEN A;  2CWT A;  2OOV C;  1N8J A;  3ZG5 A;  2CAQ A;  4TR1 A;  3A5W A;  3CPW 2;  1QVG 2;  4JF8 A;  6GSU A;  4BTX A;  2IFQ A;  1HYF A;  5ELA A;  4RNT A;  2WGO A;  1TRP A;  3DM8 A;  3DXO A;  4ZIJ A;  2REM A;  2FA4 A;  3FF2 A;  3QDN A;  3EU3 A;  3H51 A;  1BRJ A;  5HR1 A;  3KM6 A;  2DKH A;  2XSO B;  2C0E A;  5M18 A;  1KWI A;  4TVE A;  1MGR A;  3X3X A;  2XGN A;  2IWT A;  10GS A;  1BSC A;  2PER A;  1TXX A;  3IC8 A;  4KZ1 A;  4TR0 A;  1WMJ A;  4IIA A;  1DMQ A;  3KEB A;  1V40 A;  1XBS A;  3DGY A;  5LC6 A;  4WR4 A;  7RNT A;  4KX4 A;  4BWS A;  1N5H A;  5J3R A;  3CTG A;  1TK0 B;  1V74 A;  1D6Z A;  4F9Z A;  1VQM 3;  1KBN A;  1LU4 A;  4G0I A;  5IO0 A;  5D73 A;  3TKP A;  1OF5 A;  2GQM A;  4ZBA A;  2RCD A;  1PA3 A;  4MMY B;  3AGN A;  2OE3 A;  3KH9 A;  4AJ6 A;  5AYS C;  3D21 A;  2VD0 A;  1WTH A;  2OKA A;  2K6V A;  1OCV A;  3Q6O A;  5IG5 A;  4D73 A;  3QFA C;  3QD9 A;  4FO5 A;  5GSS A;  1TIJ A;  1O7G B;  1NO3 A;  4EV2 A;  2QIY A;  1UA5 A;  4QL9 A;  2VO4 A;  4R9L A;  4Q5F A;  4PQI A;  2SBL A;  1TJD A;  1LOW A;  3JUN A;  4XHM A;  2VIM A;  1Y25 A;  3MYD A;  2IMI A;  3DGQ A;  3M8N A;  3EF8 A;  4NHW A;  2B1L A;  1O7U A;  2DJ2 A;  3P7X A;  3A2V A;  2CFG A;  4EXR A;  3FMW A;  4WKW A;  1TI1 A;  1RGF A;  3BIR A;  4IHU A;  3DVW A;  4NWY A;  4HM8 B;  2PU9 C;  2XF3 A;  2K9F A;  3EUR A;  3I0Y A;  4IEL A;  7STD A;  3ZYW A;  2XFT A;  1Y6E A;  5J9B A;  3CCQ 3;  1Q81 4;  1B2M A;  1OHP A;  3KSE D;  4BVX B;  1T2I A;  4MDC A;  5FT3 A;  4YQU A;  2QSI A;  3STD A;  5JCU A;  4FQU A;  2GZZ A;  3EC3 A;  3ZL5 A;  3TRQ A;  1A2V A;  4KFE A;  1OE7 A;  4J2F A;  4PX1 A;  4V1A g;  1M1K 4;  5AIV A;  4L5L A;  1ZZY A;  1X5E A;  3G0K A;  1LOX A;  3A5I A;  1NW2 A;  1XWA A;  4NXI A;  1BNF A;  2P31 A;  3FY7 A;  2NTO A;  4JED A;  1VQO 3;  3NZN A;  4TR3 A;  3OWU A;  1CYU A;  1TTO A;  3TOT A;  2A2S A;  2I9H A;  2GSQ A;  1XWB A;  1LQG C;  2HSY A;  5ECR B;  3LXT A;  3TOU A;  1B2U A;  4K8M A;  3PYJ A;  4F82 A;  4JBB A;  1GY7 A;  3S5C A;  1ZX2 A;  2OAC A;  1MGW A;  1IYH A;  6GSW A;  2X8H A;  2LST A;  3WGE A;  2R0C A;  3DZL A;  1XW6 A;  2A2R A;  3RBT A;  1QGV A;  2WDU A;  3QFB C;  3NV0 A;  4MMX B;  2A4H A;  3NOF A;  1RTU A;  5ECM B;  4HYZ A;  1OHS A;  2IN3 A;  4ICY A;  3I55 3;  4I8B A;  3DVX A;  1JBR A;  4TOP A;  2HML B;  1YIT 3;  1N8Q A;  13GS A;  4FIW A;  3F4R A;  2E2V A;  1GTB A;  1Q98 A;  2KUC A;  1M7T A;  4ZBD A;  5COH A;  3ROB A;  22GS A;  1B2Z A;  2C8U A;  3S9F A;  1SJW A;  4AGS A;  1JKG A;  1OKT A;  2XHF A;  4OFT A;  3WMD A;  1I0V A;  1B8X A;  1ZYP A;  3VPQ A;  2HI7 A;  4MF7 A;  4ZL9 A;  4HM5 B;  4KFD A;  3FCS B;  1YJW 3;  3KCM A;  1GUK A;  1GMR A;  2LJR A;  5A4W A;  1FO5 A;  1DE3 A;  1S3C A;  5G5E A;  3N9H A;  3NX0 A;  4PUF C;  2F98 A;  2G2Q A;  1AVL A;  4JR4 A;  2VLV A;  1I0X A;  4LGQ A;  5LNK e;  1AAZ A;  3A3T A;  3VF1 A;  5IG0 A;  1SAR A;  3IJE B;  1K0A A;  1HKX A;  2K54 A;  3M9K A;  2PZV A;  3L4N A;  2CVD A;  4NAX A;  2ZA4 A;  3ISO A;  2LKU A;  2JAD A;  3MG1 A;  3GX8 A;  3CME 3;  4HM0 B;  1AXD A;  1FA3 A;  1VQ5 3;  4GTU A;  1J08 A;  4RNY A;  2E2G A;  1YEX A;  4TXV A;  3C8E A;  2D42 A;  1A8L A;  1OVN A;  4V2M A;  1DET A;  2KXG A;  1CYV A;  4BU4 A;  1OYJ A;  4K0N A;  4LA1 A;  2YAN A;  3LYK A;  4TKY A;  3GUR A;  2NPB A;  3NM7 A;  1MEK A;  3SED A;  3VI7 A;  1OUN A;  3CPO A;  3HD5 A;  2KLX A;  3F0I A;  4OWY A;  2BU4 A;  4OFN A;  1PY3 A;  1B9X C;  2AUV A;  2GT5 A;  2P0X A;  3URP A;  3GRX A;  1GSD A;  4L8P A;  1PFO A;  4L5O A;  4EXJ A;  1ROV A;  3D5G A;  1AQW A;  1T00 A;  5ABR A;  4K7I A;  3ZVJ A;  2FNO A;  2FWF A;  2LQQ A;  1PX6 A;  4MZC A;  3X40 A;  2H76 A;  3KTB A;  1FG4 A;  1GH2 A;  3GTU B;  4HQZ A;  2O89 A;  4L8E A;  1B48 A;  2Z6B A;  3WOE B;  1IVW A;  4L8O A;  1B3S A;  4DKI A;  4TN8 A;  3V98 A;  2L4C A;  1YF1 A;  1A0F A;  5F0G A;  1TRQ A;  5HFK A;  1EWX A;  2E2T A;  2KF4 A;  1O7H B;  2STD A;  4YQV A;  1OGX A;  3W6G A;  5AEU B;  1ZMA A;  2IJY A;  4TR1 B;  1K0N A;  4Z2R A;  1F37 A;  4TX4 A;  5IER A;  3EN1 B;  2EC4 A;  1DUG A;  2C10 A;  2BMQ B;  3EMX A;  2WRT A;  2YJH A;  1GTA A;  4KFF A;  4O2H A;  2G0F A;  1F8N A;  1GUL A;  3O3T A;  2YZU A;  1CEW I;  1VQK 3;  1TRV A;  5E59 A;  2HMN B;  3PR8 A;  4IVF A;  2MZC A;  5IW9 A;  4BL3 A;  4K2D A;  2AHE A;  9GSS A;  1QUW A;  1QAK A;  2FLS A;  4N0V A;  2H0H A;  1NB5 I;  1HNC A;  1W4N A;  3WD6 A;  4HZ4 A;  1G02 A;  3KMN A;  1Q40 A;  1B9Y C;  5CRE A;  2JQ5 A;  3HJO A;  4YH2 A;  1AC1 A;  3CRT A;  4G1M B;  3CC7 3;  1OF5 B;  2TIR A;  1F6M C;  4F2I A;  3AGO A;  3ZML A;  2PNC A;  12GS A;  3IPT A;  3RDW A;  5HFG A;  2H01 A;  4IT7 A;  2OBI A;  2BO9 B;  1YGW A;  3IAM 2;  3J7Y k;  3KGK A;  3LT9 A;  3KJY A;  3GKN A;  2LJA A;  3ZIT A;  1BRH A;  1SKW B;  3A2W A;  2BNG A;  1EGR A;  2RFR A;  5EPF A;  3S29 A;  6STD A;  2H72 A;  4BTY A;  2FWG A;  5DJL A;  2CFW A;  5CYY A;  3JUO A;  2OE0 A;  2INX A;  1MD3 A;  1AY7 A;  4EUY A;  2DBC A;  5JCW A;  3D3L A;  4HJL B;  3DXB A;  1UCJ A;  2CFD A;  3V1W A;  3RGR A;  4WF5 A;  4POL A;  4LSO A;  2LNS A;  4J9A A;  1ZYN A;  4K1U A;  1IVU A;  3W8J A;  2JU5 A;  1W6Y A;  1HU9 A;  1JBT A;  3LG6 A;  1LXE A;  3G16 A;  3NBJ A;  1SL2 B;  1S3R A;  2W56 A;  3VGN A;  2GZP A;  2YP6 A;  1LQM B;  4YQM A;  2XR8 B;  3VLN A;  1R26 A;  3JUQ A;  1Z3E A;  5HQP A;  1YNV X;  1K41 A;  4CY6 A;  4I6X A;  4J5G A;  3CSI A;  8RNT A;  1I2E A;  2V1L A;  2B5X A;  4N6L A;  3IK9 A;  4KA0 A;  1MTC A;  1RCL A;  2Y74 A;  4V1A p;  4HAA A;  1DSB A;  1SII A;  1ZGN A;  1H4O A;  1BYE A;  4GQC A;  2HMM B;  2V32 A;  2EIO A;  7GSS A;  2CW9 A;  4HUA A;  4FR9 A;  2YWM A;  2GU1 A;  3SOA A;  2IMD A;  4K2X A;  4ULX A;  2UX0 A;  4HZ9 B;  4PUA A;  3UAP A;  1BJX A;  1ERW A;  1MDI A;  5D93 A;  1USB A;  3A76 A;  1THO A;  5C04 A;  1B2X A;  3F8X A;  4ORL A;  2W9Q A;  1KEB A;  4OMV A;  2RBI A;  1KC8 4;  5A4V A;  3HI7 A;  4HQS A;  3FR9 A;  3N9J A;  2OQE A;  3G7Y A;  1GSE A;  1N2A A;  2GSR A;  2I4A A;  4N6O B;  5B6M A;  2OBK A;  19GS A;  1WJK A;  5ECQ B;  4XS1 A;  3CCV 3;  4V2N A;  5CRG A;  1K3O A;  1E6B A;  3F7X A;  3IOS A;  1JNQ A;  3DGO A;  4DSS B;  2CVK A;  4GSS A;  3GSP A;  2E2U A;  4MNN A;  1RLS A;  4FMB A;  3UB1 A;  1NHO A;  2VAF A;  4RQX A;  1WIK A;  1FGM A;  2ON5 A;  4STD A;  3FW2 A;  3NHX A;  2FGX A;  1UCK A;  2CZ3 A;  3GH6 A;  1WMO A;  1C7H A;  1JN5 B;  3WGX A;  2KCD A;  3PZW A;  4KAE A;  3FH1 A;  3US3 A;  2WB9 A;  4ECC A;  2H74 A;  4IJI A;  5ID2 A;  4FCJ A;  2I3Y A;  4TRX A;  2P5R A;  2C4B A;  2V6O A;  2H6Z A;  5CRD A;  3PXM A;  2XBI A;  4EDZ A;  2QGV A;  1YEP A;  4OO4 A;  4XS4 A;  3VWW A;  1VQN 3;  1S72 3;  2CWU A;  3UIW A;  5CNW A;  2KF5 A;  4EIQ A;  1TU7 A;  4AKY A;  5D82 A;  3R3E A;  4AJ7 A;  4LLR A;  4IQA A;  2B3S A;  3NBB A;  2F8A A;  1HD2 A;  2HXK A;  3EE1 A;  4N6U A;  3V99 A;  2IIY A;  3Q19 A;  3DD3 A;  3GUS A;  5DRE A;  2BMR B;  4MAB A;  1BUQ A;  4XDV A;  2WZ9 A;  5DAL B;  1RK4 A;  1EG9 B;  4HEA 2;  1JB2 A;  2HZE A;  5IM9 A;  1MD4 A;  1NHY A;  1ZS7 A;  3TB2 A;  3KH7 A;  4GCI A;  4O3V A;  1OKD A;  3K63 A;  1GSU A;  2M72 A;  3AMO B;  1TUH A;  3S27 A;  1T3B A;  3ZMK A;  1AQZ A;  3L9U A;  3GA4 A;  4KCE A;  3FG4 A;  1I70 A;  4XRA A;  3TJK A;  2GQL A;  5J41 A;  1ZGX A;  1XOA A;  2DKI A;  4WWU C;  5A0O B;  5KN3 A;  3BCK A;  1M3I A;  1RW1 A;  1E3V A;  3CD6 3;  3H3H A;  3BNC A;  1EEM A;  3VWU A;  4AF2 A;  4DSQ A;  1M2B A;  1L5G B;  2GEY A;  1A2P A;  3QR6 A;  2C11 A;  1EP8 A;  2XRX B;  3W8S A;  2ZDJ A;  1TRU A;  1JZW A;  2Z76 A;  4HM1 B;  1S3A A;  3D6I A;  5KN0 A;  3OW2 2;  3CNX A;  1HNB A;  1ON4 A;  2KHP A;  2CX4 A;  3CC4 3;  3ERF A;  2M7O A;  2RNT A;  2FWH A;  5AI1 A;  4BTW A;  3EB8 A;  4Q5Q A;  1TP6 A;  4CW9 A;  4YKG A;  1EUI C;  3DIE A;  1W5Z A;  1UN2 A;  1THX A;  2H71 A;  5ECP B;  2J8X B;  3I9V 2;  3SLU A;  1QJG A;  1K0D A;  2CAI A;  4ZB6 A;  5HFI A;  4FCZ A;  2Z7A A;  4KDY A;  6GSX A;  3UBK A;  3I43 A;  1O8W A;  3F4S A;  4K90 B;  4HI7 A;  4ZIL A;  3G71 3;  3LTA A;  4HZB B;  1MWR A;  4RNZ A;  5LD0 A;  2HMJ B;  4MF6 A;  1T4Z A;  1F3B A;  3A5E A;  1WMN A;  5F07 A;  1ST9 A;  1A2M A;  2HZF A;  4FH8 A;  1PMT A;  3X41 A;  3BLZ A;  4L0U A;  3BOA A;  1Q40 B;  1O81 A;  3UVT A;  3B4O A;  2JZT A;  2HSM A;  1STF I;  1M9B A;  3I69 A;  1O73 A;  3GZX B;  2BHM A;  2F9S A;  3BU4 A;  3UMA A;  3IV4 A;  3HVV A;  3ZRE A;  3T0U A;  1WE0 A;  1ABA A;  1GRX A;  3G4S 3;  3IMA B;  1RJO A;  1XZO A;  2WGR A;  4ACS A;  1FZU A;  1YI2 3;  3O6T A;  5D9T A;  1EGO A;  4JRF A;  2X99 A;  1Q82 4;  3M0F A;  2E7P A;  5D9X A;  2R2J A;  4K61 A;  2RM6 A;  5ECS A;  4A5P A;  4CDL A;  2F86 B;  1A0R P;  2Q07 A;  1WOU A;  1X5D A;  2FHE A;  2OJL A;  4AKZ A;  1EKM A;  3KP8 A;  16GS A;  4N0Z A;  2IYJ A;  3DRN A;  4EYC A;  2K3D A;  1JZR A;  3TKS C;  2UGI A;  2GT6 A;  5AN1 A;  2L59 A;  4WYK A;  3RPN A;  1XWG A;  2C1Y A;  4O5R A;  4ECI A;  2H8L A;  2XBQ A;  1VQ9 3;  1SK0 A;  1LNI A;  5IMD A;  5AIH A;  1JLV A;  1FHE A;  2H1D A;  1GOV A;  5H5R A;  2E2M A;  1NNV A;  1UGI A;  3APS A;  4HM3 B;  2YWN A;  2H30 A;  2GGT A;  3L78 A;  4CHS A;  4GXZ A;  1FOH A;  3A2X A;  3LJR A;  4ID0 A;  1PSQ A;  1PN0 A;  3TKQ A;  2FWE A;  3VWV A;  2MMO A;  1B4P A;  5AIF A;  2YCD A;  2W56 B;  1PL2 A;  2IL3 A;  3DEX A;  4LMW A;  1WWJ A;  2CA8 A;  5CRW A;  1BU4 A;  2DC5 A;  2GBW B;  4R80 A;  3X42 A;  1OAC A;  4O8S A;  1UVZ A;  1VF3 A;  3IRA A;  5HR3 A;  2HMO B;  3GL5 A;  1OC9 A;  4USS A;  1XG8 A;  1FGQ A;  1QMA A;  1VQ6 3;  1I2F A;  4DVC A;  3OWY A;  3NM2 A;  2K0M A;  2LRN A;  1HQO A;  5GAP D;  2YZH A;  4X1U A;  3OXA A;  14GS A;  4GLT A;  3WHO A;  1X5C A;  3EHC A;  1M2A A;  1SPU A;  1SKR B;  2FGT A;  3K8N A;  1KSI A;  3SXX A;  2R0P A;  4K5S A;  5D9V A;  5JPU A;  2GVP A;  1Q4J A;  2R41 A;  1C54 A;  4EC6 A;  5H5S A;  1AR0 A;  1BNJ A;  4TW5 A;  1K0O A;  1RGG A;  1OH0 A;  3KTL A;  1XIY A;  5D9W A;  4IPB A;  4ML1 A;  1ZCP A;  4ZBB A;  3TJJ A;  2LEG A;  2KAA A;  1GSF A;  1URM A;  3E3E A;  2JZR A;  2LRC A;  4XS6 A;  4J56 E;  2A2P A;  4BIK A;  5ECL B;  4KDU A;  3D9R A;  4YAV A;  5F06 A;  4X2O A;  3HZP A;  4KE3 A;  4IN0 A;  1GNE A;  2BJX A;  2QGU A;  1U3I A;  2LQO A;  1MNL A;  1N5P A;  2CFK A;  3M1G A;  1X1W A;  4HJM A;  3GHA A;  4WBJ A;  5G5F A;  5AIS A;  4KVH A;  1BQ7 A;  2AV4 A;  1YF0 A;  2IUK A;  1FUS A;  1EP7 A;  2PGT A;  4KUN A;  1LBK A;  5DAK A;  5GSP A;  5ID2 B;  18GS A;  5IMF A;  1Q9E A;  1XPV A;  5INY A;  4K7N A;  3DMC A;  2KP2 A;  3UNL A;  2J23 A;  3PIN A;  4TXO A;  4RI7 A;  1SK1 A;  3QPM A;  3TRP A;  4NPB A;  5JBS A;  2R4I A;  4XS4 B;  1DBY A;  2W0Q A;  1A23 A;  4MP4 A;  3RNT A;  2FA8 A;  2K8S A;  2IMJ A;  2V2G A;  4P3Y B;  3HVN A;  1GUH A;  1OGZ A;  5KOW A;  2YNX A;  4TR4 A;  1JBS A;  2DJ1 A;  1XOB A;  3ME7 A;  1PYL A;  2BTO T;  5IG4 A;  4NV5 A;  5JWQ B;  1NDO B;  3LXZ A;  1K8A 4;  4PQH A;  2Y73 A;  4XTS A;  3HJM A;  4GL6 A;  2VD1 A;  1RGC A;  3IDV A;  4XBX A;  4V2L A;  2CK3 H;  1MOL A;  4K9Z A;  2V41 A;  3R2Q A;  2CX1 A;  2WFC A;  5ELU A;  3UL6 A;  2DJK A;  2RGQ A;  5EY6 A;  3F3R A;  3KZQ A;  3TRX A;  1AW9 A;  1UUW B;  2KRT A;  1YGE A;  8CHO A;  1ZO2 A;  3GZY B;  5KEJ A;  1T5Y A;  4HU9 A;  1RNT A;  1SJI A;  4MJE A;  4ECB A;  2UZ8 A;  3EBY A;  4RBN A;  5KP4 A;  1A2L A;  5DQY A;  2JSY A;  1J9B A;  3FHK A;  4F0B A;  2I81 A;  1DYU A;  3JCM L;  1M99 A;  3ZVJ D;  3G9B A;  5AII A;  1K28 A;  3CCM 3;  1Q7H A;  3B7C A;  2IUJ A;  1BNI A;  4HDE A;  3BJ5 A;  3D4M A;  1CQG A;  1W02 A;  2RLI A;  4HOJ A;  4WHA A;  2QA1 A;  1HYU A;  1WP0 A;  1U87 A;  2LYX A;  1SKS B;  2JAC A;  1EV9 A;  2VL2 A;  2JSZ A;  3X3Z A;  1BED A;  3LTC A;  2W6J H;  1I3I A;  5F8B A;  4EIP A;  3MSZ A;  1UUG B;  1BUJ A;  1BG5 A;  4PNG A;  4N6V 0;  3ZIJ A;  1A24 A;  4LZI A;  2PN8 A;  1MWU A;  4X2H A;  5DRV A;  5AIX A;  2B24 B;  1GD3 A;  3P8W A;  3SOY A;  2B1K A;  5KN1 A;  1AV4 A;  3N54 B;  3ERW A;  4MLY A;  3F9S A;  3OX9 A;  3J7Y d;  2DJJ A;  4AEQ A;  3MPH A;  1EA2 A;  4L0W A;  1UW1 A;  5CLK A;  1BGS A;  1N9E A;  6GSP A;  3IHG A;  2PVO C;  1VZZ A;  4EV5 A;  1ASK A;  2OOV A;  1MDK A;  1RGH A;  7GSP A;  5A5K A;  4EC0 A;  1W4V A;  3F4T A;  2QKE A;  2IFQ B;  1Z9H A;  5B6N A;  1M3J A;  3LXU X;  3LH4 A;  1TP9 A;  3MG3 A;  3SVA A;  3QAG A;  1FUT A;  3DKS A;  3EJV A;  1X9W B;  3ZFZ A;  4KF9 A;  1ZYQ B;  3PH9 A;  3LOR A;  1FW7 A;  2FCH A;  4ZL8 A;  4HM4 B;  1I2G A;  1I5G A;  3CSH A;  3QCP A;  1FGO A;  4EDY A;  3NXJ A;  4FMC A;  3EWL A;  2H75 A;  4G0K A;  1ZOF A;  5AEW B;  1Z7R A;  2H1B A;  5BIR A;  3BBY A;  1QVF 2;  4HSC X;  2VUP A;  2F4Y A;  4J8T A;  2GDR A;  2CIU A;  2KP1 A;  5IMZ A;  3RAZ A;  4HM2 B;  1G6W A;  4GSP A;  1YJ9 3;  3TKR A;  2N5A A;  4H86 A;  5DCG A;  4GST A;  2M80 A;  1JB5 A;  5B7C A;  4IJ3 A;  1GTI A;  5DQS A;  6GST A;  1X9M B;  3T8U A;  3KN4 A;  1O85 A;  1STD A;  5FHI A;  1TTZ A;  5BMU A;  4IKH A;  3LWA A;  4D73 B;  1LOV A;  1E2Y A;  1OC9 B;  4GHO A;  1FB0 A;  1RHL A;  2GEX A;  1G7O A;  3CRU A;  4NHZ A;  2FY6 A;  4N11 A;  6RNT A;  2MYG A;  3UEM A;  2JL4 A;  2MBT A;  3C71 A;  3DGM A;  4HOH A;  3L9V A;  3IHQ A;  3MSO A;  2ZHX B;  1UC7 A;  1K3L A;  2F99 A;  3N5O A;  3WOD G;  3HXS A;  3NIV A;  4MPF A;  2HSH A;  5DJM A;  3CCE 3;  2RUE A;  3P90 A;  1V57 A;  2H66 A;  1V58 A;  1LJR A;  3DGL A;  1SEN A;  2OE1 A;  3RPP A;  3F8U A;  1SK2 A;  3CMA 3;  2WS2 A;  2IMK A;  1GWC A;  1QAF A;  5HGR A;  5IIZ A;  2RSX A;  2FNQ A;  3F6D A;  2E0Q A;  3F6F A;  2C3Q A;  2R0G A;  5HR2 A;  3DYR A;  1YJ6 A;  3VWX A;  1B20 A;  3EIN A;  9RNT A;  2H0I A;  2C0F A;  3RHB A;  1IVV A;  4NRE A;  1FB6 A;  2XGL A;  3N8B A;  1N8R 4;  1U3A A;  1BSD A;  5ELJ A;  1FVK A;  1JZO A;  1C72 A;  4MMM A;  4OCE A;  1T8E B;  4I2U A;  2H6X A;  2O7K A;  3TJB A;  3VK9 A;  3FZ9 A;  1AIU A;  5BVB A;  2HRF A;  2CV4 A;  2GST A;  1R5A A;  1TKD B;  5DAK B;  3PGB A;  4LYL B;  3HY2 A;  4F0C A;  2A4V A;  1GSY A;  4TXO B;  3J7Y b;  1RGK A;  3NV0 B;  5ECO B;  1QXH A;  2PMT A;  3GL3 A;  5I97 A;  5IG3 A;  3KXO A;  1BNE A;  5E4W A;  1W7C A;  1A8Y A;  4YKF A;  3CQF A;  1BNS A;  2M46 A;  3D4T A;  3TDG A;  4GSN A;  2NBS A;  2XEP A;  3KD0 A;  1WMP A;  3SX1 A;  3APO A;  2P09 A;  5IQY A;  3CU3 A;  1B21 A;  2CQ9 A;  2BMX A;  1JKG B;  1MDJ A;  3DWV A;  4OK0 A;  2C3T A;  2JZS A;  2ZCT A;  2GS3 A;  4I2T A;  1US1 A;  4NV2 A;  3JUP A;  5DDL A;  3HOH A;  3CBU A;  1ACV A;  5HOH A;  1BRG A;  4ZM8 A;  5CO3 A;  4MPG A;  3QAW A;  1UI7 A;  5IOW A;  1TRS A;  3HVX A;  2HYX A;  1O7M B;  2MMA A;  1M90 4;  1ULJ B;  2YV9 A;  4EL1 A;  1BAO A;  2B1X B;  1A2J A;  2PUK C;  1W6C A;  3TGZ A;  1YZX A;  1R5P A;  3FR6 A;  5EVO A;  2UUG C;  4EO3 A;  3CMI A;  3F40 A;  4MZB A;  3QK9 A;  4YAP A;  3WR2 A;  1BSE A;  4OCF A;  1NB3 I;  4NMU A;  4KCA A;  2HT9 A;  1KTE A;  2X49 A;  1Z6M A;  4KH7 A;  5RNT A;  1LNH A;  2EIR A;  2GQK A;  3LZA A;  5B8B A;  4G10 A;  3KZT A;  1GNW A;  3H8Q A;  3VFI A;  4U13 A;  1U8C B;  1YVS A;  3HCZ A;  4HM7 B;  4AJ8 A;  5EEO A;  5ECH B;  2IMF A;  4DEJ A;  1ERT A;  3HYP A;  3GN3 A;  4BVY A;  2CX3 A;  4HU7 A;  3IAS 2;  2ML6 A;  2O85 A;  2F5M A;  2CH9 A;  2CX0 A;  3WYW A;  1XFL A;  4MJB A;  1GP1 A;  2BT3 A;  4KSO A;  3F63 A;  1IVX A;  5G30 A;  4XCS A;  5FWG A;  2VL3 A;  3CCR 3;  2DJ0 A;  1LRA A;  3Q90 A;  3GX0 A;  3MWZ A;  5M19 A;  4MCU A;  2HOH A;  4PUR A;  3ME8 A;  2F8F A;  4KND A;  4ISD A;  3EYT A;  2Z77 A;  4WET A;  1S5A A;  1O7N B;  2TRC P;  2K8V A;  2F5W A;  3KP9 A;  3UJ1 A;  1ROA A;  1W6G A;  1Z7P A;  4FMA A;  1Q7Y 4;  1GMQ A;  2L57 A;  1IT7 A;  4POK A;  3FF0 A;  3LTD A;  2X4A A;  5BRT A;  4HM6 B;  1QFN A;  1JRQ A;  5GST A;  3FLJ A;  1TK5 B;  4ZL7 A;  5L71 A;  4GF0 A;  1G6Y A;  4Q5R A;  1TFK A;  3D4A A;  4CJN A;  3UOM A;  1GYB A;  2HRN A;  3TJG A;  3CTF A;  4O5U A;  1TI3 A;  3EC9 A;  3LW9 A;  3D79 A;  3HX8 A;  3ZZX A;  1SJ6 A;  1AVK A;  1HZ1 A;  1NM3 A;  3WA2 X;  2C3N A;  1K9M 4;  4K1F A;  3HII A;  5G31 A;  3CCS 3;  4Z2T A;  3OWS A;  4CY8 A;  2MF7 A;  1IYY A;  4JR6 A;  1XWC A;  2GLR A;  3TKS E;  1J2B A;  1VQ8 3;  1E3R A;  3CNM A;  3U5R E;  4XIH A;  4MA9 A;  4ECJ A;  4OFM A;  2IA7 A;  1RCK A;  3IXR A;  4KSM A;  1BSA A;  4MH3 A;  1I8V A;  2DIZ A;  4IGJ A;  3K9M C;  3HVS A;  2LS5 A;  2GU3 A;  2AYT A;  4OUQ A;  1IV9 A;  1J0F A;  1YHQ 3;  2HFD A;  2J9H A;  3LOY A;  1CQH A;  3MG2 A;  2AAW A;  3ZFB A;  4PXO A;  3V92 A;  3WOF B;  2R5G A;  4HS1 A;  4HVN A;  2VCV A;  3GTU A;  3CCU 3;  2HE3 A;  2O3O A;  2GZY A;  4ZB9 A;  1BRK A;  1GSQ A;  2VCQ A;  1PX7 A;  2HRA A;  17GS A;  1FUW A; 
#chains in the Genus database with same CATH homology
 2B6M A;  4G19 A;  3WT1 A;  3ED3 A;  1G0T A;  2LUS A;  1Z5Y E;  2OAD A;  2YV7 A;  4PTS A;  1HNA A;  3KMO A;  5G1L A;  2KOK A;  3HDC A;  4I5Q A;  1F2E A;  1FW1 A;  2YJ7 A;  3QOU A;  2YWO A;  3GV1 A;  3GSS A;  4MJC A;  1VF4 A;  1SYX A;  3HKR A;  2H1G A;  4E8E A;  1ZYE A;  3BD2 A;  2GSS A;  1OE8 A;  3ZLP A;  5ECI B;  2N5F A;  2ZUP A;  2HRK A;  4K7O A;  3PPU A;  5ECK B;  1TK8 B;  1K3Y A;  3HZ4 A;  2LRT A;  3ZRD A;  3IR4 A;  1V98 A;  1TU8 A;  3APQ A;  3GYK A;  2DSA A;  1V9W A;  2LV3 A;  5DVB A;  1GSS A;  2RUF A;  4ZXG A;  4G2E A;  1XXU A;  1XWK A;  3LGC A;  4OO5 A;  3HZ8 A;  2VCZ A;  3C1R A;  1F3A A;  1X9S B;  4WEY A;  1TDI A;  3TCO A;  3IC4 A;  4HZ2 A;  1T7P B;  4X4J A;  5D8I A;  4KW6 A;  2X64 A;  4K0G A;  2DMM A;  4IBP A;  3FK8 A;  2B5Y A;  5KOX A;  4BWQ A;  2CT6 A;  5D96 A;  8GSS A;  3G7I A;  1M9A A;  3AY8 A;  4WF4 A;  3C73 A;  2P0G A;  3L0H A;  1YKC A;  4GQF A;  5CP1 A;  3FYG A;  3QAV A;  5A4U A;  5KN2 A;  1SYR A;  3FRC A;  4O5Q A;  2N5B A;  4POM A;  4F03 A;  4PNF A;  1XW9 A;  3LSZ A;  2VL9 A;  1G7E A;  2V6K A;  1TRW A;  2ES7 A;  1WPI A;  3D0Z A;  1F9M A;  1SL0 B;  2AJQ B;  4WBR D;  2HZE B;  3FR3 A;  3GMF A;  4N10 A;  1BAY A;  2C0G A;  5HR0 A;  2DIY A;  2ZNM A;  4LMV A;  2X8G A;  4K6X A;  5B8A A;  1DE1 A;  3LQ7 A;  1PKZ A;  3TUE A;  4X0X A;  4BVY B;  4IP6 A;  4DSS A;  2PVQ A;  2L6D A;  3O76 A;  2H6Y A;  2NDO A;  2PWJ A;  1PQN A;  4I97 A;  1JHB A;  3H4K A;  3M3M A;  2EIQ A;  3UL3 A;  1T1V A;  2R37 A;  3CYN A;  5GAN D;  1FAA A;  4MH2 A;  4Q5N A;  5ENU A;  4EKZ A;  3IPZ A;  4MJA A;  2GTU A;  1ZL9 A;  5DAL A;  1PRX A;  2OA7 A;  3MDK A;  3C7M A;  2I1U A;  4X43 A;  4LL4 B;  2WUL A;  3I6A A;  6GSS A;  3LEF A;  1AUC A;  2K18 A;  3ZTL A;  4FYB A;  1OAZ A;  3WT2 A;  3MWH A;  1W89 A;  1EOG A;  2P5Q A;  1O6J A;  3GH9 A;  5IO2 A;  3MIX A;  4OD7 A;  2VM2 A;  3ERG A;  2H0G A;  2TRX A;  1TW9 A;  3OR5 A;  1H75 A;  5J5N A;  3MNG A;  2R6K A;  2L5O A;  4IS0 A;  5J9C A;  2LNT A;  1XW5 A;  4O92 A;  1X0R A;  2CZ2 A;  3EVI A;  3HJP A;  3RHC A;  4N30 A;  3TKS A;  3HHV A;  3SBC A;  1DE2 A;  4DSR A;  3GNJ A;  1JFU A;  1EZK A;  2O8V B;  4IW9 A;  5C00 A;  3EU4 A;  1U6T A;  5J4U A;  1M0U A;  2H1A A;  2ALB A;  3C1S A;  3H93 A;  5ECN B;  4MK3 A;  3GKK A;  1WRY A;  1VGL A;  5G2Z A;  5IMV A;  1EV4 A;  3FZ4 A;  11GS A;  3LYP A;  1QMV A;  4PQ1 A;  1GL8 A;  4IQ1 A;  3VUR A;  1SD8 A;  5G1K A;  4GRF A;  2NVL A;  1PL1 A;  1SL1 B;  4RI6 A;  2DJ3 A;  3FZ5 A;  1YY7 A;  1JZD A;  3Q18 A;  4BL7 A;  5IOX A;  2PBJ A;  2VCX A;  1YQ1 A;  3D22 A;  1S3D A;  2WCI A;  2H19 A;  3U6V A;  2O87 A;  5AGY A;  5JWR B;  1R4W A;  2Z9S A;  1FVJ A;  2L6C A;  2DML A;  3GFK A;  2B7J A;  2IME A;  5IPH A;  4KB3 A;  4PGT A;  4ML6 A;  1GTU A;  4JRR A;  1EEJ A;  1ILO A;  2XC2 A;  4EVM A;  4WXT A;  3BCI A;  1GLQ A;  4G9H A;  3UVH A;  2MMZ A;  5F05 A;  4E8H A;  2B5E A;  1ERV A;  1U88 A;  2LJK A;  4ILF A;  3EMP A;  5CRH A;  1R7H A;  1YDK A;  2IPA A;  2VM1 A;  1IYI A;  1XCC A;  4XRD A;  2RII A;  4IP1 A;  2H70 A;  3FKF A;  3IK7 A;  1AQX A;  1SU9 A;  3MAK A;  4J57 E;  3KIJ A;  3IBH A;  3LFL A;  2PPT A;  1K0B A;  2MMN A;  2D2Z A;  2VLT A;  2YPM A;  2H73 A;  5DCH A;  2WJU A;  1O8X A;  4GWR A;  5JCG A;  2F3M A;  2HNL A;  2LTK A;  4BVX A;  4LL1 B;  4HJ2 A;  3EPT A;  5H5Q A;  2C4J A;  1T4Y A;  2ON7 A;  2XPE A;  5LCZ A;  3DML A;  2L5L A;  4RUV A;  4JE1 A;  5ELG A;  4ZB8 A;  4FYU A;  4MZW A;  3GKX A;  2VCW A;  3WGD A;  2QC7 A;  1AQV A;  3FEU A;  3CXG A;  20GS A;  2R3X A;  3G7J A;  2V1M A;  1V2A A;  4Z7X A;  1OC8 A;  5CAX A;  4FYC A;  5DBQ A;  3D5J A;  3L9S A;  3GIX A;  1M2D A;  3Q74 A;  3VI5 A;  2C0D A;  2RM5 A;  3F3Q A;  3H1N A;  1YKA A;  1K0C A;  4KDX A;  2R4V A;  4EE0 A;  1PD2 1;  1VRS D;  2VCT A;  2FD3 A;  2FUG 2;  2AB6 A;  1QK8 A;  3GST A;  1JLW A;  5IMA A;  1Z6N A;  3F9U A;  2DLX A;  2VLU A;  1OC3 A;  1QQ2 A;  3ZFL A;  1RQM A;  1VF1 A;  3VPT A;  4MF5 A;  3M9J A;  3GKM A;  2YWI A;  1ERU A;  4O32 A;  1VF2 A;  3HA9 A;  1XVW A;  2L4Q A;  4QQ7 A;  3P2A A;  2X8C A;  4G0L A;  2B7K A;  5JWO B;  3TJF A;  3E0U A;  3SWL A;  1EOH A;  2YOI A;  3QMX A;  5IPG A;  4KGI A;  1I9D A;  1KNG A;  1PGT A;  2IY2 A;  2VOC A;  3PGT A;  4K5R A;  4JU5 A;  3E9J B;  1PN9 A;  2HLS A;  4POB A;  4CDO A;  4BPY A;  4EF0 A;  4Z2U A;  4RQR A;  3IE3 A;  1BX9 A;  3FZA A;  1GUM A;  4WR5 A;  3ZIV A;  1SJZ A;  1GLP A;  3UBL A;  3CSJ A;  5IMC A;  3H79 A;  3IA1 A;  2C80 A;  2VL2 C;  1ML6 A;  2QA2 A;  3UAR A;  1SD9 A;  2CVB A;  6GSY A;  5GZZ B;  1K0M A;  3EE2 A;  4QL7 A;  2XPD A;  4O7H A;  6GSV A;  1XVQ A;  5EL8 A;  1TOF A;  1PKW A;  4JZQ A;  2YN1 A;  4BA7 A;  2F51 A;  1FOV A;  1NSW A;  4BL7 B;  1B4Q A;  2MBS A;  1N8J A;  2CAQ A;  4TR1 A;  3A5W A;  6GSU A;  2IFQ A;  5ELA A;  4ZIJ A;  2REM A;  2FA4 A;  3QDN A;  3EU3 A;  5HR1 A;  3KM6 A;  2DKH A;  2C0E A;  4TVE A;  2IWT A;  10GS A;  2PER A;  1TXX A;  3IC8 A;  4TR0 A;  1WMJ A;  3KEB A;  1V40 A;  1XBS A;  4WR4 A;  4KX4 A;  4BWS A;  5J3R A;  3CTG A;  1TK0 B;  4F9Z A;  1KBN A;  1LU4 A;  4G0I A;  5IO0 A;  5D73 A;  3TKP A;  2GQM A;  4ZBA A;  1PA3 A;  2OE3 A;  3KH9 A;  4AJ6 A;  3D21 A;  2VD0 A;  2OKA A;  2K6V A;  3Q6O A;  4D73 A;  3QFA C;  3QD9 A;  4FO5 A;  5GSS A;  1UA5 A;  4QL9 A;  2VO4 A;  4Q5F A;  4PQI A;  1TJD A;  4XHM A;  2VIM A;  3MYD A;  2IMI A;  3DGQ A;  3M8N A;  4NHW A;  2B1L A;  1O7U A;  2DJ2 A;  3P7X A;  3A2V A;  3FMW A;  4WKW A;  5DQY A;  1TI1 A;  4IHU A;  3DVW A;  4NWY A;  2PU9 C;  2K9F A;  3EUR A;  4IEL A;  3ZYW A;  1Y6E A;  5J9B A;  4BVX B;  4MDC A;  5FT3 A;  4YQU A;  2QSI A;  5JCU A;  4FQU A;  2GZZ A;  3EC3 A;  3ZL5 A;  3TRQ A;  1OE7 A;  4J2F A;  4PX1 A;  4V1A g;  5AIV A;  4L5L A;  1ZZY A;  1X5E A;  3A5I A;  1NW2 A;  1XWA A;  4NXI A;  2P31 A;  3FY7 A;  2NTO A;  4JED A;  3NZN A;  4TR3 A;  3TOT A;  2A2S A;  2I9H A;  2GSQ A;  1XWB A;  2HSY A;  5ECR B;  3LXT A;  3TOU A;  4K8M A;  4F82 A;  4JBB A;  2OAC A;  1IYH A;  6GSW A;  2X8H A;  2LST A;  3WGE A;  2R0C A;  1XW6 A;  2A2R A;  3RBT A;  1QGV A;  2WDU A;  3QFB C;  2A4H A;  3NOF A;  5ECM B;  2IN3 A;  4ICY A;  4I8B A;  3DVX A;  4TOP A;  13GS A;  4FIW A;  3F4R A;  1Q98 A;  1GTB A;  4ZBD A;  2KUC A;  1M7T A;  5COH A;  22GS A;  2C8U A;  3S9F A;  4AGS A;  1OKT A;  2XHF A;  4OFT A;  1B8X A;  1ZYP A;  3VPQ A;  2HI7 A;  4MF7 A;  4ZL9 A;  3KCM A;  1GUK A;  2LJR A;  5A4W A;  1FO5 A;  1S3C A;  5G5E A;  4PUF C;  4JR4 A;  2VLV A;  5LNK e;  1AAZ A;  3A3T A;  1K0A A;  3M9K A;  3L4N A;  2CVD A;  4NAX A;  3ISO A;  2LKU A;  2JAD A;  3GX8 A;  1AXD A;  4GTU A;  1J08 A;  2E2G A;  1YEX A;  4TXV A;  3C8E A;  1A8L A;  1OVN A;  4V2M A;  4LA1 A;  1OYJ A;  4K0N A;  2YAN A;  3LYK A;  4TKY A;  3GUR A;  2NPB A;  1MEK A;  3VI7 A;  3HD5 A;  2KLX A;  3F0I A;  4OWY A;  4OFN A;  1B9X C;  2AUV A;  2GT5 A;  3GRX A;  1GSD A;  4L5O A;  4EXJ A;  1AQW A;  1T00 A;  5ABR A;  4K7I A;  3ZVJ A;  2FNO A;  2FWF A;  2LQQ A;  1PX6 A;  4MZC A;  2H76 A;  3KTB A;  1FG4 A;  1GH2 A;  3GTU B;  4HQZ A;  2O89 A;  4L8E A;  1B48 A;  4TN8 A;  2L4C A;  1YF1 A;  1A0F A;  5F0G A;  5HFK A;  1EWX A;  4YQV A;  3W6G A;  1ZMA A;  4TR1 B;  2IJY A;  1K0N A;  4Z2R A;  1F37 A;  2EC4 A;  1DUG A;  3EMX A;  2WRT A;  2YJH A;  1GTA A;  2G0F A;  1GUL A;  3O3T A;  2YZU A;  1TRV A;  5E59 A;  3PR8 A;  4IVF A;  2MZC A;  4K2D A;  2AHE A;  9GSS A;  1QUW A;  2FLS A;  4N0V A;  2H0H A;  1HNC A;  3WD6 A;  4HZ4 A;  3KMN A;  1B9Y C;  5CRE A;  3HJO A;  4YH2 A;  1AC1 A;  3CRT A;  2TIR A;  1F6M C;  4F2I A;  3ZML A;  12GS A;  3RDW A;  5HFG A;  2H01 A;  2OBI A;  3IAM 2;  3J7Y k;  3KGK A;  3KJY A;  3GKN A;  2LJA A;  3ZIT A;  1SKW B;  3A2W A;  1EGR A;  5EPF A;  2H72 A;  2FWG A;  5DJL A;  5CYY A;  2OE0 A;  1MD3 A;  4EUY A;  2DBC A;  5JCW A;  3DXB A;  3V1W A;  4WF5 A;  4POL A;  2LNS A;  1ZYN A;  3W8J A;  2JU5 A;  3LG6 A;  1SL2 B;  2GZP A;  2YP6 A;  4YQM A;  3VLN A;  1R26 A;  1Z3E A;  5HQP A;  4CY6 A;  4I6X A;  3CSI A;  2B5X A;  3IK9 A;  4KA0 A;  1MTC A;  4V1A p;  1DSB A;  1ZGN A;  1H4O A;  1BYE A;  4GQC A;  2V32 A;  2EIO A;  7GSS A;  4HUA A;  2YWM A;  2IMD A;  4K2X A;  4ULX A;  4PUA A;  3UAP A;  1BJX A;  1ERW A;  1MDI A;  5D93 A;  1USB A;  1THO A;  5C04 A;  1KEB A;  4OMV A;  5A4V A;  4HQS A;  3FR9 A;  3N9J A;  3G7Y A;  1GSE A;  1N2A A;  2GSR A;  2I4A A;  5B6M A;  2OBK A;  19GS A;  1WJK A;  5ECQ B;  4XS1 A;  5CRG A;  4V2N A;  1K3O A;  1E6B A;  3IOS A;  4DSS B;  2CVK A;  4GSS A;  4MNN A;  1NHO A;  2VAF A;  4RQX A;  1WIK A;  2ON5 A;  3FW2 A;  2FGX A;  2CZ3 A;  3GH6 A;  3WGX A;  4KAE A;  3US3 A;  2WB9 A;  4ECC A;  2H74 A;  4IJI A;  5ID2 A;  4TRX A;  2I3Y A;  2P5R A;  2V6O A;  2H6Z A;  5CRD A;  4EDZ A;  2XBI A;  2QGV A;  1YEP A;  4OO4 A;  4XS4 A;  3VWW A;  3UIW A;  5CNW A;  4EIQ A;  1TU7 A;  3R3E A;  4AJ7 A;  4LLR A;  4IQA A;  2B3S A;  2F8A A;  1HD2 A;  2HXK A;  2IIY A;  3Q19 A;  3DD3 A;  3GUS A;  4MAB A;  2WZ9 A;  5DAL B;  1RK4 A;  4HEA 2;  2HZE A;  5IM9 A;  1MD4 A;  1NHY A;  3TB2 A;  3KH7 A;  4GCI A;  1OKD A;  1GSU A;  2M72 A;  1T3B A;  3ZMK A;  3L9U A;  3GA4 A;  4KCE A;  4XRA A;  3TJK A;  5J41 A;  2GQL A;  1XOA A;  2DKI A;  5KN3 A;  3BCK A;  1RW1 A;  1EEM A;  3VWU A;  4AF2 A;  4DSQ A;  1M2B A;  3QR6 A;  1EP8 A;  3W8S A;  1TRU A;  1JZW A;  1S3A A;  3D6I A;  5KN0 A;  1HNB A;  1ON4 A;  2KHP A;  2CX4 A;  3ERF A;  2FWH A;  4Q5Q A;  4CW9 A;  4YKG A;  3DIE A;  1UN2 A;  1THX A;  2H71 A;  5ECP B;  3I9V 2;  1K0D A;  2CAI A;  4ZB6 A;  5HFI A;  4KDY A;  6GSX A;  3UBK A;  3I43 A;  1O8W A;  3F4S A;  4HI7 A;  4ZIL A;  5LD0 A;  4MF6 A;  1T4Z A;  1F3B A;  5F07 A;  1ST9 A;  1A2M A;  2HZF A;  4FH8 A;  1PMT A;  4L0U A;  3BOA A;  1O81 A;  3UVT A;  2JZT A;  2HSM A;  1M9B A;  3I69 A;  1O73 A;  2F9S A;  3UMA A;  3IV4 A;  3HVV A;  3ZRE A;  1WE0 A;  1ABA A;  1GRX A;  1XZO A;  2WGR A;  4ACS A;  3O6T A;  5D9T A;  1EGO A;  2X99 A;  3M0F A;  2E7P A;  5D9X A;  2R2J A;  2RM6 A;  5ECS A;  4A5P A;  2OJL A;  1WOU A;  1A0R P;  1X5D A;  2FHE A;  3KP8 A;  16GS A;  4N0Z A;  2IYJ A;  3DRN A;  3TKS C;  1JZR A;  2GT6 A;  5AN1 A;  2L59 A;  3RPN A;  1XWG A;  2C1Y A;  4O5R A;  4ECI A;  2H8L A;  2XBQ A;  1SK0 A;  5IMD A;  1JLV A;  1FHE A;  2H1D A;  5H5R A;  2E2M A;  3APS A;  2YWN A;  2H30 A;  2GGT A;  3L78 A;  4CHS A;  4GXZ A;  1FOH A;  3A2X A;  3LJR A;  4ID0 A;  1PSQ A;  1PN0 A;  3TKQ A;  2FWE A;  3VWV A;  2MMO A;  1B4P A;  2YCD A;  4LMW A;  1PL2 A;  2IL3 A;  3DEX A;  1WWJ A;  2CA8 A;  5CRW A;  2DC5 A;  1UVZ A;  1VF3 A;  3IRA A;  5HR3 A;  3GL5 A;  1OC9 A;  4USS A;  4DVC A;  2LRN A;  1HQO A;  5GAP D;  2YZH A;  4X1U A;  14GS A;  4GLT A;  1X5C A;  1M2A A;  1SKR B;  3K8N A;  2R0P A;  4K5S A;  5D9V A;  2GVP A;  1Q4J A;  5H5S A;  4TW5 A;  1K0O A;  3KTL A;  1XIY A;  5D9W A;  4ML1 A;  3TJJ A;  1ZCP A;  4ZBB A;  2LEG A;  1GSF A;  1URM A;  3E3E A;  2JZR A;  2LRC A;  4XS6 A;  4J56 E;  2A2P A;  5ECL B;  4KDU A;  4YAV A;  5F06 A;  4KE3 A;  4IN0 A;  1GNE A;  2BJX A;  1U3I A;  2LQO A;  3M1G A;  4HJM A;  3GHA A;  4WBJ A;  5G5F A;  5AIS A;  1BQ7 A;  2AV4 A;  1YF0 A;  1EP7 A;  2PGT A;  4KUN A;  1LBK A;  5DAK A;  5ID2 B;  18GS A;  5IMF A;  1XPV A;  5INY A;  4K7N A;  2KP2 A;  2J23 A;  3PIN A;  4TXO A;  4RI7 A;  1SK1 A;  3QPM A;  3TRP A;  4NPB A;  4XS4 B;  1DBY A;  1A23 A;  4MP4 A;  2FA8 A;  2K8S A;  2V2G A;  4P3Y B;  1GUH A;  5KOW A;  2YNX A;  4TR4 A;  2DJ1 A;  1XOB A;  3ME7 A;  2BTO T;  4NV5 A;  5JWQ B;  3LXZ A;  4PQH A;  4XTS A;  3HJM A;  2VD1 A;  3IDV A;  4V2L A;  4K9Z A;  2V41 A;  3R2Q A;  2WFC A;  2DJK A;  5EY6 A;  3TRX A;  3F3R A;  3KZQ A;  1AW9 A;  5KEJ A;  4HU9 A;  1SJI A;  4MJE A;  4ECB A;  2UZ8 A;  1A2L A;  2JSY A;  1J9B A;  3FHK A;  4F0B A;  2I81 A;  17GS A;  3JCM L;  1M99 A;  3ZVJ D;  3G9B A;  4HDE A;  3BJ5 A;  3D4M A;  1CQG A;  2RLI A;  4HOJ A;  2QA1 A;  1HYU A;  1WP0 A;  1U87 A;  1SKS B;  2JAC A;  1EV9 A;  2VL2 A;  2JSZ A;  1BED A;  5F8B A;  4EIP A;  3MSZ A;  1BG5 A;  4PNG A;  3ZIJ A;  1A24 A;  2PN8 A;  5AIX A;  3P8W A;  2B1K A;  5KN1 A;  3ERW A;  4MLY A;  2DJJ A;  4L0W A;  3IHG A;  2PVO C;  1MDK A;  5A5K A;  4EC0 A;  1W4V A;  3F4T A;  2QKE A;  2IFQ B;  1Z9H A;  5B6N A;  1TP9 A;  3QAG A;  3DKS A;  1X9W B;  4KF9 A;  1ZYQ B;  3PH9 A;  3LOR A;  2FCH A;  4ZL8 A;  1I5G A;  3CSH A;  3QCP A;  4EDY A;  3EWL A;  2H75 A;  4G0K A;  1ZOF A;  1Z7R A;  2H1B A;  3BBY A;  2VUP A;  2GDR A;  2KP1 A;  5IMZ A;  3RAZ A;  1G6W A;  3TKR A;  2N5A A;  4H86 A;  5DCG A;  4GST A;  2M80 A;  5B7C A;  4IJ3 A;  1GTI A;  5DQS A;  6GST A;  1X9M B;  1O85 A;  5FHI A;  1TTZ A;  5BMU A;  4IKH A;  3LWA A;  4D73 B;  1E2Y A;  1OC9 B;  1FB0 A;  1G7O A;  3CRU A;  4NHZ A;  2FY6 A;  4N11 A;  2MYG A;  3UEM A;  2JL4 A;  2MBT A;  3C71 A;  3L9V A;  3IHQ A;  1UC7 A;  1K3L A;  3N5O A;  3HXS A;  3NIV A;  4MPF A;  2HSH A;  5DJM A;  2RUE A;  3P90 A;  1V57 A;  2H66 A;  1V58 A;  1LJR A;  1SEN A;  2OE1 A;  3RPP A;  3F8U A;  1SK2 A;  2WS2 A;  2IMK A;  1GWC A;  5IIZ A;  3F6D A;  2E0Q A;  3F6F A;  2C3Q A;  2R0G A;  5HR2 A;  3DYR A;  1YJ6 A;  3VWX A;  3EIN A;  2H0I A;  2C0F A;  3RHB A;  1FB6 A;  1U3A A;  1FVK A;  1JZO A;  1C72 A;  4MMM A;  4OCE A;  1T8E B;  4I2U A;  2H6X A;  2O7K A;  3TJB A;  3VK9 A;  3FZ9 A;  1AIU A;  2HRF A;  2CV4 A;  2GST A;  1R5A A;  1TKD B;  5DAK B;  3HY2 A;  4F0C A;  2A4V A;  1GSY A;  4TXO B;  3J7Y b;  5ECO B;  1QXH A;  2PMT A;  3GL3 A;  3KXO A;  5E4W A;  1A8Y A;  4YKF A;  2M46 A;  3D4T A;  3TDG A;  4GSN A;  2NBS A;  3KD0 A;  3APO A;  5IQY A;  2CQ9 A;  2BMX A;  1MDJ A;  3DWV A;  2C3T A;  2JZS A;  2ZCT A;  2GS3 A;  4I2T A;  4NV2 A;  5DDL A;  3CBU A;  1ACV A;  5CO3 A;  4MPG A;  3QAW A;  5IOW A;  1TRS A;  3HVX A;  2HYX A;  2MMA A;  2YV9 A;  4EL1 A;  1A2J A;  2PUK C;  3TGZ A;  1YZX A;  1R5P A;  3FR6 A;  5EVO A;  4EO3 A;  3CMI A;  4MZB A;  4YAP A;  4OCF A;  4NMU A;  4KCA A;  2HT9 A;  1KTE A;  2X49 A;  1Z6M A;  4KH7 A;  2EIR A;  2GQK A;  5B8B A;  4G10 A;  1GNW A;  3H8Q A;  3VFI A;  3HCZ A;  4AJ8 A;  5ECH B;  2IMF A;  4DEJ A;  1ERT A;  3HYP A;  3GN3 A;  4BVY A;  2CX3 A;  4HU7 A;  3IAS 2;  2O85 A;  3WYW A;  1XFL A;  4MJB A;  1GP1 A;  4KSO A;  3F63 A;  5G30 A;  4XCS A;  5FWG A;  2VL3 A;  3GX0 A;  2DJ0 A;  4MCU A;  4PUR A;  3ME8 A;  2F8F A;  4KND A;  4ISD A;  3EYT A;  4WET A;  2TRC P;  2K8V A;  3KP9 A;  3UJ1 A;  1Z7P A;  2L57 A;  4POK A;  2X4A A;  5BRT A;  1QFN A;  5GST A;  1TK5 B;  4ZL7 A;  5L71 A;  4GF0 A;  1G6Y A;  4Q5R A;  3UOM A;  2HRN A;  3TJG A;  3CTF A;  4O5U A;  1TI3 A;  3LW9 A;  3ZZX A;  1SJ6 A;  1NM3 A;  2C3N A;  4K1F A;  5G31 A;  4Z2T A;  4CY8 A;  4JR6 A;  1XWC A;  2GLR A;  3TKS E;  3U5R E;  4XIH A;  4MA9 A;  4ECJ A;  4OFM A;  3IXR A;  4KSM A;  4MH3 A;  2DIZ A;  4IGJ A;  3HVS A;  2LS5 A;  2AYT A;  1J0F A;  2HFD A;  2J9H A;  1CQH A;  2AAW A;  3ZFB A;  4PXO A;  2R5G A;  4HS1 A;  2VCV A;  3GTU A;  2HE3 A;  2GZY A;  4ZB9 A;  1GSQ A;  2VCQ A;  1PX7 A;  2HRA A;  2G2Q A;  1Y25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...