2H0IA

Crystal structure of dsbg v216m mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAMGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 65
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0iA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0iA02
2M46A 4ZBDA 1GSUA 2PBJA 4XS4B 4KCEA 4MZCA 5CYYA 3H4KA 1K0MA 2FHEA 1T4YA 1XW5A 3GN3A 4NWYA 2DJJA 3F3RA 3TOTA 2DJ0A 1M9AA 4HJMA 2GVPA 1NHOA 3EMPA 2H1BA 3RHCA 1C72A 2JU5A 2VD1A 3TKSC 4DSSA 1YJ6A 1M2DA 2O8VB 3GH6A 5ID2B 4MA9A 3HJMA 4OMVA 4AJ8A 3KP9A 2VCXA 1VF2A 4YQUA 1QK8A 4OO4A 4HS1A 4YAPA 1JLWA 5B8BA 2X64A 4L5OA 4K8MA 2A4VA 4IS0A 4GCIA 4MLYA 5G30A 2LNTA 2IMDA 5ECLB 2JZSA 4HQSA 1GULA 2AAWA 2KUCA 3U6VA 1TU8A 2K18A 1B9XC 1ZCPA 1TKDB 2C3QA 4ZB6A 4OCFA 3I69A 3TCOA 2RIIA 1EGRA 3F3QA 1A0RP 2K8SA 5IMAA 4ZB8A 4LMWA 3TKRA 4JZQA 4PQ1A 2C0EA 4MH2A 2B7JA 1ZMAA 5D9VA 4HJ2A 5L71A 2GSSA 1S3AA 4FH8A 3FW2A 1X0RA 5LD0A 1JZOA 4MP4A 4XS1A 3GHAA 3U5RE 3DMLA 3GNJA 2C3NA 1A24A 1CQHA 3LXTA 2HRNA 2H6ZA 2FCHA 4XS6A 2FGXA 1AW9A 4FIWA 1JHBA 3F4TA 4ULXA 5IM9A 2L59A 1JFUA 4TR0A 4NV5A 3FRCA 2C3TA 5HR2A 1BG5A 3EYTA 2JZTA 3IXRA 4Q5NA 3TUEA 2BMXA 5IPHA 1E2YA 1K3OA 2M72A 4RQRA 1PA3A 1GWCA 3KJYA 3RBTA 3ED3A 3CRTA 2ON7A 4PGTA 3F6DA 3IHQA 1SK0A 1PD21 2PGTA 1ZOFA 5INYA 1Z6MA 4QL9A 3K8NA 4EE0A 4TR4A 1ZYEA 2EC4A 1PSQA 2IFQA 4AJ6A 3TJBA 2X8GA 1XOAA 3RAZA 2I1UA 3LJRA 1Z9HA 2P0GA 5A5KA 4K0NA 5CRGA 3L9SA 1GUKA 4ID0A 3QAVA 4V2NA 4ZBAA 2VM1A 4KSMA 3GUSA 1T7PB 3DKSA 1G6WA 2WCIA 4MCUA 3D4MA 4ILFA 5IO0A 2MMOA 2OBIA 1G6YA 2GS3A 4TKYA 2C1YA 2VL3A 3D0ZA 3US3A 1THOA 3DEXA 2DIYA 2HZEA 4IJIA 2LRCA 1GUHA 2ALBA 1GRXA 1TK0B 2FWFA 1N2AA 2HRFA 2LJKA 4V1Ap 2H73A 5IO2A 5ECKB 3VK9A 2CVBA 1MDJA 1E6BA 4CDOA 1XPVA 1SK1A 4V2LA 2LSTA 2DMLA 3ERFA 2CA8A 2IMFA 1OC9B 3H8QA 4F0BA 1ERTA 1R26A 4GSSA 3VWWA 1ERUA 3QFBC 3TJFA 2RUFA 1FHEA 1WJKA 2M80A 3GTUB 2VCZA 5HQPA 4KE3A 3F0IA 3GH9A 1M99A 4ZL7A 1GLPA 3DGQA 1Z3EA 1T8EB 1OKTA 2VAFA 4KGIA 3M0FA 3TDGA 2LJAA 4I6XA 2CX4A 3AY8A 2CQ9A 4DEJA 4TXOB 4HUAA 4LL1B 2GDRA 2ON5A 3QMXA 4G19A 4ZB9A 4TVEA 3ZLPA 2C0DA 3EWLA 4HDEA 2C80A 1J0FA 2HNLA 4TN8A 4WR4A 3FYGA 2H1DA 3P7XA 1IYHA 4K9ZA 2YNXA 5CRWA 3IC4A 2MZCA 1RQMA 4I97A 5D73A 5DAKB 3RHBA 2LTKA 3FKFA 1FB0A 2N5FA 5DJMA 4WXTA 2GT5A 3ZMKA 4EC0A 4MJCA 1BEDA 2I9HA 1QXHA 16GSA 2VLVA 4I8BA 6GSTA 5HR3A 5F0GA 4IP6A 3LSZA 4BL7A 4E8HA 4ZIJA 1F9MA 2CVKA 3KZQA 4ML1A 3EURA 4GF0A 3C1SA 2MMZA 2B1LA 1XWAA 3JCML 1H4OA 1SYXA 3HA9A 1ML6A 5HR1A 2OJLA 1URMA 1XVWA 1T4ZA 2YP6A 2VM2A 2KHPA 2YWIA 1YF0A 4WETA 3Q18A 3LYKA 4N11A 2OA7A 3QFAC 2WS2A 1TRSA 1XCCA 3W8SA 4PNGA 2GZZA 5GAND 3VI7A 4OFTA 1OYJA 3PGTA 4EL1A 3UJ1A 2H6YA 5CP1A 4WF4A 2MMNA 12GSA 5B6NA 3BBYA 5IIZA 1OC3A 3KCMA 3PH9A 9GSSA 4EUYA 5DALA 1O85A 3I6AA 4ZILA 1I5GA 4QL7A 2VCWA 4G10A 3FY7A 3H93A 3LGCA 3ME7A 1FB6A 2H0GA 2IJYA 4DVCA 4GQFA 5CRHA 3DVWA 3ZRDA 4TR3A 1FOVA 3F9UA 4O92A 5HFKA 3VWUA 2I4AA 1SD8A 2FWHA 2YPMA 3D22A 4ECIA 1MDIA 3IK9A 4N10A 1WIKA 2VL2C 2WFCA 1XW6A 3HJPA 5J9CA 1NSWA 2F9SA 3KM6A 3QCPA 2R5GA 2YWNA 1YDKA 1DUGA 4J56E 2DSAA 1YZXA 3E9JB 2IMIA 2MMAA 3LFLA 4IBPA 4EXJA 2LUSA 4CHSA 5IMDA 5IMCA 3TGZA 2L6CA 1Q4JA 4Q5FA 4POMA 1OE7A 22GSA 5H5SA 2HFDA 3HY2A 3E3EA 2IPAA 4KW6A 1SKRB 1V98A 3G7IA 5CRDA 5A4UA 2GZPA 3I43A 5IOWA 4FYUA 4TR1B 1TI3A 3VI5A 3GX0A 1XVQA 4KX4A 2H30A 2CZ2A 2RLIA 1F3AA 3O6TA 2CAQA 2F8AA 2B7KA 2L5OA 1FG4A 1UC7A 3WT1A 4WR5A 4EVMA 1A0FA 4ISDA 1X9MB 1TRWA 2OKAA 3GSTA 3EE2A 4XRDA 2CT6A 1Z6NA 2BJXA 2HE3A 1EZKA 4I5QA 4E8EA 4MJAA 3L9UA 4ZL8A 2WB9A 2QKEA 3GRXA 3D4TA 2KP1A 2EIQA 5G5FA 4EKZA 4F0CA 2NBSA 3VPTA 1WWJA 1XW9A 2H72A 1M2BA 3ZIJA 5ECHB 1K0AA 1UVZA 1TDIA 3O3TA 2DJKA 4Q5QA 3TRQA 2H8LA 5AISA 2E7PA 6GSSA 1R4WA 2QGVA 4POLA 5F07A 1OKDA 1ACVA 4GSNA 2K6VA 2H66A 4XS4A 2VCVA 2P5RA 4MZWA 2IIYA 3CXGA 2YWMA 1DBYA 5HFGA 4EO3A 4O5RA 1Y25A 5F8BA 2GQMA 3J7Yb 1ZYQB 5B6MA 3DD3A 2L57A 2C8UA 3RPNA 3KEBA 3LORA 2AV4A 1FVJA 4V2MA 3ZFBA 2GSQA 5ID2A 2H1GA 2VLTA 2X99A 1VGLA 4Z7XA 2JSYA 1K0BA 2HI7A 4L8EA 4YQMA 2E2GA 2WGRA 3F6FA 4XCSA 4KDXA 2C4JA 3MWHA 3CTGA 3QD9A 2QSIA 4AF2A 2H1AA 4POBA 2XC2A 3VLNA 4MPFA 5HFIA 3S9FA 2DBCA 4RI7A 1Y6EA 4N0ZA 1M9BA 1T3BA 4DSRA 4F9ZA 4PNFA 5ECRB 1GSQA 3APQA 4J57E 2H76A 3ME8A 1K3YA 4MABA 3F63A 3MDKA 4XIHA 2JL4A 2GTUA 4XTSA 3GURA 4RI6A 5ECMB 1SJIA 4K7NA 2IMEA 3CSIA 2ES7A 3IK7A 1M0UA 1PKWA 3NOFA 3D5JA 1TXXA 2VD0A 2FY6A 3WD6A 2RM6A 2DC5A 4K2DA 6GSWA 1VRSD 3DVXA 3GKKA 2B1KA 1NHYA 1TW9A 1MD4A 5C04A 1XXUA 3TJJA 4GRFA 5ECOB 1HNCA 1O7UA 2O85A 1A8LA 3GSSA 4ML6A 2AUVA 3KTLA 5DVBA 3P90A 4XHMA 3QOUA 2IFQB 3M1GA 3VWXA 4MF5A 2GQLA 1EV4A 1G7EA 1ABAA 1IYIA 5J5NA 2V6KA 2VLUA 8GSSA 2KLXA 3GKNA 1XBSA 7GSSA 2AJQB 3HHVA 2L4CA 4EDZA 3HXSA 3FR3A 3KMOA 2FD3A 1F6MC 3VPQA 1XFLA 4MH3A 3LXZA 2LNSA 4IW9A 2XBQA 4WEYA 1X9SB 1WE0A 1UA5A 3CTFA 3CYNA 2VL9A 1TOFA 4AJ7A 2WZ9A 3RPPA 1S3DA 2R37A 1GUMA 3DIEA 2PVQA 1GTIA 3OR5A 3QAWA 3L78A 2DJ2A 2FWGA 5G31A 3UAPA 2LRTA 4K7OA 2IN3A 2H19A 4JEDA 5AIXA 2MYGA 1SKSB 4YQVA 4BPYA 5ECNB 5COHA 1QGVA 1M2AA 3SBCA 4XRAA 3GFKA 1B4PA 3R2QA 3WGXA 3TJGA 2LS5A 4ZBBA 2F8FA 3SWLA 5ABRA 5E4WA 5EY6A 5KN3A 1QUWA 3ZIVA 3P8WA 2J23A 3FZ9A 2YJ7A 3EINA 2H0IA 1BYEA 4IKHA 1YQ1A 2JACA 19GSA 3TKSA 3LWAA 1XWKA 3F4RA 3UL3A 1U87A 4QQ7A 2DMMA 1QMVA 2E0QA 2IMKA 1TP9A 3Q6OA 4K7IA 4IELA 4K1FA 4KH7A 3IBHA 3ZREA 1GTAA 1SK2A 1YY7A 2YZUA 4TXOA 4FYBA 4IHUA 4GLTA 3ERGA 3GKXA 2H01A 2I3YA 4H86A 4HOJA 4FYCA 2PU9C 3WGEA 3HVVA 2R6KA 4IP1A 3IV4A 3C73A 4WF5A 4J2FA 1QQ2A 1OC8A 3IAS2 3ISOA 4NV2A 1O6JA 4OCEA 3ZTLA 5IMZA 4ACSA 1A2JA 5J4UA 4RUVA 4N0VA 3GIXA 3KH7A 2GSTA 2KP2A 1TJDA 1WPIA 1TRVA 4KDUA 1B8XA 3A3TA 4YAVA 2DJ1A 4PUAA 1V9WA 1A2LA 5DAKA 5F06A 5CREA 4MJEA 4L5LA 2OBKA 4O32A 3PR8A 2YZHA 2JADA 2B3SA 2XPDA 2B5XA 5A4VA 1K0CA 3BCIA 1AXDA 1ERVA 1R7HA 1G0TA 4JE1A 5EL8A 2NPBA 1EP7A 1EP8A 1GP1A 3N9JA 2AB6A 2OACA 5GAPD 2O7KA 2B6MA 3W8JA 4HZ2A 1O81A 1SL0B 1GH2A 2VOCA 2XHFA 5DCGA 3UEMA 5G1KA 1FVKA 4G2EA 4CW9A 1H75A 3G7YA 2IY2A 1GNEA 1MD3A 5IMVA 3BOAA 2IYJA 3FR9A 4ZL9A 3ZVJA 3UMAA 1O8WA 4N30A 5D8IA 3GMFA 2EIRA 3IRAA 1J08A 5GZZB 1V58A 4ECCA 2A2RA 1B4QA 1V2AA 1THXA 1JLVA 4D73B 2A2SA 2D2ZA 4IQ1A 4O7HA 1XIYA 2J9HA 4AGSA 2V41A 5KN1A 2WRTA 5JWQB 1HD2A 1TK5B 2R4VA 3V1WA 1USBA 3G9BA 2ZNMA 1N8JA 2YJHA 4WBJA 5DJLA 4JU5A 1PX6A 5JCWA 3KXOA 1XOBA 1A8YA 1AUCA 2LEGA 3GL3A 4GWRA 2JSZA 3RDWA 1ON4A 1FAAA 4PQIA 3TRPA 4OD7A 1EEMA 3C7MA 3ZVJD 3KH9A 3TKSE 3L4NA 2OADA 5F05A 3TRXA 4I2UA 2WDUA 1AQVA 1S3CA 3D6IA 2N5AA 2VCQA 1NM3A 3BD2A 4Q5RA 5IQYA 2LRNA 2K9FA 3HJOA 5EVOA 1R5AA 4PXOA 3FK8A 1A23A 2H75A 3TB2A 2LJRA 1F37A 1V40A 4JR6A 3IE3A 1PL2A 3HVXA 2TRXA 1LU4A 3MAKA 1FW1A 1PL1A 3ZITA 4TR1A 4MF7A 3DXBA 10GSA 1QFNA 1JZWA 1XWGA 3M8NA 1U6TA 4YH2A 1HQOA 2TRCP 3ZZXA 4GTUA 1PRXA 3ZL5A 1NW2A 3VWVA 4HU9A 3APSA 1BJXA 4GQCA 1B48A 3O76A 1RK4A 2IL3A 4BVYA 4BA7A 1ZGNA 3Q19A 2OE0A 1SKWB 2PPTA 5JCGA 4TXVA 1FO5A 3F4SA 5D93A 2YCDA 4DSSB 2GQKA 3KTBA 2ZCTA 3A5WA 5CNWA 2O89A 4KAEA 1K0NA 4POKA 3C8EA 3P2AA 2CZ3A 3IR4A 3CBUA 4TOPA 3EU3A 1W89A 3A2VA 3UBKA 2PMTA 1GL8A 3ZFLA 1GNWA 1TK8B 1K0OA 1EEJA 2WJUA 1I9DA 2FUG2 4PUFC 2ZUPA 3FR6A 17GSA 2CVDA 1WRYA 5AIVA 1PX7A 1AAZA 2L5LA 5AGYA 3HKRA 13GSA 3EC3A 6GSYA 4KNDA 2R2JA 3A2XA 3APOA 5G2ZA 3UBLA 3QPMA 4MPGA 2DJ3A 3UIWA 4HEA2 11GSA 4HU7A 2TIRA 1GSDA 2HZFA 1JZDA 5J9BA 1LJRA 5JWRB 2H6XA 5FWGA 3W6GA 4HZ4A 5LCZA 1SL2B 1PKZA 5DQSA 2F3MA 20GSA 2AHEA 3L9VA 4KUNA 1CQGA 2H71A 1EOHA 1OAZA 4BWSA 1T00A 5ELAA 3I9V2 4TRXA 5KEJA 2FA4A 1VF1A 5GSTA 4MF6A 2PN8A 1GSFA 4F03A 3IOSA 1Z7RA 5IMFA 2V6OA 3M9KA 2OE3A 1A2MA 1T1VA 2X8HA 5ECIB 3BJ5A 2G0FA 3QAGA 2VUPA 1SU9A 1BQ7A 4PX1A 5DBQA 4X43A 2V32A 1K0DA 5ECSA 1EGOA 4MK3A 2O87A 3EU4A 3GV1A 3CMIA 3J7Yk 1WOUA 4RQXA 4JRRA 1BX9A 2G2QA 3WYWA 2VL2A 1B9YC 3F8UA 3HYPA 2PERA 4HQZA 1HNAA 2CV4A 2XBIA 4LMVA 1JZRA 3FZAA 3MNGA 5ECPB 2C0GA 5DQYA 5FHIA 4MJBA 2PWJA 4BWQA 4LL4B 5KN0A 2HT9A 3GL5A 3N5OA 3WGDA 2GSRA 2H70A 1DSBA 2HSYA 2HSHA 5HR0A 3QDNA 2N5BA 3FEUA 3IDVA 2LQQA 2HZEB 4LA1A 2K8VA 2I81A 1G7OA 4EF0A 2YN1A 5AN1A 2QC7A 4KB3A 4NMUA 4K0GA 4OWYA 4WBRD 2DIZA 1UN2A 1XWCA 1VF4A 4GXZA 2VO4A 3HVSA 4NAXA 4MMMA 1HYUA 1GSSA 2L6DA 3DWVA 2AYTA 2HYXA 1SYRA 3GYKA 1LBKA 1GSEA 1YEXA 1AQWA 4OFNA 2YWOA 5CAXA 4V1Ag 3WT2A 5GSSA 4K6XA 1EV9A 2EIOA 3VURA 4OFMA 2PUKC 3EVIA 1GTUA 4FO5A 1YEPA 1O8XA 1SD9A 5FT3A 1X5EA 1OC9A 4L0UA 5KN2A 3CSJA 1XWBA 2P31A 5D9TA 1SL1B 4I2TA 5JWOB 3TKPA 1PGTA 4NHWA 2FNOA 1O73A 2MBTA 3FHKA 3GTUA 1X5DA 3GX8A 3KD0A 3UOMA 4IVFA 1OVNA 4F2IA 1U88A 5C00A 1YKAA 1PN9A 1TTZA 2WULA 4ECJA 5IPGA 3LYPA 2B5YA 5D96A 1ZZYA 1TRUA 1MEKA 3NZNA 2DLXA 2HXKA 5CO3A 1AQXA 2GGTA 4P3YB 2RM5A 2F51A 4NXIA 4GSTA 1OE8A 4OO5A 2NDOA 1GSYA 4WKWA 2E2MA 4MZBA 3KGKA 3LG6A 2L4QA 1U3IA 1Z7PA 5B7CA 2YANA 5B8AA 4TW5A 3UARA 1M7TA 6GSXA 1YF1A 3IA1A 1W4VA 2R3XA 3NIVA 1AC1A 2PVOC 3IAM2 2VIMA 2NVLA 3VFIA 1ST9A 3HZ8A 3G7JA 1Z5YE 1WMJA 3KP8A 2LKUA 4X1UA 3GA4A 2Z9SA 1SJZA 1VF3A 2LV3A 3FZ5A 1DE2A 2CAIA 1KTEA 14GSA 1X9WB 1K3LA 4L0WA 5H5RA 2HLSA 5J41A 4HI7A 4NHZA 4KDYA 2X8CA 3IPZA 1ERWA 3M9JA 1KEBA 3BCKA 3TOUA 1MDKA 1TU7A 3MSZA 4F82A 3HCZA 3DRNA 2MBSA 2NTOA 2LQOA 3PINA 3M3MA 4IJ3A 5J3RA 1Q98A 1SJ6A 2GLRA 2RUEA 5ENUA 4ECBA 5DALB 1J9BA 3ERWA 4IQAA 1SENA 4PURA 2GZYA 3H1NA 5G1LA 5ECQB 3KIJA 2V1MA 4KA0A 4JBBA 1DE1A 5D9XA 1GLQA 5H5QA 1YKCA 1ZL9A 1F3BA 3A2WA 1F2EA 3HDCA 2BTOT 4IGJA 3C1RA 4D73A 4MDCA 1XZOA 2YOIA 3CSHA 5JCUA 3CRUA 3KMNA 3C71A 2GT6A 1R5PA 2FWEA 1KNGA 4JR4A 5G5EA 5IOXA 4BVXA 3FZ4A 3DYRA 2P5QA 2OE1A 2C0FA 4NPBA 4PQHA 2H0HA 2VCTA 4G9HA 5EPFA 6GSUA 4IN0A 1PQNA 2REMA 3EMXA 5A4WA 2FLSA 2CX3A 3HD5A 3Q74A 4KSOA 1KBNA 4LLRA 18GSA 3UVHA 4KCAA 4X0XA 2V2GA 4ZXGA 1HNBA 3HZ4A 3L0HA 3ZMLA 2IWTA 1GTBA 3TKQA 5E59A 1PMTA 3GKMA 3TJKA 1EWXA 3E0UA 2XPEA 5D9WA 2FA8A 1AIUA 1V57A 5LNKe 5ELGA 2JZRA 3H79A 3ZYWA 1BAYA 3LEFA 3D21A 2B5EA 1EOGA 1ILOA 2H74A 1X5CA 1RW1A 4DSQA 2KOKA 3QR6A 5DCHA 1MTCA 1TI1A 3LQ7A 5DDLA 2YV7A 3UVTA 6GSVA 1WP0A 1U3AA 2YV9A 4EDYA
chains in the Genus database with same CATH superfamily
2M46A 4ZBDA 1GSUA 4HM4B 2PBJA 4XS4B 4KCEA 4MZCA 5CYYA 3H4KA 1K0MA 4Z2UA 1BRSA 2FHEA 2I9WA 3CC43 1T4YA 1J2BA 1XW5A 3GN3A 7RNTA 4NWYA 2DJJA 3F3RA 1EG9B 3TOTA 1TFOA 2DJ0A 1M9AA 3NQYA 2RGQA 4HJMA 2E2TA 5AYRB 1EKMA 1VQK3 3N8BA 2GVPA 1CEWI 3I553 3PPUA 1NHOA 3EMPA 4EIPA 2H1BA 3RHCA 2OQEA 3B4OA 1C72A 3NUVA 2JU5A 3G4S3 2VD1A 3TKSC 1YJ6A 1M2DA 2O8VB 4DSSA 4CPKA 3GH6A 5ID2B 4JRFA 4MA9A 3HJMA 4OMVA 4AJ8A 3KP9A 2VCXA 1EQKA 1VF2A 4YQUA 1QK8A 4OO4A 1ASKA 4HS1A 4CY8A 3AHSA 4YAPA 1JLWA 4EV5A 5B8BA 1PY3A 3AMOB 4KFEA 2X49A 2X64A 4L5OA 4K8MA 2A4VA 4IS0A 1YGWA 1VZZA 4GCIA 4MLYA 1IQ8A 5G30A 2LNTA 1GOYA 2IMDA 2JZSA 5ECLB 4HQSA 2ZHXB 1GULA 2AAWA 3NV0B 2KUCA 3U6VA 2RFRA 1DMMA 1TU8A 4K1VA 1TIJA 2Q07A 4HVNA 2K18A 1JB5A 2Z6BA 1B9XC 1ZCPA 1NU3A 1TKDB 2C3QA 4ZB6A 4FMBA 4OCFA 1RGGA 3I69A 3TCOA 2RIIA 1EGRA 3F3QA 1X1UA 1A0RP 2K8SA 1D6UA 5IMAA 4ZB8A 4LMWA 3TKRA 4JZQA 4PQ1A 2KF3A 2C0EA 1D6ZA 4N6LA 4MH2A 1TRQA 2B7JA 1ZMAA 5D9VA 3KE7A 4HJ2A 4KF9A 5L71A 1X1XA 2GSSA 3K7CA 1JB2A 1S3AA 4FH8A 3FW2A 2CH9A 2KAAA 3IC8A 1X0RA 5LD0A 4RBNA 1JZOA 4MP4A 4XS1A 3GHAA 3U5RE 3IJEB 3DMLA 3WOEB 3CCV3 4LGQA 1BNSA 3D79A 3GNJA 2C3NA 4HM3B 1C7HA 5AIIA 1A24A 1CQHA 3LXTA 2HRNA 2H6ZA 2FGTA 2FCHA 2YX9A 4XS6A 2FGXA 1VQQA 1AW9A 5EVHA 4FIWA 1JHBA 3F4TA 4ULXA 5IM9A 1FGOA 1LNHA 1JFUA 2L59A 4TR0A 3B4PA 3MPHA 1Z1SA 3FG3A 4NV5A 2JDIH 3FRCA 2C3TA 5HR2A 1BG5A 4CDLA 2KF5A 3EYTA 3FG1A 2JZTA 3IXRA 4Q5NA 3TUEA 2BMXA 5IPHA 1A90A 1E2YA 1K3OA 2M72A 5KOXA 1I2GA 3HX8A 1WNHA 4RQRA 2F99A 1LRAA 1GS3A 1PA3A 1BVIA 1BNFA 1JKGA 2ZA4A 1GWCA 1FUSA 1GD3A 2K3DA 3KJYA 3ED3A 3RBTA 3CRTA 2ON7A 4PGTA 3F6DA 3IHQA 1SIIA 2GXFA 3LTBA 5TGNA 4X4JA 5EEOA 1ZGXA 1SK0A 1PD21 1D6YA 2PGTA 1ZOFA 5KP1A 4L8PA 1JBSA 3CCQ3 1R4CA 5INYA 3NHXA 3B8LA 1Z6MA 3DGNA 3K8NA 4QL9A 4EE0A 2HMOB 4TR4A 1ZYEA 2EC4A 4HZBB 1PSQA 3DUKA 1RGEA 2IFQA 4AJ6A 2E2UA 3TJBA 2X8GA 1XOAA 1SARA 1AQZA 3RAZA 2I1UA 3LJRA 1Z9HA 2P0GA 5A5KA 4K0NA 5CRGA 2KRTA 3NXJA 3L9SA 3F8HA 1GUKA 4ID0A 1W02A 3QAVA 4V2NA 4ZBAA 2VM1A 4KSMA 1N5HA 2F4YA 3GUSA 1T7PB 1A2VA 1CYVA 3DKSA 1G6WA 3A5IA 2WCIA 4MCUA 3D4MA 2HMLB 4ILFA 2RBIA 5IO0A 2MMOA 2CWTA 2OBIA 1G6YA 2KXGA 2GS3A 4TKYA 4PTSA 2C1YA 3EPTA 2VL3A 3D0ZA 3US3A 1THOA 1JN5B 2X4AA 3DEXA 4J5GA 2JQ5A 2DIYA 2HZEA 4IJIA 2LRCA 1GUHA 2ALBA 1GRXA 1TK0B 2FWFA 1VQ63 1N2AA 2STDA 2HRFA 1N8R4 2IMJA 2LJKA 4V1Ap 3STDA 2YFJB 1M3IA 2H73A 5ECKB 3VK9A 1IQYA 2CVBA 5IO2A 3KFQC 1MDJA 1E6BA 4AKZA 2XRXB 3S67A 4CDOA 1XPVA 4Z2TA 1MGWA 2B1XB 1JJ22 1SK1A 4V2LA 2LSTA 1RNTA 2DMLA 3ERFA 3AHWA 3G6E3 2CA8A 3BNBA 2IMFA 1OC9B 1CQSA 3H8QA 4BL2A 2CWVA 4F0BA 4FCZA 4O2HA 1DYUA 1WTHA 2XH9A 1ERTA 1W2B2 4EIQA 4QWTA 1JBRA 1R26A 1ISKA 4GSSA 1ERUA 3QFBC 3VWWA 3TJFA 2RUFA 1FHEA 5IEPA 5FW5A 1WJKA 3WODG 2XEPA 1LQGC 2M80A 3GTUB 2VCZA 1VQL3 5HQPA 1QAFA 2QA2A 4KE3A 3F0IA 3GH9A 1M99A 4ZL7A 1I70A 1W6CA 1VQO3 1GLPA 3DGQA 1RGFA 1YVSA 1Z3EA 1RLSA 1SQWA 1T8EB 3IHGA 1OKTA 1Q40B 2VAFA 4KGIA 3QK9A 1YHQ3 3TDGA 3M0FA 2LJAA 4I6XA 2CX4A 3AY8A 2CQ9A 4J9AA 4DEJA 1ULIB 2GBWB 4HUAA 4LL1B 4TXOB 2GDRA 3ZFZA 2ON5A 4N6V0 1B2MA 3VF1A 3ZG0A 3QMXA 4G19A 3DGYA 3LH4A 4ZB9A 2A4HA 1OCVA 4TVEA 3ZLPA 1RJOA 2C0DA 3PXMA 3EWLA 4HDEA 3SOYA 1MWTA 4GL6A 2C80A 1K8A4 1J0FA 2HNLA 4XDVA 4TN8A 4CJNA 4WR4A 1LOXA 4XB5A 5BRTA 2OOVC 3FYGA 2H1DA 3P7XA 1IYHA 1A2PA 2IUJA 4K9ZA 5AIHA 1VQ93 2YNXA 3K0ZA 5CRWA 3IC4A 3CXC2 2QGUA 2MZCA 1RQMA 4I97A 5D73A 3OX9A 5HGRA 5IG5A 5I97A 1B3SA 6RNTA 5DAKB 2LQVA 3RHBA 2LTKA 3FKFA 4EC6A 4XBXA 1FB0A 2N5FA 2C4BA 2CFWA 4WXTA 5DJMA 4J5KA 2GT5A 1XG8A 3EBTA 1JBTA 3ZMKA 4EC0A 4MJCA 1BEDA 3H3HA 2I9HA 3KCHA 4N6UA 1QXHA 16GSA 2VLVA 3CNXA 4I8BA 6GSTA 5HR3A 2DKHA 2CFGA 1Q824 5F0GA 4IP6A 3H51A 3LSZA 4BL7A 4E8HA 4ZIJA 1F9MA 2CVKA 3KZQA 4ML1A 2HMJB 4BTXA 1FA3A 3EURA 4GF0A 1BNJA 1NDOB 3C1SA 2MMZA 2B1LA 1XWAA 3JCML 1H4OA 1W6GA 1SYXA 1BAOA 2W0QA 7GSPA 3HA9A 1ML6A 5HR1A 2OJLA 3JUNA 3PGBA 1URMA 1DVDA 5BU4A 3SYUA 4L8OA 1XVWA 3A5EA 1T4ZA 3X41A 2YP6A 4H61A 4NHFA 2VM2A 2KHPA 2YWIA 1YF0A 3HVNA 4WETA 3Q18A 5M18A 2J8XB 3LYKA 4N11A 2P0MA 1U8CB 2OA7A 3QFAC 4EW5A 1KC84 2WS2A 2GBXB 1FGMA 3G0KA 3CC73 1TRSA 1QAKA 1XCCA 3W8SA 4PNGA 4Q53A 1YJN3 2GZZA 1MWRA 5GAND 3VI7A 4OFTA 1OYJA 2FNQA 3PGTA 4EL1A 3UJ1A 2H6YA 2Z77A 5CP1A 3FGYA 4WF4A 2MMNA 12GSA 5B6NA 3E99A 3BBYA 1OC3A 3KCMA 5IIZA 5D81A 4MMXB 3PH9A 9GSSA 4EUYA 5DALA 2BIRA 3ECFA 3EB8A 1O85A 3OWSA 3I6AA 4ZILA 4FMCA 5CXOA 4OVMA 1NB3I 3KSPA 1I5GA 4QL7A 2VCWA 3FY7A 4G10A 3H93A 3LGCA 3ME7A 1AV4A 2H0GA 1FB6A 2IJYA 4DVCA 3GZRA 1Y4KA 4LSOA 4GQFA 5CRHA 3DVWA 3CCU3 3ZRDA 4HM6B 4TR3A 1FOVA 3F9UA 2W04A 4O92A 5HFKA 4HAAA 2I4AA 3VWUA 1SD8A 1BU4A 2FWHA 3JUQA 2YPMA 3D22A 3LT9A 1MDIA 3IK9A 4N10A 4ECIA 4Z2RA 1GD4A 1WIKA 2VL2C 2WFCA 1XW6A 3HJPA 5J9CA 1NSWA 2F9SA 3KM6A 3ER7A 3QCPA 2R4IA 4LYLB 2R5GA 2YWNA 1YDKA 1DUGA 2CFKA 4J56E 1BNIA 2DSAA 1YZXA 3IPTA 3E9JB 2IMIA 2MMAA 3LFLA 4IBPA 4EXJA 3NBJA 1QVG2 2LUSA 4CHSA 5IMDA 1YIT3 1MWUA 5IMCA 3TGZA 2L6CA 1Q4JA 4LMIA 4Q5FA 1IVWA 4WP5A 4POMA 1OE7A 22GSA 4N6NB 4I4KA 5H5SA 2HFDA 3HY2A 3E3EA 2IPAA 1UCKA 4KW6A 1V98A 3G7IA 5CRDA 1SKRB 4XM4A 5LC7A 1UDII 2L4VA 5A4UA 2GZPA 3I43A 5IOWA 1UGIA 4FYUA 1OF5B 1TI3A 4TR1B 3VI5A 3GX0A 2BHMA 2WOFA 1VQ43 1OGZA 1XVQA 1TP6A 1B27A 4KX4A 2H30A 2CZ2A 2RLIA 1F3AA 3O6TA 2CAQA 4EBGA 2F8AA 3X42A 2B7KA 2L5OA 3JUOA 1FG4A 1UC7A 2C11A 4WR5A 4WFOA 3WT1A 4EVMA 2P05A 2W9PA 1A0FA 2WO0A 1HU9A 4ISDA 2CX1A 1GMRA 3K5TA 1TRWA 1X9MB 2OKAA 1PN0A 3GSTA 3EE2A 4XRDA 2CT6A 4GSPA 1Z6NA 4HZ9B 2BJXA 1RTUA 2HE3A 1EZKA 4I5QA 4BVYB 3CCR3 4E8EA 4MJAA 3L9UA 4ZL8A 2YFIB 3DGOA 3DMCA 2WB9A 2QKEA 5CF2A 3GRXA 3D4TA 1E3VA 3D4AA 3HZPA 2EIQA 2KP1A 5G5FA 4EKZA 4F0CA 1BUJA 2NBSA 3VPTA 1WWJA 3SX1A 1XW9A 2H72A 1M2BA 3ZIJA 5ECHB 3URPA 3GZBA 1K0AA 2BMOB 5IW9A 3CCM3 1UVZA 1TDIA 3O3TA 3PYJA 1KQS2 2DJKA 3X40A 4Q5QA 3TRQA 4RNTA 3RGRA 2H8LA 5AISA 1L5GB 2QA1A 2E7PA 6GSSA 1R4WA 2QGVA 4POLA 5F07A 5AYSC 1YI23 1OKDA 1GY5A 4HM8B 1ACVA 4BU4A 4GSNA 2K6VA 2H66A 4XS4A 2VCVA 3DY5A 2GU1A 2P5RA 3S5CA 4MZWA 1K41A 4CCVA 2Z76A 1I3IA 3D5GA 2OOVA 1BRNL 1SJWA 2IIYA 3CXGA 2YWMA 1BSBA 1IV9A 3OV4A 1DBYA 2XSOB 5HFGA 4EO3A 3NBRA 9RNTA 4O5RA 1Y25A 5F8BA 4FCJA 2GQMA 3J7Yb 1ZYQB 5B6MA 3DD3A 2L57A 4KFDA 2C8UA 1G02A 3CNMA 3RPNA 3KEBA 3LORA 2AV4A 1FVJA 4V2MA 4CY6A 3ZFBA 2GSQA 5ID2A 2H1GA 2VLTA 1O7HB 2BMQB 2X99A 1VGLA 4Z7XA 8CHOA 3MHEA 2OCTA 2JSYA 1IK3A 1BRHA 3FF2A 1K0BA 2HI7A 3AGOA 4USSA 4L8EA 2W56B 3AMOA 4YQMA 2E2GA 3X3XA 2WGRA 2QEX3 5JBSA 3F6FA 2P38A 3LYGA 4XCSA 4KDXA 2C4JA 3MWHA 5M19A 3M8CA 4EV2A 3EHCA 3CTGA 3QD9A 1VQM3 3NV0A 2CIUA 2QSIA 4AF2A 4R80A 2H1AA 3EN8A 3OXAA 4POBA 2XC2A 2WGOA 1IVUA 4GB5A 3VLNA 4MPFA 4O02B 3G8ZA 5HFIA 3S9FA 2DBCA 1Y6EA 4RI7A 4N0ZA 1M9BA 3EN1B 1T3BA 4DSRA 4F9ZA 5AEUB 4PNFA 5ECRB 1GSQA 2R0CA 3APQA 4FR9A 4J57E 2H76A 3DM8A 3ME8A 1K3YA 4MABA 3F63A 3SEDA 3CU3A 3MDKA 3LW9A 4XIHA 2W9QA 2JL4A 1DE3A 4A5PA 2GTUA 2L1SA 4XTSA 3OWUA 3GURA 4RI6A 5ECMB 1SJIA 4K7NA 2IMEA 3FCSB 3CSIA 2ES7A 3IK7A 1RCLA 2Y73A 4G0LA 2UZ8A 4WHAA 1M0UA 1O7MB 2CG1A 1PKWA 3NOFA 1TUHA 3D5JA 3F7SA 1TXXA 2VD0A 2YFLB 1G96A 2FY6A 4BL3A 3WD6A 4K5SA 1BRIA 1MOLA 2RM6A 2DC5A 2WOHA 4K2DA 1UI7A 1RN7A 1WQLB 6GSWA 1VRSD 3DVXA 3LOYA 3GKKA 2B1KA 1NHYA 1M1XB 1TW9A 1MD4A 5C04A 1XXUA 5M1AA 3TJJA 1UW1A 4GRFA 1RGHA 1OHPA 5ECOB 1HNCA 1O7UA 2O85A 1A8LA 3GSSA 3MG1A 4ML6A 2AUVA 3KTLA 5DVBA 1AVKA 3SOAA 3P90A 4XHMA 3QOUA 1O7WB 2IFQB 3M1GA 3VWXA 4MF5A 2GQLA 1EV4A 1MNLA 1G7EA 5AIGA 3T8NA 5ELJA 3HIGA 5KP4A 1ABAA 1IYIA 1UCIA 5J5NA 4KVHA 1BNEA 1EUIC 3O8YA 2A2PA 2V6KA 2VLUA 3ALAA 8GSSA 2KLXA 3GKNA 4XDWA 1XBSA 1Q864 7GSSA 2AJQB 4HJLB 3HHVA 2L4CA 8RNTA 4EDZA 1LOWA 3HXSA 3G713 3WDGB 3FR3A 3KMOA 1UUGB 1BGSA 3J7Yd 2FD3A 1F6MC 4WYKB 1QJGA 2F86B 5BIRA 4BIRA 3VPQA 1YGEA 2K54A 1XFLA 3I563 3PZWA 3CCJ3 4MH3A 2PZVA 3LXZA 2LNSA 4IW9A 2XBQA 4WEYA 1BOXA 1X9SB 2V1LA 4U13A 3F7XA 1WE0A 1UGHI 3CMA3 5IEOA 1UA5A 3CTFA 1O7NB 3CYNA 2VL9A 1TOFA 4AJ7A 2WZ9A 1BANA 3AGNA 3RPPA 3S29A 4K5RA 2LYXA 3GZXB 1S3DA 3EC9A 2R37A 1GUMA 2CK3H 3DIEA 2PVQA 1GTIA 3OR5A 7STDA 3QAWA 3L78A 2K0MA 2DJ2A 3V92A 2FWGA 2ZL8A 5G31A 3UAPA 2LRTA 4K7OA 2IN3A 2UX0A 2H19A 4JEDA 5AIXA 1FUTA 2QA43 5AI1A 2MYGA 1SKSB 3GAXA 4YQVA 4BPYA 1S5AA 1RRLA 5ECNB 5COHA 1QGVA 1M2AA 3SBCA 1BRJA 4XRAA 3LMLA 1B4PA 3V98A 3WOFB 3LTCA 3GFKA 4GHOA 3R2QA 3WGXA 3TJGA 2LS5A 4ZBBA 2F8FA 3SWLA 4O8SA 2ZDJA 5ABRA 5E4WA 5EY6A 5KN3A 1QUWA 3ZIVA 1VQ73 3P8WA 1DMQA 3D9RA 3PS8A 2J23A 1O7GB 2HMNB 3FZ9A 2YJ7A 3EINA 2CKFB 3MIXA 3Q1CA 2H0IA 1BYEA 4IKHA 1YQ1A 2JACA 1S723 19GSA 3OW22 3TKSA 3LWAA 1XWKA 1HZ1A 1STFI 1BSAA 3F4RA 3UL3A 1U87A 4QQ7A 1NO3A 2DMMA 1QMVA 1Q40A 2E0QA 2IMKA 2QIYA 1TP9A 3SLUA 1RRHA 3Q6OA 2HSMA 4K7IA 2RNTA 1YNVX 3RDEA 4IELA 4K1FA 4KH7A 3IBHA 3ZREA 2W6JH 1GTAA 1JNQA 1SK2A 1YY7A 2YZUA 4TXOA 4FYBA 3X3YA 4IHUA 4GLTA 1GOUA 4WWUC 1K9M4 3ERGA 1OHSA 3GKXA 4R9LA 2XF3A 2F5WA 2H01A 1KSIA 5LC6A 2I3YA 4XBTA 2BNGA 4H86A 4HOJA 4FYCA 4KFFA 3S27A 3UL6A 2PU9C 3WGEA 1EA2A 3HVVA 2R6KA 4IP1A 2OTL3 3IV4A 1M904 3C73A 4WF5A 4J2FA 1QQ2A 1OC8A 3IAS2 3ISOA 4NV2A 1O6JA 4OCEA 3ZTLA 5IMZA 4ACSA 1A2JA 3FG4A 4RUVA 5J4UA 4N0VA 1E97A 3BB9A 3GIXA 3KH7A 2B24B 2GSPA 2GSTA 2KP2A 1TJDA 1WPIA 1TRVA 4KDUA 1B8XA 2XGLA 3A3TA 4YAVA 2MC8A 1UUWB 1E3RA 2DJ1A 4PUAA 1V9WA 1A2LA 5DAKA 2INXA 1ZYNA 5F06A 5CREA 4MJEA 4L5LA 2OBKA 4O32A 3PR8A 2YZHA 2SBLA 2JADA 1UCJA 2B3SA 4HM2B 2XPDA 2B5XA 5A4VA 1K0CA 3BCIA 1UCLA 1AXDA 1ERVA 1R7HA 1G0TA 1GY7A 4JE1A 5EL8A 2BO9B 2NPBA 3LXUX 1EP7A 4RZMA 1EP8A 1GP1A 3N9JA 2AB6A 2OACA 5GAPD 4RNZA 3N54B 2B6MA 2O7KA 5HOHA 5IERA 5A0OB 3W8JA 1IVVA 3EE1A 4HZ2A 2R41A 1O81A 1SL0B 2Z7AA 3F40A 1GH2A 3EJVA 2VOCA 2XHFA 5DCGA 3UEMA 1PYLA 1R4YA 5G1KA 1FVKA 4G2EA 4CW9A 1H75A 3G7YA 2IY2A 1GNEA 1ROAA 1MD3A 5IMVA 3BOAA 2IYJA 3FR9A 1X1WA 4O3VA 4ZL9A 4BIKA 3ZVJA 3K63A 3UMAA 3MYDA 1O8WA 4N30A 4JF8A 5D8IA 1S3RA 3FKAA 3GMFA 1FGRA 3X3ZA 2CWUA 1BNRA 2EIRA 3FF0A 4XBYA 1J08A 3IRAA 5GZZB 4X2OA 1V58A 5G2GA 1GYBA 4ECCA 1ROVA 2A2RA 1B4QA 1V2AA 1THXA 1JLVA 5BXQA 2A2SA 3CQFA 4D73B 2D2ZA 1DETA 3MG3A 2HOHA 4IQ1A 4TX4A 4O7HA 1XIYA 3R3EA 2J9HA 3JUPA 4AGSA 3F14A 2V41A 4MJDA 5KN1A 2WRTA 5JWQB 1HD2A 3GWRA 1TK5B 1X1YA 2R4VA 3V1WA 1PFPA 1USBA 4N6OB 3LTAA 5FGOA 3G9BA 4BVXB 2ZNMA 1N8JA 2YJHA 2HMKB 4WBJA 2W2CA 1NNVA 5DJLA 4JU5A 1PX6A 3D5IA 3GRDA 5JCWA 1LOVA 3IMAB 1XOBA 3KXOA 1VQN3 1I0VA 5EQLA 1A8YA 1AUCA 4G1MB 2LEGA 3GL3A 1US1A 4GWRA 2JSZA 3RDWA 1ON4A 1BNGA 1FAAA 4PQIA 3TRPA 4OD7A 2E2VA 1EEMA 2O3OA 3U97A 3C7MA 3ZVJD 3KH9A 1RKYA 4HBRA 3TKSE 3L4NA 2OADA 1IDPA 3G16A 3MYTA 5F05A 5JPPA 3TRXA 1IV7A 2P09A 4I2UA 2WDUA 1AQVA 1S3CA 4K90B 3F9SA 1GOVA 3D6IA 2N5AA 1HYFA 1TFKA 2VCQA 1LOYA 3LTDA 1NM3A 3BD2A 2W03A 4Q5RA 5IQYA 2LRNA 1MWSA 2K9FA 4MEIA 3HJOA 5EVOA 1R5AA 4PXOA 3FK8A 1A67A 1A23A 2H75A 3TB2A 2LJRA 3DXOA 1F37A 1V40A 4JR6A 1LNIA 3IE3A 1PL2A 1MGRA 3HVXA 3KKGA 2TRXA 3Q2PA 1YJ93 1LU4A 3MAKA 1FW1A 1PL1A 3ZITA 1T2IA 4N6TA 1OF5A 4TR1A 3OWYA 1FGTA 4MF7A 3CME3 1TRPA 3DXBA 10GSA 1QFNA 1DMNA 4FMAA 4G0IA 1JZWA 1XWGA 3M8NA 2OWPA 1JB4A 1QALA 4OUQA 1HQOA 1U6TA 4YH2A 2TRCP 3ZZXA 4GTUA 1PRXA 3ZL5A 1NW2A 3VWVA 1Q42A 5CF1A 4HU9A 2IUKA 3JUMA 4K1UA 5RNTA 4EXRA 1T2HA 3APSA 1BJXA 4GQCA 3GSPA 1LQMB 1ZYPA 1B48A 3O76A 1RK4A 3N9HA 2IL3A 4BTWA 1W00A 3BNDA 1B2ZA 4BA7A 4BVYA 1ZGNA 3Q19A 3NBBA 3T8UA 2OE0A 4IT7A 5ELUA 1SKWB 2SARA 2PPTA 5JCGA 4TXVA 1FO5A 3CC23 1B2XA 3F4SA 5D93A 2YCDA 1IT7A 2GQKA 1N9EA 4DSSB 3KTBA 2ZCTA 3DH2A 3RGAA 3A5WA 2D42A 5CNWA 2O89A 4KAEA 1M9GA 1K0NA 5JPUA 3C8EA 4POKA 3P2AA 2CZ3A 1JRQA 3IR4A 3CBUA 4TOPA 3EU3A 2F5MA 4RNYA 2CC3A 1W89A 3A2VA 3UBKA 2PMTA 1GL8A 3ZFLA 1GNWA 1TK8B 1RNBA 4DKIA 1EEJA 1K0OA 4ORLA 2WJUA 1I9DA 1W4NA 2FUG2 2ZUPA 3CPOA 4PUFC 3FR6A 17GSA 2CVDA 4MNNA 1K734 1WRYA 5AIVA 1PX7A 4HM5B 1AAZA 2L5LA 5AGYA 3MSOA 5CLKA 2R0PA 2F56A 3HK4A 3CCE3 3HKRA 13GSA 1B2SA 3EC3A 2OTJ3 6GSYA 3HIIA 4J8TA 4KNDA 2R2JA 3A2XA 4IIAA 2BU4A 3KN4A 1RMSA 3APOA 5G2ZA 3UBLA 3QPMA 2WGQA 1C54A 2CW9A 3PCSA 4MPGA 1OGXA 2DJ3A 3UIWA 1HKXA 4HEA2 11GSA 1N5PA 1PFOA 4K2XA 4HU7A 1FUWA 1IU7A 1YJW3 2TIRA 1GSDA 2HZFA 1JZDA 1LVNA 5J9BA 4LZIA 1LJRA 2KCDA 2O9UX 2W56A 2Y74A 5AIFA 5JWRB 2H6XA 1A2KA 5FWGA 3W6GA 4HZ4A 5LCZA 1SL2B 1PKZA 5DQSA 2F3MA 20GSA 2CG0A 2AHEA 3L9VA 3V99A 4KUNA 1CQGA 2H71A 1OACA 1EOHA 1RN1A 1OAZA 4BWSA 1GMPA 5D83A 1T00A 5ELAA 3I9V2 4TRXA 5KEJA 2FA4A 3BNEA 1VF1A 5GSTA 4MF6A 3D3LA 4H3UA 2PN8A 3DGLA 1GSFA 4F03A 2CFDA 3IOSA 1Z7RA 1JV2B 5D82A 2F98A 5IMFA 2V6OA 3ROBA 1BSDA 1CH0A 2D1WA 3M9KA 2OE3A 1A2MA 2KF6A 1T1VA 2X8HA 5ECIB 2RSXA 4FCMA 1PU4A 2G0FA 3BJ5A 3QAGA 2VUPA 4MMYB 1SU9A 1BQ7A 4PX1A 2XFSA 5DBQA 4X43A 1B21A 2V32A 1OPYA 1K0DA 1JKGB 1T5YA 1B2UA 1FYSA 5IG3A 4R1KA 5ECSA 3FSDA 1EGOA 2XR8B 3SXXA 4MK3A 3DGMA 2O87A 3EU4A 3GV1A 1WMNA 3CMIA 4O5UA 1UI8A 3J7Yk 1YIJ3 1GMQA 1WOUA 6GSPA 3L0RA 4RQXA 4JRRA 1BX9A 2G2QA 3WYWA 4R4KA 4HKVB 2VL2A 2M7OA 4K61A 1WMPA 3EQQB 1B9YC 3F8UA 3HYPA 2PERA 4HQZA 1HNAA 2CV4A 2XBIA 1SPUA 3MKIA 4LMVA 1JZRA 3JVCA 1Q7Y4 3FZAA 4OK0A 5IF6A 4YKFA 3MNGA 5ECPB 3CD63 2C0GA 5DQYA 1RGAA 1V74A 5FHIA 4EYCA 4MJBA 5CK6A 2PWJA 4BWQA 1Q7HA 4LL4B 5KN0A 2RCDA 2HT9A 3GL5A 3N5OA 3WGDA 2GU3A 2GSRA 2H70A 1DSBA 2HSYA 3PCRA 2HSHA 2ML5A 4HOHA 5HR0A 2CFLA 3QDNA 2N5BA 1I2EA 3FEUA 3IDVA 1LXEA 4N6MA 2LQQA 1GSPA 2GEXA 2HZEB 4LA1A 2K8VA 2I81A 1G7OA 4EF0A 2YN1A 5AN1A 4YKGA 3UNLA 3NQZA 3KIIA 2QC7A 1OH0A 4KB3A 4NMUA 4K0GA 4OWYA 3NM7A 1RGLA 2DIZA 1UN2A 4WBRD 3UJMA 1XWCA 1VF4A 4GXZA 2VO4A 3HVSA 4NAXA 5DRVA 1GY6A 1KD14 2ML6A 1HYUA 4MMMA 4WYKA 3WHOA 1RGKA 1GSSA 2L6DA 1JN5A 3DWVA 2UGIA 2A15A 3RNTA 2AYTA 1STDA 1U5OA 1B20A 1FGQA 3CCS3 2AADA 2HYXA 1RDSA 1SYRA 2HMMB 3GYKA 1DVCA 1LBKA 1GSEA 1YEXA 1AQWA 4OFNA 2YWOA 5CAXA 4V1Ag 3WT2A 5GSSA 4K6XA 1EV9A 3I0YA 1RHLA 1BUQA 2EIOA 3VURA 4STDA 4OFMA 2PUKC 3EVIA 1M1K4 4X2HA 1GTUA 4FO5A 1YEPA 1O8XA 1SD9A 5FT3A 1X5EA 1OC9A 4L0UA 5KN2A 3CSJA 1XWBA 2P31A 5D9TA 1SL1B 4I2TA 5JWOB 4G0KA 3TKPA 1PGTA 3CCL3 1W01A 4NHWA 2FNOA 1O73A 2MBTA 2P0XA 4MMZB 5AEWB 5BMUA 3BIRA 3FHKA 3GTUA 1X5DA 1Q9EA 3GX8A 3KD0A 2CX0A 3UOMA 4IVFA 1OVNA 4F2IA 1W5ZA 1U88A 4AEQA 5C00A 1YKAA 5BVBA 1ULJB 1PN9A 1TTZA 3WMDA 2WULA 4ECJA 5IPGA 3LYPA 2B5YA 1BRGA 3EX9A 3BLZA 5D96A 4FMDA 4ICYA 4PEJA 1ZZYA 1TRUA 1RCKA 3HI7A 1MEKA 1RN4A 2DLXA 2HXKA 3NZNA 5CO3A 1AQXA 2GGTA 4P3YB 2RM5A 3QRDA 3Q90A 2F51A 4NXIA 4GSTA 1OE8A 4OO5A 2OQEC 1W2ZA 2NDOA 1GSYA 4WKWA 2E2MA 4MZBA 3T0UA 3KGKA 3LG6A 2L4QA 1ZS7A 2FXTA 5GSPA 1U3IA 1Z7PA 5B7CA 1I0XA 1AR0A 2YANA 5B8AA 4TW5A 3UARA 1SIHA 1M7TA 6GSXA 4HYZA 1AY7A 1YF1A 3IA1A 1IYYA 1TTOA 1W4VA 3MG2A 3FLJA 2R3XA 3NIVA 1AC1A 4LEHA 4BL7B 2PVOC 3IAM2 2VIMA 2NVLA 1IQXA 1ST9A 3VFIA 3HZ8A 3Q3FA 3G7JA 1Z5YE 1WMJA 3KP8A 1N8QA 2LKUA 4X1UA 3GA4A 2Z9SA 1SJZA 1VF3A 3UL5A 2LV3A 3FZ5A 1DE2A 2CAIA 1KTEA 14GSA 3VGNA 1X9WB 4HM0B 1K3LA 4HSCX 3FMWA 1YVBI 4L0WA 4IPBA 1IT8A 3EF8A 2UUGC 2HLSA 1VQ53 5H5RA 5J41A 4HI7A 4NHZA 4KDYA 3K9MC 2X8CA 3IPZA 1ERWA 1ZX2A 3M9JA 1KEBA 5DREA 2MF7A 3BCKA 1BIRA 3TOUA 1MDKA 1TU7A 1IVXA 3MSZA 4F82A 3HCZA 3DRNA 2MBSA 4N3VA 2BT3A 1TU5A 2NTOA 1BRKA 4NREA 2LQOA 3PINA 3M3MA 4IJ3A 5J3RA 1Q98A 1SJ6A 2GLRA 2RUEA 5ENUA 1RSNA 4ECBA 3CPW2 1NWWA 1FOHA 5IG0A 5DALB 1OUNA 3NX0A 1J9BA 3ERWA 4IQAA 3KSED 3ZG5A 1SENA 4PURA 2GZYA 3H1NA 5G1LA 5ECQB 3KIJA 2V1MA 4KA0A 4JBBA 1DE1A 5D9XA 3WR2A 1GLQA 2CHCA 3FZWA 5H5QA 4HM1B 1YKCA 3LZAA 3MWZA 1ZL9A 1F3BA 3A2WA 1F2EA 3HDCA 2BTOT 2GEYA 4IGJA 4BTYA 3C1RA 4D73A 4MDCA 2R0GA 1XZOA 2YOIA 3BNCA 1AVLA 3CSHA 5JCUA 3CRUA 1F8NA 3KMNA 3C71A 2GT6A 1R5PA 2FWEA 2XSHB 1KNGA 1QVF2 4JR4A 5G5EA 4L7KA 5IOXA 4BVXA 1N9JA 2PNCA 3FZ4A 3DYRA 2P5QA 2OE1A 2C0FA 4NPBA 4PQHA 2H0HA 2VCTA 2XGNA 4G9HA 1K28A 5EPFA 2IA7A 6GSUA 2XFTA 4IN0A 1WMOA 5STDA 4KT3B 4AKYA 6STDA 1PQNA 2REMA 3EMXA 2KF4A 5A4WA 2FLSA 2CX3A 3FH1A 3HD5A 5IENA 3Q74A 4KSOA 3SVAA 1KBNA 4LLRA 18GSA 2DKIA 3UVHA 3U1WA 4KCAA 4X0XA 2V2GA 4ZXGA 1HNBA 1RGCA 3F8XA 3HZ4A 1I2FA 1Q814 1FW7A 3B7CA 3L0HA 1M3JA 3ZMLA 2IWTA 1GTBA 4FQUA 3HOHA 3TKQA 4HM7B 1PMTA 1VQ83 3A76A 3GKMA 5E59A 3TJKA 1FZUA 3EBYA 1NJI4 1EWXA 3E0UA 2XPEA 1I8VA 5D9WA 1CYUA 1O7PB 2FA8A 3WA3A 1AIUA 1V57A 1BSEA 1VQP3 5LNKe 5ELGA 3UB1A 5KOWA 2JZRA 3BU4A 3H79A 3ZYWA 1BAYA 3LEFA 3D21A 3DZLA 2HRKA 1OHOA 3GZYB 4KZ1A 2B5EA 1EOGA 3WA2X 1UUVB 3LT8A 1W6YA 2H74A 1BSCA 1ILOA 1ZO2A 1X5CA 3NM2A 1RW1A 4DSQA 2KOKA 2C10A 3QR6A 5DCHA 1MTCA 4ZM8A 2BMRB 1QMAA 3KZTA 5KP3A 4R9KA 1TI1A 3LQ7A 1W7CA 2AAEA 5DDLA 2YV7A 3UVTA 6GSVA 3VSYA 1KWIA 5IG4A 3S28A 1WP0A 1NB5I 1U3AA 2YV9A 2HRAA 4O5QA 4EDYA 1I3FA
chains in the Genus database with same CATH topology
2M46A 4ZBDA 1GSUA 2PBJA 4XS4B 4KCEA 4MZCA 5CYYA 3H4KA 1K0MA 4Z2UA 2FHEA 1T4YA 1XW5A 3GN3A 4NWYA 2DJJA 3F3RA 3TOTA 2DJ0A 1M9AA 4HJMA 2GVPA 3PPUA 1NHOA 3EMPA 4EIPA 2H1BA 3RHCA 1C72A 2JU5A 2VD1A 3TKSC 4DSSA 1YJ6A 1M2DA 2O8VB 3GH6A 5ID2B 4MA9A 3HJMA 4OMVA 4AJ8A 3KP9A 2VCXA 1VF2A 4YQUA 1QK8A 4OO4A 4HS1A 4CY8A 4YAPA 1JLWA 5B8BA 2X49A 2X64A 4L5OA 4K8MA 2A4VA 4IS0A 4GCIA 4MLYA 5G30A 2LNTA 2IMDA 5ECLB 2JZSA 4HQSA 1GULA 2AAWA 2KUCA 3U6VA 1TU8A 2K18A 1B9XC 1ZCPA 1TKDB 2C3QA 4ZB6A 4OCFA 3I69A 3TCOA 2RIIA 1EGRA 3F3QA 1A0RP 2K8SA 5IMAA 4ZB8A 4LMWA 3TKRA 4JZQA 4PQ1A 2C0EA 4MH2A 2B7JA 1ZMAA 5D9VA 4HJ2A 4KF9A 5L71A 2GSSA 1S3AA 4FH8A 3FW2A 3IC8A 1X0RA 5LD0A 1JZOA 4MP4A 4XS1A 3GHAA 3U5RE 3DMLA 3GNJA 2C3NA 1A24A 1CQHA 3LXTA 2HRNA 2H6ZA 2FCHA 4XS6A 2FGXA 1AW9A 4FIWA 1JHBA 3F4TA 4ULXA 5IM9A 2L59A 1JFUA 4TR0A 4NV5A 3FRCA 2C3TA 5HR2A 1BG5A 3EYTA 2JZTA 3IXRA 4Q5NA 3TUEA 2BMXA 5IPHA 1E2YA 1K3OA 2M72A 5KOXA 4RQRA 1PA3A 1GWCA 3KJYA 3RBTA 3ED3A 3CRTA 2ON7A 4PGTA 3F6DA 3IHQA 4X4JA 1SK0A 1PD21 2PGTA 1ZOFA 5INYA 1Z6MA 4QL9A 3K8NA 4EE0A 4TR4A 1ZYEA 2EC4A 1PSQA 2IFQA 4AJ6A 3TJBA 2X8GA 1XOAA 3RAZA 2I1UA 3LJRA 1Z9HA 2P0GA 5A5KA 4K0NA 5CRGA 3L9SA 1GUKA 4ID0A 3QAVA 4V2NA 4ZBAA 2VM1A 4KSMA 3GUSA 1T7PB 3DKSA 1G6WA 3A5IA 2WCIA 4MCUA 3D4MA 4ILFA 5IO0A 2MMOA 2OBIA 1G6YA 2GS3A 4TKYA 4PTSA 2C1YA 3EPTA 2VL3A 3D0ZA 3US3A 1THOA 2X4AA 3DEXA 2DIYA 2HZEA 4IJIA 2LRCA 1GUHA 2ALBA 1GRXA 1TK0B 2FWFA 1N2AA 2HRFA 2LJKA 4V1Ap 2H73A 5IO2A 5ECKB 3VK9A 2CVBA 1MDJA 1E6BA 4CDOA 1XPVA 4Z2TA 1SK1A 4V2LA 2LSTA 2DMLA 3ERFA 2CA8A 2IMFA 1OC9B 3H8QA 4F0BA 1ERTA 4EIQA 1R26A 4GSSA 3VWWA 1ERUA 3QFBC 3TJFA 2RUFA 1FHEA 1WJKA 2M80A 3GTUB 2VCZA 5HQPA 2QA2A 4KE3A 3F0IA 3GH9A 1M99A 4ZL7A 1GLPA 3DGQA 1Z3EA 1T8EB 3IHGA 1OKTA 2VAFA 4KGIA 3M0FA 3TDGA 2LJAA 4I6XA 2CX4A 3AY8A 2CQ9A 4DEJA 4TXOB 4HUAA 4LL1B 2GDRA 2ON5A 3QMXA 4G19A 4ZB9A 2A4HA 4TVEA 3ZLPA 2C0DA 3EWLA 4HDEA 2C80A 1J0FA 2HNLA 4TN8A 4WR4A 5BRTA 3FYGA 2H1DA 3P7XA 1IYHA 4K9ZA 2YNXA 5CRWA 3IC4A 2MZCA 1RQMA 4I97A 5D73A 5DAKB 3RHBA 2LTKA 3FKFA 1FB0A 2N5FA 4WXTA 5DJMA 2GT5A 3ZMKA 4EC0A 4MJCA 1BEDA 2I9HA 1QXHA 16GSA 2VLVA 4I8BA 6GSTA 5HR3A 2DKHA 5F0GA 4IP6A 3LSZA 4BL7A 4E8HA 4ZIJA 1F9MA 2CVKA 3KZQA 4ML1A 3EURA 4GF0A 3C1SA 2MMZA 2B1LA 1XWAA 3JCML 1H4OA 1SYXA 3HA9A 1ML6A 5HR1A 2OJLA 1URMA 1XVWA 1T4ZA 2YP6A 2VM2A 2KHPA 2YWIA 1YF0A 4WETA 3Q18A 3LYKA 4N11A 2OA7A 3QFAC 2WS2A 1TRSA 1XCCA 3W8SA 4PNGA 2GZZA 5GAND 3VI7A 4OFTA 1OYJA 3PGTA 4EL1A 3UJ1A 2H6YA 5CP1A 4WF4A 2MMNA 12GSA 5B6NA 3BBYA 5IIZA 1OC3A 3KCMA 3PH9A 9GSSA 4EUYA 5DALA 1O85A 3I6AA 4ZILA 1I5GA 4QL7A 2VCWA 4G10A 3FY7A 3H93A 3LGCA 3ME7A 1FB6A 2H0GA 2IJYA 4DVCA 4GQFA 5CRHA 3DVWA 3ZRDA 4TR3A 1FOVA 3F9UA 4O92A 5HFKA 3VWUA 2I4AA 1SD8A 2FWHA 2YPMA 3D22A 4ECIA 1MDIA 3IK9A 4N10A 4Z2RA 1WIKA 2VL2C 2WFCA 1XW6A 3HJPA 5J9CA 1NSWA 2F9SA 3KM6A 3QCPA 2R5GA 2YWNA 1YDKA 1DUGA 4J56E 2DSAA 1YZXA 3E9JB 2IMIA 2MMAA 3LFLA 4IBPA 4EXJA 2LUSA 4CHSA 5IMDA 5IMCA 3TGZA 2L6CA 1Q4JA 4Q5FA 4POMA 1OE7A 22GSA 5H5SA 2HFDA 3HY2A 3E3EA 2IPAA 4KW6A 1SKRB 1V98A 3G7IA 5CRDA 5A4UA 2GZPA 3I43A 5IOWA 4FYUA 4TR1B 1TI3A 3VI5A 3GX0A 1XVQA 4KX4A 2H30A 2CZ2A 2RLIA 1F3AA 3O6TA 2CAQA 2F8AA 2B7KA 2L5OA 1FG4A 1UC7A 3WT1A 4WR5A 4EVMA 1A0FA 4ISDA 1X9MB 1TRWA 2OKAA 1PN0A 3GSTA 3EE2A 4XRDA 2CT6A 1Z6NA 2BJXA 2HE3A 1EZKA 4I5QA 4BVYB 4E8EA 4MJAA 3L9UA 4ZL8A 2WB9A 2QKEA 3GRXA 3D4TA 2KP1A 2EIQA 5G5FA 4EKZA 4F0CA 2NBSA 3VPTA 1WWJA 1XW9A 2H72A 1M2BA 3ZIJA 5ECHB 1K0AA 1UVZA 1TDIA 3O3TA 2DJKA 4Q5QA 3TRQA 2H8LA 5AISA 2QA1A 2E7PA 6GSSA 1R4WA 2QGVA 4POLA 5F07A 1OKDA 1ACVA 4GSNA 2K6VA 2H66A 4XS4A 2VCVA 2P5RA 4MZWA 2IIYA 3CXGA 2YWMA 1DBYA 5HFGA 4EO3A 4O5RA 1Y25A 5F8BA 2GQMA 3J7Yb 1ZYQB 5B6MA 3DD3A 2L57A 2C8UA 3RPNA 3KEBA 3LORA 2AV4A 1FVJA 4V2MA 4CY6A 3ZFBA 2GSQA 5ID2A 2H1GA 2VLTA 2X99A 1VGLA 4Z7XA 2JSYA 1K0BA 2HI7A 4USSA 4L8EA 4YQMA 2E2GA 2WGRA 3F6FA 4XCSA 4KDXA 2C4JA 3MWHA 3CTGA 3QD9A 2QSIA 4AF2A 2H1AA 4POBA 2XC2A 3VLNA 4MPFA 5HFIA 3S9FA 2DBCA 4RI7A 1Y6EA 4N0ZA 1M9BA 1T3BA 4DSRA 4F9ZA 4PNFA 5ECRB 1GSQA 2R0CA 3APQA 4J57E 2H76A 3ME8A 1K3YA 4MABA 3F63A 3MDKA 3LW9A 4XIHA 2JL4A 4A5PA 2GTUA 4XTSA 3GURA 4RI6A 5ECMB 1SJIA 4K7NA 2IMEA 3CSIA 2ES7A 3IK7A 4G0LA 2UZ8A 1M0UA 1PKWA 3NOFA 3D5JA 1TXXA 2VD0A 2FY6A 3WD6A 4K5SA 2RM6A 2DC5A 4K2DA 6GSWA 1VRSD 3DVXA 3GKKA 2B1KA 1NHYA 1TW9A 1MD4A 5C04A 1XXUA 3TJJA 4GRFA 5ECOB 1HNCA 1O7UA 2O85A 1A8LA 3GSSA 4ML6A 2AUVA 3KTLA 5DVBA 3P90A 4XHMA 3QOUA 2IFQB 3M1GA 3VWXA 4MF5A 2GQLA 1EV4A 1G7EA 1ABAA 1IYIA 5J5NA 2A2PA 2V6KA 2VLUA 8GSSA 2KLXA 3GKNA 1XBSA 7GSSA 2AJQB 3HHVA 2L4CA 4EDZA 3HXSA 3FR3A 3KMOA 2FD3A 1F6MC 3VPQA 1XFLA 4MH3A 3LXZA 2LNSA 4IW9A 2XBQA 4WEYA 1X9SB 1WE0A 1UA5A 3CTFA 3CYNA 2VL9A 1TOFA 4AJ7A 2WZ9A 3RPPA 4K5RA 1S3DA 2R37A 1GUMA 3DIEA 2PVQA 1GTIA 3OR5A 3QAWA 3L78A 2DJ2A 2FWGA 5G31A 3UAPA 2LRTA 4K7OA 2IN3A 2H19A 4JEDA 5AIXA 2MYGA 1SKSB 4YQVA 4BPYA 5ECNB 5COHA 1QGVA 1M2AA 3SBCA 4XRAA 3GFKA 1B4PA 3R2QA 3WGXA 3TJGA 2LS5A 4ZBBA 2F8FA 3SWLA 5ABRA 5E4WA 5EY6A 5KN3A 1QUWA 3ZIVA 3P8WA 2J23A 3FZ9A 2YJ7A 3EINA 3MIXA 2H0IA 1BYEA 4IKHA 1YQ1A 2JACA 19GSA 3TKSA 3LWAA 1XWKA 3F4RA 3UL3A 1U87A 4QQ7A 2DMMA 1QMVA 2E0QA 2IMKA 1TP9A 3Q6OA 2HSMA 4K7IA 4IELA 4K1FA 4KH7A 3IBHA 3ZREA 1GTAA 1SK2A 1YY7A 2YZUA 4TXOA 4FYBA 4IHUA 4GLTA 3ERGA 3GKXA 2H01A 2I3YA 4H86A 4HOJA 4FYCA 2PU9C 3WGEA 3HVVA 2R6KA 4IP1A 3IV4A 3C73A 4WF5A 4J2FA 1QQ2A 1OC8A 3IAS2 3ISOA 4NV2A 1O6JA 4OCEA 3ZTLA 5IMZA 4ACSA 1A2JA 5J4UA 4RUVA 4N0VA 3GIXA 3KH7A 2GSTA 2KP2A 1TJDA 1WPIA 1TRVA 4KDUA 1B8XA 3A3TA 4YAVA 2DJ1A 4PUAA 1V9WA 1A2LA 5DAKA 1ZYNA 5F06A 5CREA 4MJEA 4L5LA 2OBKA 4O32A 3PR8A 2YZHA 2JADA 2B3SA 2XPDA 2B5XA 5A4VA 1K0CA 3BCIA 1AXDA 1ERVA 1R7HA 1G0TA 4JE1A 5EL8A 2NPBA 1EP7A 1EP8A 1GP1A 3N9JA 2AB6A 2OACA 5GAPD 2O7KA 2B6MA 3W8JA 4HZ2A 1O81A 1SL0B 1GH2A 2VOCA 2XHFA 5DCGA 3UEMA 5G1KA 1FVKA 4G2EA 4CW9A 1H75A 3G7YA 2IY2A 1GNEA 1MD3A 5IMVA 3BOAA 2IYJA 3FR9A 4ZL9A 3ZVJA 3UMAA 3MYDA 1O8WA 4N30A 5D8IA 3GMFA 2EIRA 3IRAA 1J08A 5GZZB 1V58A 4ECCA 2A2RA 1B4QA 1V2AA 1THXA 1JLVA 4D73B 2A2SA 2D2ZA 4IQ1A 4O7HA 1XIYA 3R3EA 2J9HA 4AGSA 2V41A 5KN1A 2WRTA 5JWQB 1HD2A 1TK5B 2R4VA 3V1WA 1USBA 3G9BA 4BVXB 2ZNMA 1N8JA 2YJHA 4WBJA 5DJLA 4JU5A 1PX6A 5JCWA 3KXOA 1XOBA 1A8YA 1AUCA 2LEGA 3GL3A 4GWRA 2JSZA 3RDWA 1ON4A 1FAAA 4PQIA 3TRPA 4OD7A 1EEMA 3C7MA 3ZVJD 3KH9A 3TKSE 3L4NA 2OADA 5F05A 3TRXA 4I2UA 2WDUA 1AQVA 1S3CA 3D6IA 2N5AA 2VCQA 1NM3A 3BD2A 4Q5RA 5IQYA 2LRNA 2K9FA 3HJOA 5EVOA 1R5AA 4PXOA 3FK8A 1A23A 2H75A 3TB2A 2LJRA 1F37A 1V40A 4JR6A 3IE3A 1PL2A 3HVXA 2TRXA 1LU4A 3MAKA 1FW1A 1PL1A 3ZITA 4TR1A 4MF7A 3DXBA 10GSA 1QFNA 4G0IA 1JZWA 1XWGA 3M8NA 1U6TA 4YH2A 1HQOA 2TRCP 3ZZXA 4GTUA 1PRXA 3ZL5A 1NW2A 3VWVA 4HU9A 3APSA 1BJXA 4GQCA 1ZYPA 1B48A 3O76A 1RK4A 2IL3A 4BVYA 4BA7A 1ZGNA 3Q19A 2OE0A 1SKWB 2PPTA 5JCGA 4TXVA 1FO5A 3F4SA 5D93A 2YCDA 4DSSB 2GQKA 3KTBA 2ZCTA 3A5WA 5CNWA 2O89A 4KAEA 1K0NA 4POKA 3C8EA 3P2AA 2CZ3A 3IR4A 3CBUA 4TOPA 3EU3A 1W89A 3A2VA 3UBKA 2PMTA 1GL8A 3ZFLA 1GNWA 1TK8B 1K0OA 1EEJA 2WJUA 1I9DA 2FUG2 4PUFC 2ZUPA 3FR6A 17GSA 2CVDA 4MNNA 1WRYA 5AIVA 1PX7A 1AAZA 2L5LA 5AGYA 2R0PA 3HKRA 13GSA 3EC3A 6GSYA 4KNDA 2R2JA 3A2XA 3APOA 5G2ZA 3UBLA 3QPMA 4MPGA 2DJ3A 3UIWA 4HEA2 11GSA 4K2XA 4HU7A 2TIRA 1GSDA 2HZFA 1JZDA 5J9BA 1LJRA 5JWRB 2H6XA 5FWGA 3W6GA 4HZ4A 5LCZA 1SL2B 1PKZA 5DQSA 2F3MA 20GSA 2AHEA 3L9VA 4KUNA 1CQGA 2H71A 1EOHA 1OAZA 4BWSA 1T00A 5ELAA 3I9V2 4TRXA 5KEJA 2FA4A 1VF1A 5GSTA 4MF6A 2PN8A 1GSFA 4F03A 3IOSA 1Z7RA 5IMFA 2V6OA 3M9KA 2OE3A 1A2MA 1T1VA 2X8HA 5ECIB 3BJ5A 2G0FA 3QAGA 2VUPA 1SU9A 1BQ7A 4PX1A 5DBQA 4X43A 2V32A 1K0DA 5ECSA 1EGOA 4MK3A 2O87A 3EU4A 3GV1A 3CMIA 4O5UA 3J7Yk 1WOUA 4RQXA 4JRRA 1BX9A 2G2QA 3WYWA 2VL2A 1B9YC 3F8UA 3HYPA 2PERA 4HQZA 1HNAA 2CV4A 2XBIA 4LMVA 1JZRA 3FZAA 4YKFA 3MNGA 5ECPB 2C0GA 5DQYA 5FHIA 4MJBA 2PWJA 4BWQA 4LL4B 5KN0A 2HT9A 3GL5A 3N5OA 3WGDA 2GSRA 2H70A 1DSBA 2HSYA 2HSHA 5HR0A 3QDNA 2N5BA 3FEUA 3IDVA 2LQQA 2HZEB 4LA1A 2K8VA 2I81A 1G7OA 4EF0A 2YN1A 5AN1A 4YKGA 2QC7A 4KB3A 4NMUA 4K0GA 4OWYA 4WBRD 2DIZA 1UN2A 1XWCA 1VF4A 4GXZA 2VO4A 3HVSA 4NAXA 4MMMA 1HYUA 1GSSA 2L6DA 3DWVA 2AYTA 2HYXA 1SYRA 3GYKA 1LBKA 1GSEA 1YEXA 1AQWA 4OFNA 2YWOA 5CAXA 4V1Ag 3WT2A 5GSSA 4K6XA 1EV9A 2EIOA 3VURA 4OFMA 2PUKC 3EVIA 1GTUA 4FO5A 1YEPA 1O8XA 1SD9A 5FT3A 1X5EA 1OC9A 4L0UA 5KN2A 3CSJA 1XWBA 2P31A 5D9TA 1SL1B 4I2TA 5JWOB 4G0KA 3TKPA 1PGTA 4NHWA 2FNOA 1O73A 2MBTA 5BMUA 3FHKA 3GTUA 1X5DA 3GX8A 3KD0A 3UOMA 4IVFA 1OVNA 4F2IA 1U88A 5C00A 1YKAA 1PN9A 1TTZA 2WULA 4ECJA 5IPGA 3LYPA 2B5YA 5D96A 4ICYA 1ZZYA 1TRUA 1MEKA 3NZNA 2DLXA 2HXKA 5CO3A 1AQXA 2GGTA 4P3YB 2RM5A 2F51A 4NXIA 4GSTA 1OE8A 4OO5A 2NDOA 1GSYA 4WKWA 2E2MA 4MZBA 3KGKA 3LG6A 2L4QA 1U3IA 1Z7PA 5B7CA 2YANA 5B8AA 4TW5A 3UARA 1M7TA 6GSXA 1YF1A 3IA1A 1W4VA 2R3XA 3NIVA 1AC1A 4BL7B 2PVOC 3IAM2 2VIMA 2NVLA 3VFIA 1ST9A 3HZ8A 3G7JA 1Z5YE 1WMJA 3KP8A 2LKUA 4X1UA 3GA4A 2Z9SA 1SJZA 1VF3A 2LV3A 3FZ5A 1DE2A 2CAIA 1KTEA 14GSA 1X9WB 1K3LA 3FMWA 4L0WA 5H5RA 2HLSA 5J41A 4HI7A 4NHZA 4KDYA 2X8CA 3IPZA 1ERWA 3M9JA 1KEBA 3BCKA 3TOUA 1MDKA 1TU7A 3MSZA 4F82A 3HCZA 3DRNA 2MBSA 2NTOA 2LQOA 3PINA 3M3MA 4IJ3A 5J3RA 1Q98A 1SJ6A 2GLRA 2RUEA 5ENUA 4ECBA 1FOHA 5DALB 1J9BA 3ERWA 4IQAA 1SENA 4PURA 2GZYA 3H1NA 5G1LA 5ECQB 3KIJA 2V1MA 4KA0A 4JBBA 1DE1A 5D9XA 1GLQA 5H5QA 1YKCA 1ZL9A 1F3BA 3A2WA 1F2EA 3HDCA 2BTOT 4IGJA 3C1RA 4D73A 4MDCA 2R0GA 1XZOA 2YOIA 3CSHA 5JCUA 3CRUA 3KMNA 3C71A 2GT6A 1R5PA 2FWEA 1KNGA 4JR4A 5G5EA 5IOXA 4BVXA 3FZ4A 3DYRA 2P5QA 2OE1A 2C0FA 4NPBA 4PQHA 2H0HA 2VCTA 4G9HA 5EPFA 6GSUA 4IN0A 1PQNA 2REMA 3EMXA 5A4WA 2FLSA 2CX3A 3HD5A 3Q74A 4KSOA 1KBNA 4LLRA 18GSA 2DKIA 3UVHA 4KCAA 4X0XA 2V2GA 4ZXGA 1HNBA 3HZ4A 3L0HA 3ZMLA 2IWTA 1GTBA 4FQUA 3TKQA 5E59A 1PMTA 3GKMA 3TJKA 1EWXA 3E0UA 2XPEA 5D9WA 2FA8A 1AIUA 1V57A 5LNKe 5ELGA 5KOWA 2JZRA 3H79A 3ZYWA 1BAYA 3LEFA 3D21A 2HRKA 2B5EA 1EOGA 1ILOA 2H74A 1X5CA 1RW1A 4DSQA 2KOKA 3QR6A 5DCHA 1MTCA 1TI1A 3LQ7A 5DDLA 2YV7A 3UVTA 6GSVA 1WP0A 1U3AA 2YV9A 2HRAA 4O5QA 4EDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M46 A;  4ZBD A;  1GSU A;  2PBJ A;  4XS4 B;  4KCE A;  4MZC A;  5CYY A;  3H4K A;  1K0M A;  2FHE A;  1T4Y A;  1XW5 A;  3GN3 A;  4NWY A;  2DJJ A;  3F3R A;  3TOT A;  2DJ0 A;  1M9A A;  4HJM A;  2GVP A;  1NHO A;  3EMP A;  2H1B A;  3RHC A;  1C72 A;  2JU5 A;  2VD1 A;  3TKS C;  4DSS A;  1YJ6 A;  1M2D A;  2O8V B;  3GH6 A;  5ID2 B;  4MA9 A;  3HJM A;  4OMV A;  4AJ8 A;  3KP9 A;  2VCX A;  1VF2 A;  4YQU A;  1QK8 A;  4OO4 A;  4HS1 A;  4YAP A;  1JLW A;  5B8B A;  2X64 A;  4L5O A;  4K8M A;  2A4V A;  4IS0 A;  4GCI A;  4MLY A;  5G30 A;  2LNT A;  2IMD A;  5ECL B;  2JZS A;  4HQS A;  1GUL A;  2AAW A;  2KUC A;  3U6V A;  1TU8 A;  2K18 A;  1B9X C;  1ZCP A;  1TKD B;  2C3Q A;  4ZB6 A;  4OCF A;  3I69 A;  3TCO A;  2RII A;  1EGR A;  3F3Q A;  1A0R P;  2K8S A;  5IMA A;  4ZB8 A;  4LMW A;  3TKR A;  4JZQ A;  4PQ1 A;  2C0E A;  4MH2 A;  2B7J A;  1ZMA A;  5D9V A;  4HJ2 A;  5L71 A;  2GSS A;  1S3A A;  4FH8 A;  3FW2 A;  1X0R A;  5LD0 A;  1JZO A;  4MP4 A;  4XS1 A;  3GHA A;  3U5R E;  3DML A;  3GNJ A;  2C3N A;  1A24 A;  1CQH A;  3LXT A;  2HRN A;  2H6Z A;  2FCH A;  4XS6 A;  2FGX A;  1AW9 A;  4FIW A;  1JHB A;  3F4T A;  4ULX A;  5IM9 A;  2L59 A;  1JFU A;  4TR0 A;  4NV5 A;  3FRC A;  2C3T A;  5HR2 A;  1BG5 A;  3EYT A;  2JZT A;  3IXR A;  4Q5N A;  3TUE A;  2BMX A;  5IPH A;  1E2Y A;  1K3O A;  2M72 A;  4RQR A;  1PA3 A;  1GWC A;  3KJY A;  3RBT A;  3ED3 A;  3CRT A;  2ON7 A;  4PGT A;  3F6D A;  3IHQ A;  1SK0 A;  1PD2 1;  2PGT A;  1ZOF A;  5INY A;  1Z6M A;  4QL9 A;  3K8N A;  4EE0 A;  4TR4 A;  1ZYE A;  2EC4 A;  1PSQ A;  2IFQ A;  4AJ6 A;  3TJB A;  2X8G A;  1XOA A;  3RAZ A;  2I1U A;  3LJR A;  1Z9H A;  2P0G A;  5A5K A;  4K0N A;  5CRG A;  3L9S A;  1GUK A;  4ID0 A;  3QAV A;  4V2N A;  4ZBA A;  2VM1 A;  4KSM A;  3GUS A;  1T7P B;  3DKS A;  1G6W A;  2WCI A;  4MCU A;  3D4M A;  4ILF A;  5IO0 A;  2MMO A;  2OBI A;  1G6Y A;  2GS3 A;  4TKY A;  2C1Y A;  2VL3 A;  3D0Z A;  3US3 A;  1THO A;  3DEX A;  2DIY A;  2HZE A;  4IJI A;  2LRC A;  1GUH A;  2ALB A;  1GRX A;  1TK0 B;  2FWF A;  1N2A A;  2HRF A;  2LJK A;  4V1A p;  2H73 A;  5IO2 A;  5ECK B;  3VK9 A;  2CVB A;  1MDJ A;  1E6B A;  4CDO A;  1XPV A;  1SK1 A;  4V2L A;  2LST A;  2DML A;  3ERF A;  2CA8 A;  2IMF A;  1OC9 B;  3H8Q A;  4F0B A;  1ERT A;  1R26 A;  4GSS A;  3VWW A;  1ERU A;  3QFB C;  3TJF A;  2RUF A;  1FHE A;  1WJK A;  2M80 A;  3GTU B;  2VCZ A;  5HQP A;  4KE3 A;  3F0I A;  3GH9 A;  1M99 A;  4ZL7 A;  1GLP A;  3DGQ A;  1Z3E A;  1T8E B;  1OKT A;  2VAF A;  4KGI A;  3M0F A;  3TDG A;  2LJA A;  4I6X A;  2CX4 A;  3AY8 A;  2CQ9 A;  4DEJ A;  4TXO B;  4HUA A;  4LL1 B;  2GDR A;  2ON5 A;  3QMX A;  4G19 A;  4ZB9 A;  4TVE A;  3ZLP A;  2C0D A;  3EWL A;  4HDE A;  2C80 A;  1J0F A;  2HNL A;  4TN8 A;  4WR4 A;  3FYG A;  2H1D A;  3P7X A;  1IYH A;  4K9Z A;  2YNX A;  5CRW A;  3IC4 A;  2MZC A;  1RQM A;  4I97 A;  5D73 A;  5DAK B;  3RHB A;  2LTK A;  3FKF A;  1FB0 A;  2N5F A;  5DJM A;  4WXT A;  2GT5 A;  3ZMK A;  4EC0 A;  4MJC A;  1BED A;  2I9H A;  1QXH A;  16GS A;  2VLV A;  4I8B A;  6GST A;  5HR3 A;  5F0G A;  4IP6 A;  3LSZ A;  4BL7 A;  4E8H A;  4ZIJ A;  1F9M A;  2CVK A;  3KZQ A;  4ML1 A;  3EUR A;  4GF0 A;  3C1S A;  2MMZ A;  2B1L A;  1XWA A;  3JCM L;  1H4O A;  1SYX A;  3HA9 A;  1ML6 A;  5HR1 A;  2OJL A;  1URM A;  1XVW A;  1T4Z A;  2YP6 A;  2VM2 A;  2KHP A;  2YWI A;  1YF0 A;  4WET A;  3Q18 A;  3LYK A;  4N11 A;  2OA7 A;  3QFA C;  2WS2 A;  1TRS A;  1XCC A;  3W8S A;  4PNG A;  2GZZ A;  5GAN D;  3VI7 A;  4OFT A;  1OYJ A;  3PGT A;  4EL1 A;  3UJ1 A;  2H6Y A;  5CP1 A;  4WF4 A;  2MMN A;  12GS A;  5B6N A;  3BBY A;  5IIZ A;  1OC3 A;  3KCM A;  3PH9 A;  9GSS A;  4EUY A;  5DAL A;  1O85 A;  3I6A A;  4ZIL A;  1I5G A;  4QL7 A;  2VCW A;  4G10 A;  3FY7 A;  3H93 A;  3LGC A;  3ME7 A;  1FB6 A;  2H0G A;  2IJY A;  4DVC A;  4GQF A;  5CRH A;  3DVW A;  3ZRD A;  4TR3 A;  1FOV A;  3F9U A;  4O92 A;  5HFK A;  3VWU A;  2I4A A;  1SD8 A;  2FWH A;  2YPM A;  3D22 A;  4ECI A;  1MDI A;  3IK9 A;  4N10 A;  1WIK A;  2VL2 C;  2WFC A;  1XW6 A;  3HJP A;  5J9C A;  1NSW A;  2F9S A;  3KM6 A;  3QCP A;  2R5G A;  2YWN A;  1YDK A;  1DUG A;  4J56 E;  2DSA A;  1YZX A;  3E9J B;  2IMI A;  2MMA A;  3LFL A;  4IBP A;  4EXJ A;  2LUS A;  4CHS A;  5IMD A;  5IMC A;  3TGZ A;  2L6C A;  1Q4J A;  4Q5F A;  4POM A;  1OE7 A;  22GS A;  5H5S A;  2HFD A;  3HY2 A;  3E3E A;  2IPA A;  4KW6 A;  1SKR B;  1V98 A;  3G7I A;  5CRD A;  5A4U A;  2GZP A;  3I43 A;  5IOW A;  4FYU A;  4TR1 B;  1TI3 A;  3VI5 A;  3GX0 A;  1XVQ A;  4KX4 A;  2H30 A;  2CZ2 A;  2RLI A;  1F3A A;  3O6T A;  2CAQ A;  2F8A A;  2B7K A;  2L5O A;  1FG4 A;  1UC7 A;  3WT1 A;  4WR5 A;  4EVM A;  1A0F A;  4ISD A;  1X9M B;  1TRW A;  2OKA A;  3GST A;  3EE2 A;  4XRD A;  2CT6 A;  1Z6N A;  2BJX A;  2HE3 A;  1EZK A;  4I5Q A;  4E8E A;  4MJA A;  3L9U A;  4ZL8 A;  2WB9 A;  2QKE A;  3GRX A;  3D4T A;  2KP1 A;  2EIQ A;  5G5F A;  4EKZ A;  4F0C A;  2NBS A;  3VPT A;  1WWJ A;  1XW9 A;  2H72 A;  1M2B A;  3ZIJ A;  5ECH B;  1K0A A;  1UVZ A;  1TDI A;  3O3T A;  2DJK A;  4Q5Q A;  3TRQ A;  2H8L A;  5AIS A;  2E7P A;  6GSS A;  1R4W A;  2QGV A;  4POL A;  5F07 A;  1OKD A;  1ACV A;  4GSN A;  2K6V A;  2H66 A;  4XS4 A;  2VCV A;  2P5R A;  4MZW A;  2IIY A;  3CXG A;  2YWM A;  1DBY A;  5HFG A;  4EO3 A;  4O5R A;  1Y25 A;  5F8B A;  2GQM A;  3J7Y b;  1ZYQ B;  5B6M A;  3DD3 A;  2L57 A;  2C8U A;  3RPN A;  3KEB A;  3LOR A;  2AV4 A;  1FVJ A;  4V2M A;  3ZFB A;  2GSQ A;  5ID2 A;  2H1G A;  2VLT A;  2X99 A;  1VGL A;  4Z7X A;  2JSY A;  1K0B A;  2HI7 A;  4L8E A;  4YQM A;  2E2G A;  2WGR A;  3F6F A;  4XCS A;  4KDX A;  2C4J A;  3MWH A;  3CTG A;  3QD9 A;  2QSI A;  4AF2 A;  2H1A A;  4POB A;  2XC2 A;  3VLN A;  4MPF A;  5HFI A;  3S9F A;  2DBC A;  4RI7 A;  1Y6E A;  4N0Z A;  1M9B A;  1T3B A;  4DSR A;  4F9Z A;  4PNF A;  5ECR B;  1GSQ A;  3APQ A;  4J57 E;  2H76 A;  3ME8 A;  1K3Y A;  4MAB A;  3F63 A;  3MDK A;  4XIH A;  2JL4 A;  2GTU A;  4XTS A;  3GUR A;  4RI6 A;  5ECM B;  1SJI A;  4K7N A;  2IME A;  3CSI A;  2ES7 A;  3IK7 A;  1M0U A;  1PKW A;  3NOF A;  3D5J A;  1TXX A;  2VD0 A;  2FY6 A;  3WD6 A;  2RM6 A;  2DC5 A;  4K2D A;  6GSW A;  1VRS D;  3DVX A;  3GKK A;  2B1K A;  1NHY A;  1TW9 A;  1MD4 A;  5C04 A;  1XXU A;  3TJJ A;  4GRF A;  5ECO B;  1HNC A;  1O7U A;  2O85 A;  1A8L A;  3GSS A;  4ML6 A;  2AUV A;  3KTL A;  5DVB A;  3P90 A;  4XHM A;  3QOU A;  2IFQ B;  3M1G A;  3VWX A;  4MF5 A;  2GQL A;  1EV4 A;  1G7E A;  1ABA A;  1IYI A;  5J5N A;  2V6K A;  2VLU A;  8GSS A;  2KLX A;  3GKN A;  1XBS A;  7GSS A;  2AJQ B;  3HHV A;  2L4C A;  4EDZ A;  3HXS A;  3FR3 A;  3KMO A;  2FD3 A;  1F6M C;  3VPQ A;  1XFL A;  4MH3 A;  3LXZ A;  2LNS A;  4IW9 A;  2XBQ A;  4WEY A;  1X9S B;  1WE0 A;  1UA5 A;  3CTF A;  3CYN A;  2VL9 A;  1TOF A;  4AJ7 A;  2WZ9 A;  3RPP A;  1S3D A;  2R37 A;  1GUM A;  3DIE A;  2PVQ A;  1GTI A;  3OR5 A;  3QAW A;  3L78 A;  2DJ2 A;  2FWG A;  5G31 A;  3UAP A;  2LRT A;  4K7O A;  2IN3 A;  2H19 A;  4JED A;  5AIX A;  2MYG A;  1SKS B;  4YQV A;  4BPY A;  5ECN B;  5COH A;  1QGV A;  1M2A A;  3SBC A;  4XRA A;  3GFK A;  1B4P A;  3R2Q A;  3WGX A;  3TJG A;  2LS5 A;  4ZBB A;  2F8F A;  3SWL A;  5ABR A;  5E4W A;  5EY6 A;  5KN3 A;  1QUW A;  3ZIV A;  3P8W A;  2J23 A;  3FZ9 A;  2YJ7 A;  3EIN A;  2H0I A;  1BYE A;  4IKH A;  1YQ1 A;  2JAC A;  19GS A;  3TKS A;  3LWA A;  1XWK A;  3F4R A;  3UL3 A;  1U87 A;  4QQ7 A;  2DMM A;  1QMV A;  2E0Q A;  2IMK A;  1TP9 A;  3Q6O A;  4K7I A;  4IEL A;  4K1F A;  4KH7 A;  3IBH A;  3ZRE A;  1GTA A;  1SK2 A;  1YY7 A;  2YZU A;  4TXO A;  4FYB A;  4IHU A;  4GLT A;  3ERG A;  3GKX A;  2H01 A;  2I3Y A;  4H86 A;  4HOJ A;  4FYC A;  2PU9 C;  3WGE A;  3HVV A;  2R6K A;  4IP1 A;  3IV4 A;  3C73 A;  4WF5 A;  4J2F A;  1QQ2 A;  1OC8 A;  3IAS 2;  3ISO A;  4NV2 A;  1O6J A;  4OCE A;  3ZTL A;  5IMZ A;  4ACS A;  1A2J A;  5J4U A;  4RUV A;  4N0V A;  3GIX A;  3KH7 A;  2GST A;  2KP2 A;  1TJD A;  1WPI A;  1TRV A;  4KDU A;  1B8X A;  3A3T A;  4YAV A;  2DJ1 A;  4PUA A;  1V9W A;  1A2L A;  5DAK A;  5F06 A;  5CRE A;  4MJE A;  4L5L A;  2OBK A;  4O32 A;  3PR8 A;  2YZH A;  2JAD A;  2B3S A;  2XPD A;  2B5X A;  5A4V A;  1K0C A;  3BCI A;  1AXD A;  1ERV A;  1R7H A;  1G0T A;  4JE1 A;  5EL8 A;  2NPB A;  1EP7 A;  1EP8 A;  1GP1 A;  3N9J A;  2AB6 A;  2OAC A;  5GAP D;  2O7K A;  2B6M A;  3W8J A;  4HZ2 A;  1O81 A;  1SL0 B;  1GH2 A;  2VOC A;  2XHF A;  5DCG A;  3UEM A;  5G1K A;  1FVK A;  4G2E A;  4CW9 A;  1H75 A;  3G7Y A;  2IY2 A;  1GNE A;  1MD3 A;  5IMV A;  3BOA A;  2IYJ A;  3FR9 A;  4ZL9 A;  3ZVJ A;  3UMA A;  1O8W A;  4N30 A;  5D8I A;  3GMF A;  2EIR A;  3IRA A;  1J08 A;  5GZZ B;  1V58 A;  4ECC A;  2A2R A;  1B4Q A;  1V2A A;  1THX A;  1JLV A;  4D73 B;  2A2S A;  2D2Z A;  4IQ1 A;  4O7H A;  1XIY A;  2J9H A;  4AGS A;  2V41 A;  5KN1 A;  2WRT A;  5JWQ B;  1HD2 A;  1TK5 B;  2R4V A;  3V1W A;  1USB A;  3G9B A;  2ZNM A;  1N8J A;  2YJH A;  4WBJ A;  5DJL A;  4JU5 A;  1PX6 A;  5JCW A;  3KXO A;  1XOB A;  1A8Y A;  1AUC A;  2LEG A;  3GL3 A;  4GWR A;  2JSZ A;  3RDW A;  1ON4 A;  1FAA A;  4PQI A;  3TRP A;  4OD7 A;  1EEM A;  3C7M A;  3ZVJ D;  3KH9 A;  3TKS E;  3L4N A;  2OAD A;  5F05 A;  3TRX A;  4I2U A;  2WDU A;  1AQV A;  1S3C A;  3D6I A;  2N5A A;  2VCQ A;  1NM3 A;  3BD2 A;  4Q5R A;  5IQY A;  2LRN A;  2K9F A;  3HJO A;  5EVO A;  1R5A A;  4PXO A;  3FK8 A;  1A23 A;  2H75 A;  3TB2 A;  2LJR A;  1F37 A;  1V40 A;  4JR6 A;  3IE3 A;  1PL2 A;  3HVX A;  2TRX A;  1LU4 A;  3MAK A;  1FW1 A;  1PL1 A;  3ZIT A;  4TR1 A;  4MF7 A;  3DXB A;  10GS A;  1QFN A;  1JZW A;  1XWG A;  3M8N A;  1U6T A;  4YH2 A;  1HQO A;  2TRC P;  3ZZX A;  4GTU A;  1PRX A;  3ZL5 A;  1NW2 A;  3VWV A;  4HU9 A;  3APS A;  1BJX A;  4GQC A;  1B48 A;  3O76 A;  1RK4 A;  2IL3 A;  4BVY A;  4BA7 A;  1ZGN A;  3Q19 A;  2OE0 A;  1SKW B;  2PPT A;  5JCG A;  4TXV A;  1FO5 A;  3F4S A;  5D93 A;  2YCD A;  4DSS B;  2GQK A;  3KTB A;  2ZCT A;  3A5W A;  5CNW A;  2O89 A;  4KAE A;  1K0N A;  4POK A;  3C8E A;  3P2A A;  2CZ3 A;  3IR4 A;  3CBU A;  4TOP A;  3EU3 A;  1W89 A;  3A2V A;  3UBK A;  2PMT A;  1GL8 A;  3ZFL A;  1GNW A;  1TK8 B;  1K0O A;  1EEJ A;  2WJU A;  1I9D A;  2FUG 2;  4PUF C;  2ZUP A;  3FR6 A;  17GS A;  2CVD A;  1WRY A;  5AIV A;  1PX7 A;  1AAZ A;  2L5L A;  5AGY A;  3HKR A;  13GS A;  3EC3 A;  6GSY A;  4KND A;  2R2J A;  3A2X A;  3APO A;  5G2Z A;  3UBL A;  3QPM A;  4MPG A;  2DJ3 A;  3UIW A;  4HEA 2;  11GS A;  4HU7 A;  2TIR A;  1GSD A;  2HZF A;  1JZD A;  5J9B A;  1LJR A;  5JWR B;  2H6X A;  5FWG A;  3W6G A;  4HZ4 A;  5LCZ A;  1SL2 B;  1PKZ A;  5DQS A;  2F3M A;  20GS A;  2AHE A;  3L9V A;  4KUN A;  1CQG A;  2H71 A;  1EOH A;  1OAZ A;  4BWS A;  1T00 A;  5ELA A;  3I9V 2;  4TRX A;  5KEJ A;  2FA4 A;  1VF1 A;  5GST A;  4MF6 A;  2PN8 A;  1GSF A;  4F03 A;  3IOS A;  1Z7R A;  5IMF A;  2V6O A;  3M9K A;  2OE3 A;  1A2M A;  1T1V A;  2X8H A;  5ECI B;  3BJ5 A;  2G0F A;  3QAG A;  2VUP A;  1SU9 A;  1BQ7 A;  4PX1 A;  5DBQ A;  4X43 A;  2V32 A;  1K0D A;  5ECS A;  1EGO A;  4MK3 A;  2O87 A;  3EU4 A;  3GV1 A;  3CMI A;  3J7Y k;  1WOU A;  4RQX A;  4JRR A;  1BX9 A;  2G2Q A;  3WYW A;  2VL2 A;  1B9Y C;  3F8U A;  3HYP A;  2PER A;  4HQZ A;  1HNA A;  2CV4 A;  2XBI A;  4LMV A;  1JZR A;  3FZA A;  3MNG A;  5ECP B;  2C0G A;  5DQY A;  5FHI A;  4MJB A;  2PWJ A;  4BWQ A;  4LL4 B;  5KN0 A;  2HT9 A;  3GL5 A;  3N5O A;  3WGD A;  2GSR A;  2H70 A;  1DSB A;  2HSY A;  2HSH A;  5HR0 A;  3QDN A;  2N5B A;  3FEU A;  3IDV A;  2LQQ A;  2HZE B;  4LA1 A;  2K8V A;  2I81 A;  1G7O A;  4EF0 A;  2YN1 A;  5AN1 A;  2QC7 A;  4KB3 A;  4NMU A;  4K0G A;  4OWY A;  4WBR D;  2DIZ A;  1UN2 A;  1XWC A;  1VF4 A;  4GXZ A;  2VO4 A;  3HVS A;  4NAX A;  4MMM A;  1HYU A;  1GSS A;  2L6D A;  3DWV A;  2AYT A;  2HYX A;  1SYR A;  3GYK A;  1LBK A;  1GSE A;  1YEX A;  1AQW A;  4OFN A;  2YWO A;  5CAX A;  4V1A g;  3WT2 A;  5GSS A;  4K6X A;  1EV9 A;  2EIO A;  3VUR A;  4OFM A;  2PUK C;  3EVI A;  1GTU A;  4FO5 A;  1YEP A;  1O8X A;  1SD9 A;  5FT3 A;  1X5E A;  1OC9 A;  4L0U A;  5KN2 A;  3CSJ A;  1XWB A;  2P31 A;  5D9T A;  1SL1 B;  4I2T A;  5JWO B;  3TKP A;  1PGT A;  4NHW A;  2FNO A;  1O73 A;  2MBT A;  3FHK A;  3GTU A;  1X5D A;  3GX8 A;  3KD0 A;  3UOM A;  4IVF A;  1OVN A;  4F2I A;  1U88 A;  5C00 A;  1YKA A;  1PN9 A;  1TTZ A;  2WUL A;  4ECJ A;  5IPG A;  3LYP A;  2B5Y A;  5D96 A;  1ZZY A;  1TRU A;  1MEK A;  3NZN A;  2DLX A;  2HXK A;  5CO3 A;  1AQX A;  2GGT A;  4P3Y B;  2RM5 A;  2F51 A;  4NXI A;  4GST A;  1OE8 A;  4OO5 A;  2NDO A;  1GSY A;  4WKW A;  2E2M A;  4MZB A;  3KGK A;  3LG6 A;  2L4Q A;  1U3I A;  1Z7P A;  5B7C A;  2YAN A;  5B8A A;  4TW5 A;  3UAR A;  1M7T A;  6GSX A;  1YF1 A;  3IA1 A;  1W4V A;  2R3X A;  3NIV A;  1AC1 A;  2PVO C;  3IAM 2;  2VIM A;  2NVL A;  3VFI A;  1ST9 A;  3HZ8 A;  3G7J A;  1Z5Y E;  1WMJ A;  3KP8 A;  2LKU A;  4X1U A;  3GA4 A;  2Z9S A;  1SJZ A;  1VF3 A;  2LV3 A;  3FZ5 A;  1DE2 A;  2CAI A;  1KTE A;  14GS A;  1X9W B;  1K3L A;  4L0W A;  5H5R A;  2HLS A;  5J41 A;  4HI7 A;  4NHZ A;  4KDY A;  2X8C A;  3IPZ A;  1ERW A;  3M9J A;  1KEB A;  3BCK A;  3TOU A;  1MDK A;  1TU7 A;  3MSZ A;  4F82 A;  3HCZ A;  3DRN A;  2MBS A;  2NTO A;  2LQO A;  3PIN A;  3M3M A;  4IJ3 A;  5J3R A;  1Q98 A;  1SJ6 A;  2GLR A;  2RUE A;  5ENU A;  4ECB A;  5DAL B;  1J9B A;  3ERW A;  4IQA A;  1SEN A;  4PUR A;  2GZY A;  3H1N A;  5G1L A;  5ECQ B;  3KIJ A;  2V1M A;  4KA0 A;  4JBB A;  1DE1 A;  5D9X A;  1GLQ A;  5H5Q A;  1YKC A;  1ZL9 A;  1F3B A;  3A2W A;  1F2E A;  3HDC A;  2BTO T;  4IGJ A;  3C1R A;  4D73 A;  4MDC A;  1XZO A;  2YOI A;  3CSH A;  5JCU A;  3CRU A;  3KMN A;  3C71 A;  2GT6 A;  1R5P A;  2FWE A;  1KNG A;  4JR4 A;  5G5E A;  5IOX A;  4BVX A;  3FZ4 A;  3DYR A;  2P5Q A;  2OE1 A;  2C0F A;  4NPB A;  4PQH A;  2H0H A;  2VCT A;  4G9H A;  5EPF A;  6GSU A;  4IN0 A;  1PQN A;  2REM A;  3EMX A;  5A4W A;  2FLS A;  2CX3 A;  3HD5 A;  3Q74 A;  4KSO A;  1KBN A;  4LLR A;  18GS A;  3UVH A;  4KCA A;  4X0X A;  2V2G A;  4ZXG A;  1HNB A;  3HZ4 A;  3L0H A;  3ZML A;  2IWT A;  1GTB A;  3TKQ A;  5E59 A;  1PMT A;  3GKM A;  3TJK A;  1EWX A;  3E0U A;  2XPE A;  5D9W A;  2FA8 A;  1AIU A;  1V57 A;  5LNK e;  5ELG A;  2JZR A;  3H79 A;  3ZYW A;  1BAY A;  3LEF A;  3D21 A;  2B5E A;  1EOG A;  1ILO A;  2H74 A;  1X5C A;  1RW1 A;  4DSQ A;  2KOK A;  3QR6 A;  5DCH A;  1MTC A;  1TI1 A;  3LQ7 A;  5DDL A;  2YV7 A;  3UVT A;  6GSV A;  1WP0 A;  1U3A A;  2YV9 A;  4EDY A; 
#chains in the Genus database with same CATH topology
 2M46 A;  4ZBD A;  1GSU A;  4HM4 B;  2PBJ A;  4XS4 B;  4KCE A;  4MZC A;  5CYY A;  3H4K A;  1K0M A;  4Z2U A;  1BRS A;  2FHE A;  2I9W A;  3CC4 3;  1T4Y A;  1J2B A;  1XW5 A;  3GN3 A;  7RNT A;  4NWY A;  2DJJ A;  3F3R A;  1EG9 B;  3TOT A;  1TFO A;  2DJ0 A;  1M9A A;  3NQY A;  2RGQ A;  4HJM A;  2E2T A;  5AYR B;  1EKM A;  1VQK 3;  3N8B A;  2GVP A;  1CEW I;  3I55 3;  3PPU A;  1NHO A;  3EMP A;  4EIP A;  2H1B A;  3RHC A;  2OQE A;  3B4O A;  1C72 A;  3NUV A;  2JU5 A;  3G4S 3;  2VD1 A;  3TKS C;  1YJ6 A;  1M2D A;  2O8V B;  4DSS A;  4CPK A;  3GH6 A;  5ID2 B;  4JRF A;  4MA9 A;  3HJM A;  4OMV A;  4AJ8 A;  3KP9 A;  2VCX A;  1EQK A;  1VF2 A;  4YQU A;  1QK8 A;  4OO4 A;  1ASK A;  4HS1 A;  4CY8 A;  3AHS A;  4YAP A;  1JLW A;  4EV5 A;  5B8B A;  1PY3 A;  3AMO B;  4KFE A;  2X49 A;  2X64 A;  4L5O A;  4K8M A;  2A4V A;  4IS0 A;  1YGW A;  1VZZ A;  4GCI A;  4MLY A;  1IQ8 A;  5G30 A;  2LNT A;  1GOY A;  2IMD A;  2JZS A;  5ECL B;  4HQS A;  2ZHX B;  1GUL A;  2AAW A;  3NV0 B;  2KUC A;  3U6V A;  2RFR A;  1DMM A;  1TU8 A;  4K1V A;  1TIJ A;  2Q07 A;  4HVN A;  2K18 A;  1JB5 A;  2Z6B A;  1B9X C;  1ZCP A;  1NU3 A;  1TKD B;  2C3Q A;  4ZB6 A;  4FMB A;  4OCF A;  1RGG A;  3I69 A;  3TCO A;  2RII A;  1EGR A;  3F3Q A;  1X1U A;  1A0R P;  2K8S A;  1D6U A;  5IMA A;  4ZB8 A;  4LMW A;  3TKR A;  4JZQ A;  4PQ1 A;  2KF3 A;  2C0E A;  1D6Z A;  4N6L A;  4MH2 A;  1TRQ A;  2B7J A;  1ZMA A;  5D9V A;  3KE7 A;  4HJ2 A;  4KF9 A;  5L71 A;  1X1X A;  2GSS A;  3K7C A;  1JB2 A;  1S3A A;  4FH8 A;  3FW2 A;  2CH9 A;  2KAA A;  3IC8 A;  1X0R A;  5LD0 A;  4RBN A;  1JZO A;  4MP4 A;  4XS1 A;  3GHA A;  3U5R E;  3IJE B;  3DML A;  3WOE B;  3CCV 3;  4LGQ A;  1BNS A;  3D79 A;  3GNJ A;  2C3N A;  4HM3 B;  1C7H A;  5AII A;  1A24 A;  1CQH A;  3LXT A;  2HRN A;  2H6Z A;  2FGT A;  2FCH A;  2YX9 A;  4XS6 A;  2FGX A;  1VQQ A;  1AW9 A;  5EVH A;  4FIW A;  1JHB A;  3F4T A;  4ULX A;  5IM9 A;  1FGO A;  1LNH A;  1JFU A;  2L59 A;  4TR0 A;  3B4P A;  3MPH A;  1Z1S A;  3FG3 A;  4NV5 A;  2JDI H;  3FRC A;  2C3T A;  5HR2 A;  1BG5 A;  4CDL A;  2KF5 A;  3EYT A;  3FG1 A;  2JZT A;  3IXR A;  4Q5N A;  3TUE A;  2BMX A;  5IPH A;  1A90 A;  1E2Y A;  1K3O A;  2M72 A;  5KOX A;  1I2G A;  3HX8 A;  1WNH A;  4RQR A;  2F99 A;  1LRA A;  1GS3 A;  1PA3 A;  1BVI A;  1BNF A;  1JKG A;  2ZA4 A;  1GWC A;  1FUS A;  1GD3 A;  2K3D A;  3KJY A;  3ED3 A;  3RBT A;  3CRT A;  2ON7 A;  4PGT A;  3F6D A;  3IHQ A;  1SII A;  2GXF A;  3LTB A;  5TGN A;  4X4J A;  5EEO A;  1ZGX A;  1SK0 A;  1PD2 1;  1D6Y A;  2PGT A;  1ZOF A;  5KP1 A;  4L8P A;  1JBS A;  3CCQ 3;  1R4C A;  5INY A;  3NHX A;  3B8L A;  1Z6M A;  3DGN A;  3K8N A;  4QL9 A;  4EE0 A;  2HMO B;  4TR4 A;  1ZYE A;  2EC4 A;  4HZB B;  1PSQ A;  3DUK A;  1RGE A;  2IFQ A;  4AJ6 A;  2E2U A;  3TJB A;  2X8G A;  1XOA A;  1SAR A;  1AQZ A;  3RAZ A;  2I1U A;  3LJR A;  1Z9H A;  2P0G A;  5A5K A;  4K0N A;  5CRG A;  2KRT A;  3NXJ A;  3L9S A;  3F8H A;  1GUK A;  4ID0 A;  1W02 A;  3QAV A;  4V2N A;  4ZBA A;  2VM1 A;  4KSM A;  1N5H A;  2F4Y A;  3GUS A;  1T7P B;  1A2V A;  1CYV A;  3DKS A;  1G6W A;  3A5I A;  2WCI A;  4MCU A;  3D4M A;  2HML B;  4ILF A;  2RBI A;  5IO0 A;  2MMO A;  2CWT A;  2OBI A;  1G6Y A;  2KXG A;  2GS3 A;  4TKY A;  4PTS A;  2C1Y A;  3EPT A;  2VL3 A;  3D0Z A;  3US3 A;  1THO A;  1JN5 B;  2X4A A;  3DEX A;  4J5G A;  2JQ5 A;  2DIY A;  2HZE A;  4IJI A;  2LRC A;  1GUH A;  2ALB A;  1GRX A;  1TK0 B;  2FWF A;  1VQ6 3;  1N2A A;  2STD A;  2HRF A;  1N8R 4;  2IMJ A;  2LJK A;  4V1A p;  3STD A;  2YFJ B;  1M3I A;  2H73 A;  5ECK B;  3VK9 A;  1IQY A;  2CVB A;  5IO2 A;  3KFQ C;  1MDJ A;  1E6B A;  4AKZ A;  2XRX B;  3S67 A;  4CDO A;  1XPV A;  4Z2T A;  1MGW A;  2B1X B;  1JJ2 2;  1SK1 A;  4V2L A;  2LST A;  1RNT A;  2DML A;  3ERF A;  3AHW A;  3G6E 3;  2CA8 A;  3BNB A;  2IMF A;  1OC9 B;  1CQS A;  3H8Q A;  4BL2 A;  2CWV A;  4F0B A;  4FCZ A;  4O2H A;  1DYU A;  1WTH A;  2XH9 A;  1ERT A;  1W2B 2;  4EIQ A;  4QWT A;  1JBR A;  1R26 A;  1ISK A;  4GSS A;  1ERU A;  3QFB C;  3VWW A;  3TJF A;  2RUF A;  1FHE A;  5IEP A;  5FW5 A;  1WJK A;  3WOD G;  2XEP A;  1LQG C;  2M80 A;  3GTU B;  2VCZ A;  1VQL 3;  5HQP A;  1QAF A;  2QA2 A;  4KE3 A;  3F0I A;  3GH9 A;  1M99 A;  4ZL7 A;  1I70 A;  1W6C A;  1VQO 3;  1GLP A;  3DGQ A;  1RGF A;  1YVS A;  1Z3E A;  1RLS A;  1SQW A;  1T8E B;  3IHG A;  1OKT A;  1Q40 B;  2VAF A;  4KGI A;  3QK9 A;  1YHQ 3;  3TDG A;  3M0F A;  2LJA A;  4I6X A;  2CX4 A;  3AY8 A;  2CQ9 A;  4J9A A;  4DEJ A;  1ULI B;  2GBW B;  4HUA A;  4LL1 B;  4TXO B;  2GDR A;  3ZFZ A;  2ON5 A;  4N6V 0;  1B2M A;  3VF1 A;  3ZG0 A;  3QMX A;  4G19 A;  3DGY A;  3LH4 A;  4ZB9 A;  2A4H A;  1OCV A;  4TVE A;  3ZLP A;  1RJO A;  2C0D A;  3PXM A;  3EWL A;  4HDE A;  3SOY A;  1MWT A;  4GL6 A;  2C80 A;  1K8A 4;  1J0F A;  2HNL A;  4XDV A;  4TN8 A;  4CJN A;  4WR4 A;  1LOX A;  4XB5 A;  5BRT A;  2OOV C;  3FYG A;  2H1D A;  3P7X A;  1IYH A;  1A2P A;  2IUJ A;  4K9Z A;  5AIH A;  1VQ9 3;  2YNX A;  3K0Z A;  5CRW A;  3IC4 A;  3CXC 2;  2QGU A;  2MZC A;  1RQM A;  4I97 A;  5D73 A;  3OX9 A;  5HGR A;  5IG5 A;  5I97 A;  1B3S A;  6RNT A;  5DAK B;  2LQV A;  3RHB A;  2LTK A;  3FKF A;  4EC6 A;  4XBX A;  1FB0 A;  2N5F A;  2C4B A;  2CFW A;  4WXT A;  5DJM A;  4J5K A;  2GT5 A;  1XG8 A;  3EBT A;  1JBT A;  3ZMK A;  4EC0 A;  4MJC A;  1BED A;  3H3H A;  2I9H A;  3KCH A;  4N6U A;  1QXH A;  16GS A;  2VLV A;  3CNX A;  4I8B A;  6GST A;  5HR3 A;  2DKH A;  2CFG A;  1Q82 4;  5F0G A;  4IP6 A;  3H51 A;  3LSZ A;  4BL7 A;  4E8H A;  4ZIJ A;  1F9M A;  2CVK A;  3KZQ A;  4ML1 A;  2HMJ B;  4BTX A;  1FA3 A;  3EUR A;  4GF0 A;  1BNJ A;  1NDO B;  3C1S A;  2MMZ A;  2B1L A;  1XWA A;  3JCM L;  1H4O A;  1W6G A;  1SYX A;  1BAO A;  2W0Q A;  7GSP A;  3HA9 A;  1ML6 A;  5HR1 A;  2OJL A;  3JUN A;  3PGB A;  1URM A;  1DVD A;  5BU4 A;  3SYU A;  4L8O A;  1XVW A;  3A5E A;  1T4Z A;  3X41 A;  2YP6 A;  4H61 A;  4NHF A;  2VM2 A;  2KHP A;  2YWI A;  1YF0 A;  3HVN A;  4WET A;  3Q18 A;  5M18 A;  2J8X B;  3LYK A;  4N11 A;  2P0M A;  1U8C B;  2OA7 A;  3QFA C;  4EW5 A;  1KC8 4;  2WS2 A;  2GBX B;  1FGM A;  3G0K A;  3CC7 3;  1TRS A;  1QAK A;  1XCC A;  3W8S A;  4PNG A;  4Q53 A;  1YJN 3;  2GZZ A;  1MWR A;  5GAN D;  3VI7 A;  4OFT A;  1OYJ A;  2FNQ A;  3PGT A;  4EL1 A;  3UJ1 A;  2H6Y A;  2Z77 A;  5CP1 A;  3FGY A;  4WF4 A;  2MMN A;  12GS A;  5B6N A;  3E99 A;  3BBY A;  1OC3 A;  3KCM A;  5IIZ A;  5D81 A;  4MMX B;  3PH9 A;  9GSS A;  4EUY A;  5DAL A;  2BIR A;  3ECF A;  3EB8 A;  1O85 A;  3OWS A;  3I6A A;  4ZIL A;  4FMC A;  5CXO A;  4OVM A;  1NB3 I;  3KSP A;  1I5G A;  4QL7 A;  2VCW A;  3FY7 A;  4G10 A;  3H93 A;  3LGC A;  3ME7 A;  1AV4 A;  2H0G A;  1FB6 A;  2IJY A;  4DVC A;  3GZR A;  1Y4K A;  4LSO A;  4GQF A;  5CRH A;  3DVW A;  3CCU 3;  3ZRD A;  4HM6 B;  4TR3 A;  1FOV A;  3F9U A;  2W04 A;  4O92 A;  5HFK A;  4HAA A;  2I4A A;  3VWU A;  1SD8 A;  1BU4 A;  2FWH A;  3JUQ A;  2YPM A;  3D22 A;  3LT9 A;  1MDI A;  3IK9 A;  4N10 A;  4ECI A;  4Z2R A;  1GD4 A;  1WIK A;  2VL2 C;  2WFC A;  1XW6 A;  3HJP A;  5J9C A;  1NSW A;  2F9S A;  3KM6 A;  3ER7 A;  3QCP A;  2R4I A;  4LYL B;  2R5G A;  2YWN A;  1YDK A;  1DUG A;  2CFK A;  4J56 E;  1BNI A;  2DSA A;  1YZX A;  3IPT A;  3E9J B;  2IMI A;  2MMA A;  3LFL A;  4IBP A;  4EXJ A;  3NBJ A;  1QVG 2;  2LUS A;  4CHS A;  5IMD A;  1YIT 3;  1MWU A;  5IMC A;  3TGZ A;  2L6C A;  1Q4J A;  4LMI A;  4Q5F A;  1IVW A;  4WP5 A;  4POM A;  1OE7 A;  22GS A;  4N6N B;  4I4K A;  5H5S A;  2HFD A;  3HY2 A;  3E3E A;  2IPA A;  1UCK A;  4KW6 A;  1V98 A;  3G7I A;  5CRD A;  1SKR B;  4XM4 A;  5LC7 A;  1UDI I;  2L4V A;  5A4U A;  2GZP A;  3I43 A;  5IOW A;  1UGI A;  4FYU A;  1OF5 B;  1TI3 A;  4TR1 B;  3VI5 A;  3GX0 A;  2BHM A;  2WOF A;  1VQ4 3;  1OGZ A;  1XVQ A;  1TP6 A;  1B27 A;  4KX4 A;  2H30 A;  2CZ2 A;  2RLI A;  1F3A A;  3O6T A;  2CAQ A;  4EBG A;  2F8A A;  3X42 A;  2B7K A;  2L5O A;  3JUO A;  1FG4 A;  1UC7 A;  2C11 A;  4WR5 A;  4WFO A;  3WT1 A;  4EVM A;  2P05 A;  2W9P A;  1A0F A;  2WO0 A;  1HU9 A;  4ISD A;  2CX1 A;  1GMR A;  3K5T A;  1TRW A;  1X9M B;  2OKA A;  1PN0 A;  3GST A;  3EE2 A;  4XRD A;  2CT6 A;  4GSP A;  1Z6N A;  4HZ9 B;  2BJX A;  1RTU A;  2HE3 A;  1EZK A;  4I5Q A;  4BVY B;  3CCR 3;  4E8E A;  4MJA A;  3L9U A;  4ZL8 A;  2YFI B;  3DGO A;  3DMC A;  2WB9 A;  2QKE A;  5CF2 A;  3GRX A;  3D4T A;  1E3V A;  3D4A A;  3HZP A;  2EIQ A;  2KP1 A;  5G5F A;  4EKZ A;  4F0C A;  1BUJ A;  2NBS A;  3VPT A;  1WWJ A;  3SX1 A;  1XW9 A;  2H72 A;  1M2B A;  3ZIJ A;  5ECH B;  3URP A;  3GZB A;  1K0A A;  2BMO B;  5IW9 A;  3CCM 3;  1UVZ A;  1TDI A;  3O3T A;  3PYJ A;  1KQS 2;  2DJK A;  3X40 A;  4Q5Q A;  3TRQ A;  4RNT A;  3RGR A;  2H8L A;  5AIS A;  1L5G B;  2QA1 A;  2E7P A;  6GSS A;  1R4W A;  2QGV A;  4POL A;  5F07 A;  5AYS C;  1YI2 3;  1OKD A;  1GY5 A;  4HM8 B;  1ACV A;  4BU4 A;  4GSN A;  2K6V A;  2H66 A;  4XS4 A;  2VCV A;  3DY5 A;  2GU1 A;  2P5R A;  3S5C A;  4MZW A;  1K41 A;  4CCV A;  2Z76 A;  1I3I A;  3D5G A;  2OOV A;  1BRN L;  1SJW A;  2IIY A;  3CXG A;  2YWM A;  1BSB A;  1IV9 A;  3OV4 A;  1DBY A;  2XSO B;  5HFG A;  4EO3 A;  3NBR A;  9RNT A;  4O5R A;  1Y25 A;  5F8B A;  4FCJ A;  2GQM A;  3J7Y b;  1ZYQ B;  5B6M A;  3DD3 A;  2L57 A;  4KFD A;  2C8U A;  1G02 A;  3CNM A;  3RPN A;  3KEB A;  3LOR A;  2AV4 A;  1FVJ A;  4V2M A;  4CY6 A;  3ZFB A;  2GSQ A;  5ID2 A;  2H1G A;  2VLT A;  1O7H B;  2BMQ B;  2X99 A;  1VGL A;  4Z7X A;  8CHO A;  3MHE A;  2OCT A;  2JSY A;  1IK3 A;  1BRH A;  3FF2 A;  1K0B A;  2HI7 A;  3AGO A;  4USS A;  4L8E A;  2W56 B;  3AMO A;  4YQM A;  2E2G A;  3X3X A;  2WGR A;  2QEX 3;  5JBS A;  3F6F A;  2P38 A;  3LYG A;  4XCS A;  4KDX A;  2C4J A;  3MWH A;  5M19 A;  3M8C A;  4EV2 A;  3EHC A;  3CTG A;  3QD9 A;  1VQM 3;  3NV0 A;  2CIU A;  2QSI A;  4AF2 A;  4R80 A;  2H1A A;  3EN8 A;  3OXA A;  4POB A;  2XC2 A;  2WGO A;  1IVU A;  4GB5 A;  3VLN A;  4MPF A;  4O02 B;  3G8Z A;  5HFI A;  3S9F A;  2DBC A;  1Y6E A;  4RI7 A;  4N0Z A;  1M9B A;  3EN1 B;  1T3B A;  4DSR A;  4F9Z A;  5AEU B;  4PNF A;  5ECR B;  1GSQ A;  2R0C A;  3APQ A;  4FR9 A;  4J57 E;  2H76 A;  3DM8 A;  3ME8 A;  1K3Y A;  4MAB A;  3F63 A;  3SED A;  3CU3 A;  3MDK A;  3LW9 A;  4XIH A;  2W9Q A;  2JL4 A;  1DE3 A;  4A5P A;  2GTU A;  2L1S A;  4XTS A;  3OWU A;  3GUR A;  4RI6 A;  5ECM B;  1SJI A;  4K7N A;  2IME A;  3FCS B;  3CSI A;  2ES7 A;  3IK7 A;  1RCL A;  2Y73 A;  4G0L A;  2UZ8 A;  4WHA A;  1M0U A;  1O7M B;  2CG1 A;  1PKW A;  3NOF A;  1TUH A;  3D5J A;  3F7S A;  1TXX A;  2VD0 A;  2YFL B;  1G96 A;  2FY6 A;  4BL3 A;  3WD6 A;  4K5S A;  1BRI A;  1MOL A;  2RM6 A;  2DC5 A;  2WOH A;  4K2D A;  1UI7 A;  1RN7 A;  1WQL B;  6GSW A;  1VRS D;  3DVX A;  3LOY A;  3GKK A;  2B1K A;  1NHY A;  1M1X B;  1TW9 A;  1MD4 A;  5C04 A;  1XXU A;  5M1A A;  3TJJ A;  1UW1 A;  4GRF A;  1RGH A;  1OHP A;  5ECO B;  1HNC A;  1O7U A;  2O85 A;  1A8L A;  3GSS A;  3MG1 A;  4ML6 A;  2AUV A;  3KTL A;  5DVB A;  1AVK A;  3SOA A;  3P90 A;  4XHM A;  3QOU A;  1O7W B;  2IFQ B;  3M1G A;  3VWX A;  4MF5 A;  2GQL A;  1EV4 A;  1MNL A;  1G7E A;  5AIG A;  3T8N A;  5ELJ A;  3HIG A;  5KP4 A;  1ABA A;  1IYI A;  1UCI A;  5J5N A;  4KVH A;  1BNE A;  1EUI C;  3O8Y A;  2A2P A;  2V6K A;  2VLU A;  3ALA A;  8GSS A;  2KLX A;  3GKN A;  4XDW A;  1XBS A;  1Q86 4;  7GSS A;  2AJQ B;  4HJL B;  3HHV A;  2L4C A;  8RNT A;  4EDZ A;  1LOW A;  3HXS A;  3G71 3;  3WDG B;  3FR3 A;  3KMO A;  1UUG B;  1BGS A;  3J7Y d;  2FD3 A;  1F6M C;  4WYK B;  1QJG A;  2F86 B;  5BIR A;  4BIR A;  3VPQ A;  1YGE A;  2K54 A;  1XFL A;  3I56 3;  3PZW A;  3CCJ 3;  4MH3 A;  2PZV A;  3LXZ A;  2LNS A;  4IW9 A;  2XBQ A;  4WEY A;  1BOX A;  1X9S B;  2V1L A;  4U13 A;  3F7X A;  1WE0 A;  1UGH I;  3CMA 3;  5IEO A;  1UA5 A;  3CTF A;  1O7N B;  3CYN A;  2VL9 A;  1TOF A;  4AJ7 A;  2WZ9 A;  1BAN A;  3AGN A;  3RPP A;  3S29 A;  4K5R A;  2LYX A;  3GZX B;  1S3D A;  3EC9 A;  2R37 A;  1GUM A;  2CK3 H;  3DIE A;  2PVQ A;  1GTI A;  3OR5 A;  7STD A;  3QAW A;  3L78 A;  2K0M A;  2DJ2 A;  3V92 A;  2FWG A;  2ZL8 A;  5G31 A;  3UAP A;  2LRT A;  4K7O A;  2IN3 A;  2UX0 A;  2H19 A;  4JED A;  5AIX A;  1FUT A;  2QA4 3;  5AI1 A;  2MYG A;  1SKS B;  3GAX A;  4YQV A;  4BPY A;  1S5A A;  1RRL A;  5ECN B;  5COH A;  1QGV A;  1M2A A;  3SBC A;  1BRJ A;  4XRA A;  3LML A;  1B4P A;  3V98 A;  3WOF B;  3LTC A;  3GFK A;  4GHO A;  3R2Q A;  3WGX A;  3TJG A;  2LS5 A;  4ZBB A;  2F8F A;  3SWL A;  4O8S A;  2ZDJ A;  5ABR A;  5E4W A;  5EY6 A;  5KN3 A;  1QUW A;  3ZIV A;  1VQ7 3;  3P8W A;  1DMQ A;  3D9R A;  3PS8 A;  2J23 A;  1O7G B;  2HMN B;  3FZ9 A;  2YJ7 A;  3EIN A;  2CKF B;  3MIX A;  3Q1C A;  2H0I A;  1BYE A;  4IKH A;  1YQ1 A;  2JAC A;  1S72 3;  19GS A;  3OW2 2;  3TKS A;  3LWA A;  1XWK A;  1HZ1 A;  1STF I;  1BSA A;  3F4R A;  3UL3 A;  1U87 A;  4QQ7 A;  1NO3 A;  2DMM A;  1QMV A;  1Q40 A;  2E0Q A;  2IMK A;  2QIY A;  1TP9 A;  3SLU A;  1RRH A;  3Q6O A;  2HSM A;  4K7I A;  2RNT A;  1YNV X;  3RDE A;  4IEL A;  4K1F A;  4KH7 A;  3IBH A;  3ZRE A;  2W6J H;  1GTA A;  1JNQ A;  1SK2 A;  1YY7 A;  2YZU A;  4TXO A;  4FYB A;  3X3Y A;  4IHU A;  4GLT A;  1GOU A;  4WWU C;  1K9M 4;  3ERG A;  1OHS A;  3GKX A;  4R9L A;  2XF3 A;  2F5W A;  2H01 A;  1KSI A;  5LC6 A;  2I3Y A;  4XBT A;  2BNG A;  4H86 A;  4HOJ A;  4FYC A;  4KFF A;  3S27 A;  3UL6 A;  2PU9 C;  3WGE A;  1EA2 A;  3HVV A;  2R6K A;  4IP1 A;  2OTL 3;  3IV4 A;  1M90 4;  3C73 A;  4WF5 A;  4J2F A;  1QQ2 A;  1OC8 A;  3IAS 2;  3ISO A;  4NV2 A;  1O6J A;  4OCE A;  3ZTL A;  5IMZ A;  4ACS A;  1A2J A;  3FG4 A;  4RUV A;  5J4U A;  4N0V A;  1E97 A;  3BB9 A;  3GIX A;  3KH7 A;  2B24 B;  2GSP A;  2GST A;  2KP2 A;  1TJD A;  1WPI A;  1TRV A;  4KDU A;  1B8X A;  2XGL A;  3A3T A;  4YAV A;  2MC8 A;  1UUW B;  1E3R A;  2DJ1 A;  4PUA A;  1V9W A;  1A2L A;  5DAK A;  2INX A;  1ZYN A;  5F06 A;  5CRE A;  4MJE A;  4L5L A;  2OBK A;  4O32 A;  3PR8 A;  2YZH A;  2SBL A;  2JAD A;  1UCJ A;  2B3S A;  4HM2 B;  2XPD A;  2B5X A;  5A4V A;  1K0C A;  3BCI A;  1UCL A;  1AXD A;  1ERV A;  1R7H A;  1G0T A;  1GY7 A;  4JE1 A;  5EL8 A;  2BO9 B;  2NPB A;  3LXU X;  1EP7 A;  4RZM A;  1EP8 A;  1GP1 A;  3N9J A;  2AB6 A;  2OAC A;  5GAP D;  4RNZ A;  3N54 B;  2B6M A;  2O7K A;  5HOH A;  5IER A;  5A0O B;  3W8J A;  1IVV A;  3EE1 A;  4HZ2 A;  2R41 A;  1O81 A;  1SL0 B;  2Z7A A;  3F40 A;  1GH2 A;  3EJV A;  2VOC A;  2XHF A;  5DCG A;  3UEM A;  1PYL A;  1R4Y A;  5G1K A;  1FVK A;  4G2E A;  4CW9 A;  1H75 A;  3G7Y A;  2IY2 A;  1GNE A;  1ROA A;  1MD3 A;  5IMV A;  3BOA A;  2IYJ A;  3FR9 A;  1X1W A;  4O3V A;  4ZL9 A;  4BIK A;  3ZVJ A;  3K63 A;  3UMA A;  3MYD A;  1O8W A;  4N30 A;  4JF8 A;  5D8I A;  1S3R A;  3FKA A;  3GMF A;  1FGR A;  3X3Z A;  2CWU A;  1BNR A;  2EIR A;  3FF0 A;  4XBY A;  1J08 A;  3IRA A;  5GZZ B;  4X2O A;  1V58 A;  5G2G A;  1GYB A;  4ECC A;  1ROV A;  2A2R A;  1B4Q A;  1V2A A;  1THX A;  1JLV A;  5BXQ A;  2A2S A;  3CQF A;  4D73 B;  2D2Z A;  1DET A;  3MG3 A;  2HOH A;  4IQ1 A;  4TX4 A;  4O7H A;  1XIY A;  3R3E A;  2J9H A;  3JUP A;  4AGS A;  3F14 A;  2V41 A;  4MJD A;  5KN1 A;  2WRT A;  5JWQ B;  1HD2 A;  3GWR A;  1TK5 B;  1X1Y A;  2R4V A;  3V1W A;  1PFP A;  1USB A;  4N6O B;  3LTA A;  5FGO A;  3G9B A;  4BVX B;  2ZNM A;  1N8J A;  2YJH A;  2HMK B;  4WBJ A;  2W2C A;  1NNV A;  5DJL A;  4JU5 A;  1PX6 A;  3D5I A;  3GRD A;  5JCW A;  1LOV A;  3IMA B;  1XOB A;  3KXO A;  1VQN 3;  1I0V A;  5EQL A;  1A8Y A;  1AUC A;  4G1M B;  2LEG A;  3GL3 A;  1US1 A;  4GWR A;  2JSZ A;  3RDW A;  1ON4 A;  1BNG A;  1FAA A;  4PQI A;  3TRP A;  4OD7 A;  2E2V A;  1EEM A;  2O3O A;  3U97 A;  3C7M A;  3ZVJ D;  3KH9 A;  1RKY A;  4HBR A;  3TKS E;  3L4N A;  2OAD A;  1IDP A;  3G16 A;  3MYT A;  5F05 A;  5JPP A;  3TRX A;  1IV7 A;  2P09 A;  4I2U A;  2WDU A;  1AQV A;  1S3C A;  4K90 B;  3F9S A;  1GOV A;  3D6I A;  2N5A A;  1HYF A;  1TFK A;  2VCQ A;  1LOY A;  3LTD A;  1NM3 A;  3BD2 A;  2W03 A;  4Q5R A;  5IQY A;  2LRN A;  1MWS A;  2K9F A;  4MEI A;  3HJO A;  5EVO A;  1R5A A;  4PXO A;  3FK8 A;  1A67 A;  1A23 A;  2H75 A;  3TB2 A;  2LJR A;  3DXO A;  1F37 A;  1V40 A;  4JR6 A;  1LNI A;  3IE3 A;  1PL2 A;  1MGR A;  3HVX A;  3KKG A;  2TRX A;  3Q2P A;  1YJ9 3;  1LU4 A;  3MAK A;  1FW1 A;  1PL1 A;  3ZIT A;  1T2I A;  4N6T A;  1OF5 A;  4TR1 A;  3OWY A;  1FGT A;  4MF7 A;  3CME 3;  1TRP A;  3DXB A;  10GS A;  1QFN A;  1DMN A;  4FMA A;  4G0I A;  1JZW A;  1XWG A;  3M8N A;  2OWP A;  1JB4 A;  1QAL A;  4OUQ A;  1HQO A;  1U6T A;  4YH2 A;  2TRC P;  3ZZX A;  4GTU A;  1PRX A;  3ZL5 A;  1NW2 A;  3VWV A;  1Q42 A;  5CF1 A;  4HU9 A;  2IUK A;  3JUM A;  4K1U A;  5RNT A;  4EXR A;  1T2H A;  3APS A;  1BJX A;  4GQC A;  3GSP A;  1LQM B;  1ZYP A;  1B48 A;  3O76 A;  1RK4 A;  3N9H A;  2IL3 A;  4BTW A;  1W00 A;  3BND A;  1B2Z A;  4BA7 A;  4BVY A;  1ZGN A;  3Q19 A;  3NBB A;  3T8U A;  2OE0 A;  4IT7 A;  5ELU A;  1SKW B;  2SAR A;  2PPT A;  5JCG A;  4TXV A;  1FO5 A;  3CC2 3;  1B2X A;  3F4S A;  5D93 A;  2YCD A;  1IT7 A;  2GQK A;  1N9E A;  4DSS B;  3KTB A;  2ZCT A;  3DH2 A;  3RGA A;  3A5W A;  2D42 A;  5CNW A;  2O89 A;  4KAE A;  1M9G A;  1K0N A;  5JPU A;  3C8E A;  4POK A;  3P2A A;  2CZ3 A;  1JRQ A;  3IR4 A;  3CBU A;  4TOP A;  3EU3 A;  2F5M A;  4RNY A;  2CC3 A;  1W89 A;  3A2V A;  3UBK A;  2PMT A;  1GL8 A;  3ZFL A;  1GNW A;  1TK8 B;  1RNB A;  4DKI A;  1EEJ A;  1K0O A;  4ORL A;  2WJU A;  1I9D A;  1W4N A;  2FUG 2;  2ZUP A;  3CPO A;  4PUF C;  3FR6 A;  17GS A;  2CVD A;  4MNN A;  1K73 4;  1WRY A;  5AIV A;  1PX7 A;  4HM5 B;  1AAZ A;  2L5L A;  5AGY A;  3MSO A;  5CLK A;  2R0P A;  2F56 A;  3HK4 A;  3CCE 3;  3HKR A;  13GS A;  1B2S A;  3EC3 A;  2OTJ 3;  6GSY A;  3HII A;  4J8T A;  4KND A;  2R2J A;  3A2X A;  4IIA A;  2BU4 A;  3KN4 A;  1RMS A;  3APO A;  5G2Z A;  3UBL A;  3QPM A;  2WGQ A;  1C54 A;  2CW9 A;  3PCS A;  4MPG A;  1OGX A;  2DJ3 A;  3UIW A;  1HKX A;  4HEA 2;  11GS A;  1N5P A;  1PFO A;  4K2X A;  4HU7 A;  1FUW A;  1IU7 A;  1YJW 3;  2TIR A;  1GSD A;  2HZF A;  1JZD A;  1LVN A;  5J9B A;  4LZI A;  1LJR A;  2KCD A;  2O9U X;  2W56 A;  2Y74 A;  5AIF A;  5JWR B;  2H6X A;  1A2K A;  5FWG A;  3W6G A;  4HZ4 A;  5LCZ A;  1SL2 B;  1PKZ A;  5DQS A;  2F3M A;  20GS A;  2CG0 A;  2AHE A;  3L9V A;  3V99 A;  4KUN A;  1CQG A;  2H71 A;  1OAC A;  1EOH A;  1RN1 A;  1OAZ A;  4BWS A;  1GMP A;  5D83 A;  1T00 A;  5ELA A;  3I9V 2;  4TRX A;  5KEJ A;  2FA4 A;  3BNE A;  1VF1 A;  5GST A;  4MF6 A;  3D3L A;  4H3U A;  2PN8 A;  3DGL A;  1GSF A;  4F03 A;  2CFD A;  3IOS A;  1Z7R A;  1JV2 B;  5D82 A;  2F98 A;  5IMF A;  2V6O A;  3ROB A;  1BSD A;  1CH0 A;  2D1W A;  3M9K A;  2OE3 A;  1A2M A;  2KF6 A;  1T1V A;  2X8H A;  5ECI B;  2RSX A;  4FCM A;  1PU4 A;  2G0F A;  3BJ5 A;  3QAG A;  2VUP A;  4MMY B;  1SU9 A;  1BQ7 A;  4PX1 A;  2XFS A;  5DBQ A;  4X43 A;  1B21 A;  2V32 A;  1OPY A;  1K0D A;  1JKG B;  1T5Y A;  1B2U A;  1FYS A;  5IG3 A;  4R1K A;  5ECS A;  3FSD A;  1EGO A;  2XR8 B;  3SXX A;  4MK3 A;  3DGM A;  2O87 A;  3EU4 A;  3GV1 A;  1WMN A;  3CMI A;  4O5U A;  1UI8 A;  3J7Y k;  1YIJ 3;  1GMQ A;  1WOU A;  6GSP A;  3L0R A;  4RQX A;  4JRR A;  1BX9 A;  2G2Q A;  3WYW A;  4R4K A;  4HKV B;  2VL2 A;  2M7O A;  4K61 A;  1WMP A;  3EQQ B;  1B9Y C;  3F8U A;  3HYP A;  2PER A;  4HQZ A;  1HNA A;  2CV4 A;  2XBI A;  1SPU A;  3MKI A;  4LMV A;  1JZR A;  3JVC A;  1Q7Y 4;  3FZA A;  4OK0 A;  5IF6 A;  4YKF A;  3MNG A;  5ECP B;  3CD6 3;  2C0G A;  5DQY A;  1RGA A;  1V74 A;  5FHI A;  4EYC A;  4MJB A;  5CK6 A;  2PWJ A;  4BWQ A;  1Q7H A;  4LL4 B;  5KN0 A;  2RCD A;  2HT9 A;  3GL5 A;  3N5O A;  3WGD A;  2GU3 A;  2GSR A;  2H70 A;  1DSB A;  2HSY A;  3PCR A;  2HSH A;  2ML5 A;  4HOH A;  5HR0 A;  2CFL A;  3QDN A;  2N5B A;  1I2E A;  3FEU A;  3IDV A;  1LXE A;  4N6M A;  2LQQ A;  1GSP A;  2GEX A;  2HZE B;  4LA1 A;  2K8V A;  2I81 A;  1G7O A;  4EF0 A;  2YN1 A;  5AN1 A;  4YKG A;  3UNL A;  3NQZ A;  3KII A;  2QC7 A;  1OH0 A;  4KB3 A;  4NMU A;  4K0G A;  4OWY A;  3NM7 A;  1RGL A;  2DIZ A;  1UN2 A;  4WBR D;  3UJM A;  1XWC A;  1VF4 A;  4GXZ A;  2VO4 A;  3HVS A;  4NAX A;  5DRV A;  1GY6 A;  1KD1 4;  2ML6 A;  1HYU A;  4MMM A;  4WYK A;  3WHO A;  1RGK A;  1GSS A;  2L6D A;  1JN5 A;  3DWV A;  2UGI A;  2A15 A;  3RNT A;  2AYT A;  1STD A;  1U5O A;  1B20 A;  1FGQ A;  3CCS 3;  2AAD A;  2HYX A;  1RDS A;  1SYR A;  2HMM B;  3GYK A;  1DVC A;  1LBK A;  1GSE A;  1YEX A;  1AQW A;  4OFN A;  2YWO A;  5CAX A;  4V1A g;  3WT2 A;  5GSS A;  4K6X A;  1EV9 A;  3I0Y A;  1RHL A;  1BUQ A;  2EIO A;  3VUR A;  4STD A;  4OFM A;  2PUK C;  3EVI A;  1M1K 4;  4X2H A;  1GTU A;  4FO5 A;  1YEP A;  1O8X A;  1SD9 A;  5FT3 A;  1X5E A;  1OC9 A;  4L0U A;  5KN2 A;  3CSJ A;  1XWB A;  2P31 A;  5D9T A;  1SL1 B;  4I2T A;  5JWO B;  4G0K A;  3TKP A;  1PGT A;  3CCL 3;  1W01 A;  4NHW A;  2FNO A;  1O73 A;  2MBT A;  2P0X A;  4MMZ B;  5AEW B;  5BMU A;  3BIR A;  3FHK A;  3GTU A;  1X5D A;  1Q9E A;  3GX8 A;  3KD0 A;  2CX0 A;  3UOM A;  4IVF A;  1OVN A;  4F2I A;  1W5Z A;  1U88 A;  4AEQ A;  5C00 A;  1YKA A;  5BVB A;  1ULJ B;  1PN9 A;  1TTZ A;  3WMD A;  2WUL A;  4ECJ A;  5IPG A;  3LYP A;  2B5Y A;  1BRG A;  3EX9 A;  3BLZ A;  5D96 A;  4FMD A;  4ICY A;  4PEJ A;  1ZZY A;  1TRU A;  1RCK A;  3HI7 A;  1MEK A;  1RN4 A;  2DLX A;  2HXK A;  3NZN A;  5CO3 A;  1AQX A;  2GGT A;  4P3Y B;  2RM5 A;  3QRD A;  3Q90 A;  2F51 A;  4NXI A;  4GST A;  1OE8 A;  4OO5 A;  2OQE C;  1W2Z A;  2NDO A;  1GSY A;  4WKW A;  2E2M A;  4MZB A;  3T0U A;  3KGK A;  3LG6 A;  2L4Q A;  1ZS7 A;  2FXT A;  5GSP A;  1U3I A;  1Z7P A;  5B7C A;  1I0X A;  1AR0 A;  2YAN A;  5B8A A;  4TW5 A;  3UAR A;  1SIH A;  1M7T A;  6GSX A;  4HYZ A;  1AY7 A;  1YF1 A;  3IA1 A;  1IYY A;  1TTO A;  1W4V A;  3MG2 A;  3FLJ A;  2R3X A;  3NIV A;  1AC1 A;  4LEH A;  4BL7 B;  2PVO C;  3IAM 2;  2VIM A;  2NVL A;  1IQX A;  1ST9 A;  3VFI A;  3HZ8 A;  3Q3F A;  3G7J A;  1Z5Y E;  1WMJ A;  3KP8 A;  1N8Q A;  2LKU A;  4X1U A;  3GA4 A;  2Z9S A;  1SJZ A;  1VF3 A;  3UL5 A;  2LV3 A;  3FZ5 A;  1DE2 A;  2CAI A;  1KTE A;  14GS A;  3VGN A;  1X9W B;  4HM0 B;  1K3L A;  4HSC X;  3FMW A;  1YVB I;  4L0W A;  4IPB A;  1IT8 A;  3EF8 A;  2UUG C;  2HLS A;  1VQ5 3;  5H5R A;  5J41 A;  4HI7 A;  4NHZ A;  4KDY A;  3K9M C;  2X8C A;  3IPZ A;  1ERW A;  1ZX2 A;  3M9J A;  1KEB A;  5DRE A;  2MF7 A;  3BCK A;  1BIR A;  3TOU A;  1MDK A;  1TU7 A;  1IVX A;  3MSZ A;  4F82 A;  3HCZ A;  3DRN A;  2MBS A;  4N3V A;  2BT3 A;  1TU5 A;  2NTO A;  1BRK A;  4NRE A;  2LQO A;  3PIN A;  3M3M A;  4IJ3 A;  5J3R A;  1Q98 A;  1SJ6 A;  2GLR A;  2RUE A;  5ENU A;  1RSN A;  4ECB A;  3CPW 2;  1NWW A;  1FOH A;  5IG0 A;  5DAL B;  1OUN A;  3NX0 A;  1J9B A;  3ERW A;  4IQA A;  3KSE D;  3ZG5 A;  1SEN A;  4PUR A;  2GZY A;  3H1N A;  5G1L A;  5ECQ B;  3KIJ A;  2V1M A;  4KA0 A;  4JBB A;  1DE1 A;  5D9X A;  3WR2 A;  1GLQ A;  2CHC A;  3FZW A;  5H5Q A;  4HM1 B;  1YKC A;  3LZA A;  3MWZ A;  1ZL9 A;  1F3B A;  3A2W A;  1F2E A;  3HDC A;  2BTO T;  2GEY A;  4IGJ A;  4BTY A;  3C1R A;  4D73 A;  4MDC A;  2R0G A;  1XZO A;  2YOI A;  3BNC A;  1AVL A;  3CSH A;  5JCU A;  3CRU A;  1F8N A;  3KMN A;  3C71 A;  2GT6 A;  1R5P A;  2FWE A;  2XSH B;  1KNG A;  1QVF 2;  4JR4 A;  5G5E A;  4L7K A;  5IOX A;  4BVX A;  1N9J A;  2PNC A;  3FZ4 A;  3DYR A;  2P5Q A;  2OE1 A;  2C0F A;  4NPB A;  4PQH A;  2H0H A;  2VCT A;  2XGN A;  4G9H A;  1K28 A;  5EPF A;  2IA7 A;  6GSU A;  2XFT A;  4IN0 A;  1WMO A;  5STD A;  4KT3 B;  4AKY A;  6STD A;  1PQN A;  2REM A;  3EMX A;  2KF4 A;  5A4W A;  2FLS A;  2CX3 A;  3FH1 A;  3HD5 A;  5IEN A;  3Q74 A;  4KSO A;  3SVA A;  1KBN A;  4LLR A;  18GS A;  2DKI A;  3UVH A;  3U1W A;  4KCA A;  4X0X A;  2V2G A;  4ZXG A;  1HNB A;  1RGC A;  3F8X A;  3HZ4 A;  1I2F A;  1Q81 4;  1FW7 A;  3B7C A;  3L0H A;  1M3J A;  3ZML A;  2IWT A;  1GTB A;  4FQU A;  3HOH A;  3TKQ A;  4HM7 B;  1PMT A;  1VQ8 3;  3A76 A;  3GKM A;  5E59 A;  3TJK A;  1FZU A;  3EBY A;  1NJI 4;  1EWX A;  3E0U A;  2XPE A;  1I8V A;  5D9W A;  1CYU A;  1O7P B;  2FA8 A;  3WA3 A;  1AIU A;  1V57 A;  1BSE A;  1VQP 3;  5LNK e;  5ELG A;  3UB1 A;  5KOW A;  2JZR A;  3BU4 A;  3H79 A;  3ZYW A;  1BAY A;  3LEF A;  3D21 A;  3DZL A;  2HRK A;  1OHO A;  3GZY B;  4KZ1 A;  2B5E A;  1EOG A;  3WA2 X;  1UUV B;  3LT8 A;  1W6Y A;  2H74 A;  1BSC A;  1ILO A;  1ZO2 A;  1X5C A;  3NM2 A;  1RW1 A;  4DSQ A;  2KOK A;  2C10 A;  3QR6 A;  5DCH A;  1MTC A;  4ZM8 A;  2BMR B;  1QMA A;  3KZT A;  5KP3 A;  4R9K A;  1TI1 A;  3LQ7 A;  1W7C A;  2AAE A;  5DDL A;  2YV7 A;  3UVT A;  6GSV A;  3VSY A;  1KWI A;  5IG4 A;  3S28 A;  1WP0 A;  1NB5 I;  1U3A A;  2YV9 A;  2HRA A;  4O5Q A;  4EDY A;  1I3F A; 
#chains in the Genus database with same CATH homology
 2M46 A;  4ZBD A;  1GSU A;  2PBJ A;  4XS4 B;  4KCE A;  4MZC A;  5CYY A;  3H4K A;  1K0M A;  4Z2U A;  2FHE A;  1T4Y A;  1XW5 A;  3GN3 A;  4NWY A;  2DJJ A;  3F3R A;  3TOT A;  2DJ0 A;  1M9A A;  4HJM A;  2GVP A;  3PPU A;  1NHO A;  3EMP A;  4EIP A;  2H1B A;  3RHC A;  1C72 A;  2JU5 A;  2VD1 A;  3TKS C;  4DSS A;  1YJ6 A;  1M2D A;  2O8V B;  3GH6 A;  5ID2 B;  4MA9 A;  3HJM A;  4OMV A;  4AJ8 A;  3KP9 A;  2VCX A;  1VF2 A;  4YQU A;  1QK8 A;  4OO4 A;  4HS1 A;  4CY8 A;  4YAP A;  1JLW A;  5B8B A;  2X49 A;  2X64 A;  4L5O A;  4K8M A;  2A4V A;  4IS0 A;  4GCI A;  4MLY A;  5G30 A;  2LNT A;  2IMD A;  5ECL B;  2JZS A;  4HQS A;  1GUL A;  2AAW A;  2KUC A;  3U6V A;  1TU8 A;  2K18 A;  1B9X C;  1ZCP A;  1TKD B;  2C3Q A;  4ZB6 A;  4OCF A;  3I69 A;  3TCO A;  2RII A;  1EGR A;  3F3Q A;  1A0R P;  2K8S A;  5IMA A;  4ZB8 A;  4LMW A;  3TKR A;  4JZQ A;  4PQ1 A;  2C0E A;  4MH2 A;  2B7J A;  1ZMA A;  5D9V A;  4HJ2 A;  4KF9 A;  5L71 A;  2GSS A;  1S3A A;  4FH8 A;  3FW2 A;  3IC8 A;  1X0R A;  5LD0 A;  1JZO A;  4MP4 A;  4XS1 A;  3GHA A;  3U5R E;  3DML A;  3GNJ A;  2C3N A;  1A24 A;  1CQH A;  3LXT A;  2HRN A;  2H6Z A;  2FCH A;  4XS6 A;  2FGX A;  1AW9 A;  4FIW A;  1JHB A;  3F4T A;  4ULX A;  5IM9 A;  2L59 A;  1JFU A;  4TR0 A;  4NV5 A;  3FRC A;  2C3T A;  5HR2 A;  1BG5 A;  3EYT A;  2JZT A;  3IXR A;  4Q5N A;  3TUE A;  2BMX A;  5IPH A;  1E2Y A;  1K3O A;  2M72 A;  5KOX A;  4RQR A;  1PA3 A;  1GWC A;  3KJY A;  3RBT A;  3ED3 A;  3CRT A;  2ON7 A;  4PGT A;  3F6D A;  3IHQ A;  4X4J A;  1SK0 A;  1PD2 1;  2PGT A;  1ZOF A;  5INY A;  1Z6M A;  4QL9 A;  3K8N A;  4EE0 A;  4TR4 A;  1ZYE A;  2EC4 A;  1PSQ A;  2IFQ A;  4AJ6 A;  3TJB A;  2X8G A;  1XOA A;  3RAZ A;  2I1U A;  3LJR A;  1Z9H A;  2P0G A;  5A5K A;  4K0N A;  5CRG A;  3L9S A;  1GUK A;  4ID0 A;  3QAV A;  4V2N A;  4ZBA A;  2VM1 A;  4KSM A;  3GUS A;  1T7P B;  3DKS A;  1G6W A;  3A5I A;  2WCI A;  4MCU A;  3D4M A;  4ILF A;  5IO0 A;  2MMO A;  2OBI A;  1G6Y A;  2GS3 A;  4TKY A;  4PTS A;  2C1Y A;  3EPT A;  2VL3 A;  3D0Z A;  3US3 A;  1THO A;  2X4A A;  3DEX A;  2DIY A;  2HZE A;  4IJI A;  2LRC A;  1GUH A;  2ALB A;  1GRX A;  1TK0 B;  2FWF A;  1N2A A;  2HRF A;  2LJK A;  4V1A p;  2H73 A;  5IO2 A;  5ECK B;  3VK9 A;  2CVB A;  1MDJ A;  1E6B A;  4CDO A;  1XPV A;  4Z2T A;  1SK1 A;  4V2L A;  2LST A;  2DML A;  3ERF A;  2CA8 A;  2IMF A;  1OC9 B;  3H8Q A;  4F0B A;  1ERT A;  4EIQ A;  1R26 A;  4GSS A;  3VWW A;  1ERU A;  3QFB C;  3TJF A;  2RUF A;  1FHE A;  1WJK A;  2M80 A;  3GTU B;  2VCZ A;  5HQP A;  2QA2 A;  4KE3 A;  3F0I A;  3GH9 A;  1M99 A;  4ZL7 A;  1GLP A;  3DGQ A;  1Z3E A;  1T8E B;  3IHG A;  1OKT A;  2VAF A;  4KGI A;  3M0F A;  3TDG A;  2LJA A;  4I6X A;  2CX4 A;  3AY8 A;  2CQ9 A;  4DEJ A;  4TXO B;  4HUA A;  4LL1 B;  2GDR A;  2ON5 A;  3QMX A;  4G19 A;  4ZB9 A;  2A4H A;  4TVE A;  3ZLP A;  2C0D A;  3EWL A;  4HDE A;  2C80 A;  1J0F A;  2HNL A;  4TN8 A;  4WR4 A;  5BRT A;  3FYG A;  2H1D A;  3P7X A;  1IYH A;  4K9Z A;  2YNX A;  5CRW A;  3IC4 A;  2MZC A;  1RQM A;  4I97 A;  5D73 A;  5DAK B;  3RHB A;  2LTK A;  3FKF A;  1FB0 A;  2N5F A;  4WXT A;  5DJM A;  2GT5 A;  3ZMK A;  4EC0 A;  4MJC A;  1BED A;  2I9H A;  1QXH A;  16GS A;  2VLV A;  4I8B A;  6GST A;  5HR3 A;  2DKH A;  5F0G A;  4IP6 A;  3LSZ A;  4BL7 A;  4E8H A;  4ZIJ A;  1F9M A;  2CVK A;  3KZQ A;  4ML1 A;  3EUR A;  4GF0 A;  3C1S A;  2MMZ A;  2B1L A;  1XWA A;  3JCM L;  1H4O A;  1SYX A;  3HA9 A;  1ML6 A;  5HR1 A;  2OJL A;  1URM A;  1XVW A;  1T4Z A;  2YP6 A;  2VM2 A;  2KHP A;  2YWI A;  1YF0 A;  4WET A;  3Q18 A;  3LYK A;  4N11 A;  2OA7 A;  3QFA C;  2WS2 A;  1TRS A;  1XCC A;  3W8S A;  4PNG A;  2GZZ A;  5GAN D;  3VI7 A;  4OFT A;  1OYJ A;  3PGT A;  4EL1 A;  3UJ1 A;  2H6Y A;  5CP1 A;  4WF4 A;  2MMN A;  12GS A;  5B6N A;  3BBY A;  5IIZ A;  1OC3 A;  3KCM A;  3PH9 A;  9GSS A;  4EUY A;  5DAL A;  1O85 A;  3I6A A;  4ZIL A;  1I5G A;  4QL7 A;  2VCW A;  4G10 A;  3FY7 A;  3H93 A;  3LGC A;  3ME7 A;  1FB6 A;  2H0G A;  2IJY A;  4DVC A;  4GQF A;  5CRH A;  3DVW A;  3ZRD A;  4TR3 A;  1FOV A;  3F9U A;  4O92 A;  5HFK A;  3VWU A;  2I4A A;  1SD8 A;  2FWH A;  2YPM A;  3D22 A;  4ECI A;  1MDI A;  3IK9 A;  4N10 A;  4Z2R A;  1WIK A;  2VL2 C;  2WFC A;  1XW6 A;  3HJP A;  5J9C A;  1NSW A;  2F9S A;  3KM6 A;  3QCP A;  2R5G A;  2YWN A;  1YDK A;  1DUG A;  4J56 E;  2DSA A;  1YZX A;  3E9J B;  2IMI A;  2MMA A;  3LFL A;  4IBP A;  4EXJ A;  2LUS A;  4CHS A;  5IMD A;  5IMC A;  3TGZ A;  2L6C A;  1Q4J A;  4Q5F A;  4POM A;  1OE7 A;  22GS A;  5H5S A;  2HFD A;  3HY2 A;  3E3E A;  2IPA A;  4KW6 A;  1SKR B;  1V98 A;  3G7I A;  5CRD A;  5A4U A;  2GZP A;  3I43 A;  5IOW A;  4FYU A;  4TR1 B;  1TI3 A;  3VI5 A;  3GX0 A;  1XVQ A;  4KX4 A;  2H30 A;  2CZ2 A;  2RLI A;  1F3A A;  3O6T A;  2CAQ A;  2F8A A;  2B7K A;  2L5O A;  1FG4 A;  1UC7 A;  3WT1 A;  4WR5 A;  4EVM A;  1A0F A;  4ISD A;  1X9M B;  1TRW A;  2OKA A;  1PN0 A;  3GST A;  3EE2 A;  4XRD A;  2CT6 A;  1Z6N A;  2BJX A;  2HE3 A;  1EZK A;  4I5Q A;  4BVY B;  4E8E A;  4MJA A;  3L9U A;  4ZL8 A;  2WB9 A;  2QKE A;  3GRX A;  3D4T A;  2KP1 A;  2EIQ A;  5G5F A;  4EKZ A;  4F0C A;  2NBS A;  3VPT A;  1WWJ A;  1XW9 A;  2H72 A;  1M2B A;  3ZIJ A;  5ECH B;  1K0A A;  1UVZ A;  1TDI A;  3O3T A;  2DJK A;  4Q5Q A;  3TRQ A;  2H8L A;  5AIS A;  2QA1 A;  2E7P A;  6GSS A;  1R4W A;  2QGV A;  4POL A;  5F07 A;  1OKD A;  1ACV A;  4GSN A;  2K6V A;  2H66 A;  4XS4 A;  2VCV A;  2P5R A;  4MZW A;  2IIY A;  3CXG A;  2YWM A;  1DBY A;  5HFG A;  4EO3 A;  4O5R A;  1Y25 A;  5F8B A;  2GQM A;  3J7Y b;  1ZYQ B;  5B6M A;  3DD3 A;  2L57 A;  2C8U A;  3RPN A;  3KEB A;  3LOR A;  2AV4 A;  1FVJ A;  4V2M A;  4CY6 A;  3ZFB A;  2GSQ A;  5ID2 A;  2H1G A;  2VLT A;  2X99 A;  1VGL A;  4Z7X A;  2JSY A;  1K0B A;  2HI7 A;  4USS A;  4L8E A;  4YQM A;  2E2G A;  2WGR A;  3F6F A;  4XCS A;  4KDX A;  2C4J A;  3MWH A;  3CTG A;  3QD9 A;  2QSI A;  4AF2 A;  2H1A A;  4POB A;  2XC2 A;  3VLN A;  4MPF A;  5HFI A;  3S9F A;  2DBC A;  4RI7 A;  1Y6E A;  4N0Z A;  1M9B A;  1T3B A;  4DSR A;  4F9Z A;  4PNF A;  5ECR B;  1GSQ A;  2R0C A;  3APQ A;  4J57 E;  2H76 A;  3ME8 A;  1K3Y A;  4MAB A;  3F63 A;  3MDK A;  3LW9 A;  4XIH A;  2JL4 A;  4A5P A;  2GTU A;  4XTS A;  3GUR A;  4RI6 A;  5ECM B;  1SJI A;  4K7N A;  2IME A;  3CSI A;  2ES7 A;  3IK7 A;  4G0L A;  2UZ8 A;  1M0U A;  1PKW A;  3NOF A;  3D5J A;  1TXX A;  2VD0 A;  2FY6 A;  3WD6 A;  4K5S A;  2RM6 A;  2DC5 A;  4K2D A;  6GSW A;  1VRS D;  3DVX A;  3GKK A;  2B1K A;  1NHY A;  1TW9 A;  1MD4 A;  5C04 A;  1XXU A;  3TJJ A;  4GRF A;  5ECO B;  1HNC A;  1O7U A;  2O85 A;  1A8L A;  3GSS A;  4ML6 A;  2AUV A;  3KTL A;  5DVB A;  3P90 A;  4XHM A;  3QOU A;  2IFQ B;  3M1G A;  3VWX A;  4MF5 A;  2GQL A;  1EV4 A;  1G7E A;  1ABA A;  1IYI A;  5J5N A;  2A2P A;  2V6K A;  2VLU A;  8GSS A;  2KLX A;  3GKN A;  1XBS A;  7GSS A;  2AJQ B;  3HHV A;  2L4C A;  4EDZ A;  3HXS A;  3FR3 A;  3KMO A;  2FD3 A;  1F6M C;  3VPQ A;  1XFL A;  4MH3 A;  3LXZ A;  2LNS A;  4IW9 A;  2XBQ A;  4WEY A;  1X9S B;  1WE0 A;  1UA5 A;  3CTF A;  3CYN A;  2VL9 A;  1TOF A;  4AJ7 A;  2WZ9 A;  3RPP A;  4K5R A;  1S3D A;  2R37 A;  1GUM A;  3DIE A;  2PVQ A;  1GTI A;  3OR5 A;  3QAW A;  3L78 A;  2DJ2 A;  2FWG A;  5G31 A;  3UAP A;  2LRT A;  4K7O A;  2IN3 A;  2H19 A;  4JED A;  5AIX A;  2MYG A;  1SKS B;  4YQV A;  4BPY A;  5ECN B;  5COH A;  1QGV A;  1M2A A;  3SBC A;  4XRA A;  3GFK A;  1B4P A;  3R2Q A;  3WGX A;  3TJG A;  2LS5 A;  4ZBB A;  2F8F A;  3SWL A;  5ABR A;  5E4W A;  5EY6 A;  5KN3 A;  1QUW A;  3ZIV A;  3P8W A;  2J23 A;  3FZ9 A;  2YJ7 A;  3EIN A;  3MIX A;  2H0I A;  1BYE A;  4IKH A;  1YQ1 A;  2JAC A;  19GS A;  3TKS A;  3LWA A;  1XWK A;  3F4R A;  3UL3 A;  1U87 A;  4QQ7 A;  2DMM A;  1QMV A;  2E0Q A;  2IMK A;  1TP9 A;  3Q6O A;  2HSM A;  4K7I A;  4IEL A;  4K1F A;  4KH7 A;  3IBH A;  3ZRE A;  1GTA A;  1SK2 A;  1YY7 A;  2YZU A;  4TXO A;  4FYB A;  4IHU A;  4GLT A;  3ERG A;  3GKX A;  2H01 A;  2I3Y A;  4H86 A;  4HOJ A;  4FYC A;  2PU9 C;  3WGE A;  3HVV A;  2R6K A;  4IP1 A;  3IV4 A;  3C73 A;  4WF5 A;  4J2F A;  1QQ2 A;  1OC8 A;  3IAS 2;  3ISO A;  4NV2 A;  1O6J A;  4OCE A;  3ZTL A;  5IMZ A;  4ACS A;  1A2J A;  5J4U A;  4RUV A;  4N0V A;  3GIX A;  3KH7 A;  2GST A;  2KP2 A;  1TJD A;  1WPI A;  1TRV A;  4KDU A;  1B8X A;  3A3T A;  4YAV A;  2DJ1 A;  4PUA A;  1V9W A;  1A2L A;  5DAK A;  1ZYN A;  5F06 A;  5CRE A;  4MJE A;  4L5L A;  2OBK A;  4O32 A;  3PR8 A;  2YZH A;  2JAD A;  2B3S A;  2XPD A;  2B5X A;  5A4V A;  1K0C A;  3BCI A;  1AXD A;  1ERV A;  1R7H A;  1G0T A;  4JE1 A;  5EL8 A;  2NPB A;  1EP7 A;  1EP8 A;  1GP1 A;  3N9J A;  2AB6 A;  2OAC A;  5GAP D;  2O7K A;  2B6M A;  3W8J A;  4HZ2 A;  1O81 A;  1SL0 B;  1GH2 A;  2VOC A;  2XHF A;  5DCG A;  3UEM A;  5G1K A;  1FVK A;  4G2E A;  4CW9 A;  1H75 A;  3G7Y A;  2IY2 A;  1GNE A;  1MD3 A;  5IMV A;  3BOA A;  2IYJ A;  3FR9 A;  4ZL9 A;  3ZVJ A;  3UMA A;  3MYD A;  1O8W A;  4N30 A;  5D8I A;  3GMF A;  2EIR A;  3IRA A;  1J08 A;  5GZZ B;  1V58 A;  4ECC A;  2A2R A;  1B4Q A;  1V2A A;  1THX A;  1JLV A;  4D73 B;  2A2S A;  2D2Z A;  4IQ1 A;  4O7H A;  1XIY A;  3R3E A;  2J9H A;  4AGS A;  2V41 A;  5KN1 A;  2WRT A;  5JWQ B;  1HD2 A;  1TK5 B;  2R4V A;  3V1W A;  1USB A;  3G9B A;  4BVX B;  2ZNM A;  1N8J A;  2YJH A;  4WBJ A;  5DJL A;  4JU5 A;  1PX6 A;  5JCW A;  3KXO A;  1XOB A;  1A8Y A;  1AUC A;  2LEG A;  3GL3 A;  4GWR A;  2JSZ A;  3RDW A;  1ON4 A;  1FAA A;  4PQI A;  3TRP A;  4OD7 A;  1EEM A;  3C7M A;  3ZVJ D;  3KH9 A;  3TKS E;  3L4N A;  2OAD A;  5F05 A;  3TRX A;  4I2U A;  2WDU A;  1AQV A;  1S3C A;  3D6I A;  2N5A A;  2VCQ A;  1NM3 A;  3BD2 A;  4Q5R A;  5IQY A;  2LRN A;  2K9F A;  3HJO A;  5EVO A;  1R5A A;  4PXO A;  3FK8 A;  1A23 A;  2H75 A;  3TB2 A;  2LJR A;  1F37 A;  1V40 A;  4JR6 A;  3IE3 A;  1PL2 A;  3HVX A;  2TRX A;  1LU4 A;  3MAK A;  1FW1 A;  1PL1 A;  3ZIT A;  4TR1 A;  4MF7 A;  3DXB A;  10GS A;  1QFN A;  4G0I A;  1JZW A;  1XWG A;  3M8N A;  1U6T A;  4YH2 A;  1HQO A;  2TRC P;  3ZZX A;  4GTU A;  1PRX A;  3ZL5 A;  1NW2 A;  3VWV A;  4HU9 A;  3APS A;  1BJX A;  4GQC A;  1ZYP A;  1B48 A;  3O76 A;  1RK4 A;  2IL3 A;  4BVY A;  4BA7 A;  1ZGN A;  3Q19 A;  2OE0 A;  1SKW B;  2PPT A;  5JCG A;  4TXV A;  1FO5 A;  3F4S A;  5D93 A;  2YCD A;  4DSS B;  2GQK A;  3KTB A;  2ZCT A;  3A5W A;  5CNW A;  2O89 A;  4KAE A;  1K0N A;  4POK A;  3C8E A;  3P2A A;  2CZ3 A;  3IR4 A;  3CBU A;  4TOP A;  3EU3 A;  1W89 A;  3A2V A;  3UBK A;  2PMT A;  1GL8 A;  3ZFL A;  1GNW A;  1TK8 B;  1K0O A;  1EEJ A;  2WJU A;  1I9D A;  2FUG 2;  4PUF C;  2ZUP A;  3FR6 A;  17GS A;  2CVD A;  4MNN A;  1WRY A;  5AIV A;  1PX7 A;  1AAZ A;  2L5L A;  5AGY A;  2R0P A;  3HKR A;  13GS A;  3EC3 A;  6GSY A;  4KND A;  2R2J A;  3A2X A;  3APO A;  5G2Z A;  3UBL A;  3QPM A;  4MPG A;  2DJ3 A;  3UIW A;  4HEA 2;  11GS A;  4K2X A;  4HU7 A;  2TIR A;  1GSD A;  2HZF A;  1JZD A;  5J9B A;  1LJR A;  5JWR B;  2H6X A;  5FWG A;  3W6G A;  4HZ4 A;  5LCZ A;  1SL2 B;  1PKZ A;  5DQS A;  2F3M A;  20GS A;  2AHE A;  3L9V A;  4KUN A;  1CQG A;  2H71 A;  1EOH A;  1OAZ A;  4BWS A;  1T00 A;  5ELA A;  3I9V 2;  4TRX A;  5KEJ A;  2FA4 A;  1VF1 A;  5GST A;  4MF6 A;  2PN8 A;  1GSF A;  4F03 A;  3IOS A;  1Z7R A;  5IMF A;  2V6O A;  3M9K A;  2OE3 A;  1A2M A;  1T1V A;  2X8H A;  5ECI B;  3BJ5 A;  2G0F A;  3QAG A;  2VUP A;  1SU9 A;  1BQ7 A;  4PX1 A;  5DBQ A;  4X43 A;  2V32 A;  1K0D A;  5ECS A;  1EGO A;  4MK3 A;  2O87 A;  3EU4 A;  3GV1 A;  3CMI A;  4O5U A;  3J7Y k;  1WOU A;  4RQX A;  4JRR A;  1BX9 A;  2G2Q A;  3WYW A;  2VL2 A;  1B9Y C;  3F8U A;  3HYP A;  2PER A;  4HQZ A;  1HNA A;  2CV4 A;  2XBI A;  4LMV A;  1JZR A;  3FZA A;  4YKF A;  3MNG A;  5ECP B;  2C0G A;  5DQY A;  5FHI A;  4MJB A;  2PWJ A;  4BWQ A;  4LL4 B;  5KN0 A;  2HT9 A;  3GL5 A;  3N5O A;  3WGD A;  2GSR A;  2H70 A;  1DSB A;  2HSY A;  2HSH A;  5HR0 A;  3QDN A;  2N5B A;  3FEU A;  3IDV A;  2LQQ A;  2HZE B;  4LA1 A;  2K8V A;  2I81 A;  1G7O A;  4EF0 A;  2YN1 A;  5AN1 A;  4YKG A;  2QC7 A;  4KB3 A;  4NMU A;  4K0G A;  4OWY A;  4WBR D;  2DIZ A;  1UN2 A;  1XWC A;  1VF4 A;  4GXZ A;  2VO4 A;  3HVS A;  4NAX A;  4MMM A;  1HYU A;  1GSS A;  2L6D A;  3DWV A;  2AYT A;  2HYX A;  1SYR A;  3GYK A;  1LBK A;  1GSE A;  1YEX A;  1AQW A;  4OFN A;  2YWO A;  5CAX A;  4V1A g;  3WT2 A;  5GSS A;  4K6X A;  1EV9 A;  2EIO A;  3VUR A;  4OFM A;  2PUK C;  3EVI A;  1GTU A;  4FO5 A;  1YEP A;  1O8X A;  1SD9 A;  5FT3 A;  1X5E A;  1OC9 A;  4L0U A;  5KN2 A;  3CSJ A;  1XWB A;  2P31 A;  5D9T A;  1SL1 B;  4I2T A;  5JWO B;  4G0K A;  3TKP A;  1PGT A;  4NHW A;  2FNO A;  1O73 A;  2MBT A;  5BMU A;  3FHK A;  3GTU A;  1X5D A;  3GX8 A;  3KD0 A;  3UOM A;  4IVF A;  1OVN A;  4F2I A;  1U88 A;  5C00 A;  1YKA A;  1PN9 A;  1TTZ A;  2WUL A;  4ECJ A;  5IPG A;  3LYP A;  2B5Y A;  5D96 A;  4ICY A;  1ZZY A;  1TRU A;  1MEK A;  3NZN A;  2DLX A;  2HXK A;  5CO3 A;  1AQX A;  2GGT A;  4P3Y B;  2RM5 A;  2F51 A;  4NXI A;  4GST A;  1OE8 A;  4OO5 A;  2NDO A;  1GSY A;  4WKW A;  2E2M A;  4MZB A;  3KGK A;  3LG6 A;  2L4Q A;  1U3I A;  1Z7P A;  5B7C A;  2YAN A;  5B8A A;  4TW5 A;  3UAR A;  1M7T A;  6GSX A;  1YF1 A;  3IA1 A;  1W4V A;  2R3X A;  3NIV A;  1AC1 A;  4BL7 B;  2PVO C;  3IAM 2;  2VIM A;  2NVL A;  3VFI A;  1ST9 A;  3HZ8 A;  3G7J A;  1Z5Y E;  1WMJ A;  3KP8 A;  2LKU A;  4X1U A;  3GA4 A;  2Z9S A;  1SJZ A;  1VF3 A;  2LV3 A;  3FZ5 A;  1DE2 A;  2CAI A;  1KTE A;  14GS A;  1X9W B;  1K3L A;  3FMW A;  4L0W A;  5H5R A;  2HLS A;  5J41 A;  4HI7 A;  4NHZ A;  4KDY A;  2X8C A;  3IPZ A;  1ERW A;  3M9J A;  1KEB A;  3BCK A;  3TOU A;  1MDK A;  1TU7 A;  3MSZ A;  4F82 A;  3HCZ A;  3DRN A;  2MBS A;  2NTO A;  2LQO A;  3PIN A;  3M3M A;  4IJ3 A;  5J3R A;  1Q98 A;  1SJ6 A;  2GLR A;  2RUE A;  5ENU A;  4ECB A;  1FOH A;  5DAL B;  1J9B A;  3ERW A;  4IQA A;  1SEN A;  4PUR A;  2GZY A;  3H1N A;  5G1L A;  5ECQ B;  3KIJ A;  2V1M A;  4KA0 A;  4JBB A;  1DE1 A;  5D9X A;  1GLQ A;  5H5Q A;  1YKC A;  1ZL9 A;  1F3B A;  3A2W A;  1F2E A;  3HDC A;  2BTO T;  4IGJ A;  3C1R A;  4D73 A;  4MDC A;  2R0G A;  1XZO A;  2YOI A;  3CSH A;  5JCU A;  3CRU A;  3KMN A;  3C71 A;  2GT6 A;  1R5P A;  2FWE A;  1KNG A;  4JR4 A;  5G5E A;  5IOX A;  4BVX A;  3FZ4 A;  3DYR A;  2P5Q A;  2OE1 A;  2C0F A;  4NPB A;  4PQH A;  2H0H A;  2VCT A;  4G9H A;  5EPF A;  6GSU A;  4IN0 A;  1PQN A;  2REM A;  3EMX A;  5A4W A;  2FLS A;  2CX3 A;  3HD5 A;  3Q74 A;  4KSO A;  1KBN A;  4LLR A;  18GS A;  2DKI A;  3UVH A;  4KCA A;  4X0X A;  2V2G A;  4ZXG A;  1HNB A;  3HZ4 A;  3L0H A;  3ZML A;  2IWT A;  1GTB A;  4FQU A;  3TKQ A;  5E59 A;  1PMT A;  3GKM A;  3TJK A;  1EWX A;  3E0U A;  2XPE A;  5D9W A;  2FA8 A;  1AIU A;  1V57 A;  5LNK e;  5ELG A;  5KOW A;  2JZR A;  3H79 A;  3ZYW A;  1BAY A;  3LEF A;  3D21 A;  2HRK A;  2B5E A;  1EOG A;  1ILO A;  2H74 A;  1X5C A;  1RW1 A;  4DSQ A;  2KOK A;  3QR6 A;  5DCH A;  1MTC A;  1TI1 A;  3LQ7 A;  5DDL A;  2YV7 A;  3UVT A;  6GSV A;  1WP0 A;  1U3A A;  2YV9 A;  2HRA A;  4O5Q A;  4EDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...