2H0IA

Crystal structure of dsbg v216m mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAMGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbG
total genus 65
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0iA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0iA02
1SENA 1XWBA 2YOIA 2WS2A 5INYA 4PUFC 3F4TA 2K18A 4MJAA 4MH3A 3GL3A 4N11A 2AV4A 1XIYA 2PBJA 1TTZA 2VD1A 3VFIA 2GSRA 2OBIA 2R5GA 3Q19A 2LRNA 1TW9A 3TB2A 2BMXA 5B6NA 2JADA 1SKWB 2Z9SA 5CP1A 4ZL9A 3F3RA 2VIMA 1ZGNA 2JZSA 2B1KA 3LSZA 2IWTA 4AGSA 1T1VA 4EE0A 1YZXA 3LFLA 4EDYA 4FH8A 3E9JB 3FR6A 4PX1A 2E7PA 5J9BA 3DD3A 3WGDA 3FKFA 2ON7A 4YQUA 3TKSA 1DE2A 5IMZA 5D9XA 2CQ9A 2X8CA 1TRWA 3TGZA 3LXTA 2DJ3A 3O76A 4WEYA 5A5KA 4GQFA 4HS1A 4K7OA 2JACA 1TI1A 1XW9A 5JCWA 3WGEA 2TRCP 4KSMA 4WXTA 1GULA 4TVEA 4KDXA 3TJBA 4YQMA 2R6KA 2PVOC 4PURA 1B4QA 1PN9A 3ZIJA 4TRXA 1AW9A 5AISA 4FO5A 5HFGA 2QSIA 3MSZA 1I9DA 4MMMA 6GSYA 4GXZA 2C8UA 3G7JA 1B8XA 1XVQA 4ID0A 2QGVA 3RHCA 1O85A 2F51A 5D73A 1OE8A 1X0RA 4MZBA 1V98A 2OADA 2J23A 5JCGA 1T4YA 1TOFA 2VL9A 2OE0A 3EVIA 4MLYA 5J3RA 2NVLA 1B9YC 3KH7A 4YAPA 3ERFA 2IY2A 5KN3A 2J9HA 5COHA 3CYNA 2GTUA 4GCIA 2IMDA 3GKNA 2OE1A 3IV4A 2A2RA 3FR3A 1Y25A 2A4VA 3H1NA 3KMOA 3M3MA 3L9VA 2MMAA 3M1GA 1F37A 5CYYA 2H6YA 1GSFA 4HU7A 4DSQA 4ZBDA 2IL3A 1LU4A 1S3AA 2LJAA 2NBSA 2H74A 4GSTA 3GHAA 3H93A 1B4PA 1K0MA 3QFBC 2NDOA 3TKSE 4WF4A 2YV9A 2VCXA 1FG4A 2EIOA 5E4WA 1A2LA 3IAM2 2EC4A 4V1Ag 3WGXA 1MDKA 3F9UA 1A2MA 1M9BA 3GA4A 5DCHA 3F4RA 3F0IA 2CZ2A 5IIZA 3I9V2 2WGRA 4N10A 4DVCA 2LSTA 5ABRA 4E8HA 2HRNA 1K3LA 4K6XA 1V58A 1T3BA 2M72A 1B48A 2PMTA 1SJ6A 2HSHA 2VCTA 2QC7A 5AIVA 3QAGA 5F07A 1M7TA 3GKKA 3ZVJD 4MH2A 1BEDA 1TKDB 3GX8A 5DAKA 2OACA 5IQYA 4QQ7A 1KBNA 4BL7A 1ABAA 2HYXA 3GSSA 4GQCA 2GZZA 4K1FA 2IMKA 3GH6A 4OFNA 2JSZA 2H1BA 3IXRA 2GZYA 1G7OA 4RI7A 4TR1A 5G30A 4HJ2A 5ELGA 1M0UA 2VCQA 2IPAA 1TI3A 3A2VA 4F0BA 2DSAA 2V1MA 3HA9A 2DJ2A 2ES7A 1YDKA 2P5QA 4O5RA 16GSA 4MPFA 2GQLA 1KTEA 2HZEB 1IYIA 2MBSA 2VL2A 5GZZB 1WWJA 1ERWA 2KLXA 5G5FA 3EU4A 5DQSA 3ZTLA 4MF6A 2FHEA 3L9SA 2LRTA 1K0CA 3MDKA 5E59A 1DBYA 2KP2A 3UJ1A 3DVWA 5C04A 1VF4A 4CW9A 1O8WA 1PX6A 4OFTA 5HR2A 1XWCA 1MDIA 4EL1A 3ZL5A 2L57A 2JZTA 3QD9A 1J9BA 2VM1A 4L5OA 1WPIA 1LBKA 3EC3A 1G0TA 5ID2A 1FAAA 1YEXA 2LKUA 3GFKA 20GSA 3KH9A 4MCUA 3HJPA 1HQOA 1AUCA 5JWQB 3EURA 3CBUA 5ID2B 2X8HA 4K2DA 2PU9C 4NV2A 4J56E 3L9UA 1ERUA 3NOFA 1U87A 4CHSA 3IR4A 1TK5B 4NV5A 1RW1A 3ZZXA 3C1SA 2WCIA 2YWOA 2B7KA 3QOUA 2PN8A 1Z3EA 2H30A 2M46A 1SD9A 4WR5A 3UVHA 2DIYA 4IP6A 3ZIVA 2PVQA 2CX3A 2G2QA 3HCZA 1SYRA 2VCVA 3EU3A 3HHVA 5ECLB 2L4CA 5D9VA 2LEGA 4HQZA 1W89A 4O7HA 1EP7A 2HFDA 5J5NA 2HI7A 4XS6A 3D22A 3PINA 3GKMA 4ZILA 5D96A 3TKRA 4NXIA 5DDLA 5F0GA 6GSXA 1TRVA 4HU9A 4PQIA 1TDIA 5HFIA 2M80A 1NSWA 4GRFA 2DJKA 2JU5A 4EUYA 4ISDA 2I81A 3GYKA 5CO3A 1TXXA 2H0IA 2MBTA 4K9ZA 2FWHA 4HZ2A 3KTBA 4PNGA 4ECJA 3G9BA 4HZ4A 4XS1A 3W8JA 2V2GA 3ZMLA 3V1WA 4DSSA 3QAVA 3D5JA 1IYHA 1PRXA 5GSSA 3CSIA 4ULXA 4OFMA 3D4MA 3HVSA 3L0HA 1XWGA 2CVBA 2VD0A 1ZYEA 5H5QA 3GMFA 1R26A 1Z7PA 4XHMA 2LV3A 4IELA 4J57E 2V32A 5ECMB 3LJRA 3US3A 2AB6A 2MMOA 2H0HA 1YY7A 4GLTA 1OYJA 1JLVA 2ZNMA 4JEDA 4EF0A 1O6JA 2DC5A 4G2EA 4OO4A 1XWAA 1U6TA 4MABA 4TXVA 1EP8A 1V57A 3UARA 1GSSA 4GF0A 4D73B 1RK4A 5DJLA 1TRUA 5H5SA 1XVWA 3GH9A 1A23A 3GURA 4HJMA 5D9WA 5G2ZA 1A2JA 2L6DA 4TOPA 4ILFA 2GLRA 3GL5A 2ZUPA 1M9AA 2GZPA 1CQGA 2GGTA 1JLWA 1S3CA 3MWHA 1WIKA 4X1UA 2R4VA 3L78A 1A24A 4BWQA 2CT6A 4IBPA 4TR1B 2ALBA 4KAEA 2JL4A 2MMZA 4KGIA 1PL2A 3ZREA 2DIZA 5JWOB 2FA8A 4OMVA 4AJ6A 2LNSA 3ME7A 4JRRA 3P8WA 5IMFA 4ECCA 3TJJA 4V1Ap 1GTUA 3A3TA 5DVBA 2CV4A 4LMWA 1JZWA 5ECIB 3EMXA 2N5BA 4MA9A 3LQ7A 2HZEA 2HT9A 1EGRA 4H86A 2B3SA 3HZ8A 3NZNA 1YF0A 3EINA 4MZCA 1WOUA 2E2MA 1TK0B 3DYRA 1F9MA 4KCEA 3P2AA 5ELAA 1O81A 1H4OA 1BJXA 3BJ5A 2H72A 1FVJA 3C1RA 4NPBA 4ZB6A 2GSSA 3UEMA 1TJDA 3DWVA 1EOHA 1X5CA 2H6XA 1BYEA 2H75A 3ZLPA 3M8NA 2IJYA 1U88A 5ECRB 5H5RA 3I6AA 5KN2A 4X43A 4JZQA 1SJIA 3EMPA 5ECSA 4EC0A 2IMFA 1TK8B 3VURA 3TOTA 4ZL8A 4RQXA 9GSSA 1AXDA 2OKAA 2C80A 4V2LA 1DUGA 5IO2A 1Z5YE 2FY6A 1SL1B 3QR6A 2FA4A 3UBLA 2NPBA 5IPGA 1G6WA 1E6BA 1OC9A 1XFLA 2BJXA 3F6FA 2DJ1A 5B8AA 1OKTA 1DSBA 1R5AA 3MAKA 2IIYA 2EIQA 5DALB 5IOWA 1R7HA 2VO4A 5ECNB 4AJ8A 3LG6A 2E0QA 1SK0A 3KIJA 4G10A 5GSTA 4YQVA 4TN8A 1SK2A 4L0WA 2V6KA 1NW2A 3AY8A 4PQHA 3EYTA 4KDUA 2R3XA 3KXOA 1K0OA 3NIVA 3M9JA 2F3MA 1SKRB 4KW6A 2F9SA 1X9WB 3ZRDA 2LRCA 1EGOA 4KNDA 4KH7A 4F2IA 1MDJA 4Q5QA 1YKCA 3BCIA 3VI5A 3KGKA 3GKXA 1M2AA 3UAPA 10GSA 2GSTA 1X5DA 1K0BA 1W4VA 2RM5A 3H79A 1O73A 2H1DA 4J2FA 5FT3A 4POMA 1XPVA 3UOMA 4KE3A 5B8BA 1MEKA 4IGJA 2CAQA 3IDVA 5AN1A 4V2MA 4NHZA 2WULA 8GSSA 1HNAA 5ECKB 3FW2A 3IAS2 3FRCA 4EVMA 4TR0A 2GVPA 6GSWA 1XXUA 4G19A 1PL1A 1C72A 4L5LA 2G0FA 2XBQA 3VI7A 3TKQA 5EVOA 1Z6MA 2FD3A 1QUWA 1XOBA 3OR5A 5A4VA 3ED3A 5LNKe 4FYUA 3GV1A 1K3YA 2B5YA 4HI7A 2H66A 2XBIA 2VCWA 3ZYWA 5GAPD 3HVVA 3C73A 2MYGA 1OVNA 3KEBA 2C0GA 2OJLA 1AQXA 1YKAA 2BTOT 2I3YA 1XOAA 5IMCA 4MZWA 2I4AA 3ISOA 1S3DA 3JCML 1VGLA 5EY6A 2C3NA 2GS3A 2PWJA 4IW9A 1PKWA 4OCFA 1X9SB 3E0UA 5EPFA 4F0CA 1GH2A 4ML1A 1HD2A 1VF2A 3ERWA 1ZZYA 2L6CA 1DE1A 2OE3A 2IYJA 4CDOA 1Z7RA 3U6VA 3DMLA 3KJYA 1UVZA 4RUVA 1K3OA 3D0ZA 1AC1A 2LQQA 4PXOA 2H1GA 2AAWA 5IPHA 2O7KA 11GSA 1GSUA 4BPYA 4TXOA 4POBA 4MJCA 1KEBA 4ZB9A 4EO3A 3HD5A 1X9MB 2YANA 3RDWA 3RAZA 4Q5RA 6GSUA 2DMLA 1ZCPA 5DAKB 2MMNA 4LL4B 1PX7A 2H8LA 5DQYA 3ERGA 4I2UA 3E3EA 2X99A 2RIIA 1ML6A 2CX4A 5JWRB 1XCCA 3DEXA 2K9FA 2IN3A 5C00A 1SKSB 4IVFA 3UL3A 2GDRA 3D6IA 1X5EA 3HJOA 2C0DA 1WMJA 1QK8A 3QFAC 3D21A 2YNXA 2C4JA 1I5GA 3CXGA 5IM9A 1JZDA 2GQKA 1V2AA 5AIXA 3CRTA 4IS0A 1GUKA 3FY7A 1PA3A 1YQ1A 1SL2B 3IC4A 4HOJA 3RHBA 4ZB8A 3IBHA 2WB9A 4EDZA 3HJMA 5CNWA 4E8EA 5IMDA 1GSEA 3N5OA 1U3AA 1XW5A 3EWLA 5ECPB 5ECHB 2N5FA 1HNBA 3C7MA 1Q4JA 1FOVA 5FHIA 1PD21 3APSA 3LGCA 1VRSD 2YV7A 1MD4A 5IO0A 1AAZA 3F6DA 2LS5A 2L4QA 4K7IA 2AUVA 1PQNA 3UVTA 3BD2A 3BCKA 3CSJA 4FIWA 19GSA 2FWFA 2WDUA 5KN0A 4QL7A 3VPQA 3IA1A 3ME8A 3IOSA 2FWGA 5D93A 1GSYA 1QGVA 3WD6A 2WZ9A 4AJ7A 1K0DA 1RQMA 1QFNA 1GUHA 3HYPA 2OA7A 2HSYA 4OCEA 2VLTA 5HQPA 4I97A 2VM2A 1M2BA 3CRUA 3EE2A 3QMXA 1AQVA 1NHOA 7GSSA 1J0FA 3IPZA 1V40A 1M99A 2FWEA 1WJKA 4KX4A 6GSTA 2WFCA 17GSA 2JZRA 2X64A 22GSA 2VL2C 3SBCA 5G5EA 2VCZA 2D2ZA 3P90A 1EV4A 4N0VA 2XC2A 5G1KA 4XCSA 4I8BA 2L59A 4WKWA 3A5WA 1GTIA 3UIWA 4ZBAA 1T8EB 1YF1A 4MJBA 5CAXA 1XZOA 1Z9HA 4G9HA 4O92A 4I5QA 2YWMA 4MF5A 3RPPA 3TKPA 3VWWA 2XPEA 3KMNA 1AQWA 14GSA 2YZUA 2H71A 1F3AA 2K8VA 1T7PB 3O3TA 4PNFA 3O6TA 1BX9A 1TP9A 2C0EA 2NTOA 1GLQA 4KCAA 3SWLA 1SU9A 4ZL7A 3APOA 3IK7A 1LJRA 3CTFA 3FEUA 3RPNA 1F2EA 4IN0A 4ZXGA 2TRXA 4TKYA 2YPMA 5ENUA 4V2NA 1WE0A 2EIRA 4XRDA 1WP0A 2N5AA 6GSSA 4DEJA 5F8BA 4NHWA 3VWUA 2VUPA 4RI6A 3GRXA 4N30A 4BA7A 1HYUA 4WETA 4I6XA 2C0FA 18GSA 1JFUA 2B5EA 5B6MA 1GWCA 1FW1A 2I1UA 4ML6A 1GUMA 3U5RE 1G7EA 1PKZA 1UC7A 1OC3A 4YAVA 3TCOA 4JE1A 2HZFA 4IP1A 3IRAA 1OC9B 2GSQA 12GSA 3GIXA 3LYKA 2KP1A 4ZIJA 3ZVJA 3A2WA 1GL8A 5A4UA 1EEMA 4KDYA 3N9JA 5KN1A 2IFQB 2B7JA 3F8UA 1SL0B 5HR1A 2L5OA 1SYXA 4IJ3A 2JSYA 3DXBA 5CREA 4HUAA 1GLPA 2B5XA 3H4KA 3CMIA 1CQHA 4O32A 5ECQB 5J41A 5B7CA 2LJRA 3Q74A 5DCGA 5CRWA 2YWIA 1Q98A 4KB3A 4TR3A 1E2YA 3I43A 3KCMA 3TKSC 1GRXA 3FZAA 4IQAA 13GSA 2PGTA 2AHEA 4KUNA 4WBRD 2F8AA 4JU5A 3ZFBA 3VLNA 4IQ1A 1A8LA 3QCPA 1ACVA 2O85A 4KSOA 1V9WA 4EXJA 4YH2A 5KEJA 1O8XA 1YEPA 1U3IA 2H6ZA 2WJUA 3FYGA 5IMVA 3PGTA 2X8GA 3P7XA 4OWYA 3VK9A 4F82A 2I9HA 1UN2A 4OO5A 1ZYQB 1YJ6A 2FGXA 4GSSA 1ILOA 2RUFA 2ZCTA 4GTUA 1FVKA 2P31A 1BG5A 2YZHA 3C8EA 1Z6NA 5IOXA 1EV9A 2LNTA 1ST9A 2VLUA 3GX0A 5DBQA 2RUEA 5HR0A 4HQSA 2IMIA 3KP8A 3FK8A 1R5PA 3IE3A 4XS4A 2KUCA 3TJKA 4Q5NA 2C1YA 2GQMA 5CRGA 4LMVA 3A2XA 3TDGA 2H19A 1FO5A 2ON5A 5J4UA 4POLA 3BOAA 1QQ2A 4MJEA 4AF2A 3UMAA 2LJKA 1MTCA 4DSRA 5L71A 2K8SA 1TRSA 3TJFA 3IHQA 4GSNA 2XPDA 3G7YA 3K8NA 4HDEA 3F3QA 3Q18A 1GTBA 2O8VB 1XW6A 3LWAA 2V41A 2CVKA 1TU8A 4F03A 5CRDA 3I69A 1OAZA 2K6VA 2KHPA 1TU7A 2REMA 2V6OA 5D9TA 2YJHA 4XIHA 1PSQA 4MDCA 4K0GA 2IMEA 4XRAA 2B1LA 4EKZA 5GAND 3WYWA 4JR6A 1M2DA 1PGTA 3TRXA 3LXZA 4K7NA 3RBTA 1HNCA 2TIRA 4K8MA 4OD7A 3GN3A 4LLRA 2RLIA 2A2SA 3DGQA 3TOUA 3G7IA 2HLSA 2HNLA 4JBBA 1B9XC 3KM6A 3GNJA 3S9FA 5F06A 2P0GA 1A8YA 1T00A 2FUG2 1USBA 1K0NA 5J9CA 4L8EA 4F9ZA 2PUKC 2PPTA 4NMUA 1VF1A 2DJJA 4MPGA 4NAXA 3HVXA 2C3QA 2CAIA 5FWGA 2FNOA 3C71A 4TW5A 1O7UA 3GUSA 2DLXA 4P3YB 1QMVA 4I2TA 3GTUA 1SD8A 2DBCA 3LEFA 2LTKA 1GNWA 2YN1A 2H76A 1NHYA 4MK3A 5G1LA 4Q5FA 4X0XA 2FLSA 1ZOFA 2LQOA 3CSHA 5F05A 3MNGA 3WT1A 5LCZA 3FZ9A 1BAYA 5D8IA 2AYTA 5CRHA 2PERA 1VF3A 3J7Yb 5A4WA 2H70A 5JCUA 4IHUA 2HRFA 4RQRA 2XHFA 2VAFA 5LD0A 4MP4A 1T4ZA 2LUSA 1ZMAA 4BVXA 2VLVA 1H75A 3TRQA 2VOCA 1SK1A 4KA0A 2O87A 1K0AA 2QKEA 1URMA 1MD3A 3W6GA 4PUAA 5DALA 1GSDA 2FCHA 3QAWA 1WRYA 4PQ1A 2CZ3A 1R4WA 2HE3A 3LORA 2HXKA 1EEJA 2YCDA 3VPTA 1F6MC 4K0NA 3HZ4A 4JR4A 4D73A 1ON4A 1SJZA 3J7Yk 4XS4B 2VL3A 4TXOB 3FZ5A 4WF5A 1FB6A 2YP6A 4HEA2 2CA8A 4POKA 5ECOB 3HKRA 2H0GA 3W8SA 2KOKA 3HDCA 1A0FA 1N2AA 3KD0A 3FZ4A 1F3BA 4Z7XA 1ERTA 1PMTA 3PR8A 3PH9A 4LA1A 3LYPA 4FYCA 1KNGA 3TJGA 1G6YA 3DIEA 4BVYA 3L4NA 4ECIA 3BBYA 1EOGA 4DSSB 3R2QA 1OE7A 2L5LA 5EL8A 2DJ0A 1QXHA 2AJQB 2IFQA 2DMMA 4ACSA 1FHEA 3VWVA 1Y6EA 4FYBA 3CTGA 1EWXA 3DKSA 3M0FA 1GTAA 3IK9A 1OKDA 4PGTA 3FR9A 1JZRA 3F4SA 1EZKA 3QDNA 1THXA 4L0UA 5G31A 3FHKA 5AGYA 3UBKA 1N8JA 5HFKA 3KP9A 1AIUA 4NWYA 1J08A 3KZQA 1A0RP 4IKHA 1BQ7A 2P5RA 1JZOA 2WRTA 3DRNA 1THOA 5DJMA 4ZBBA 4WR4A 2H01A 1ZL9A 2B6MA 2CVDA 4GWRA 4TR4A 2H1AA 3QPMA 3H8QA 2YWNA 3DVXA 1GP1A 1FB0A 6GSVA 3ZFLA 3KTLA 3ZMKA 2OBKA 4BWSA 3F63A 3TUEA 1JHBA 2RM6A 3VWXA 1XBSA 2O89A 4XTSA 4ECBA 3TRPA 5IMAA 3Q6OA 3GSTA 3WT2A 3D4TA 3GTUB 3HXSA 4IJIA 2R2JA 4N0ZA 4WBJA 5HR3A 1GSQA 1UA5A 2YJ7A 4LL1B 3ZITA 4QL9A 3APQA 2F8FA 2R37A 1GNEA 1NM3A 2C3TA 1XWKA 2H73A 3HY2A 2GT5A 2GT6A 3M9KA 2E2GA 2MZCA 1ERVA 1OC8A 4MF7A
chains in the Genus database with same CATH superfamily
1SENA 3GZBA 1XWBA 2WS2A 1W6CA 2YOIA 2GU1A 5INYA 1DETA 4PUFC 3F4TA 3CU3A 4K5RA 2K18A 3NHXA 4MJAA 4MH3A 3GL3A 4N11A 2AV4A 1XIYA 2Q07A 1Q864 1VQK3 2PBJA 2P38A 1TTZA 2VD1A 3VFIA 3LMLA 2GSRA 2OBIA 2R5GA 3Q19A 2LRNA 1VQ73 3MKIA 1W02A 1TW9A 3TB2A 2BMXA 5B6NA 1VQQA 4HM1B 2JADA 5CK6A 4Z2TA 3BNBA 1SKWB 2YFIB 4HM6B 2R0PA 5HOHA 2Z9SA 5CP1A 4ZL9A 1RJOA 2VIMA 4GB5A 3F3RA 1ZGNA 2JZSA 2B1KA 3LSZA 2IWTA 4AGSA 2RCDA 1T1VA 2FXTA 1BUQA 3E99A 1Q7Y4 1BVIA 4EE0A 1CH0A 1YZXA 1VQL3 3LFLA 4EDYA 3F40A 4FH8A 4MJDA 3E9JB 3FR6A 4PX1A 2CWUA 5EQLA 2E7PA 4GHOA 5J9BA 3DD3A 1NU3A 3WGDA 3FKFA 2RGQA 2ON7A 4YQUA 1TP6A 4HZBB 1VQ63 3TKSA 1DE2A 5IMZA 2CW9A 5D9XA 2CIUA 2CQ9A 3N9HA 2X8CA 1TRWA 3TGZA 3LXTA 2DJ3A 1AR0A 3O76A 4WEYA 5A5KA 3D79A 4GQFA 4HS1A 4K7OA 2JACA 4R9KA 4O8SA 1TI1A 1A2VA 1XW9A 1X1WA 5JCWA 3WGEA 3URPA 4CPKA 1OACA 2TRCP 1YIT3 4KSMA 4WXTA 1GULA 4TVEA 4KDXA 3TJBA 4YQMA 3T0UA 2R6KA 3WOFB 2PVOC 4PURA 1B4QA 1PN9A 3ZIJA 1M904 3CCV3 1ASKA 4TRXA 1AW9A 5AISA 4FO5A 5HFGA 3FZWA 1RGCA 2QSIA 3MSZA 2D42A 1I9DA 1GMQA 4MMMA 6GSYA 4GXZA 4XBYA 2C8UA 2W6JH 5LC6A 1X1UA 3G7JA 1B8XA 3CC43 3H3HA 1GS3A 1XVQA 4ID0A 2QGVA 3RHCA 1BSCA 1O85A 1W4NA 3AHSA 3LW9A 2F51A 3I553 2HMJB 5D73A 1LXEA 1OE8A 1X0RA 1O7NB 3PCRA 1BRNL 5CXOA 4MZBA 1WQLB 1V98A 2OADA 2J23A 1LVNA 2OQEC 5JCGA 4CY8A 2F4YA 1ULJB 1T4YA 3FCSB 1TOFA 2VL9A 2OE0A 1IDPA 4N6UA 3EVIA 2WO0A 1RNBA 4MLYA 5J3RA 2NVLA 1B9YC 3KH7A 4YAPA 1BRIA 3ERFA 2IY2A 5KN3A 2J9HA 5COHA 2CX0A 3HI7A 2ZL8A 3KE7A 2GTUA 3CYNA 1YHQ3 3S28A 4HKVB 4GCIA 1ULIB 2IMDA 3GKNA 2OE1A 3IV4A 1IQ8A 2A2RA 5AEUB 3FR3A 1Y25A 2A4VA 3F9SA 3H1NA 5KP4A 3KMOA 4STDA 3M3MA 3L9VA 2MMAA 3M1GA 1OCVA 1F37A 5CYYA 2H6YA 1GSFA 4HU7A 4DSQA 2UGIA 1I2GA 3KSPA 4ZBDA 2IL3A 1LU4A 1S3AA 2LJAA 2NBSA 2H74A 4GSTA 6GSPA 3Q1CA 3GHAA 3H93A 4TX4A 1B4PA 1K0MA 3Q90A 3HIGA 3QFBC 1BU4A 2NDOA 3TKSE 2HRKA 4WF4A 2P0MA 3HZPA 2YV9A 3KZTA 2VCXA 1FG4A 2EIOA 5E4WA 1OGXA 1A2LA 3IAM2 2EC4A 4V1Ag 1YJW3 4AEQA 3WGXA 1MDKA 1Q814 3F9UA 3AGNA 1A2MA 1M9BA 3KCHA 5EVHA 1T2HA 3EB8A 3GA4A 5DCHA 3F4RA 3GWRA 3F0IA 2CZ2A 4ORLA 5IIZA 3EBTA 2IMJA 3I9V2 2WGRA 4N10A 4DVCA 2LSTA 5ABRA 1OPYA 4E8HA 2HRNA 1K3LA 3NQYA 2OOVA 4BTYA 1VQP3 4K6XA 3UJMA 1JB4A 4YKGA 2SBLA 1V58A 1T3BA 2M72A 1OHOA 4FMAA 1B48A 2PMTA 1SJ6A 2HSHA 2VCTA 5AIGA 2QC7A 5AIVA 4AKZA 3QAGA 5F07A 4BL3A 4KZ1A 5D83A 1M7TA 3GKKA 3ZVJD 1TIJA 3D3LA 4MH2A 4HBRA 1BEDA 2XGLA 3N54B 5RNTA 4FCZA 1TKDB 3GX8A 5DAKA 2HMKB 2OACA 5IQYA 4QQ7A 1DMMA 5D82A 1KBNA 4BL7A 1G96A 3SYUA 3X42A 1ABAA 1V74A 2HYXA 3GSSA 1S5AA 4CDLA 4GQCA 2GZZA 1HKXA 4K1FA 2IMKA 4XBTA 3GH6A 4OFNA 2JSZA 2H1BA 3ROBA 3IXRA 2GZYA 4K61A 4HVNA 1G7OA 2HMMB 4RI7A 3B4OA 4TR1A 5G30A 1M1K4 1GOUA 3OX9A 4AKYA 3GAXA 4HJ2A 1IU7A 1RTUA 5ELGA 1M0UA 2VCQA 2IPAA 1TI3A 3A2VA 4F0BA 2DSAA 2V1MA 3HA9A 2DJ2A 2BMOB 4FR9A 2ES7A 1YDKA 2P5QA 4O5RA 3S67A 16GSA 3WHOA 4MPFA 2GQLA 2INXA 2R4IA 4R4KA 2Y73A 3CQFA 3FSDA 1KTEA 2HZEB 4EBGA 2K0MA 1IYIA 2MBSA 2VL2A 3DUKA 1IT7A 5GZZB 1WWJA 1ERWA 2KLXA 5G5FA 1KC84 3EU4A 5DQSA 3ZTLA 4MF6A 2W56A 1BNIA 2FHEA 1PN0A 3ECFA 3L9SA 3OWUA 1Q9EA 2HMLB 1K0CA 2LRTA 3MDKA 5E59A 1DBYA 5JPPA 1N9JA 4J5GA 2KP2A 2F98A 3ZG5A 3UJ1A 3DVWA 5C04A 2ZHXB 1VF4A 4XBXA 4CW9A 1O8WA 1PX6A 4OFTA 5HR2A 1XWCA 1MDIA 4HM3B 1YNVX 1UCJA 4EL1A 3ZL5A 3DZLA 3Q3FA 2GBXB 4K90B 2OCTA 2L57A 2JZTA 3QD9A 4RBNA 4H61A 1J9BA 1QVF2 2E2TA 2VM1A 4L5OA 1WPIA 1LBKA 3EC3A 1G0TA 3PYJA 2FGTA 5ID2A 3NM2A 2ML5A 1FAAA 3U1WA 1YEXA 2LKUA 2RSXA 3A5EA 3GFKA 20GSA 1L5GB 1M1XB 2WOFA 3KH9A 4MCUA 1OUNA 3HJPA 3AMOA 4O2HA 1BOXA 1AUCA 1HQOA 5JWQB 3EURA 3CBUA 5ID2B 2X8HA 3LZAA 4K2DA 2PU9C 4NV2A 3PXMA 3NQZA 4J56E 3UL5A 3L9UA 1ERUA 3NOFA 1I3IA 4ICYA 1U87A 4CHSA 3IR4A 1TK5B 1YVSA 4NV5A 3ZG0A 1RW1A 3ZZXA 3C1SA 1UGHI 2WCIA 2YWOA 2B7KA 3QOUA 3NBJA 2PN8A 1YVBI 1Z3EA 2BO9B 5LC7A 3LT9A 3IMAB 3BNEA 2H30A 2ZA4A 4L7KA 3LT8A 2M46A 1SD9A 4WR5A 3UVHA 2DIYA 4IP6A 3ZIVA 2PVQA 2CX3A 2G2QA 3HCZA 1SYRA 2VCVA 1JRQA 5HGRA 3EU3A 1NNVA 3HHVA 5ECLB 4G1MB 3DGLA 4LYLB 2L4CA 5D9VA 3NV0B 1EG9B 3V98A 2LEGA 4HQZA 1TRPA 1W89A 1SPUA 4O7HA 2KF5A 1KQS2 1EP7A 2HFDA 5J5NA 2HI7A 4XS6A 3D22A 4KFEA 1N5HA 2XRXB 3PINA 3QRDA 3GKMA 5DRVA 4ZILA 1WNHA 2HMOB 5D96A 3TKRA 4H3UA 3LTAA 2X49A 3ALAA 1E3VA 4NXIA 5DDLA 5STDA 4JF8A 4OVMA 5F0GA 2F86B 1TRVA 6GSXA 4HU9A 4PQIA 1TDIA 5HFIA 2M80A 4K2XA 1NSWA 1K9M4 4GRFA 2DJKA 2JU5A 4EUYA 4ISDA 2I81A 3GYKA 1R4CA 5CO3A 2XR8B 1TXXA 3I563 3FKAA 2H0IA 2MBTA 3MPHA 3CCS3 1ROAA 4K9ZA 4ZM8A 2FWHA 4HZ2A 3KTBA 1QJGA 4PNGA 4ECJA 3G9BA 4XDVA 4HZ4A 2F5MA 2ML6A 2KF3A 4XS1A 3W8JA 3NV0A 2K3DA 2V2GA 3ZMLA 3V1WA 4DSSA 3QAVA 1BNRA 1IYHA 3D5JA 1GMPA 1PRXA 5GSSA 1X1XA 3CSIA 5BIRA 1WMPA 2MC8A 4OFMA 4ULXA 3D4MA 3HVSA 3L0HA 3GZRA 1XWGA 2CVBA 1N9EA 1Q7HA 2VD0A 1ZYEA 5H5QA 3GMFA 1LQGC 1R26A 1Z7PA 5JPUA 4EW5A 4XHMA 1RLSA 3G6E3 2GEYA 2LV3A 4IELA 4J57E 1I8VA 2V32A 3DGNA 5ECMB 3LJRA 3US3A 2AB6A 2Z7AA 2MMOA 5GSPA 2H0HA 1YY7A 1RNTA 2SARA 1AY7A 1OYJA 4GLTA 1JLVA 2ZNMA 4CCVA 1HU9A 3B4PA 4NHFA 4JEDA 2L1SA 4N6LA 4EF0A 1O6JA 2DC5A 1JV2B 2GSPA 4G2EA 2Z6BA 4OO4A 1XWAA 3OXAA 2Z76A 1U6TA 1UI7A 4MABA 4TXVA 1EP8A 1BRGA 1V57A 4G0KA 3UARA 1GSSA 1GY6A 4GF0A 1VZZA 4D73B 1MOLA 1RK4A 1TRUA 5DJLA 1XVWA 3GH9A 5H5SA 4HM2B 1A23A 3CME3 3GURA 4HJMA 5D9WA 5G2ZA 3BIRA 3CXC2 1A2JA 2L6DA 4TOPA 4ILFA 3LYGA 2GLRA 3GL5A 2ZUPA 3X40A 1RN4A 1M9AA 2GZPA 1SJWA 1CQGA 2GGTA 3CCL3 1FGQA 1JLWA 1S3CA 3MWHA 1WIKA 4X1UA 2R4VA 3L78A 1A24A 2HRAA 4BWQA 1VQ43 2CT6A 4IBPA 4TR1B 2ALBA 2QA1A 1JBSA 4KAEA 2JL4A 2MMZA 1N8R4 4WWUC 4KGIA 1PL2A 4FMBA 1TFKA 3EC9A 3ZREA 3J7Yd 2DIZA 5JWOB 4FCJA 2FA8A 4OMVA 1W2B2 4AJ6A 4K1VA 2LNSA 3ME7A 4JRRA 3P8WA 5IMFA 2UZ8A 1KD14 3LTCA 4ECCA 3TJJA 2CHCA 4V1Ap 4BL7B 1GTUA 1B21A 1RHLA 1M3IA 4N6TA 3A3TA 5DVBA 2CV4A 5AEWB 4LMWA 3MIXA 1I0XA 2XFTA 1JZWA 5IENA 3PGBA 5ECIB 3EMXA 1HYFA 2N5BA 4MA9A 3LQ7A 3A5IA 2HZEA 2HT9A 1RCLA 2QEX3 1EGRA 4H86A 2B3SA 3HZ8A 4OK0A 2W2CA 3N8BA 3NZNA 4FQUA 4KT3B 1YF0A 3EINA 2OOVC 4Z2UA 4MZCA 1MWSA 1WOUA 2E2MA 1TK0B 3DYRA 3IC8A 4PEJA 1F9MA 4KCEA 4O5QA 3P2AA 4LEHA 1A67A 4OUQA 4HM5B 1TUHA 5ELAA 3NBBA 1O81A 1H4OA 3OWYA 4X2OA 4WHAA 3FF0A 3V92A 1BJXA 3BJ5A 2H72A 1K734 1NJI4 1FVJA 4DKIA 2YFLB 4NPBA 3C1RA 4ZB6A 1ZO2A 1VQ83 2GSSA 1U8CB 3I0YA 3WOEB 3UEMA 1TJDA 1TFOA 1RGEA 3DWVA 1EOHA 3JUMA 1S723 1X5CA 2H6XA 1BYEA 2H75A 3ZLPA 1FUTA 3QK9A 3M8NA 2IJYA 4L8OA 1U88A 5ECRB 5H5RA 3MYDA 2B1XB 3CNMA 3KN4A 3I6AA 5KN2A 4X43A 3KKGA 4FCMA 4JZQA 2Y74A 1FGMA 1M3JA 2LQVA 2W9QA 3M8CA 1SJIA 4GL6A 3EMPA 5ECSA 4EC0A 3K0ZA 2IMFA 1TK8B 3VURA 3TOTA 1BNFA 4ZL8A 1JN5A 3IPTA 4RQXA 3HIIA 9GSSA 1AXDA 2OKAA 3K7CA 3JUOA 2C80A 3FMWA 5ELJA 4V2LA 2CG1A 3K5TA 2GEXA 1DUGA 5IO2A 2Z77A 2CFKA 3G4S3 1Z5YE 2FY6A 4G0LA 1SL1B 5ELUA 3QR6A 1K28A 2FA4A 3UBLA 2NPBA 1UI8A 5IPGA 1G6WA 1C7HA 4J5KA 1E6BA 1OC9A 1XFLA 2BJXA 3EQQB 2DJ1A 3F6FA 4O5UA 5B8AA 1NDOB 3D4AA 1OKTA 2R0GA 1DSBA 2HOHA 3PPUA 2BU4A 1R5AA 3MAKA 2IIYA 2EIQA 5DALB 5IOWA 1R7HA 2VO4A 5ECNB 4AJ8A 3LG6A 2E0QA 3SX1A 5AIHA 4BVYB 1SK0A 1RN7A 3KIJA 3BU4A 4G10A 5GSTA 4YQVA 2BMQB 4BVXB 4TN8A 1PFPA 1SIIA 1SK2A 1QAKA 2W56B 2V6KA 4L0WA 1NW2A 3AY8A 4PQHA 2JQ5A 1GY5A 3F14A 3EYTA 4KDUA 2R3XA 4EXRA 3KXOA 1I70A 1LQMB 1K0OA 2D1WA 3NIVA 3M9JA 2F3MA 1SKRB 4KW6A 2F9SA 1X9WB 3CPOA 3ZRDA 2LRCA 1EGOA 4KNDA 4KH7A 1O7PB 4F2IA 2OQEA 1MDJA 1A2PA 4Q5QA 1JKGA 1YKCA 1PY3A 3BCIA 2QA2A 3VI5A 3KGKA 3F7XA 3GKXA 3KSED 1M2AA 1QMAA 3ZFZA 5KOWA 3UAPA 4N6MA 10GSA 1W01A 2GSTA 3GRDA 1X5DA 1G02A 2JDIH 1K0BA 1W4VA 2RM5A 3CCM3 3H79A 5AYSC 1O73A 2H1DA 4USSA 4J2FA 3K9MC 3DH2A 5FT3A 4POMA 1XPVA 1N8QA 1GOYA 3UOMA 4KE3A 5B8BA 1MEKA 4IGJA 4EYCA 5IW9A 2K54A 3VSYA 2CAQA 3IDVA 1LOWA 5AN1A 2F99A 4V2MA 4NHZA 2WULA 8GSSA 1LOXA 1WTHA 1HNAA 3F8XA 3RDEA 5ECKB 3FW2A 3IAS2 3FRCA 4EVMA 1AVKA 4TR0A 1RGGA 2GVPA 6GSWA 1XXUA 1BRJA 1PL1A 4G19A 2C4BA 3WDGB 1QALA 1C72A 1SARA 1BNGA 4L5LA 2G0FA 2XBQA 1N5PA 3VI7A 9RNTA 3TKQA 5EVOA 2W0QA 1DYUA 1Z6MA 2FD3A 4L8PA 1FA3A 1QUWA 2KXGA 1XOBA 3OR5A 5A4VA 3ED3A 1FOHA 2BMRB 5LNKe 5I97A 4FYUA 3GV1A 3LOYA 1K3YA 2B5YA 1DMQA 4HI7A 4J9AA 1GD3A 2H66A 2XBIA 1GYBA 1I3FA 2VCWA 3ZYWA 5GAPD 3HVVA 4MMZB 3C73A 2MYGA 2KRTA 2F5WA 3DM8A 3LXUX 1BSBA 4MNNA 1ZX2A 1OVNA 1D6YA 3KEBA 1ZGXA 1CYUA 2C0GA 1J2BA 4Q53A 2OJLA 1AQXA 3LTBA 4N6NB 1YKAA 2XSOB 2W03A 2BTOT 4BIKA 2I3YA 1XOAA 3EN8A 4XB5A 5IMCA 4MZWA 2I4AA 3CC73 3ISOA 1S3DA 3JCML 1VGLA 5EY6A 1RMSA 2C3NA 2GS3A 2PWJA 4IW9A 4LGQA 1PKWA 4OCFA 5EEOA 8RNTA 3HX8A 1X9SB 1W7CA 3E0UA 1HZ1A 5EPFA 4F0CA 1JBRA 1GH2A 4ML1A 1OH0A 2QA43 1HD2A 1VF2A 3ERWA 1ZZYA 2L6CA 1DE1A 2OE3A 2IYJA 4CDOA 1AVLA 1Z7RA 3U6VA 4IT7A 5IG0A 3DMLA 1DMNA 1UVZA 3KJYA 4RUVA 3G0KA 1K3OA 3ER7A 3D0ZA 1AC1A 1BANA 3SOAA 2LQQA 4PXOA 2H1GA 3OWSA 2AAWA 5IPHA 2O7KA 11GSA 1GSUA 4BPYA 4TXOA 4POBA 4MJCA 1VQO3 2XSHB 1VQM3 4FMDA 1KEBA 1T5YA 4KF9A 4ZB9A 4EO3A 3HD5A 1X9MB 1MNLA 1YGEA 4YKFA 2YANA 3RDWA 3RAZA 1Q824 4Q5RA 6GSUA 1DVDA 2DMLA 1ZCPA 5DAKB 2MMNA 4LL4B 1PX7A 2H8LA 4EIPA 5DQYA 3ERGA 4I2UA 3E3EA 2X99A 1YGWA 2RIIA 1ML6A 1MGWA 2CX4A 3X3YA 5JWRB 1XCCA 3DEXA 1Q40B 3H51A 1B2MA 2K9FA 1BRSA 2IN3A 1RGKA 5C00A 1SKSB 1B2UA 4IVFA 3UL3A 3Q2PA 2GDRA 1W6YA 3D6IA 1X5EA 3EX9A 3HJOA 2C0DA 3WODG 1WMJA 1QK8A 3QFAC 3D21A 2YNXA 2C4JA 1I5GA 3CXGA 5IM9A 1JZDA 2GQKA 1UUGB 1V2AA 2R41A 1O7WB 1RN1A 5BU4A 5AIXA 3JVCA 1RKYA 3CRTA 4IS0A 1GUKA 2GU3A 3FY7A 1PA3A 1YQ1A 1Z1SA 1RDSA 1SL2B 1ISKA 3IC4A 4HM0B 2L4VA 4HOJA 3RHBA 4ZB8A 3IBHA 2WB9A 4EDZA 3HJMA 5CNWA 1IVUA 4E8EA 5IMDA 1RRHA 1GSEA 3N5OA 4Z2RA 3GZYB 1BGSA 8CHOA 1U3AA 1XW5A 3EWLA 2B24B 2E2UA 1UCIA 5ECPB 1UGIA 4A5PA 3AMOB 5ECHB 2N5FA 1HNBA 3C7MA 1JN5B 1Q4JA 2WGOA 1FOVA 5D81A 5FHIA 2CWTA 1PD21 3APSA 3LGCA 1VRSD 2YV7A 1MD4A 5IO0A 1AAZA 3F6DA 2LS5A 2L4QA 4K7IA 3EE1A 2AUVA 1VQN3 1PQNA 3UVTA 3STDA 2OWPA 3BD2A 3BCKA 1JB2A 3CSJA 4FIWA 19GSA 1JB5A 2FWFA 3B8LA 3S5CA 5KOXA 5FW5A 4HM4B 2WDUA 5KN0A 4EC6A 5IEOA 4QL7A 3VPQA 3V99A 3IA1A 3ME8A 3IOSA 1FGOA 2FWGA 3BNCA 5D93A 3AGOA 1GSYA 1FGRA 1QGVA 4O3VA 2J8XB 3X3XA 3WD6A 1ZYPA 1BRKA 2WZ9A 1WMNA 3D9RA 4AJ7A 4G0IA 1K0DA 2HMNB 1RQMA 1QFNA 1GUHA 3HYPA 2OA7A 2HSYA 4LZIA 4OCEA 2VLTA 5HQPA 4I97A 2VM2A 1M2BA 3CRUA 1Q42A 3EE2A 3QMXA 3CMA3 1AQVA 1NHOA 7GSSA 1J0FA 1MGRA 2CFDA 3IPZA 1V40A 1M99A 3S29A 2FWEA 1WJKA 4KX4A 6GSTA 2WFCA 17GSA 2JZRA 3KFQC 1BNJA 2X64A 22GSA 4N3VA 4WYKB 5A0OB 2VL2C 3SBCA 5G5EA 1IK3A 1B3SA 5AIFA 4R9LA 3U97A 1UW1A 2AADA 2AAEA 1DE3A 5IG5A 2VCZA 2D2ZA 3P90A 3BNDA 1EV4A 4N0VA 1F8NA 2XC2A 5G1KA 1W5ZA 1FZUA 4XCSA 4I8BA 2L59A 4WKWA 2IA7A 3A5WA 3UB1A 1D6UA 1IYYA 1GTIA 3JUQA 2DKHA 2BHMA 2HSMA 3UIWA 1FUSA 4ZBAA 2X4AA 1T8EB 3HVNA 3PZWA 5BRTA 1YF1A 1OHPA 4MJBA 1IVXA 2XFSA 5CAXA 1XZOA 1Z9HA 4G9HA 3FH1A 4O92A 4I5QA 3UNLA 2YWMA 4X4JA 3FGYA 4MF5A 3RPPA 1RRLA 2QIYA 1UUWB 3TKPA 3VWWA 2XPEA 3KMNA 1AQWA 14GSA 2YZUA 2H71A 1F3AA 2K8VA 4J8TA 2A15A 2I9WA 1T7PB 3O3TA 4PNFA 1NO3A 3O6TA 2OTJ3 1BX9A 1TP9A 2C0EA 2NTOA 4K1UA 2RFRA 3WMDA 1GLQA 4KCAA 3SWLA 1SU9A 4ZL7A 3APOA 3IK7A 1LJRA 3HOHA 3CTFA 1W2ZA 3FEUA 3RPNA 1F2EA 4IN0A 4ZXGA 2TRXA 3L0RA 2XEPA 4TKYA 2YPMA 5ENUA 1OHSA 1JKGB 4V2NA 1UUVB 3LTDA 2O9UX 1WE0A 2EIRA 4XRDA 1ZS7A 1WP0A 2N5AA 6GSSA 1MWTA 2M7OA 1UDII 3RGRA 5AIIA 1GD4A 4DEJA 4BTXA 2CFLA 5F8BA 4NHWA 3VWUA 2XH9A 2VUPA 3NBRA 4RI6A 2PZVA 3GRXA 4N30A 1RGHA 4BA7A 3D5GA 1HYUA 3CCU3 2W9PA 1AQZA 4I6XA 1EKMA 4WETA 1MWRA 2C0FA 18GSA 1JFUA 2B5EA 4N6OB 5B6MA 1GWCA 1BSEA 6RNTA 1FW1A 2I1UA 3IHGA 4ML6A 1D6ZA 2KF4A 1GUMA 3U5RE 1PKZA 1UC7A 1E97A 1G7EA 1OC3A 4YAVA 3TCOA 1LRAA 4O02B 4JE1A 2HZFA 5IG4A 4IP1A 3IRAA 1OC9B 2GSQA 1I2FA 5G2GA 1GY7A 3CD63 12GSA 2CH9A 3GIXA 3LYKA 2KP1A 4ZIJA 3ZVJA 3A2WA 1GL8A 5A4UA 3FF2A 1EEMA 4KDYA 3DY5A 3CCQ3 3N9JA 2BNGA 7GSPA 3VF1A 5KN1A 2IFQB 4CJNA 1SQWA 7RNTA 2B7JA 3F8UA 4MMYB 1SL0B 1I2EA 5HR1A 3G8ZA 1VQ53 2L5OA 1IVVA 1SYXA 4IJ3A 5IG3A 3MSOA 2JSYA 3DXBA 3BLZA 5CREA 4HUAA 1GLPA 4XM4A 3CCE3 2B5XA 3H4KA 3CMIA 1CQHA 2UX0A 4RNTA 4O32A 5ECQB 5J41A 5B7CA 5M19A 2LJRA 3Q74A 5DCGA 1SIHA 2RBIA 5CRWA 2YWIA 4CY6A 1RGLA 2RNTA 1B27A 5KP1A 1Q98A 4KB3A 5BXQA 1E2YA 4TR3A 1GMRA 1S3RA 3I43A 2CC3A 3KCMA 3R3EA 3TKSC 1GRXA 1RGAA 3FZAA 5IEPA 4IQAA 13GSA 2PGTA 2AHEA 4KUNA 3MG3A 4WBRD 2F8AA 1NWWA 2XF3A 4JU5A 3VLNA 3ZFBA 4HYZA 1STDA 1W00A 3SOYA 2LYXA 4IQ1A 1A8LA 3QCPA 2KCDA 1ACVA 2O85A 4BIRA 1IVWA 4KSOA 1UCLA 1V9WA 4EXJA 4HSCX 4YH2A 5FGOA 5KEJA 1O8XA 3SVAA 1YEPA 1U3IA 2H6ZA 4XDWA 2WJUA 4EIQA 2OTL3 3FYGA 3PS8A 5IMVA 1PFOA 3SLUA 3PGTA 2X8GA 3P7XA 2CG0A 4OWYA 3VK9A 4F82A 2I9HA 3O8YA 1MWUA 4HOHA 1UN2A 4OO5A 1FUWA 1RSNA 2CFGA 3T8UA 1ZYQB 1YJ6A 2FGXA 4GSSA 1OF5A 1ILOA 1E3RA 2DKIA 2RUFA 2ZCTA 4GTUA 1BSDA 1FVKA 2P31A 4IPBA 1BG5A 2YZHA 3C8EA 1Z6NA 5IOXA 1EV9A 2LNTA 1ST9A 2VLUA 2E2VA 3GX0A 5DBQA 2RUEA 3CNXA 3FLJA 4GSPA 4HQSA 2IMIA 2BT3A 5HR0A 3DGOA 3KP8A 3FK8A 4BL2A 1X1YA 1RGFA 1CQSA 1BNSA 1R5PA 3G16A 3IE3A 3G713 3EBYA 4XS4A 2KUCA 5KP3A 2IUJA 3TJKA 4Q5NA 3EN1B 5AYRB 1PYLA 3SXXA 2C1YA 2GQMA 5CRGA 4LMVA 3A2XA 3TDGA 2H19A 1FO5A 2ON5A 5J4UA 2A4HA 4POLA 3BOAA 1QQ2A 4MJEA 4AF2A 3UMAA 2GXFA 2LJKA 3LH4A 1MTCA 4DSRA 2W04A 1NB5I 5L71A 4BU4A 1RCKA 2K8SA 1TRSA 1FYSA 3IHQA 3TJFA 4GSNA 2KF6A 2XPDA 1O7MB 3G7YA 1GSPA 3K8NA 4HDEA 3F3QA 1BSAA 4FMCA 1Q40A 1LNIA 3Q18A 2UUGC 2YFJB 1GTBA 4RZMA 3WA3A 2O8VB 1XW6A 1B2XA 1IQXA 3LWAA 3WR2A 2V41A 3KIIA 5BMUA 2CVKA 1IV7A 3DXOA 1TU8A 4F03A 3RNTA 1YJN3 5CRDA 3I69A 1OAZA 2K6VA 4JRFA 4EV5A 4K5SA 2KHPA 1TU7A 2REMA 2V6OA 5D9TA 2YJHA 4XIHA 1PSQA 3NX0A 1IV9A 4MDCA 3MWZA 4BTWA 3MYTA 4X2HA 2IMEA 4K0GA 5M1AA 4XRAA 3EHCA 2B1LA 4EKZA 5GAND 3WYWA 1KSIA 1LOVA 4JR6A 1IT8A 1M2DA 1PGTA 1WMOA 3TRXA 3LXZA 4K7NA 3RBTA 3DGMA 1HNCA 3EJVA 1CEWI 2TIRA 4K8MA 4OD7A 3GN3A 5DREA 4LLRA 2RLIA 4IIAA 3OW22 1FW7A 2A2SA 3DGQA 1TRQA 3FG3A 2WGQA 3TOUA 4WFOA 3G7IA 2HLSA 2HNLA 4JBBA 1B9XC 3KM6A 3GNJA 3EPTA 2CWVA 2C11A 3S9FA 5F06A 2P0GA 3WA2X 1A8YA 1T00A 2FUG2 1B20A 1QAFA 3MG2A 1USBA 4MEIA 1K0NA 2CX1A 2BIRA 1I0VA 3FG4A 5J9CA 4L8EA 4F9ZA 2PUKC 2PPTA 4NMUA 1VF1A 3K63A 4QWTA 2DJJA 4MPGA 3D5IA 4NAXA 2V1LA 4R1KA 3GZXB 3HVXA 2C3QA 2CAIA 5FWGA 3NXJA 2FNOA 3C71A 5CF1A 4TW5A 1O7UA 3GUSA 2DLXA 4HJLB 4P3YB 1QMVA 1M9GA 4I2TA 3GTUA 1SD8A 4HAAA 3NM7A 2DBCA 2P09A 3LEFA 2LTKA 1GNWA 2XGNA 2YN1A 2H76A 4LSOA 1NHYA 1O7GB 1U5OA 3MG1A 4MK3A 5G1LA 3JUNA 4Q5FA 4X0XA 2FLSA 2YX9A 1ZOFA 1BIRA 2LQOA 1O7HB 3CSHA 5F05A 2FNQA 3MNGA 3WT1A 5LCZA 4U13A 3FZ9A 1BAYA 5D8IA 2AYTA 5CRHA 2PERA 1VF3A 3J7Yb 1TTOA 5A4WA 2STDA 2H70A 2GBWB 4R80A 5JCUA 5JBSA 5M18A 4IHUA 2PNCA 2HRFA 4RQRA 2XHFA 2VAFA 3FG1A 5IF6A 5LD0A 4MP4A 1T4ZA 3DGYA 4I4KA 2LUSA 1ZMAA 4BVXA 2VLVA 1H75A 1OGZA 3TRQA 2VOCA 1SK1A 4KA0A 1T2IA 3CCR3 2O87A 1DVCA 1K0AA 4RNZA 2QKEA 3GSPA 1IQYA 1URMA 1B2ZA 1MD3A 3W6GA 4PUAA 5DALA 1GSDA 2FCHA 3QAWA 1WRYA 4PQ1A 1Y4KA 2CK3H 1UCKA 1JBTA 1YI23 2CZ3A 1R4WA 2P05A 4KVHA 2HE3A 3LORA 2IUKA 5TGNA 2HXKA 1EEJA 1W6GA 1QVG2 2YCDA 1BRHA 3VPTA 1F6MC 4K0NA 2MF7A 3HZ4A 2C10A 4JR4A 1STFI 4D73A 1ON4A 1K8A4 4WYKA 1VQ93 1SJZA 3J7Yk 2F56A 1JNQA 2VL3A 4XS4B 3DMCA 4TXOB 3FZ5A 4WF5A 5IERA 1FB6A 2YP6A 4HEA2 4KFFA 2CA8A 1B2SA 1FGTA 4POKA 5ECOB 3OV4A 4N6V0 3HKRA 1LNHA 2H0GA 3W8SA 2KOKA 3HDCA 4LMIA 3SEDA 1YIJ3 5BVBA 1A0FA 1N2AA 3B7CA 3KD0A 3FZ4A 2R0CA 1OF5B 1F3BA 4Z7XA 1ERTA 1PMTA 1TU5A 3PR8A 3PH9A 4LA1A 3LYPA 4FYCA 1KNGA 3TJGA 1ZYNA 1G6YA 3S27A 3DIEA 2CFWA 4BVYA 4RNYA 3L4NA 4HM8B 4ECIA 3BBYA 1EOGA 4DSSB 3R2QA 3CPW2 3F8HA 1XG8A 1OE7A 1A2KA 3A76A 3HK4A 2L5LA 5EL8A 2DJ0A 6STDA 1QXHA 4MMXB 4HM7B 2AJQB 1EA2A 2IFQA 2DMMA 1BNEA 4ACSA 1FHEA 3VWVA 4WP5A 1Y6EA 1A90A 4FYBA 1C54A 3PCSA 1YJ93 1JJ22 3CTGA 1EWXA 3DKSA 3M0FA 1KWIA 2O3OA 1GTAA 4HZ9B 3IK9A 1OKDA 3MHEA 4PGTA 3FR9A 3CC23 1JZRA 3F4SA 1EZKA 3QDNA 1THXA 4L0UA 5G31A 3FHKA 5AGYA 3UBKA 1N8JA 3CCJ3 5HFKA 3KP9A 1AIUA 2A2PA 4PTSA 4NWYA 1J08A 3KZQA 1A0RP 4IKHA 3IJEB 1AV4A 4KFDA 1BQ7A 1JZOA 7STDA 2P5RA 3EF8A 1THOA 2WRTA 3DRNA 5DJMA 3JUPA 4ZBBA 4WR4A 2H01A 2B6MA 1ZL9A 2CVDA 3T8NA 4GWRA 4TR4A 2H1AA 1K41A 3QPMA 3H8QA 2YWNA 3DVXA 1GP1A 1FB0A 6GSVA 3ZFLA 3KTLA 3ZMKA 1EUIC 2QGUA 1PU4A 2OBKA 4BWSA 3F63A 3TUEA 3NUVA 1JHBA 3BB9A 2RM6A 1R4YA 3X3ZA 2P0XA 3VWXA 1XBSA 2O89A 4XTSA 1GOVA 2CKFB 2WOHA 4ECBA 3RGAA 3TRPA 5IMAA 2ZDJA 3Q6OA 3GSTA 3WT2A 3D4TA 3GTUB 1CYVA 3HXSA 4IJIA 2R2JA 4N0ZA 3UL6A 4EV2A 4WBJA 5HR3A 1GSQA 3X41A 1BUJA 1UA5A 2YJ7A 3F7SA 4LL1B 3ZITA 2KAAA 4QL9A 5CLKA 5AI1A 3APQA 2F8FA 2R37A 1NB3I 1GNEA 1NM3A 1EQKA 2C3TA 1XWKA 2H73A 3HY2A 2GT5A 3VGNA 2GT6A 3M9KA 2E2GA 2MZCA 1BAOA 1ROVA 1ERVA 1OC8A 1LOYA 3AHWA 4NREA 4MF7A 5CF2A 1US1A
chains in the Genus database with same CATH topology
1SENA 1XWBA 2YOIA 2WS2A 5INYA 4PUFC 3F4TA 4K5RA 2K18A 4MJAA 4MH3A 3GL3A 4N11A 2AV4A 1XIYA 2PBJA 1TTZA 2VD1A 3VFIA 2GSRA 2OBIA 2R5GA 3Q19A 2LRNA 1TW9A 3TB2A 2BMXA 5B6NA 2JADA 4Z2TA 1SKWB 2R0PA 2Z9SA 5CP1A 4ZL9A 3F3RA 2VIMA 1ZGNA 2JZSA 2B1KA 3LSZA 2IWTA 4AGSA 1T1VA 4EE0A 1YZXA 3LFLA 4EDYA 4FH8A 3E9JB 3FR6A 4PX1A 2E7PA 5J9BA 3DD3A 3WGDA 3FKFA 2ON7A 4YQUA 3TKSA 1DE2A 5IMZA 5D9XA 2CQ9A 2X8CA 1TRWA 3TGZA 3LXTA 2DJ3A 3O76A 4WEYA 5A5KA 4GQFA 4HS1A 4K7OA 2JACA 1TI1A 1XW9A 5JCWA 3WGEA 2TRCP 4KSMA 4WXTA 1GULA 4TVEA 4KDXA 3TJBA 4YQMA 2R6KA 2PVOC 4PURA 1B4QA 1PN9A 3ZIJA 4TRXA 1AW9A 5AISA 4FO5A 5HFGA 2QSIA 3MSZA 1I9DA 4MMMA 6GSYA 4GXZA 2C8UA 3G7JA 1B8XA 1XVQA 4ID0A 2QGVA 3RHCA 1O85A 3LW9A 2F51A 5D73A 1OE8A 1X0RA 4MZBA 1V98A 2OADA 2J23A 5JCGA 4CY8A 1T4YA 1TOFA 2VL9A 2OE0A 3EVIA 4MLYA 5J3RA 2NVLA 1B9YC 3KH7A 4YAPA 3ERFA 2IY2A 5KN3A 2J9HA 5COHA 3CYNA 2GTUA 4GCIA 2IMDA 3GKNA 2OE1A 3IV4A 2A2RA 3FR3A 1Y25A 2A4VA 3H1NA 3KMOA 3M3MA 3L9VA 2MMAA 3M1GA 1F37A 5CYYA 2H6YA 1GSFA 4HU7A 4DSQA 4ZBDA 2IL3A 1LU4A 1S3AA 2LJAA 2NBSA 2H74A 4GSTA 3GHAA 3H93A 1B4PA 1K0MA 3QFBC 2NDOA 3TKSE 2HRKA 4WF4A 2YV9A 2VCXA 1FG4A 2EIOA 5E4WA 1A2LA 3IAM2 2EC4A 4V1Ag 3WGXA 1MDKA 3F9UA 1A2MA 1M9BA 3GA4A 5DCHA 3F4RA 3F0IA 2CZ2A 5IIZA 3I9V2 2WGRA 4N10A 4DVCA 2LSTA 5ABRA 4E8HA 2HRNA 1K3LA 4K6XA 4YKGA 1V58A 1T3BA 2M72A 1B48A 2PMTA 1SJ6A 2HSHA 2VCTA 2QC7A 5AIVA 3QAGA 5F07A 1M7TA 3GKKA 3ZVJD 4MH2A 1BEDA 1TKDB 3GX8A 5DAKA 2OACA 5IQYA 4QQ7A 1KBNA 4BL7A 1ABAA 2HYXA 3GSSA 4GQCA 2GZZA 4K1FA 2IMKA 3GH6A 4OFNA 2JSZA 2H1BA 3IXRA 2GZYA 1G7OA 4RI7A 4TR1A 5G30A 4HJ2A 5ELGA 1M0UA 2VCQA 2IPAA 1TI3A 3A2VA 4F0BA 2DSAA 2V1MA 3HA9A 2DJ2A 2ES7A 1YDKA 2P5QA 4O5RA 16GSA 4MPFA 2GQLA 1KTEA 2HZEB 1IYIA 2MBSA 2VL2A 5GZZB 1WWJA 1ERWA 2KLXA 5G5FA 3EU4A 5DQSA 3ZTLA 4MF6A 2FHEA 1PN0A 3L9SA 2LRTA 1K0CA 3MDKA 5E59A 1DBYA 2KP2A 3UJ1A 3DVWA 5C04A 1VF4A 4CW9A 1O8WA 1PX6A 4OFTA 5HR2A 1XWCA 1MDIA 4EL1A 3ZL5A 2L57A 2JZTA 3QD9A 1J9BA 2VM1A 4L5OA 1WPIA 1LBKA 3EC3A 1G0TA 5ID2A 1FAAA 1YEXA 2LKUA 3GFKA 20GSA 3KH9A 4MCUA 3HJPA 1HQOA 1AUCA 5JWQB 3EURA 3CBUA 5ID2B 2X8HA 4K2DA 2PU9C 4NV2A 4J56E 3L9UA 1ERUA 3NOFA 4ICYA 1U87A 4CHSA 3IR4A 1TK5B 4NV5A 1RW1A 3ZZXA 3C1SA 2WCIA 2YWOA 2B7KA 3QOUA 2PN8A 1Z3EA 2H30A 2M46A 1SD9A 4WR5A 3UVHA 2DIYA 4IP6A 3ZIVA 2PVQA 2CX3A 2G2QA 3HCZA 1SYRA 2VCVA 3EU3A 3HHVA 5ECLB 2L4CA 5D9VA 2LEGA 4HQZA 1W89A 4O7HA 1EP7A 2HFDA 5J5NA 2HI7A 4XS6A 3D22A 3PINA 3GKMA 4ZILA 5D96A 3TKRA 2X49A 4NXIA 5DDLA 5F0GA 6GSXA 1TRVA 4HU9A 4PQIA 1TDIA 5HFIA 2M80A 4K2XA 1NSWA 4GRFA 2DJKA 2JU5A 4EUYA 4ISDA 2I81A 3GYKA 5CO3A 1TXXA 2H0IA 2MBTA 4K9ZA 2FWHA 4HZ2A 3KTBA 4PNGA 4ECJA 3G9BA 4HZ4A 4XS1A 3W8JA 2V2GA 3ZMLA 3V1WA 4DSSA 3QAVA 3D5JA 1IYHA 1PRXA 5GSSA 3CSIA 4ULXA 4OFMA 3D4MA 3HVSA 3L0HA 1XWGA 2CVBA 2VD0A 1ZYEA 5H5QA 3GMFA 1R26A 1Z7PA 4XHMA 2LV3A 4IELA 4J57E 2V32A 5ECMB 3LJRA 3US3A 2AB6A 2MMOA 2H0HA 1YY7A 4GLTA 1OYJA 1JLVA 2ZNMA 4JEDA 4EF0A 1O6JA 2DC5A 4G2EA 4OO4A 1XWAA 1U6TA 4MABA 4TXVA 1EP8A 1V57A 4G0KA 3UARA 1GSSA 4GF0A 4D73B 1RK4A 5DJLA 1TRUA 5H5SA 1XVWA 3GH9A 1A23A 3GURA 4HJMA 5D9WA 5G2ZA 1A2JA 2L6DA 4TOPA 4ILFA 2GLRA 3GL5A 2ZUPA 1M9AA 2GZPA 1CQGA 2GGTA 1JLWA 1S3CA 3MWHA 1WIKA 4X1UA 2R4VA 3L78A 1A24A 2HRAA 4BWQA 2CT6A 4IBPA 4TR1B 2ALBA 2QA1A 4KAEA 2JL4A 2MMZA 4KGIA 1PL2A 3ZREA 2DIZA 5JWOB 2FA8A 4OMVA 4AJ6A 2LNSA 3ME7A 4JRRA 3P8WA 5IMFA 2UZ8A 4ECCA 3TJJA 4V1Ap 4BL7B 1GTUA 3A3TA 5DVBA 2CV4A 4LMWA 3MIXA 1JZWA 5ECIB 3EMXA 2N5BA 4MA9A 3LQ7A 3A5IA 2HZEA 2HT9A 1EGRA 4H86A 2B3SA 3HZ8A 3NZNA 4FQUA 1YF0A 3EINA 4Z2UA 4MZCA 1WOUA 2E2MA 1TK0B 3DYRA 3IC8A 1F9MA 4KCEA 4O5QA 3P2AA 5ELAA 1O81A 1H4OA 1BJXA 3BJ5A 2H72A 1FVJA 3C1RA 4NPBA 4ZB6A 2GSSA 3UEMA 1TJDA 3DWVA 1EOHA 1X5CA 2H6XA 1BYEA 2H75A 3ZLPA 3M8NA 2IJYA 1U88A 5ECRB 5H5RA 3MYDA 3I6AA 5KN2A 4X43A 4JZQA 1SJIA 3EMPA 5ECSA 4EC0A 2IMFA 1TK8B 3VURA 3TOTA 4ZL8A 4RQXA 9GSSA 1AXDA 2OKAA 2C80A 3FMWA 4V2LA 1DUGA 5IO2A 1Z5YE 4G0LA 2FY6A 1SL1B 3QR6A 2FA4A 3UBLA 2NPBA 5IPGA 1G6WA 1E6BA 1OC9A 1XFLA 2BJXA 3F6FA 2DJ1A 4O5UA 5B8AA 1OKTA 2R0GA 1DSBA 3PPUA 1R5AA 3MAKA 2IIYA 2EIQA 5DALB 5IOWA 1R7HA 2VO4A 5ECNB 4AJ8A 3LG6A 2E0QA 4BVYB 1SK0A 3KIJA 4G10A 5GSTA 4YQVA 4BVXB 4TN8A 1SK2A 4L0WA 2V6KA 1NW2A 3AY8A 4PQHA 3EYTA 4KDUA 2R3XA 3KXOA 1K0OA 3NIVA 3M9JA 2F3MA 1SKRB 4KW6A 2F9SA 1X9WB 3ZRDA 2LRCA 1EGOA 4KNDA 4KH7A 4F2IA 1MDJA 4Q5QA 1YKCA 3BCIA 2QA2A 3VI5A 3KGKA 3GKXA 1M2AA 5KOWA 3UAPA 10GSA 2GSTA 1X5DA 1K0BA 1W4VA 2RM5A 3H79A 1O73A 2H1DA 4USSA 4J2FA 5FT3A 4POMA 1XPVA 3UOMA 4KE3A 5B8BA 1MEKA 4IGJA 2CAQA 3IDVA 5AN1A 4V2MA 4NHZA 2WULA 8GSSA 1HNAA 5ECKB 3FW2A 3IAS2 3FRCA 4EVMA 4TR0A 2GVPA 6GSWA 1XXUA 4G19A 1PL1A 1C72A 4L5LA 2G0FA 2XBQA 3VI7A 3TKQA 5EVOA 1Z6MA 2FD3A 1QUWA 1XOBA 3OR5A 5A4VA 3ED3A 1FOHA 5LNKe 4FYUA 3GV1A 1K3YA 2B5YA 4HI7A 2H66A 2XBIA 2VCWA 3ZYWA 5GAPD 3HVVA 3C73A 2MYGA 4MNNA 1OVNA 3KEBA 2C0GA 2OJLA 1AQXA 1YKAA 2BTOT 2I3YA 1XOAA 5IMCA 4MZWA 2I4AA 3ISOA 1S3DA 3JCML 1VGLA 5EY6A 2C3NA 2GS3A 2PWJA 4IW9A 1PKWA 4OCFA 1X9SB 3E0UA 5EPFA 4F0CA 1GH2A 4ML1A 1HD2A 1VF2A 3ERWA 1ZZYA 2L6CA 1DE1A 2OE3A 2IYJA 4CDOA 1Z7RA 3U6VA 3DMLA 3KJYA 1UVZA 4RUVA 1K3OA 3D0ZA 1AC1A 2LQQA 4PXOA 2H1GA 2AAWA 5IPHA 2O7KA 11GSA 1GSUA 4BPYA 4TXOA 4POBA 4MJCA 1KEBA 4ZB9A 4KF9A 4EO3A 3HD5A 1X9MB 4YKFA 2YANA 3RDWA 3RAZA 4Q5RA 6GSUA 2DMLA 1ZCPA 5DAKB 2MMNA 4LL4B 1PX7A 2H8LA 4EIPA 5DQYA 3ERGA 4I2UA 3E3EA 2X99A 2RIIA 1ML6A 2CX4A 5JWRB 1XCCA 3DEXA 2K9FA 2IN3A 5C00A 1SKSB 4IVFA 3UL3A 2GDRA 3D6IA 1X5EA 3HJOA 2C0DA 1WMJA 1QK8A 3QFAC 3D21A 2YNXA 2C4JA 1I5GA 3CXGA 5IM9A 1JZDA 2GQKA 1V2AA 5AIXA 3CRTA 4IS0A 1GUKA 3FY7A 1PA3A 1YQ1A 1SL2B 3IC4A 4HOJA 3RHBA 4ZB8A 3IBHA 2WB9A 4EDZA 3HJMA 5CNWA 4E8EA 5IMDA 1GSEA 3N5OA 4Z2RA 1U3AA 1XW5A 3EWLA 5ECPB 4A5PA 5ECHB 2N5FA 1HNBA 3C7MA 1Q4JA 1FOVA 5FHIA 1PD21 3APSA 3LGCA 1VRSD 2YV7A 1MD4A 5IO0A 1AAZA 3F6DA 2LS5A 2L4QA 4K7IA 2AUVA 1PQNA 3UVTA 3BD2A 3BCKA 3CSJA 4FIWA 19GSA 2FWFA 5KOXA 2WDUA 5KN0A 4QL7A 3VPQA 3IA1A 3ME8A 3IOSA 2FWGA 5D93A 1GSYA 1QGVA 3WD6A 1ZYPA 2WZ9A 4AJ7A 4G0IA 1K0DA 1RQMA 1QFNA 1GUHA 3HYPA 2OA7A 2HSYA 4OCEA 2VLTA 5HQPA 4I97A 2VM2A 1M2BA 3CRUA 3EE2A 3QMXA 1AQVA 1NHOA 7GSSA 1J0FA 3IPZA 1V40A 1M99A 2FWEA 1WJKA 4KX4A 6GSTA 2WFCA 17GSA 2JZRA 2X64A 22GSA 2VL2C 3SBCA 5G5EA 2VCZA 2D2ZA 3P90A 1EV4A 4N0VA 2XC2A 5G1KA 4XCSA 4I8BA 2L59A 4WKWA 3A5WA 1GTIA 2DKHA 2HSMA 3UIWA 4ZBAA 2X4AA 1T8EB 5BRTA 1YF1A 4MJBA 5CAXA 1XZOA 1Z9HA 4G9HA 4O92A 4I5QA 2YWMA 4X4JA 4MF5A 3RPPA 3TKPA 3VWWA 2XPEA 3KMNA 1AQWA 14GSA 2YZUA 2H71A 1F3AA 2K8VA 1T7PB 3O3TA 4PNFA 3O6TA 1BX9A 1TP9A 2C0EA 2NTOA 1GLQA 4KCAA 3SWLA 1SU9A 4ZL7A 3APOA 3IK7A 1LJRA 3CTFA 3FEUA 3RPNA 1F2EA 4IN0A 4ZXGA 2TRXA 4TKYA 2YPMA 5ENUA 4V2NA 1WE0A 2EIRA 4XRDA 1WP0A 2N5AA 6GSSA 4DEJA 5F8BA 4NHWA 3VWUA 2VUPA 4RI6A 3GRXA 4N30A 4BA7A 1HYUA 4WETA 4I6XA 2C0FA 18GSA 1JFUA 2B5EA 5B6MA 1GWCA 1FW1A 2I1UA 3IHGA 4ML6A 1GUMA 3U5RE 1G7EA 1PKZA 1UC7A 1OC3A 3TCOA 4YAVA 4JE1A 2HZFA 4IP1A 3IRAA 1OC9B 2GSQA 12GSA 3GIXA 3LYKA 2KP1A 4ZIJA 3ZVJA 3A2WA 1GL8A 5A4UA 1EEMA 4KDYA 3N9JA 5KN1A 2IFQB 2B7JA 3F8UA 1SL0B 5HR1A 2L5OA 1SYXA 4IJ3A 2JSYA 3DXBA 5CREA 4HUAA 1GLPA 2B5XA 3H4KA 3CMIA 1CQHA 4O32A 5ECQB 5J41A 5B7CA 2LJRA 3Q74A 5DCGA 5CRWA 2YWIA 4CY6A 1Q98A 4KB3A 4TR3A 1E2YA 3I43A 3KCMA 3R3EA 3TKSC 1GRXA 3FZAA 4IQAA 13GSA 2PGTA 2AHEA 4KUNA 4WBRD 2F8AA 4JU5A 3VLNA 3ZFBA 4IQ1A 1A8LA 3QCPA 1ACVA 2O85A 4KSOA 1V9WA 4EXJA 4YH2A 5KEJA 1O8XA 1YEPA 1U3IA 2H6ZA 2WJUA 4EIQA 3FYGA 5IMVA 3PGTA 2X8GA 3P7XA 4OWYA 3VK9A 4F82A 2I9HA 1UN2A 4OO5A 1ZYQB 1YJ6A 2FGXA 4GSSA 1ILOA 2DKIA 2RUFA 2ZCTA 4GTUA 1FVKA 2P31A 1BG5A 2YZHA 3C8EA 1Z6NA 5IOXA 1EV9A 2LNTA 1ST9A 2VLUA 3GX0A 5DBQA 2RUEA 5HR0A 4HQSA 2IMIA 3KP8A 3FK8A 1R5PA 3IE3A 4XS4A 2KUCA 3TJKA 4Q5NA 2C1YA 2GQMA 5CRGA 4LMVA 3A2XA 3TDGA 2H19A 1FO5A 2ON5A 5J4UA 2A4HA 4POLA 3BOAA 1QQ2A 4MJEA 4AF2A 3UMAA 2LJKA 1MTCA 4DSRA 5L71A 2K8SA 1TRSA 3TJFA 3IHQA 4GSNA 2XPDA 3G7YA 3K8NA 4HDEA 3F3QA 3Q18A 1GTBA 2O8VB 1XW6A 3LWAA 2V41A 5BMUA 2CVKA 1TU8A 4F03A 5CRDA 3I69A 1OAZA 2K6VA 4K5SA 2KHPA 1TU7A 2REMA 2V6OA 5D9TA 2YJHA 4XIHA 1PSQA 4MDCA 4K0GA 2IMEA 4XRAA 2B1LA 4EKZA 5GAND 3WYWA 4JR6A 1M2DA 1PGTA 3TRXA 3LXZA 4K7NA 3RBTA 1HNCA 2TIRA 4K8MA 4OD7A 3GN3A 4LLRA 2RLIA 2A2SA 3DGQA 3TOUA 3G7IA 2HLSA 2HNLA 4JBBA 1B9XC 3KM6A 3GNJA 3EPTA 3S9FA 5F06A 2P0GA 1A8YA 1T00A 2FUG2 1USBA 1K0NA 5J9CA 4L8EA 4F9ZA 2PUKC 2PPTA 4NMUA 1VF1A 2DJJA 4MPGA 4NAXA 3HVXA 2C3QA 2CAIA 5FWGA 2FNOA 3C71A 4TW5A 1O7UA 3GUSA 2DLXA 4P3YB 1QMVA 4I2TA 3GTUA 1SD8A 2DBCA 3LEFA 2LTKA 1GNWA 2YN1A 2H76A 1NHYA 4MK3A 5G1LA 4Q5FA 4X0XA 2FLSA 1ZOFA 2LQOA 3CSHA 5F05A 3MNGA 3WT1A 5LCZA 3FZ9A 1BAYA 5D8IA 2AYTA 5CRHA 2PERA 1VF3A 3J7Yb 5A4WA 2H70A 5JCUA 4IHUA 2HRFA 4RQRA 2XHFA 2VAFA 5LD0A 4MP4A 1T4ZA 2LUSA 1ZMAA 4BVXA 2VLVA 1H75A 3TRQA 2VOCA 1SK1A 4KA0A 2O87A 1K0AA 2QKEA 1URMA 1MD3A 3W6GA 4PUAA 5DALA 1GSDA 2FCHA 3QAWA 1WRYA 4PQ1A 2CZ3A 1R4WA 2HE3A 3LORA 2HXKA 1EEJA 2YCDA 3VPTA 1F6MC 4K0NA 3HZ4A 4JR4A 4D73A 1ON4A 1SJZA 3J7Yk 4XS4B 2VL3A 4TXOB 3FZ5A 4WF5A 1FB6A 2YP6A 4HEA2 2CA8A 4POKA 5ECOB 3HKRA 2H0GA 3W8SA 2KOKA 3HDCA 1A0FA 1N2AA 3KD0A 3FZ4A 2R0CA 1F3BA 4Z7XA 1ERTA 1PMTA 3PR8A 3PH9A 4LA1A 3LYPA 3TJGA 4FYCA 1KNGA 1ZYNA 1G6YA 3DIEA 4BVYA 3L4NA 4ECIA 3BBYA 1EOGA 4DSSB 3R2QA 1OE7A 2L5LA 5EL8A 2DJ0A 1QXHA 2AJQB 2IFQA 2DMMA 4ACSA 1FHEA 3VWVA 1Y6EA 4FYBA 3CTGA 1EWXA 3DKSA 3M0FA 1GTAA 3IK9A 1OKDA 4PGTA 3FR9A 1JZRA 3F4SA 1EZKA 3QDNA 1THXA 4L0UA 5G31A 3FHKA 5AGYA 3UBKA 1N8JA 5HFKA 3KP9A 1AIUA 2A2PA 4PTSA 4NWYA 1J08A 3KZQA 1A0RP 4IKHA 1BQ7A 2P5RA 1JZOA 2WRTA 3DRNA 1THOA 5DJMA 4ZBBA 4WR4A 2H01A 1ZL9A 2B6MA 2CVDA 4GWRA 4TR4A 2H1AA 3QPMA 3H8QA 2YWNA 3DVXA 1GP1A 1FB0A 6GSVA 3ZFLA 3KTLA 3ZMKA 2OBKA 4BWSA 3F63A 3TUEA 1JHBA 2RM6A 3VWXA 1XBSA 2O89A 4XTSA 4ECBA 3TRPA 5IMAA 3Q6OA 3GSTA 3WT2A 3D4TA 3GTUB 3HXSA 4IJIA 2R2JA 4N0ZA 4WBJA 5HR3A 1GSQA 1UA5A 2YJ7A 4LL1B 3ZITA 4QL9A 3APQA 2F8FA 2R37A 1GNEA 1NM3A 2C3TA 1XWKA 2H73A 3HY2A 2GT5A 2GT6A 3M9KA 2E2GA 2MZCA 1ERVA 1OC8A 4MF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SEN A;  1XWB A;  2YOI A;  2WS2 A;  5INY A;  4PUF C;  3F4T A;  2K18 A;  4MJA A;  4MH3 A;  3GL3 A;  4N11 A;  2AV4 A;  1XIY A;  2PBJ A;  1TTZ A;  2VD1 A;  3VFI A;  2GSR A;  2OBI A;  2R5G A;  3Q19 A;  2LRN A;  1TW9 A;  3TB2 A;  2BMX A;  5B6N A;  2JAD A;  1SKW B;  2Z9S A;  5CP1 A;  4ZL9 A;  3F3R A;  2VIM A;  1ZGN A;  2JZS A;  2B1K A;  3LSZ A;  2IWT A;  4AGS A;  1T1V A;  4EE0 A;  1YZX A;  3LFL A;  4EDY A;  4FH8 A;  3E9J B;  3FR6 A;  4PX1 A;  2E7P A;  5J9B A;  3DD3 A;  3WGD A;  3FKF A;  2ON7 A;  4YQU A;  3TKS A;  1DE2 A;  5IMZ A;  5D9X A;  2CQ9 A;  2X8C A;  1TRW A;  3TGZ A;  3LXT A;  2DJ3 A;  3O76 A;  4WEY A;  5A5K A;  4GQF A;  4HS1 A;  4K7O A;  2JAC A;  1TI1 A;  1XW9 A;  5JCW A;  3WGE A;  2TRC P;  4KSM A;  4WXT A;  1GUL A;  4TVE A;  4KDX A;  3TJB A;  4YQM A;  2R6K A;  2PVO C;  4PUR A;  1B4Q A;  1PN9 A;  3ZIJ A;  4TRX A;  1AW9 A;  5AIS A;  4FO5 A;  5HFG A;  2QSI A;  3MSZ A;  1I9D A;  4MMM A;  6GSY A;  4GXZ A;  2C8U A;  3G7J A;  1B8X A;  1XVQ A;  4ID0 A;  2QGV A;  3RHC A;  1O85 A;  2F51 A;  5D73 A;  1OE8 A;  1X0R A;  4MZB A;  1V98 A;  2OAD A;  2J23 A;  5JCG A;  1T4Y A;  1TOF A;  2VL9 A;  2OE0 A;  3EVI A;  4MLY A;  5J3R A;  2NVL A;  1B9Y C;  3KH7 A;  4YAP A;  3ERF A;  2IY2 A;  5KN3 A;  2J9H A;  5COH A;  3CYN A;  2GTU A;  4GCI A;  2IMD A;  3GKN A;  2OE1 A;  3IV4 A;  2A2R A;  3FR3 A;  1Y25 A;  2A4V A;  3H1N A;  3KMO A;  3M3M A;  3L9V A;  2MMA A;  3M1G A;  1F37 A;  5CYY A;  2H6Y A;  1GSF A;  4HU7 A;  4DSQ A;  4ZBD A;  2IL3 A;  1LU4 A;  1S3A A;  2LJA A;  2NBS A;  2H74 A;  4GST A;  3GHA A;  3H93 A;  1B4P A;  1K0M A;  3QFB C;  2NDO A;  3TKS E;  4WF4 A;  2YV9 A;  2VCX A;  1FG4 A;  2EIO A;  5E4W A;  1A2L A;  3IAM 2;  2EC4 A;  4V1A g;  3WGX A;  1MDK A;  3F9U A;  1A2M A;  1M9B A;  3GA4 A;  5DCH A;  3F4R A;  3F0I A;  2CZ2 A;  5IIZ A;  3I9V 2;  2WGR A;  4N10 A;  4DVC A;  2LST A;  5ABR A;  4E8H A;  2HRN A;  1K3L A;  4K6X A;  1V58 A;  1T3B A;  2M72 A;  1B48 A;  2PMT A;  1SJ6 A;  2HSH A;  2VCT A;  2QC7 A;  5AIV A;  3QAG A;  5F07 A;  1M7T A;  3GKK A;  3ZVJ D;  4MH2 A;  1BED A;  1TKD B;  3GX8 A;  5DAK A;  2OAC A;  5IQY A;  4QQ7 A;  1KBN A;  4BL7 A;  1ABA A;  2HYX A;  3GSS A;  4GQC A;  2GZZ A;  4K1F A;  2IMK A;  3GH6 A;  4OFN A;  2JSZ A;  2H1B A;  3IXR A;  2GZY A;  1G7O A;  4RI7 A;  4TR1 A;  5G30 A;  4HJ2 A;  5ELG A;  1M0U A;  2VCQ A;  2IPA A;  1TI3 A;  3A2V A;  4F0B A;  2DSA A;  2V1M A;  3HA9 A;  2DJ2 A;  2ES7 A;  1YDK A;  2P5Q A;  4O5R A;  16GS A;  4MPF A;  2GQL A;  1KTE A;  2HZE B;  1IYI A;  2MBS A;  2VL2 A;  5GZZ B;  1WWJ A;  1ERW A;  2KLX A;  5G5F A;  3EU4 A;  5DQS A;  3ZTL A;  4MF6 A;  2FHE A;  3L9S A;  2LRT A;  1K0C A;  3MDK A;  5E59 A;  1DBY A;  2KP2 A;  3UJ1 A;  3DVW A;  5C04 A;  1VF4 A;  4CW9 A;  1O8W A;  1PX6 A;  4OFT A;  5HR2 A;  1XWC A;  1MDI A;  4EL1 A;  3ZL5 A;  2L57 A;  2JZT A;  3QD9 A;  1J9B A;  2VM1 A;  4L5O A;  1WPI A;  1LBK A;  3EC3 A;  1G0T A;  5ID2 A;  1FAA A;  1YEX A;  2LKU A;  3GFK A;  20GS A;  3KH9 A;  4MCU A;  3HJP A;  1HQO A;  1AUC A;  5JWQ B;  3EUR A;  3CBU A;  5ID2 B;  2X8H A;  4K2D A;  2PU9 C;  4NV2 A;  4J56 E;  3L9U A;  1ERU A;  3NOF A;  1U87 A;  4CHS A;  3IR4 A;  1TK5 B;  4NV5 A;  1RW1 A;  3ZZX A;  3C1S A;  2WCI A;  2YWO A;  2B7K A;  3QOU A;  2PN8 A;  1Z3E A;  2H30 A;  2M46 A;  1SD9 A;  4WR5 A;  3UVH A;  2DIY A;  4IP6 A;  3ZIV A;  2PVQ A;  2CX3 A;  2G2Q A;  3HCZ A;  1SYR A;  2VCV A;  3EU3 A;  3HHV A;  5ECL B;  2L4C A;  5D9V A;  2LEG A;  4HQZ A;  1W89 A;  4O7H A;  1EP7 A;  2HFD A;  5J5N A;  2HI7 A;  4XS6 A;  3D22 A;  3PIN A;  3GKM A;  4ZIL A;  5D96 A;  3TKR A;  4NXI A;  5DDL A;  5F0G A;  6GSX A;  1TRV A;  4HU9 A;  4PQI A;  1TDI A;  5HFI A;  2M80 A;  1NSW A;  4GRF A;  2DJK A;  2JU5 A;  4EUY A;  4ISD A;  2I81 A;  3GYK A;  5CO3 A;  1TXX A;  2H0I A;  2MBT A;  4K9Z A;  2FWH A;  4HZ2 A;  3KTB A;  4PNG A;  4ECJ A;  3G9B A;  4HZ4 A;  4XS1 A;  3W8J A;  2V2G A;  3ZML A;  3V1W A;  4DSS A;  3QAV A;  3D5J A;  1IYH A;  1PRX A;  5GSS A;  3CSI A;  4ULX A;  4OFM A;  3D4M A;  3HVS A;  3L0H A;  1XWG A;  2CVB A;  2VD0 A;  1ZYE A;  5H5Q A;  3GMF A;  1R26 A;  1Z7P A;  4XHM A;  2LV3 A;  4IEL A;  4J57 E;  2V32 A;  5ECM B;  3LJR A;  3US3 A;  2AB6 A;  2MMO A;  2H0H A;  1YY7 A;  4GLT A;  1OYJ A;  1JLV A;  2ZNM A;  4JED A;  4EF0 A;  1O6J A;  2DC5 A;  4G2E A;  4OO4 A;  1XWA A;  1U6T A;  4MAB A;  4TXV A;  1EP8 A;  1V57 A;  3UAR A;  1GSS A;  4GF0 A;  4D73 B;  1RK4 A;  5DJL A;  1TRU A;  5H5S A;  1XVW A;  3GH9 A;  1A23 A;  3GUR A;  4HJM A;  5D9W A;  5G2Z A;  1A2J A;  2L6D A;  4TOP A;  4ILF A;  2GLR A;  3GL5 A;  2ZUP A;  1M9A A;  2GZP A;  1CQG A;  2GGT A;  1JLW A;  1S3C A;  3MWH A;  1WIK A;  4X1U A;  2R4V A;  3L78 A;  1A24 A;  4BWQ A;  2CT6 A;  4IBP A;  4TR1 B;  2ALB A;  4KAE A;  2JL4 A;  2MMZ A;  4KGI A;  1PL2 A;  3ZRE A;  2DIZ A;  5JWO B;  2FA8 A;  4OMV A;  4AJ6 A;  2LNS A;  3ME7 A;  4JRR A;  3P8W A;  5IMF A;  4ECC A;  3TJJ A;  4V1A p;  1GTU A;  3A3T A;  5DVB A;  2CV4 A;  4LMW A;  1JZW A;  5ECI B;  3EMX A;  2N5B A;  4MA9 A;  3LQ7 A;  2HZE A;  2HT9 A;  1EGR A;  4H86 A;  2B3S A;  3HZ8 A;  3NZN A;  1YF0 A;  3EIN A;  4MZC A;  1WOU A;  2E2M A;  1TK0 B;  3DYR A;  1F9M A;  4KCE A;  3P2A A;  5ELA A;  1O81 A;  1H4O A;  1BJX A;  3BJ5 A;  2H72 A;  1FVJ A;  3C1R A;  4NPB A;  4ZB6 A;  2GSS A;  3UEM A;  1TJD A;  3DWV A;  1EOH A;  1X5C A;  2H6X A;  1BYE A;  2H75 A;  3ZLP A;  3M8N A;  2IJY A;  1U88 A;  5ECR B;  5H5R A;  3I6A A;  5KN2 A;  4X43 A;  4JZQ A;  1SJI A;  3EMP A;  5ECS A;  4EC0 A;  2IMF A;  1TK8 B;  3VUR A;  3TOT A;  4ZL8 A;  4RQX A;  9GSS A;  1AXD A;  2OKA A;  2C80 A;  4V2L A;  1DUG A;  5IO2 A;  1Z5Y E;  2FY6 A;  1SL1 B;  3QR6 A;  2FA4 A;  3UBL A;  2NPB A;  5IPG A;  1G6W A;  1E6B A;  1OC9 A;  1XFL A;  2BJX A;  3F6F A;  2DJ1 A;  5B8A A;  1OKT A;  1DSB A;  1R5A A;  3MAK A;  2IIY A;  2EIQ A;  5DAL B;  5IOW A;  1R7H A;  2VO4 A;  5ECN B;  4AJ8 A;  3LG6 A;  2E0Q A;  1SK0 A;  3KIJ A;  4G10 A;  5GST A;  4YQV A;  4TN8 A;  1SK2 A;  4L0W A;  2V6K A;  1NW2 A;  3AY8 A;  4PQH A;  3EYT A;  4KDU A;  2R3X A;  3KXO A;  1K0O A;  3NIV A;  3M9J A;  2F3M A;  1SKR B;  4KW6 A;  2F9S A;  1X9W B;  3ZRD A;  2LRC A;  1EGO A;  4KND A;  4KH7 A;  4F2I A;  1MDJ A;  4Q5Q A;  1YKC A;  3BCI A;  3VI5 A;  3KGK A;  3GKX A;  1M2A A;  3UAP A;  10GS A;  2GST A;  1X5D A;  1K0B A;  1W4V A;  2RM5 A;  3H79 A;  1O73 A;  2H1D A;  4J2F A;  5FT3 A;  4POM A;  1XPV A;  3UOM A;  4KE3 A;  5B8B A;  1MEK A;  4IGJ A;  2CAQ A;  3IDV A;  5AN1 A;  4V2M A;  4NHZ A;  2WUL A;  8GSS A;  1HNA A;  5ECK B;  3FW2 A;  3IAS 2;  3FRC A;  4EVM A;  4TR0 A;  2GVP A;  6GSW A;  1XXU A;  4G19 A;  1PL1 A;  1C72 A;  4L5L A;  2G0F A;  2XBQ A;  3VI7 A;  3TKQ A;  5EVO A;  1Z6M A;  2FD3 A;  1QUW A;  1XOB A;  3OR5 A;  5A4V A;  3ED3 A;  5LNK e;  4FYU A;  3GV1 A;  1K3Y A;  2B5Y A;  4HI7 A;  2H66 A;  2XBI A;  2VCW A;  3ZYW A;  5GAP D;  3HVV A;  3C73 A;  2MYG A;  1OVN A;  3KEB A;  2C0G A;  2OJL A;  1AQX A;  1YKA A;  2BTO T;  2I3Y A;  1XOA A;  5IMC A;  4MZW A;  2I4A A;  3ISO A;  1S3D A;  3JCM L;  1VGL A;  5EY6 A;  2C3N A;  2GS3 A;  2PWJ A;  4IW9 A;  1PKW A;  4OCF A;  1X9S B;  3E0U A;  5EPF A;  4F0C A;  1GH2 A;  4ML1 A;  1HD2 A;  1VF2 A;  3ERW A;  1ZZY A;  2L6C A;  1DE1 A;  2OE3 A;  2IYJ A;  4CDO A;  1Z7R A;  3U6V A;  3DML A;  3KJY A;  1UVZ A;  4RUV A;  1K3O A;  3D0Z A;  1AC1 A;  2LQQ A;  4PXO A;  2H1G A;  2AAW A;  5IPH A;  2O7K A;  11GS A;  1GSU A;  4BPY A;  4TXO A;  4POB A;  4MJC A;  1KEB A;  4ZB9 A;  4EO3 A;  3HD5 A;  1X9M B;  2YAN A;  3RDW A;  3RAZ A;  4Q5R A;  6GSU A;  2DML A;  1ZCP A;  5DAK B;  2MMN A;  4LL4 B;  1PX7 A;  2H8L A;  5DQY A;  3ERG A;  4I2U A;  3E3E A;  2X99 A;  2RII A;  1ML6 A;  2CX4 A;  5JWR B;  1XCC A;  3DEX A;  2K9F A;  2IN3 A;  5C00 A;  1SKS B;  4IVF A;  3UL3 A;  2GDR A;  3D6I A;  1X5E A;  3HJO A;  2C0D A;  1WMJ A;  1QK8 A;  3QFA C;  3D21 A;  2YNX A;  2C4J A;  1I5G A;  3CXG A;  5IM9 A;  1JZD A;  2GQK A;  1V2A A;  5AIX A;  3CRT A;  4IS0 A;  1GUK A;  3FY7 A;  1PA3 A;  1YQ1 A;  1SL2 B;  3IC4 A;  4HOJ A;  3RHB A;  4ZB8 A;  3IBH A;  2WB9 A;  4EDZ A;  3HJM A;  5CNW A;  4E8E A;  5IMD A;  1GSE A;  3N5O A;  1U3A A;  1XW5 A;  3EWL A;  5ECP B;  5ECH B;  2N5F A;  1HNB A;  3C7M A;  1Q4J A;  1FOV A;  5FHI A;  1PD2 1;  3APS A;  3LGC A;  1VRS D;  2YV7 A;  1MD4 A;  5IO0 A;  1AAZ A;  3F6D A;  2LS5 A;  2L4Q A;  4K7I A;  2AUV A;  1PQN A;  3UVT A;  3BD2 A;  3BCK A;  3CSJ A;  4FIW A;  19GS A;  2FWF A;  2WDU A;  5KN0 A;  4QL7 A;  3VPQ A;  3IA1 A;  3ME8 A;  3IOS A;  2FWG A;  5D93 A;  1GSY A;  1QGV A;  3WD6 A;  2WZ9 A;  4AJ7 A;  1K0D A;  1RQM A;  1QFN A;  1GUH A;  3HYP A;  2OA7 A;  2HSY A;  4OCE A;  2VLT A;  5HQP A;  4I97 A;  2VM2 A;  1M2B A;  3CRU A;  3EE2 A;  3QMX A;  1AQV A;  1NHO A;  7GSS A;  1J0F A;  3IPZ A;  1V40 A;  1M99 A;  2FWE A;  1WJK A;  4KX4 A;  6GST A;  2WFC A;  17GS A;  2JZR A;  2X64 A;  22GS A;  2VL2 C;  3SBC A;  5G5E A;  2VCZ A;  2D2Z A;  3P90 A;  1EV4 A;  4N0V A;  2XC2 A;  5G1K A;  4XCS A;  4I8B A;  2L59 A;  4WKW A;  3A5W A;  1GTI A;  3UIW A;  4ZBA A;  1T8E B;  1YF1 A;  4MJB A;  5CAX A;  1XZO A;  1Z9H A;  4G9H A;  4O92 A;  4I5Q A;  2YWM A;  4MF5 A;  3RPP A;  3TKP A;  3VWW A;  2XPE A;  3KMN A;  1AQW A;  14GS A;  2YZU A;  2H71 A;  1F3A A;  2K8V A;  1T7P B;  3O3T A;  4PNF A;  3O6T A;  1BX9 A;  1TP9 A;  2C0E A;  2NTO A;  1GLQ A;  4KCA A;  3SWL A;  1SU9 A;  4ZL7 A;  3APO A;  3IK7 A;  1LJR A;  3CTF A;  3FEU A;  3RPN A;  1F2E A;  4IN0 A;  4ZXG A;  2TRX A;  4TKY A;  2YPM A;  5ENU A;  4V2N A;  1WE0 A;  2EIR A;  4XRD A;  1WP0 A;  2N5A A;  6GSS A;  4DEJ A;  5F8B A;  4NHW A;  3VWU A;  2VUP A;  4RI6 A;  3GRX A;  4N30 A;  4BA7 A;  1HYU A;  4WET A;  4I6X A;  2C0F A;  18GS A;  1JFU A;  2B5E A;  5B6M A;  1GWC A;  1FW1 A;  2I1U A;  4ML6 A;  1GUM A;  3U5R E;  1G7E A;  1PKZ A;  1UC7 A;  1OC3 A;  4YAV A;  3TCO A;  4JE1 A;  2HZF A;  4IP1 A;  3IRA A;  1OC9 B;  2GSQ A;  12GS A;  3GIX A;  3LYK A;  2KP1 A;  4ZIJ A;  3ZVJ A;  3A2W A;  1GL8 A;  5A4U A;  1EEM A;  4KDY A;  3N9J A;  5KN1 A;  2IFQ B;  2B7J A;  3F8U A;  1SL0 B;  5HR1 A;  2L5O A;  1SYX A;  4IJ3 A;  2JSY A;  3DXB A;  5CRE A;  4HUA A;  1GLP A;  2B5X A;  3H4K A;  3CMI A;  1CQH A;  4O32 A;  5ECQ B;  5J41 A;  5B7C A;  2LJR A;  3Q74 A;  5DCG A;  5CRW A;  2YWI A;  1Q98 A;  4KB3 A;  4TR3 A;  1E2Y A;  3I43 A;  3KCM A;  3TKS C;  1GRX A;  3FZA A;  4IQA A;  13GS A;  2PGT A;  2AHE A;  4KUN A;  4WBR D;  2F8A A;  4JU5 A;  3ZFB A;  3VLN A;  4IQ1 A;  1A8L A;  3QCP A;  1ACV A;  2O85 A;  4KSO A;  1V9W A;  4EXJ A;  4YH2 A;  5KEJ A;  1O8X A;  1YEP A;  1U3I A;  2H6Z A;  2WJU A;  3FYG A;  5IMV A;  3PGT A;  2X8G A;  3P7X A;  4OWY A;  3VK9 A;  4F82 A;  2I9H A;  1UN2 A;  4OO5 A;  1ZYQ B;  1YJ6 A;  2FGX A;  4GSS A;  1ILO A;  2RUF A;  2ZCT A;  4GTU A;  1FVK A;  2P31 A;  1BG5 A;  2YZH A;  3C8E A;  1Z6N A;  5IOX A;  1EV9 A;  2LNT A;  1ST9 A;  2VLU A;  3GX0 A;  5DBQ A;  2RUE A;  5HR0 A;  4HQS A;  2IMI A;  3KP8 A;  3FK8 A;  1R5P A;  3IE3 A;  4XS4 A;  2KUC A;  3TJK A;  4Q5N A;  2C1Y A;  2GQM A;  5CRG A;  4LMV A;  3A2X A;  3TDG A;  2H19 A;  1FO5 A;  2ON5 A;  5J4U A;  4POL A;  3BOA A;  1QQ2 A;  4MJE A;  4AF2 A;  3UMA A;  2LJK A;  1MTC A;  4DSR A;  5L71 A;  2K8S A;  1TRS A;  3TJF A;  3IHQ A;  4GSN A;  2XPD A;  3G7Y A;  3K8N A;  4HDE A;  3F3Q A;  3Q18 A;  1GTB A;  2O8V B;  1XW6 A;  3LWA A;  2V41 A;  2CVK A;  1TU8 A;  4F03 A;  5CRD A;  3I69 A;  1OAZ A;  2K6V A;  2KHP A;  1TU7 A;  2REM A;  2V6O A;  5D9T A;  2YJH A;  4XIH A;  1PSQ A;  4MDC A;  4K0G A;  2IME A;  4XRA A;  2B1L A;  4EKZ A;  5GAN D;  3WYW A;  4JR6 A;  1M2D A;  1PGT A;  3TRX A;  3LXZ A;  4K7N A;  3RBT A;  1HNC A;  2TIR A;  4K8M A;  4OD7 A;  3GN3 A;  4LLR A;  2RLI A;  2A2S A;  3DGQ A;  3TOU A;  3G7I A;  2HLS A;  2HNL A;  4JBB A;  1B9X C;  3KM6 A;  3GNJ A;  3S9F A;  5F06 A;  2P0G A;  1A8Y A;  1T00 A;  2FUG 2;  1USB A;  1K0N A;  5J9C A;  4L8E A;  4F9Z A;  2PUK C;  2PPT A;  4NMU A;  1VF1 A;  2DJJ A;  4MPG A;  4NAX A;  3HVX A;  2C3Q A;  2CAI A;  5FWG A;  2FNO A;  3C71 A;  4TW5 A;  1O7U A;  3GUS A;  2DLX A;  4P3Y B;  1QMV A;  4I2T A;  3GTU A;  1SD8 A;  2DBC A;  3LEF A;  2LTK A;  1GNW A;  2YN1 A;  2H76 A;  1NHY A;  4MK3 A;  5G1L A;  4Q5F A;  4X0X A;  2FLS A;  1ZOF A;  2LQO A;  3CSH A;  5F05 A;  3MNG A;  3WT1 A;  5LCZ A;  3FZ9 A;  1BAY A;  5D8I A;  2AYT A;  5CRH A;  2PER A;  1VF3 A;  3J7Y b;  5A4W A;  2H70 A;  5JCU A;  4IHU A;  2HRF A;  4RQR A;  2XHF A;  2VAF A;  5LD0 A;  4MP4 A;  1T4Z A;  2LUS A;  1ZMA A;  4BVX A;  2VLV A;  1H75 A;  3TRQ A;  2VOC A;  1SK1 A;  4KA0 A;  2O87 A;  1K0A A;  2QKE A;  1URM A;  1MD3 A;  3W6G A;  4PUA A;  5DAL A;  1GSD A;  2FCH A;  3QAW A;  1WRY A;  4PQ1 A;  2CZ3 A;  1R4W A;  2HE3 A;  3LOR A;  2HXK A;  1EEJ A;  2YCD A;  3VPT A;  1F6M C;  4K0N A;  3HZ4 A;  4JR4 A;  4D73 A;  1ON4 A;  1SJZ A;  3J7Y k;  4XS4 B;  2VL3 A;  4TXO B;  3FZ5 A;  4WF5 A;  1FB6 A;  2YP6 A;  4HEA 2;  2CA8 A;  4POK A;  5ECO B;  3HKR A;  2H0G A;  3W8S A;  2KOK A;  3HDC A;  1A0F A;  1N2A A;  3KD0 A;  3FZ4 A;  1F3B A;  4Z7X A;  1ERT A;  1PMT A;  3PR8 A;  3PH9 A;  4LA1 A;  3LYP A;  4FYC A;  1KNG A;  3TJG A;  1G6Y A;  3DIE A;  4BVY A;  3L4N A;  4ECI A;  3BBY A;  1EOG A;  4DSS B;  3R2Q A;  1OE7 A;  2L5L A;  5EL8 A;  2DJ0 A;  1QXH A;  2AJQ B;  2IFQ A;  2DMM A;  4ACS A;  1FHE A;  3VWV A;  1Y6E A;  4FYB A;  3CTG A;  1EWX A;  3DKS A;  3M0F A;  1GTA A;  3IK9 A;  1OKD A;  4PGT A;  3FR9 A;  1JZR A;  3F4S A;  1EZK A;  3QDN A;  1THX A;  4L0U A;  5G31 A;  3FHK A;  5AGY A;  3UBK A;  1N8J A;  5HFK A;  3KP9 A;  1AIU A;  4NWY A;  1J08 A;  3KZQ A;  1A0R P;  4IKH A;  1BQ7 A;  2P5R A;  1JZO A;  2WRT A;  3DRN A;  1THO A;  5DJM A;  4ZBB A;  4WR4 A;  2H01 A;  1ZL9 A;  2B6M A;  2CVD A;  4GWR A;  4TR4 A;  2H1A A;  3QPM A;  3H8Q A;  2YWN A;  3DVX A;  1GP1 A;  1FB0 A;  6GSV A;  3ZFL A;  3KTL A;  3ZMK A;  2OBK A;  4BWS A;  3F63 A;  3TUE A;  1JHB A;  2RM6 A;  3VWX A;  1XBS A;  2O89 A;  4XTS A;  4ECB A;  3TRP A;  5IMA A;  3Q6O A;  3GST A;  3WT2 A;  3D4T A;  3GTU B;  3HXS A;  4IJI A;  2R2J A;  4N0Z A;  4WBJ A;  5HR3 A;  1GSQ A;  1UA5 A;  2YJ7 A;  4LL1 B;  3ZIT A;  4QL9 A;  3APQ A;  2F8F A;  2R37 A;  1GNE A;  1NM3 A;  2C3T A;  1XWK A;  2H73 A;  3HY2 A;  2GT5 A;  2GT6 A;  3M9K A;  2E2G A;  2MZC A;  1ERV A;  1OC8 A;  4MF7 A; 
#chains in the Genus database with same CATH topology
 1SEN A;  3GZB A;  1XWB A;  2WS2 A;  1W6C A;  2YOI A;  2GU1 A;  5INY A;  1DET A;  4PUF C;  3F4T A;  3CU3 A;  4K5R A;  2K18 A;  3NHX A;  4MJA A;  4MH3 A;  3GL3 A;  4N11 A;  2AV4 A;  1XIY A;  2Q07 A;  1Q86 4;  1VQK 3;  2PBJ A;  2P38 A;  1TTZ A;  2VD1 A;  3VFI A;  3LML A;  2GSR A;  2OBI A;  2R5G A;  3Q19 A;  2LRN A;  1VQ7 3;  3MKI A;  1W02 A;  1TW9 A;  3TB2 A;  2BMX A;  5B6N A;  1VQQ A;  4HM1 B;  2JAD A;  5CK6 A;  4Z2T A;  3BNB A;  1SKW B;  2YFI B;  4HM6 B;  2R0P A;  5HOH A;  2Z9S A;  5CP1 A;  4ZL9 A;  1RJO A;  2VIM A;  4GB5 A;  3F3R A;  1ZGN A;  2JZS A;  2B1K A;  3LSZ A;  2IWT A;  4AGS A;  2RCD A;  1T1V A;  2FXT A;  1BUQ A;  3E99 A;  1Q7Y 4;  1BVI A;  4EE0 A;  1CH0 A;  1YZX A;  1VQL 3;  3LFL A;  4EDY A;  3F40 A;  4FH8 A;  4MJD A;  3E9J B;  3FR6 A;  4PX1 A;  2CWU A;  5EQL A;  2E7P A;  4GHO A;  5J9B A;  3DD3 A;  1NU3 A;  3WGD A;  3FKF A;  2RGQ A;  2ON7 A;  4YQU A;  1TP6 A;  4HZB B;  1VQ6 3;  3TKS A;  1DE2 A;  5IMZ A;  2CW9 A;  5D9X A;  2CIU A;  2CQ9 A;  3N9H A;  2X8C A;  1TRW A;  3TGZ A;  3LXT A;  2DJ3 A;  1AR0 A;  3O76 A;  4WEY A;  5A5K A;  3D79 A;  4GQF A;  4HS1 A;  4K7O A;  2JAC A;  4R9K A;  4O8S A;  1TI1 A;  1A2V A;  1XW9 A;  1X1W A;  5JCW A;  3WGE A;  3URP A;  4CPK A;  1OAC A;  2TRC P;  1YIT 3;  4KSM A;  4WXT A;  1GUL A;  4TVE A;  4KDX A;  3TJB A;  4YQM A;  3T0U A;  2R6K A;  3WOF B;  2PVO C;  4PUR A;  1B4Q A;  1PN9 A;  3ZIJ A;  1M90 4;  3CCV 3;  1ASK A;  4TRX A;  1AW9 A;  5AIS A;  4FO5 A;  5HFG A;  3FZW A;  1RGC A;  2QSI A;  3MSZ A;  2D42 A;  1I9D A;  1GMQ A;  4MMM A;  6GSY A;  4GXZ A;  4XBY A;  2C8U A;  2W6J H;  5LC6 A;  1X1U A;  3G7J A;  1B8X A;  3CC4 3;  3H3H A;  1GS3 A;  1XVQ A;  4ID0 A;  2QGV A;  3RHC A;  1BSC A;  1O85 A;  1W4N A;  3AHS A;  3LW9 A;  2F51 A;  3I55 3;  2HMJ B;  5D73 A;  1LXE A;  1OE8 A;  1X0R A;  1O7N B;  3PCR A;  1BRN L;  5CXO A;  4MZB A;  1WQL B;  1V98 A;  2OAD A;  2J23 A;  1LVN A;  2OQE C;  5JCG A;  4CY8 A;  2F4Y A;  1ULJ B;  1T4Y A;  3FCS B;  1TOF A;  2VL9 A;  2OE0 A;  1IDP A;  4N6U A;  3EVI A;  2WO0 A;  1RNB A;  4MLY A;  5J3R A;  2NVL A;  1B9Y C;  3KH7 A;  4YAP A;  1BRI A;  3ERF A;  2IY2 A;  5KN3 A;  2J9H A;  5COH A;  2CX0 A;  3HI7 A;  2ZL8 A;  3KE7 A;  2GTU A;  3CYN A;  1YHQ 3;  3S28 A;  4HKV B;  4GCI A;  1ULI B;  2IMD A;  3GKN A;  2OE1 A;  3IV4 A;  1IQ8 A;  2A2R A;  5AEU B;  3FR3 A;  1Y25 A;  2A4V A;  3F9S A;  3H1N A;  5KP4 A;  3KMO A;  4STD A;  3M3M A;  3L9V A;  2MMA A;  3M1G A;  1OCV A;  1F37 A;  5CYY A;  2H6Y A;  1GSF A;  4HU7 A;  4DSQ A;  2UGI A;  1I2G A;  3KSP A;  4ZBD A;  2IL3 A;  1LU4 A;  1S3A A;  2LJA A;  2NBS A;  2H74 A;  4GST A;  6GSP A;  3Q1C A;  3GHA A;  3H93 A;  4TX4 A;  1B4P A;  1K0M A;  3Q90 A;  3HIG A;  3QFB C;  1BU4 A;  2NDO A;  3TKS E;  2HRK A;  4WF4 A;  2P0M A;  3HZP A;  2YV9 A;  3KZT A;  2VCX A;  1FG4 A;  2EIO A;  5E4W A;  1OGX A;  1A2L A;  3IAM 2;  2EC4 A;  4V1A g;  1YJW 3;  4AEQ A;  3WGX A;  1MDK A;  1Q81 4;  3F9U A;  3AGN A;  1A2M A;  1M9B A;  3KCH A;  5EVH A;  1T2H A;  3EB8 A;  3GA4 A;  5DCH A;  3F4R A;  3GWR A;  3F0I A;  2CZ2 A;  4ORL A;  5IIZ A;  3EBT A;  2IMJ A;  3I9V 2;  2WGR A;  4N10 A;  4DVC A;  2LST A;  5ABR A;  1OPY A;  4E8H A;  2HRN A;  1K3L A;  3NQY A;  2OOV A;  4BTY A;  1VQP 3;  4K6X A;  3UJM A;  1JB4 A;  4YKG A;  2SBL A;  1V58 A;  1T3B A;  2M72 A;  1OHO A;  4FMA A;  1B48 A;  2PMT A;  1SJ6 A;  2HSH A;  2VCT A;  5AIG A;  2QC7 A;  5AIV A;  4AKZ A;  3QAG A;  5F07 A;  4BL3 A;  4KZ1 A;  5D83 A;  1M7T A;  3GKK A;  3ZVJ D;  1TIJ A;  3D3L A;  4MH2 A;  4HBR A;  1BED A;  2XGL A;  3N54 B;  5RNT A;  4FCZ A;  1TKD B;  3GX8 A;  5DAK A;  2HMK B;  2OAC A;  5IQY A;  4QQ7 A;  1DMM A;  5D82 A;  1KBN A;  4BL7 A;  1G96 A;  3SYU A;  3X42 A;  1ABA A;  1V74 A;  2HYX A;  3GSS A;  1S5A A;  4CDL A;  4GQC A;  2GZZ A;  1HKX A;  4K1F A;  2IMK A;  4XBT A;  3GH6 A;  4OFN A;  2JSZ A;  2H1B A;  3ROB A;  3IXR A;  2GZY A;  4K61 A;  4HVN A;  1G7O A;  2HMM B;  4RI7 A;  3B4O A;  4TR1 A;  5G30 A;  1M1K 4;  1GOU A;  3OX9 A;  4AKY A;  3GAX A;  4HJ2 A;  1IU7 A;  1RTU A;  5ELG A;  1M0U A;  2VCQ A;  2IPA A;  1TI3 A;  3A2V A;  4F0B A;  2DSA A;  2V1M A;  3HA9 A;  2DJ2 A;  2BMO B;  4FR9 A;  2ES7 A;  1YDK A;  2P5Q A;  4O5R A;  3S67 A;  16GS A;  3WHO A;  4MPF A;  2GQL A;  2INX A;  2R4I A;  4R4K A;  2Y73 A;  3CQF A;  3FSD A;  1KTE A;  2HZE B;  4EBG A;  2K0M A;  1IYI A;  2MBS A;  2VL2 A;  3DUK A;  1IT7 A;  5GZZ B;  1WWJ A;  1ERW A;  2KLX A;  5G5F A;  1KC8 4;  3EU4 A;  5DQS A;  3ZTL A;  4MF6 A;  2W56 A;  1BNI A;  2FHE A;  1PN0 A;  3ECF A;  3L9S A;  3OWU A;  1Q9E A;  2HML B;  1K0C A;  2LRT A;  3MDK A;  5E59 A;  1DBY A;  5JPP A;  1N9J A;  4J5G A;  2KP2 A;  2F98 A;  3ZG5 A;  3UJ1 A;  3DVW A;  5C04 A;  2ZHX B;  1VF4 A;  4XBX A;  4CW9 A;  1O8W A;  1PX6 A;  4OFT A;  5HR2 A;  1XWC A;  1MDI A;  4HM3 B;  1YNV X;  1UCJ A;  4EL1 A;  3ZL5 A;  3DZL A;  3Q3F A;  2GBX B;  4K90 B;  2OCT A;  2L57 A;  2JZT A;  3QD9 A;  4RBN A;  4H61 A;  1J9B A;  1QVF 2;  2E2T A;  2VM1 A;  4L5O A;  1WPI A;  1LBK A;  3EC3 A;  1G0T A;  3PYJ A;  2FGT A;  5ID2 A;  3NM2 A;  2ML5 A;  1FAA A;  3U1W A;  1YEX A;  2LKU A;  2RSX A;  3A5E A;  3GFK A;  20GS A;  1L5G B;  1M1X B;  2WOF A;  3KH9 A;  4MCU A;  1OUN A;  3HJP A;  3AMO A;  4O2H A;  1BOX A;  1AUC A;  1HQO A;  5JWQ B;  3EUR A;  3CBU A;  5ID2 B;  2X8H A;  3LZA A;  4K2D A;  2PU9 C;  4NV2 A;  3PXM A;  3NQZ A;  4J56 E;  3UL5 A;  3L9U A;  1ERU A;  3NOF A;  1I3I A;  4ICY A;  1U87 A;  4CHS A;  3IR4 A;  1TK5 B;  1YVS A;  4NV5 A;  3ZG0 A;  1RW1 A;  3ZZX A;  3C1S A;  1UGH I;  2WCI A;  2YWO A;  2B7K A;  3QOU A;  3NBJ A;  2PN8 A;  1YVB I;  1Z3E A;  2BO9 B;  5LC7 A;  3LT9 A;  3IMA B;  3BNE A;  2H30 A;  2ZA4 A;  4L7K A;  3LT8 A;  2M46 A;  1SD9 A;  4WR5 A;  3UVH A;  2DIY A;  4IP6 A;  3ZIV A;  2PVQ A;  2CX3 A;  2G2Q A;  3HCZ A;  1SYR A;  2VCV A;  1JRQ A;  5HGR A;  3EU3 A;  1NNV A;  3HHV A;  5ECL B;  4G1M B;  3DGL A;  4LYL B;  2L4C A;  5D9V A;  3NV0 B;  1EG9 B;  3V98 A;  2LEG A;  4HQZ A;  1TRP A;  1W89 A;  1SPU A;  4O7H A;  2KF5 A;  1KQS 2;  1EP7 A;  2HFD A;  5J5N A;  2HI7 A;  4XS6 A;  3D22 A;  4KFE A;  1N5H A;  2XRX B;  3PIN A;  3QRD A;  3GKM A;  5DRV A;  4ZIL A;  1WNH A;  2HMO B;  5D96 A;  3TKR A;  4H3U A;  3LTA A;  2X49 A;  3ALA A;  1E3V A;  4NXI A;  5DDL A;  5STD A;  4JF8 A;  4OVM A;  5F0G A;  2F86 B;  1TRV A;  6GSX A;  4HU9 A;  4PQI A;  1TDI A;  5HFI A;  2M80 A;  4K2X A;  1NSW A;  1K9M 4;  4GRF A;  2DJK A;  2JU5 A;  4EUY A;  4ISD A;  2I81 A;  3GYK A;  1R4C A;  5CO3 A;  2XR8 B;  1TXX A;  3I56 3;  3FKA A;  2H0I A;  2MBT A;  3MPH A;  3CCS 3;  1ROA A;  4K9Z A;  4ZM8 A;  2FWH A;  4HZ2 A;  3KTB A;  1QJG A;  4PNG A;  4ECJ A;  3G9B A;  4XDV A;  4HZ4 A;  2F5M A;  2ML6 A;  2KF3 A;  4XS1 A;  3W8J A;  3NV0 A;  2K3D A;  2V2G A;  3ZML A;  3V1W A;  4DSS A;  3QAV A;  1BNR A;  1IYH A;  3D5J A;  1GMP A;  1PRX A;  5GSS A;  1X1X A;  3CSI A;  5BIR A;  1WMP A;  2MC8 A;  4OFM A;  4ULX A;  3D4M A;  3HVS A;  3L0H A;  3GZR A;  1XWG A;  2CVB A;  1N9E A;  1Q7H A;  2VD0 A;  1ZYE A;  5H5Q A;  3GMF A;  1LQG C;  1R26 A;  1Z7P A;  5JPU A;  4EW5 A;  4XHM A;  1RLS A;  3G6E 3;  2GEY A;  2LV3 A;  4IEL A;  4J57 E;  1I8V A;  2V32 A;  3DGN A;  5ECM B;  3LJR A;  3US3 A;  2AB6 A;  2Z7A A;  2MMO A;  5GSP A;  2H0H A;  1YY7 A;  1RNT A;  2SAR A;  1AY7 A;  1OYJ A;  4GLT A;  1JLV A;  2ZNM A;  4CCV A;  1HU9 A;  3B4P A;  4NHF A;  4JED A;  2L1S A;  4N6L A;  4EF0 A;  1O6J A;  2DC5 A;  1JV2 B;  2GSP A;  4G2E A;  2Z6B A;  4OO4 A;  1XWA A;  3OXA A;  2Z76 A;  1U6T A;  1UI7 A;  4MAB A;  4TXV A;  1EP8 A;  1BRG A;  1V57 A;  4G0K A;  3UAR A;  1GSS A;  1GY6 A;  4GF0 A;  1VZZ A;  4D73 B;  1MOL A;  1RK4 A;  1TRU A;  5DJL A;  1XVW A;  3GH9 A;  5H5S A;  4HM2 B;  1A23 A;  3CME 3;  3GUR A;  4HJM A;  5D9W A;  5G2Z A;  3BIR A;  3CXC 2;  1A2J A;  2L6D A;  4TOP A;  4ILF A;  3LYG A;  2GLR A;  3GL5 A;  2ZUP A;  3X40 A;  1RN4 A;  1M9A A;  2GZP A;  1SJW A;  1CQG A;  2GGT A;  3CCL 3;  1FGQ A;  1JLW A;  1S3C A;  3MWH A;  1WIK A;  4X1U A;  2R4V A;  3L78 A;  1A24 A;  2HRA A;  4BWQ A;  1VQ4 3;  2CT6 A;  4IBP A;  4TR1 B;  2ALB A;  2QA1 A;  1JBS A;  4KAE A;  2JL4 A;  2MMZ A;  1N8R 4;  4WWU C;  4KGI A;  1PL2 A;  4FMB A;  1TFK A;  3EC9 A;  3ZRE A;  3J7Y d;  2DIZ A;  5JWO B;  4FCJ A;  2FA8 A;  4OMV A;  1W2B 2;  4AJ6 A;  4K1V A;  2LNS A;  3ME7 A;  4JRR A;  3P8W A;  5IMF A;  2UZ8 A;  1KD1 4;  3LTC A;  4ECC A;  3TJJ A;  2CHC A;  4V1A p;  4BL7 B;  1GTU A;  1B21 A;  1RHL A;  1M3I A;  4N6T A;  3A3T A;  5DVB A;  2CV4 A;  5AEW B;  4LMW A;  3MIX A;  1I0X A;  2XFT A;  1JZW A;  5IEN A;  3PGB A;  5ECI B;  3EMX A;  1HYF A;  2N5B A;  4MA9 A;  3LQ7 A;  3A5I A;  2HZE A;  2HT9 A;  1RCL A;  2QEX 3;  1EGR A;  4H86 A;  2B3S A;  3HZ8 A;  4OK0 A;  2W2C A;  3N8B A;  3NZN A;  4FQU A;  4KT3 B;  1YF0 A;  3EIN A;  2OOV C;  4Z2U A;  4MZC A;  1MWS A;  1WOU A;  2E2M A;  1TK0 B;  3DYR A;  3IC8 A;  4PEJ A;  1F9M A;  4KCE A;  4O5Q A;  3P2A A;  4LEH A;  1A67 A;  4OUQ A;  4HM5 B;  1TUH A;  5ELA A;  3NBB A;  1O81 A;  1H4O A;  3OWY A;  4X2O A;  4WHA A;  3FF0 A;  3V92 A;  1BJX A;  3BJ5 A;  2H72 A;  1K73 4;  1NJI 4;  1FVJ A;  4DKI A;  2YFL B;  4NPB A;  3C1R A;  4ZB6 A;  1ZO2 A;  1VQ8 3;  2GSS A;  1U8C B;  3I0Y A;  3WOE B;  3UEM A;  1TJD A;  1TFO A;  1RGE A;  3DWV A;  1EOH A;  3JUM A;  1S72 3;  1X5C A;  2H6X A;  1BYE A;  2H75 A;  3ZLP A;  1FUT A;  3QK9 A;  3M8N A;  2IJY A;  4L8O A;  1U88 A;  5ECR B;  5H5R A;  3MYD A;  2B1X B;  3CNM A;  3KN4 A;  3I6A A;  5KN2 A;  4X43 A;  3KKG A;  4FCM A;  4JZQ A;  2Y74 A;  1FGM A;  1M3J A;  2LQV A;  2W9Q A;  3M8C A;  1SJI A;  4GL6 A;  3EMP A;  5ECS A;  4EC0 A;  3K0Z A;  2IMF A;  1TK8 B;  3VUR A;  3TOT A;  1BNF A;  4ZL8 A;  1JN5 A;  3IPT A;  4RQX A;  3HII A;  9GSS A;  1AXD A;  2OKA A;  3K7C A;  3JUO A;  2C80 A;  3FMW A;  5ELJ A;  4V2L A;  2CG1 A;  3K5T A;  2GEX A;  1DUG A;  5IO2 A;  2Z77 A;  2CFK A;  3G4S 3;  1Z5Y E;  2FY6 A;  4G0L A;  1SL1 B;  5ELU A;  3QR6 A;  1K28 A;  2FA4 A;  3UBL A;  2NPB A;  1UI8 A;  5IPG A;  1G6W A;  1C7H A;  4J5K A;  1E6B A;  1OC9 A;  1XFL A;  2BJX A;  3EQQ B;  2DJ1 A;  3F6F A;  4O5U A;  5B8A A;  1NDO B;  3D4A A;  1OKT A;  2R0G A;  1DSB A;  2HOH A;  3PPU A;  2BU4 A;  1R5A A;  3MAK A;  2IIY A;  2EIQ A;  5DAL B;  5IOW A;  1R7H A;  2VO4 A;  5ECN B;  4AJ8 A;  3LG6 A;  2E0Q A;  3SX1 A;  5AIH A;  4BVY B;  1SK0 A;  1RN7 A;  3KIJ A;  3BU4 A;  4G10 A;  5GST A;  4YQV A;  2BMQ B;  4BVX B;  4TN8 A;  1PFP A;  1SII A;  1SK2 A;  1QAK A;  2W56 B;  2V6K A;  4L0W A;  1NW2 A;  3AY8 A;  4PQH A;  2JQ5 A;  1GY5 A;  3F14 A;  3EYT A;  4KDU A;  2R3X A;  4EXR A;  3KXO A;  1I70 A;  1LQM B;  1K0O A;  2D1W A;  3NIV A;  3M9J A;  2F3M A;  1SKR B;  4KW6 A;  2F9S A;  1X9W B;  3CPO A;  3ZRD A;  2LRC A;  1EGO A;  4KND A;  4KH7 A;  1O7P B;  4F2I A;  2OQE A;  1MDJ A;  1A2P A;  4Q5Q A;  1JKG A;  1YKC A;  1PY3 A;  3BCI A;  2QA2 A;  3VI5 A;  3KGK A;  3F7X A;  3GKX A;  3KSE D;  1M2A A;  1QMA A;  3ZFZ A;  5KOW A;  3UAP A;  4N6M A;  10GS A;  1W01 A;  2GST A;  3GRD A;  1X5D A;  1G02 A;  2JDI H;  1K0B A;  1W4V A;  2RM5 A;  3CCM 3;  3H79 A;  5AYS C;  1O73 A;  2H1D A;  4USS A;  4J2F A;  3K9M C;  3DH2 A;  5FT3 A;  4POM A;  1XPV A;  1N8Q A;  1GOY A;  3UOM A;  4KE3 A;  5B8B A;  1MEK A;  4IGJ A;  4EYC A;  5IW9 A;  2K54 A;  3VSY A;  2CAQ A;  3IDV A;  1LOW A;  5AN1 A;  2F99 A;  4V2M A;  4NHZ A;  2WUL A;  8GSS A;  1LOX A;  1WTH A;  1HNA A;  3F8X A;  3RDE A;  5ECK B;  3FW2 A;  3IAS 2;  3FRC A;  4EVM A;  1AVK A;  4TR0 A;  1RGG A;  2GVP A;  6GSW A;  1XXU A;  1BRJ A;  1PL1 A;  4G19 A;  2C4B A;  3WDG B;  1QAL A;  1C72 A;  1SAR A;  1BNG A;  4L5L A;  2G0F A;  2XBQ A;  1N5P A;  3VI7 A;  9RNT A;  3TKQ A;  5EVO A;  2W0Q A;  1DYU A;  1Z6M A;  2FD3 A;  4L8P A;  1FA3 A;  1QUW A;  2KXG A;  1XOB A;  3OR5 A;  5A4V A;  3ED3 A;  1FOH A;  2BMR B;  5LNK e;  5I97 A;  4FYU A;  3GV1 A;  3LOY A;  1K3Y A;  2B5Y A;  1DMQ A;  4HI7 A;  4J9A A;  1GD3 A;  2H66 A;  2XBI A;  1GYB A;  1I3F A;  2VCW A;  3ZYW A;  5GAP D;  3HVV A;  4MMZ B;  3C73 A;  2MYG A;  2KRT A;  2F5W A;  3DM8 A;  3LXU X;  1BSB A;  4MNN A;  1ZX2 A;  1OVN A;  1D6Y A;  3KEB A;  1ZGX A;  1CYU A;  2C0G A;  1J2B A;  4Q53 A;  2OJL A;  1AQX A;  3LTB A;  4N6N B;  1YKA A;  2XSO B;  2W03 A;  2BTO T;  4BIK A;  2I3Y A;  1XOA A;  3EN8 A;  4XB5 A;  5IMC A;  4MZW A;  2I4A A;  3CC7 3;  3ISO A;  1S3D A;  3JCM L;  1VGL A;  5EY6 A;  1RMS A;  2C3N A;  2GS3 A;  2PWJ A;  4IW9 A;  4LGQ A;  1PKW A;  4OCF A;  5EEO A;  8RNT A;  3HX8 A;  1X9S B;  1W7C A;  3E0U A;  1HZ1 A;  5EPF A;  4F0C A;  1JBR A;  1GH2 A;  4ML1 A;  1OH0 A;  2QA4 3;  1HD2 A;  1VF2 A;  3ERW A;  1ZZY A;  2L6C A;  1DE1 A;  2OE3 A;  2IYJ A;  4CDO A;  1AVL A;  1Z7R A;  3U6V A;  4IT7 A;  5IG0 A;  3DML A;  1DMN A;  1UVZ A;  3KJY A;  4RUV A;  3G0K A;  1K3O A;  3ER7 A;  3D0Z A;  1AC1 A;  1BAN A;  3SOA A;  2LQQ A;  4PXO A;  2H1G A;  3OWS A;  2AAW A;  5IPH A;  2O7K A;  11GS A;  1GSU A;  4BPY A;  4TXO A;  4POB A;  4MJC A;  1VQO 3;  2XSH B;  1VQM 3;  4FMD A;  1KEB A;  1T5Y A;  4KF9 A;  4ZB9 A;  4EO3 A;  3HD5 A;  1X9M B;  1MNL A;  1YGE A;  4YKF A;  2YAN A;  3RDW A;  3RAZ A;  1Q82 4;  4Q5R A;  6GSU A;  1DVD A;  2DML A;  1ZCP A;  5DAK B;  2MMN A;  4LL4 B;  1PX7 A;  2H8L A;  4EIP A;  5DQY A;  3ERG A;  4I2U A;  3E3E A;  2X99 A;  1YGW A;  2RII A;  1ML6 A;  1MGW A;  2CX4 A;  3X3Y A;  5JWR B;  1XCC A;  3DEX A;  1Q40 B;  3H51 A;  1B2M A;  2K9F A;  1BRS A;  2IN3 A;  1RGK A;  5C00 A;  1SKS B;  1B2U A;  4IVF A;  3UL3 A;  3Q2P A;  2GDR A;  1W6Y A;  3D6I A;  1X5E A;  3EX9 A;  3HJO A;  2C0D A;  3WOD G;  1WMJ A;  1QK8 A;  3QFA C;  3D21 A;  2YNX A;  2C4J A;  1I5G A;  3CXG A;  5IM9 A;  1JZD A;  2GQK A;  1UUG B;  1V2A A;  2R41 A;  1O7W B;  1RN1 A;  5BU4 A;  5AIX A;  3JVC A;  1RKY A;  3CRT A;  4IS0 A;  1GUK A;  2GU3 A;  3FY7 A;  1PA3 A;  1YQ1 A;  1Z1S A;  1RDS A;  1SL2 B;  1ISK A;  3IC4 A;  4HM0 B;  2L4V A;  4HOJ A;  3RHB A;  4ZB8 A;  3IBH A;  2WB9 A;  4EDZ A;  3HJM A;  5CNW A;  1IVU A;  4E8E A;  5IMD A;  1RRH A;  1GSE A;  3N5O A;  4Z2R A;  3GZY B;  1BGS A;  8CHO A;  1U3A A;  1XW5 A;  3EWL A;  2B24 B;  2E2U A;  1UCI A;  5ECP B;  1UGI A;  4A5P A;  3AMO B;  5ECH B;  2N5F A;  1HNB A;  3C7M A;  1JN5 B;  1Q4J A;  2WGO A;  1FOV A;  5D81 A;  5FHI A;  2CWT A;  1PD2 1;  3APS A;  3LGC A;  1VRS D;  2YV7 A;  1MD4 A;  5IO0 A;  1AAZ A;  3F6D A;  2LS5 A;  2L4Q A;  4K7I A;  3EE1 A;  2AUV A;  1VQN 3;  1PQN A;  3UVT A;  3STD A;  2OWP A;  3BD2 A;  3BCK A;  1JB2 A;  3CSJ A;  4FIW A;  19GS A;  1JB5 A;  2FWF A;  3B8L A;  3S5C A;  5KOX A;  5FW5 A;  4HM4 B;  2WDU A;  5KN0 A;  4EC6 A;  5IEO A;  4QL7 A;  3VPQ A;  3V99 A;  3IA1 A;  3ME8 A;  3IOS A;  1FGO A;  2FWG A;  3BNC A;  5D93 A;  3AGO A;  1GSY A;  1FGR A;  1QGV A;  4O3V A;  2J8X B;  3X3X A;  3WD6 A;  1ZYP A;  1BRK A;  2WZ9 A;  1WMN A;  3D9R A;  4AJ7 A;  4G0I A;  1K0D A;  2HMN B;  1RQM A;  1QFN A;  1GUH A;  3HYP A;  2OA7 A;  2HSY A;  4LZI A;  4OCE A;  2VLT A;  5HQP A;  4I97 A;  2VM2 A;  1M2B A;  3CRU A;  1Q42 A;  3EE2 A;  3QMX A;  3CMA 3;  1AQV A;  1NHO A;  7GSS A;  1J0F A;  1MGR A;  2CFD A;  3IPZ A;  1V40 A;  1M99 A;  3S29 A;  2FWE A;  1WJK A;  4KX4 A;  6GST A;  2WFC A;  17GS A;  2JZR A;  3KFQ C;  1BNJ A;  2X64 A;  22GS A;  4N3V A;  4WYK B;  5A0O B;  2VL2 C;  3SBC A;  5G5E A;  1IK3 A;  1B3S A;  5AIF A;  4R9L A;  3U97 A;  1UW1 A;  2AAD A;  2AAE A;  1DE3 A;  5IG5 A;  2VCZ A;  2D2Z A;  3P90 A;  3BND A;  1EV4 A;  4N0V A;  1F8N A;  2XC2 A;  5G1K A;  1W5Z A;  1FZU A;  4XCS A;  4I8B A;  2L59 A;  4WKW A;  2IA7 A;  3A5W A;  3UB1 A;  1D6U A;  1IYY A;  1GTI A;  3JUQ A;  2DKH A;  2BHM A;  2HSM A;  3UIW A;  1FUS A;  4ZBA A;  2X4A A;  1T8E B;  3HVN A;  3PZW A;  5BRT A;  1YF1 A;  1OHP A;  4MJB A;  1IVX A;  2XFS A;  5CAX A;  1XZO A;  1Z9H A;  4G9H A;  3FH1 A;  4O92 A;  4I5Q A;  3UNL A;  2YWM A;  4X4J A;  3FGY A;  4MF5 A;  3RPP A;  1RRL A;  2QIY A;  1UUW B;  3TKP A;  3VWW A;  2XPE A;  3KMN A;  1AQW A;  14GS A;  2YZU A;  2H71 A;  1F3A A;  2K8V A;  4J8T A;  2A15 A;  2I9W A;  1T7P B;  3O3T A;  4PNF A;  1NO3 A;  3O6T A;  2OTJ 3;  1BX9 A;  1TP9 A;  2C0E A;  2NTO A;  4K1U A;  2RFR A;  3WMD A;  1GLQ A;  4KCA A;  3SWL A;  1SU9 A;  4ZL7 A;  3APO A;  3IK7 A;  1LJR A;  3HOH A;  3CTF A;  1W2Z A;  3FEU A;  3RPN A;  1F2E A;  4IN0 A;  4ZXG A;  2TRX A;  3L0R A;  2XEP A;  4TKY A;  2YPM A;  5ENU A;  1OHS A;  1JKG B;  4V2N A;  1UUV B;  3LTD A;  2O9U X;  1WE0 A;  2EIR A;  4XRD A;  1ZS7 A;  1WP0 A;  2N5A A;  6GSS A;  1MWT A;  2M7O A;  1UDI I;  3RGR A;  5AII A;  1GD4 A;  4DEJ A;  4BTX A;  2CFL A;  5F8B A;  4NHW A;  3VWU A;  2XH9 A;  2VUP A;  3NBR A;  4RI6 A;  2PZV A;  3GRX A;  4N30 A;  1RGH A;  4BA7 A;  3D5G A;  1HYU A;  3CCU 3;  2W9P A;  1AQZ A;  4I6X A;  1EKM A;  4WET A;  1MWR A;  2C0F A;  18GS A;  1JFU A;  2B5E A;  4N6O B;  5B6M A;  1GWC A;  1BSE A;  6RNT A;  1FW1 A;  2I1U A;  3IHG A;  4ML6 A;  1D6Z A;  2KF4 A;  1GUM A;  3U5R E;  1PKZ A;  1UC7 A;  1E97 A;  1G7E A;  1OC3 A;  4YAV A;  3TCO A;  1LRA A;  4O02 B;  4JE1 A;  2HZF A;  5IG4 A;  4IP1 A;  3IRA A;  1OC9 B;  2GSQ A;  1I2F A;  5G2G A;  1GY7 A;  3CD6 3;  12GS A;  2CH9 A;  3GIX A;  3LYK A;  2KP1 A;  4ZIJ A;  3ZVJ A;  3A2W A;  1GL8 A;  5A4U A;  3FF2 A;  1EEM A;  4KDY A;  3DY5 A;  3CCQ 3;  3N9J A;  2BNG A;  7GSP A;  3VF1 A;  5KN1 A;  2IFQ B;  4CJN A;  1SQW A;  7RNT A;  2B7J A;  3F8U A;  4MMY B;  1SL0 B;  1I2E A;  5HR1 A;  3G8Z A;  1VQ5 3;  2L5O A;  1IVV A;  1SYX A;  4IJ3 A;  5IG3 A;  3MSO A;  2JSY A;  3DXB A;  3BLZ A;  5CRE A;  4HUA A;  1GLP A;  4XM4 A;  3CCE 3;  2B5X A;  3H4K A;  3CMI A;  1CQH A;  2UX0 A;  4RNT A;  4O32 A;  5ECQ B;  5J41 A;  5B7C A;  5M19 A;  2LJR A;  3Q74 A;  5DCG A;  1SIH A;  2RBI A;  5CRW A;  2YWI A;  4CY6 A;  1RGL A;  2RNT A;  1B27 A;  5KP1 A;  1Q98 A;  4KB3 A;  5BXQ A;  1E2Y A;  4TR3 A;  1GMR A;  1S3R A;  3I43 A;  2CC3 A;  3KCM A;  3R3E A;  3TKS C;  1GRX A;  1RGA A;  3FZA A;  5IEP A;  4IQA A;  13GS A;  2PGT A;  2AHE A;  4KUN A;  3MG3 A;  4WBR D;  2F8A A;  1NWW A;  2XF3 A;  4JU5 A;  3VLN A;  3ZFB A;  4HYZ A;  1STD A;  1W00 A;  3SOY A;  2LYX A;  4IQ1 A;  1A8L A;  3QCP A;  2KCD A;  1ACV A;  2O85 A;  4BIR A;  1IVW A;  4KSO A;  1UCL A;  1V9W A;  4EXJ A;  4HSC X;  4YH2 A;  5FGO A;  5KEJ A;  1O8X A;  3SVA A;  1YEP A;  1U3I A;  2H6Z A;  4XDW A;  2WJU A;  4EIQ A;  2OTL 3;  3FYG A;  3PS8 A;  5IMV A;  1PFO A;  3SLU A;  3PGT A;  2X8G A;  3P7X A;  2CG0 A;  4OWY A;  3VK9 A;  4F82 A;  2I9H A;  3O8Y A;  1MWU A;  4HOH A;  1UN2 A;  4OO5 A;  1FUW A;  1RSN A;  2CFG A;  3T8U A;  1ZYQ B;  1YJ6 A;  2FGX A;  4GSS A;  1OF5 A;  1ILO A;  1E3R A;  2DKI A;  2RUF A;  2ZCT A;  4GTU A;  1BSD A;  1FVK A;  2P31 A;  4IPB A;  1BG5 A;  2YZH A;  3C8E A;  1Z6N A;  5IOX A;  1EV9 A;  2LNT A;  1ST9 A;  2VLU A;  2E2V A;  3GX0 A;  5DBQ A;  2RUE A;  3CNX A;  3FLJ A;  4GSP A;  4HQS A;  2IMI A;  2BT3 A;  5HR0 A;  3DGO A;  3KP8 A;  3FK8 A;  4BL2 A;  1X1Y A;  1RGF A;  1CQS A;  1BNS A;  1R5P A;  3G16 A;  3IE3 A;  3G71 3;  3EBY A;  4XS4 A;  2KUC A;  5KP3 A;  2IUJ A;  3TJK A;  4Q5N A;  3EN1 B;  5AYR B;  1PYL A;  3SXX A;  2C1Y A;  2GQM A;  5CRG A;  4LMV A;  3A2X A;  3TDG A;  2H19 A;  1FO5 A;  2ON5 A;  5J4U A;  2A4H A;  4POL A;  3BOA A;  1QQ2 A;  4MJE A;  4AF2 A;  3UMA A;  2GXF A;  2LJK A;  3LH4 A;  1MTC A;  4DSR A;  2W04 A;  1NB5 I;  5L71 A;  4BU4 A;  1RCK A;  2K8S A;  1TRS A;  1FYS A;  3IHQ A;  3TJF A;  4GSN A;  2KF6 A;  2XPD A;  1O7M B;  3G7Y A;  1GSP A;  3K8N A;  4HDE A;  3F3Q A;  1BSA A;  4FMC A;  1Q40 A;  1LNI A;  3Q18 A;  2UUG C;  2YFJ B;  1GTB A;  4RZM A;  3WA3 A;  2O8V B;  1XW6 A;  1B2X A;  1IQX A;  3LWA A;  3WR2 A;  2V41 A;  3KII A;  5BMU A;  2CVK A;  1IV7 A;  3DXO A;  1TU8 A;  4F03 A;  3RNT A;  1YJN 3;  5CRD A;  3I69 A;  1OAZ A;  2K6V A;  4JRF A;  4EV5 A;  4K5S A;  2KHP A;  1TU7 A;  2REM A;  2V6O A;  5D9T A;  2YJH A;  4XIH A;  1PSQ A;  3NX0 A;  1IV9 A;  4MDC A;  3MWZ A;  4BTW A;  3MYT A;  4X2H A;  2IME A;  4K0G A;  5M1A A;  4XRA A;  3EHC A;  2B1L A;  4EKZ A;  5GAN D;  3WYW A;  1KSI A;  1LOV A;  4JR6 A;  1IT8 A;  1M2D A;  1PGT A;  1WMO A;  3TRX A;  3LXZ A;  4K7N A;  3RBT A;  3DGM A;  1HNC A;  3EJV A;  1CEW I;  2TIR A;  4K8M A;  4OD7 A;  3GN3 A;  5DRE A;  4LLR A;  2RLI A;  4IIA A;  3OW2 2;  1FW7 A;  2A2S A;  3DGQ A;  1TRQ A;  3FG3 A;  2WGQ A;  3TOU A;  4WFO A;  3G7I A;  2HLS A;  2HNL A;  4JBB A;  1B9X C;  3KM6 A;  3GNJ A;  3EPT A;  2CWV A;  2C11 A;  3S9F A;  5F06 A;  2P0G A;  3WA2 X;  1A8Y A;  1T00 A;  2FUG 2;  1B20 A;  1QAF A;  3MG2 A;  1USB A;  4MEI A;  1K0N A;  2CX1 A;  2BIR A;  1I0V A;  3FG4 A;  5J9C A;  4L8E A;  4F9Z A;  2PUK C;  2PPT A;  4NMU A;  1VF1 A;  3K63 A;  4QWT A;  2DJJ A;  4MPG A;  3D5I A;  4NAX A;  2V1L A;  4R1K A;  3GZX B;  3HVX A;  2C3Q A;  2CAI A;  5FWG A;  3NXJ A;  2FNO A;  3C71 A;  5CF1 A;  4TW5 A;  1O7U A;  3GUS A;  2DLX A;  4HJL B;  4P3Y B;  1QMV A;  1M9G A;  4I2T A;  3GTU A;  1SD8 A;  4HAA A;  3NM7 A;  2DBC A;  2P09 A;  3LEF A;  2LTK A;  1GNW A;  2XGN A;  2YN1 A;  2H76 A;  4LSO A;  1NHY A;  1O7G B;  1U5O A;  3MG1 A;  4MK3 A;  5G1L A;  3JUN A;  4Q5F A;  4X0X A;  2FLS A;  2YX9 A;  1ZOF A;  1BIR A;  2LQO A;  1O7H B;  3CSH A;  5F05 A;  2FNQ A;  3MNG A;  3WT1 A;  5LCZ A;  4U13 A;  3FZ9 A;  1BAY A;  5D8I A;  2AYT A;  5CRH A;  2PER A;  1VF3 A;  3J7Y b;  1TTO A;  5A4W A;  2STD A;  2H70 A;  2GBW B;  4R80 A;  5JCU A;  5JBS A;  5M18 A;  4IHU A;  2PNC A;  2HRF A;  4RQR A;  2XHF A;  2VAF A;  3FG1 A;  5IF6 A;  5LD0 A;  4MP4 A;  1T4Z A;  3DGY A;  4I4K A;  2LUS A;  1ZMA A;  4BVX A;  2VLV A;  1H75 A;  1OGZ A;  3TRQ A;  2VOC A;  1SK1 A;  4KA0 A;  1T2I A;  3CCR 3;  2O87 A;  1DVC A;  1K0A A;  4RNZ A;  2QKE A;  3GSP A;  1IQY A;  1URM A;  1B2Z A;  1MD3 A;  3W6G A;  4PUA A;  5DAL A;  1GSD A;  2FCH A;  3QAW A;  1WRY A;  4PQ1 A;  1Y4K A;  2CK3 H;  1UCK A;  1JBT A;  1YI2 3;  2CZ3 A;  1R4W A;  2P05 A;  4KVH A;  2HE3 A;  3LOR A;  2IUK A;  5TGN A;  2HXK A;  1EEJ A;  1W6G A;  1QVG 2;  2YCD A;  1BRH A;  3VPT A;  1F6M C;  4K0N A;  2MF7 A;  3HZ4 A;  2C10 A;  4JR4 A;  1STF I;  4D73 A;  1ON4 A;  1K8A 4;  4WYK A;  1VQ9 3;  1SJZ A;  3J7Y k;  2F56 A;  1JNQ A;  2VL3 A;  4XS4 B;  3DMC A;  4TXO B;  3FZ5 A;  4WF5 A;  5IER A;  1FB6 A;  2YP6 A;  4HEA 2;  4KFF A;  2CA8 A;  1B2S A;  1FGT A;  4POK A;  5ECO B;  3OV4 A;  4N6V 0;  3HKR A;  1LNH A;  2H0G A;  3W8S A;  2KOK A;  3HDC A;  4LMI A;  3SED A;  1YIJ 3;  5BVB A;  1A0F A;  1N2A A;  3B7C A;  3KD0 A;  3FZ4 A;  2R0C A;  1OF5 B;  1F3B A;  4Z7X A;  1ERT A;  1PMT A;  1TU5 A;  3PR8 A;  3PH9 A;  4LA1 A;  3LYP A;  4FYC A;  1KNG A;  3TJG A;  1ZYN A;  1G6Y A;  3S27 A;  3DIE A;  2CFW A;  4BVY A;  4RNY A;  3L4N A;  4HM8 B;  4ECI A;  3BBY A;  1EOG A;  4DSS B;  3R2Q A;  3CPW 2;  3F8H A;  1XG8 A;  1OE7 A;  1A2K A;  3A76 A;  3HK4 A;  2L5L A;  5EL8 A;  2DJ0 A;  6STD A;  1QXH A;  4MMX B;  4HM7 B;  2AJQ B;  1EA2 A;  2IFQ A;  2DMM A;  1BNE A;  4ACS A;  1FHE A;  3VWV A;  4WP5 A;  1Y6E A;  1A90 A;  4FYB A;  1C54 A;  3PCS A;  1YJ9 3;  1JJ2 2;  3CTG A;  1EWX A;  3DKS A;  3M0F A;  1KWI A;  2O3O A;  1GTA A;  4HZ9 B;  3IK9 A;  1OKD A;  3MHE A;  4PGT A;  3FR9 A;  3CC2 3;  1JZR A;  3F4S A;  1EZK A;  3QDN A;  1THX A;  4L0U A;  5G31 A;  3FHK A;  5AGY A;  3UBK A;  1N8J A;  3CCJ 3;  5HFK A;  3KP9 A;  1AIU A;  2A2P A;  4PTS A;  4NWY A;  1J08 A;  3KZQ A;  1A0R P;  4IKH A;  3IJE B;  1AV4 A;  4KFD A;  1BQ7 A;  1JZO A;  7STD A;  2P5R A;  3EF8 A;  1THO A;  2WRT A;  3DRN A;  5DJM A;  3JUP A;  4ZBB A;  4WR4 A;  2H01 A;  2B6M A;  1ZL9 A;  2CVD A;  3T8N A;  4GWR A;  4TR4 A;  2H1A A;  1K41 A;  3QPM A;  3H8Q A;  2YWN A;  3DVX A;  1GP1 A;  1FB0 A;  6GSV A;  3ZFL A;  3KTL A;  3ZMK A;  1EUI C;  2QGU A;  1PU4 A;  2OBK A;  4BWS A;  3F63 A;  3TUE A;  3NUV A;  1JHB A;  3BB9 A;  2RM6 A;  1R4Y A;  3X3Z A;  2P0X A;  3VWX A;  1XBS A;  2O89 A;  4XTS A;  1GOV A;  2CKF B;  2WOH A;  4ECB A;  3RGA A;  3TRP A;  5IMA A;  2ZDJ A;  3Q6O A;  3GST A;  3WT2 A;  3D4T A;  3GTU B;  1CYV A;  3HXS A;  4IJI A;  2R2J A;  4N0Z A;  3UL6 A;  4EV2 A;  4WBJ A;  5HR3 A;  1GSQ A;  3X41 A;  1BUJ A;  1UA5 A;  2YJ7 A;  3F7S A;  4LL1 B;  3ZIT A;  2KAA A;  4QL9 A;  5CLK A;  5AI1 A;  3APQ A;  2F8F A;  2R37 A;  1NB3 I;  1GNE A;  1NM3 A;  1EQK A;  2C3T A;  1XWK A;  2H73 A;  3HY2 A;  2GT5 A;  3VGN A;  2GT6 A;  3M9K A;  2E2G A;  2MZC A;  1BAO A;  1ROV A;  1ERV A;  1OC8 A;  1LOY A;  3AHW A;  4NRE A;  4MF7 A;  5CF2 A;  1US1 A; 
#chains in the Genus database with same CATH homology
 1SEN A;  1XWB A;  2YOI A;  2WS2 A;  5INY A;  4PUF C;  3F4T A;  4K5R A;  2K18 A;  4MJA A;  4MH3 A;  3GL3 A;  4N11 A;  2AV4 A;  1XIY A;  2PBJ A;  1TTZ A;  2VD1 A;  3VFI A;  2GSR A;  2OBI A;  2R5G A;  3Q19 A;  2LRN A;  1TW9 A;  3TB2 A;  2BMX A;  5B6N A;  2JAD A;  4Z2T A;  1SKW B;  2R0P A;  2Z9S A;  5CP1 A;  4ZL9 A;  3F3R A;  2VIM A;  1ZGN A;  2JZS A;  2B1K A;  3LSZ A;  2IWT A;  4AGS A;  1T1V A;  4EE0 A;  1YZX A;  3LFL A;  4EDY A;  4FH8 A;  3E9J B;  3FR6 A;  4PX1 A;  2E7P A;  5J9B A;  3DD3 A;  3WGD A;  3FKF A;  2ON7 A;  4YQU A;  3TKS A;  1DE2 A;  5IMZ A;  5D9X A;  2CQ9 A;  2X8C A;  1TRW A;  3TGZ A;  3LXT A;  2DJ3 A;  3O76 A;  4WEY A;  5A5K A;  4GQF A;  4HS1 A;  4K7O A;  2JAC A;  1TI1 A;  1XW9 A;  5JCW A;  3WGE A;  2TRC P;  4KSM A;  4WXT A;  1GUL A;  4TVE A;  4KDX A;  3TJB A;  4YQM A;  2R6K A;  2PVO C;  4PUR A;  1B4Q A;  1PN9 A;  3ZIJ A;  4TRX A;  1AW9 A;  5AIS A;  4FO5 A;  5HFG A;  2QSI A;  3MSZ A;  1I9D A;  4MMM A;  6GSY A;  4GXZ A;  2C8U A;  3G7J A;  1B8X A;  1XVQ A;  4ID0 A;  2QGV A;  3RHC A;  1O85 A;  3LW9 A;  2F51 A;  5D73 A;  1OE8 A;  1X0R A;  4MZB A;  1V98 A;  2OAD A;  2J23 A;  5JCG A;  4CY8 A;  1T4Y A;  1TOF A;  2VL9 A;  2OE0 A;  3EVI A;  4MLY A;  5J3R A;  2NVL A;  1B9Y C;  3KH7 A;  4YAP A;  3ERF A;  2IY2 A;  5KN3 A;  2J9H A;  5COH A;  3CYN A;  2GTU A;  4GCI A;  2IMD A;  3GKN A;  2OE1 A;  3IV4 A;  2A2R A;  3FR3 A;  1Y25 A;  2A4V A;  3H1N A;  3KMO A;  3M3M A;  3L9V A;  2MMA A;  3M1G A;  1F37 A;  5CYY A;  2H6Y A;  1GSF A;  4HU7 A;  4DSQ A;  4ZBD A;  2IL3 A;  1LU4 A;  1S3A A;  2LJA A;  2NBS A;  2H74 A;  4GST A;  3GHA A;  3H93 A;  1B4P A;  1K0M A;  3QFB C;  2NDO A;  3TKS E;  2HRK A;  4WF4 A;  2YV9 A;  2VCX A;  1FG4 A;  2EIO A;  5E4W A;  1A2L A;  3IAM 2;  2EC4 A;  4V1A g;  3WGX A;  1MDK A;  3F9U A;  1A2M A;  1M9B A;  3GA4 A;  5DCH A;  3F4R A;  3F0I A;  2CZ2 A;  5IIZ A;  3I9V 2;  2WGR A;  4N10 A;  4DVC A;  2LST A;  5ABR A;  4E8H A;  2HRN A;  1K3L A;  4K6X A;  4YKG A;  1V58 A;  1T3B A;  2M72 A;  1B48 A;  2PMT A;  1SJ6 A;  2HSH A;  2VCT A;  2QC7 A;  5AIV A;  3QAG A;  5F07 A;  1M7T A;  3GKK A;  3ZVJ D;  4MH2 A;  1BED A;  1TKD B;  3GX8 A;  5DAK A;  2OAC A;  5IQY A;  4QQ7 A;  1KBN A;  4BL7 A;  1ABA A;  2HYX A;  3GSS A;  4GQC A;  2GZZ A;  4K1F A;  2IMK A;  3GH6 A;  4OFN A;  2JSZ A;  2H1B A;  3IXR A;  2GZY A;  1G7O A;  4RI7 A;  4TR1 A;  5G30 A;  4HJ2 A;  5ELG A;  1M0U A;  2VCQ A;  2IPA A;  1TI3 A;  3A2V A;  4F0B A;  2DSA A;  2V1M A;  3HA9 A;  2DJ2 A;  2ES7 A;  1YDK A;  2P5Q A;  4O5R A;  16GS A;  4MPF A;  2GQL A;  1KTE A;  2HZE B;  1IYI A;  2MBS A;  2VL2 A;  5GZZ B;  1WWJ A;  1ERW A;  2KLX A;  5G5F A;  3EU4 A;  5DQS A;  3ZTL A;  4MF6 A;  2FHE A;  1PN0 A;  3L9S A;  2LRT A;  1K0C A;  3MDK A;  5E59 A;  1DBY A;  2KP2 A;  3UJ1 A;  3DVW A;  5C04 A;  1VF4 A;  4CW9 A;  1O8W A;  1PX6 A;  4OFT A;  5HR2 A;  1XWC A;  1MDI A;  4EL1 A;  3ZL5 A;  2L57 A;  2JZT A;  3QD9 A;  1J9B A;  2VM1 A;  4L5O A;  1WPI A;  1LBK A;  3EC3 A;  1G0T A;  5ID2 A;  1FAA A;  1YEX A;  2LKU A;  3GFK A;  20GS A;  3KH9 A;  4MCU A;  3HJP A;  1HQO A;  1AUC A;  5JWQ B;  3EUR A;  3CBU A;  5ID2 B;  2X8H A;  4K2D A;  2PU9 C;  4NV2 A;  4J56 E;  3L9U A;  1ERU A;  3NOF A;  4ICY A;  1U87 A;  4CHS A;  3IR4 A;  1TK5 B;  4NV5 A;  1RW1 A;  3ZZX A;  3C1S A;  2WCI A;  2YWO A;  2B7K A;  3QOU A;  2PN8 A;  1Z3E A;  2H30 A;  2M46 A;  1SD9 A;  4WR5 A;  3UVH A;  2DIY A;  4IP6 A;  3ZIV A;  2PVQ A;  2CX3 A;  2G2Q A;  3HCZ A;  1SYR A;  2VCV A;  3EU3 A;  3HHV A;  5ECL B;  2L4C A;  5D9V A;  2LEG A;  4HQZ A;  1W89 A;  4O7H A;  1EP7 A;  2HFD A;  5J5N A;  2HI7 A;  4XS6 A;  3D22 A;  3PIN A;  3GKM A;  4ZIL A;  5D96 A;  3TKR A;  2X49 A;  4NXI A;  5DDL A;  5F0G A;  6GSX A;  1TRV A;  4HU9 A;  4PQI A;  1TDI A;  5HFI A;  2M80 A;  4K2X A;  1NSW A;  4GRF A;  2DJK A;  2JU5 A;  4EUY A;  4ISD A;  2I81 A;  3GYK A;  5CO3 A;  1TXX A;  2H0I A;  2MBT A;  4K9Z A;  2FWH A;  4HZ2 A;  3KTB A;  4PNG A;  4ECJ A;  3G9B A;  4HZ4 A;  4XS1 A;  3W8J A;  2V2G A;  3ZML A;  3V1W A;  4DSS A;  3QAV A;  3D5J A;  1IYH A;  1PRX A;  5GSS A;  3CSI A;  4ULX A;  4OFM A;  3D4M A;  3HVS A;  3L0H A;  1XWG A;  2CVB A;  2VD0 A;  1ZYE A;  5H5Q A;  3GMF A;  1R26 A;  1Z7P A;  4XHM A;  2LV3 A;  4IEL A;  4J57 E;  2V32 A;  5ECM B;  3LJR A;  3US3 A;  2AB6 A;  2MMO A;  2H0H A;  1YY7 A;  4GLT A;  1OYJ A;  1JLV A;  2ZNM A;  4JED A;  4EF0 A;  1O6J A;  2DC5 A;  4G2E A;  4OO4 A;  1XWA A;  1U6T A;  4MAB A;  4TXV A;  1EP8 A;  1V57 A;  4G0K A;  3UAR A;  1GSS A;  4GF0 A;  4D73 B;  1RK4 A;  5DJL A;  1TRU A;  5H5S A;  1XVW A;  3GH9 A;  1A23 A;  3GUR A;  4HJM A;  5D9W A;  5G2Z A;  1A2J A;  2L6D A;  4TOP A;  4ILF A;  2GLR A;  3GL5 A;  2ZUP A;  1M9A A;  2GZP A;  1CQG A;  2GGT A;  1JLW A;  1S3C A;  3MWH A;  1WIK A;  4X1U A;  2R4V A;  3L78 A;  1A24 A;  2HRA A;  4BWQ A;  2CT6 A;  4IBP A;  4TR1 B;  2ALB A;  2QA1 A;  4KAE A;  2JL4 A;  2MMZ A;  4KGI A;  1PL2 A;  3ZRE A;  2DIZ A;  5JWO B;  2FA8 A;  4OMV A;  4AJ6 A;  2LNS A;  3ME7 A;  4JRR A;  3P8W A;  5IMF A;  2UZ8 A;  4ECC A;  3TJJ A;  4V1A p;  4BL7 B;  1GTU A;  3A3T A;  5DVB A;  2CV4 A;  4LMW A;  3MIX A;  1JZW A;  5ECI B;  3EMX A;  2N5B A;  4MA9 A;  3LQ7 A;  3A5I A;  2HZE A;  2HT9 A;  1EGR A;  4H86 A;  2B3S A;  3HZ8 A;  3NZN A;  4FQU A;  1YF0 A;  3EIN A;  4Z2U A;  4MZC A;  1WOU A;  2E2M A;  1TK0 B;  3DYR A;  3IC8 A;  1F9M A;  4KCE A;  4O5Q A;  3P2A A;  5ELA A;  1O81 A;  1H4O A;  1BJX A;  3BJ5 A;  2H72 A;  1FVJ A;  3C1R A;  4NPB A;  4ZB6 A;  2GSS A;  3UEM A;  1TJD A;  3DWV A;  1EOH A;  1X5C A;  2H6X A;  1BYE A;  2H75 A;  3ZLP A;  3M8N A;  2IJY A;  1U88 A;  5ECR B;  5H5R A;  3MYD A;  3I6A A;  5KN2 A;  4X43 A;  4JZQ A;  1SJI A;  3EMP A;  5ECS A;  4EC0 A;  2IMF A;  1TK8 B;  3VUR A;  3TOT A;  4ZL8 A;  4RQX A;  9GSS A;  1AXD A;  2OKA A;  2C80 A;  3FMW A;  4V2L A;  1DUG A;  5IO2 A;  1Z5Y E;  4G0L A;  2FY6 A;  1SL1 B;  3QR6 A;  2FA4 A;  3UBL A;  2NPB A;  5IPG A;  1G6W A;  1E6B A;  1OC9 A;  1XFL A;  2BJX A;  3F6F A;  2DJ1 A;  4O5U A;  5B8A A;  1OKT A;  2R0G A;  1DSB A;  3PPU A;  1R5A A;  3MAK A;  2IIY A;  2EIQ A;  5DAL B;  5IOW A;  1R7H A;  2VO4 A;  5ECN B;  4AJ8 A;  3LG6 A;  2E0Q A;  4BVY B;  1SK0 A;  3KIJ A;  4G10 A;  5GST A;  4YQV A;  4BVX B;  4TN8 A;  1SK2 A;  4L0W A;  2V6K A;  1NW2 A;  3AY8 A;  4PQH A;  3EYT A;  4KDU A;  2R3X A;  3KXO A;  1K0O A;  3NIV A;  3M9J A;  2F3M A;  1SKR B;  4KW6 A;  2F9S A;  1X9W B;  3ZRD A;  2LRC A;  1EGO A;  4KND A;  4KH7 A;  4F2I A;  1MDJ A;  4Q5Q A;  1YKC A;  3BCI A;  2QA2 A;  3VI5 A;  3KGK A;  3GKX A;  1M2A A;  5KOW A;  3UAP A;  10GS A;  2GST A;  1X5D A;  1K0B A;  1W4V A;  2RM5 A;  3H79 A;  1O73 A;  2H1D A;  4USS A;  4J2F A;  5FT3 A;  4POM A;  1XPV A;  3UOM A;  4KE3 A;  5B8B A;  1MEK A;  4IGJ A;  2CAQ A;  3IDV A;  5AN1 A;  4V2M A;  4NHZ A;  2WUL A;  8GSS A;  1HNA A;  5ECK B;  3FW2 A;  3IAS 2;  3FRC A;  4EVM A;  4TR0 A;  2GVP A;  6GSW A;  1XXU A;  4G19 A;  1PL1 A;  1C72 A;  4L5L A;  2G0F A;  2XBQ A;  3VI7 A;  3TKQ A;  5EVO A;  1Z6M A;  2FD3 A;  1QUW A;  1XOB A;  3OR5 A;  5A4V A;  3ED3 A;  1FOH A;  5LNK e;  4FYU A;  3GV1 A;  1K3Y A;  2B5Y A;  4HI7 A;  2H66 A;  2XBI A;  2VCW A;  3ZYW A;  5GAP D;  3HVV A;  3C73 A;  2MYG A;  4MNN A;  1OVN A;  3KEB A;  2C0G A;  2OJL A;  1AQX A;  1YKA A;  2BTO T;  2I3Y A;  1XOA A;  5IMC A;  4MZW A;  2I4A A;  3ISO A;  1S3D A;  3JCM L;  1VGL A;  5EY6 A;  2C3N A;  2GS3 A;  2PWJ A;  4IW9 A;  1PKW A;  4OCF A;  1X9S B;  3E0U A;  5EPF A;  4F0C A;  1GH2 A;  4ML1 A;  1HD2 A;  1VF2 A;  3ERW A;  1ZZY A;  2L6C A;  1DE1 A;  2OE3 A;  2IYJ A;  4CDO A;  1Z7R A;  3U6V A;  3DML A;  3KJY A;  1UVZ A;  4RUV A;  1K3O A;  3D0Z A;  1AC1 A;  2LQQ A;  4PXO A;  2H1G A;  2AAW A;  5IPH A;  2O7K A;  11GS A;  1GSU A;  4BPY A;  4TXO A;  4POB A;  4MJC A;  1KEB A;  4ZB9 A;  4KF9 A;  4EO3 A;  3HD5 A;  1X9M B;  4YKF A;  2YAN A;  3RDW A;  3RAZ A;  4Q5R A;  6GSU A;  2DML A;  1ZCP A;  5DAK B;  2MMN A;  4LL4 B;  1PX7 A;  2H8L A;  4EIP A;  5DQY A;  3ERG A;  4I2U A;  3E3E A;  2X99 A;  2RII A;  1ML6 A;  2CX4 A;  5JWR B;  1XCC A;  3DEX A;  2K9F A;  2IN3 A;  5C00 A;  1SKS B;  4IVF A;  3UL3 A;  2GDR A;  3D6I A;  1X5E A;  3HJO A;  2C0D A;  1WMJ A;  1QK8 A;  3QFA C;  3D21 A;  2YNX A;  2C4J A;  1I5G A;  3CXG A;  5IM9 A;  1JZD A;  2GQK A;  1V2A A;  5AIX A;  3CRT A;  4IS0 A;  1GUK A;  3FY7 A;  1PA3 A;  1YQ1 A;  1SL2 B;  3IC4 A;  4HOJ A;  3RHB A;  4ZB8 A;  3IBH A;  2WB9 A;  4EDZ A;  3HJM A;  5CNW A;  4E8E A;  5IMD A;  1GSE A;  3N5O A;  4Z2R A;  1U3A A;  1XW5 A;  3EWL A;  5ECP B;  4A5P A;  5ECH B;  2N5F A;  1HNB A;  3C7M A;  1Q4J A;  1FOV A;  5FHI A;  1PD2 1;  3APS A;  3LGC A;  1VRS D;  2YV7 A;  1MD4 A;  5IO0 A;  1AAZ A;  3F6D A;  2LS5 A;  2L4Q A;  4K7I A;  2AUV A;  1PQN A;  3UVT A;  3BD2 A;  3BCK A;  3CSJ A;  4FIW A;  19GS A;  2FWF A;  5KOX A;  2WDU A;  5KN0 A;  4QL7 A;  3VPQ A;  3IA1 A;  3ME8 A;  3IOS A;  2FWG A;  5D93 A;  1GSY A;  1QGV A;  3WD6 A;  1ZYP A;  2WZ9 A;  4AJ7 A;  4G0I A;  1K0D A;  1RQM A;  1QFN A;  1GUH A;  3HYP A;  2OA7 A;  2HSY A;  4OCE A;  2VLT A;  5HQP A;  4I97 A;  2VM2 A;  1M2B A;  3CRU A;  3EE2 A;  3QMX A;  1AQV A;  1NHO A;  7GSS A;  1J0F A;  3IPZ A;  1V40 A;  1M99 A;  2FWE A;  1WJK A;  4KX4 A;  6GST A;  2WFC A;  17GS A;  2JZR A;  2X64 A;  22GS A;  2VL2 C;  3SBC A;  5G5E A;  2VCZ A;  2D2Z A;  3P90 A;  1EV4 A;  4N0V A;  2XC2 A;  5G1K A;  4XCS A;  4I8B A;  2L59 A;  4WKW A;  3A5W A;  1GTI A;  2DKH A;  2HSM A;  3UIW A;  4ZBA A;  2X4A A;  1T8E B;  5BRT A;  1YF1 A;  4MJB A;  5CAX A;  1XZO A;  1Z9H A;  4G9H A;  4O92 A;  4I5Q A;  2YWM A;  4X4J A;  4MF5 A;  3RPP A;  3TKP A;  3VWW A;  2XPE A;  3KMN A;  1AQW A;  14GS A;  2YZU A;  2H71 A;  1F3A A;  2K8V A;  1T7P B;  3O3T A;  4PNF A;  3O6T A;  1BX9 A;  1TP9 A;  2C0E A;  2NTO A;  1GLQ A;  4KCA A;  3SWL A;  1SU9 A;  4ZL7 A;  3APO A;  3IK7 A;  1LJR A;  3CTF A;  3FEU A;  3RPN A;  1F2E A;  4IN0 A;  4ZXG A;  2TRX A;  4TKY A;  2YPM A;  5ENU A;  4V2N A;  1WE0 A;  2EIR A;  4XRD A;  1WP0 A;  2N5A A;  6GSS A;  4DEJ A;  5F8B A;  4NHW A;  3VWU A;  2VUP A;  4RI6 A;  3GRX A;  4N30 A;  4BA7 A;  1HYU A;  4WET A;  4I6X A;  2C0F A;  18GS A;  1JFU A;  2B5E A;  5B6M A;  1GWC A;  1FW1 A;  2I1U A;  3IHG A;  4ML6 A;  1GUM A;  3U5R E;  1G7E A;  1PKZ A;  1UC7 A;  1OC3 A;  3TCO A;  4YAV A;  4JE1 A;  2HZF A;  4IP1 A;  3IRA A;  1OC9 B;  2GSQ A;  12GS A;  3GIX A;  3LYK A;  2KP1 A;  4ZIJ A;  3ZVJ A;  3A2W A;  1GL8 A;  5A4U A;  1EEM A;  4KDY A;  3N9J A;  5KN1 A;  2IFQ B;  2B7J A;  3F8U A;  1SL0 B;  5HR1 A;  2L5O A;  1SYX A;  4IJ3 A;  2JSY A;  3DXB A;  5CRE A;  4HUA A;  1GLP A;  2B5X A;  3H4K A;  3CMI A;  1CQH A;  4O32 A;  5ECQ B;  5J41 A;  5B7C A;  2LJR A;  3Q74 A;  5DCG A;  5CRW A;  2YWI A;  4CY6 A;  1Q98 A;  4KB3 A;  4TR3 A;  1E2Y A;  3I43 A;  3KCM A;  3R3E A;  3TKS C;  1GRX A;  3FZA A;  4IQA A;  13GS A;  2PGT A;  2AHE A;  4KUN A;  4WBR D;  2F8A A;  4JU5 A;  3VLN A;  3ZFB A;  4IQ1 A;  1A8L A;  3QCP A;  1ACV A;  2O85 A;  4KSO A;  1V9W A;  4EXJ A;  4YH2 A;  5KEJ A;  1O8X A;  1YEP A;  1U3I A;  2H6Z A;  2WJU A;  4EIQ A;  3FYG A;  5IMV A;  3PGT A;  2X8G A;  3P7X A;  4OWY A;  3VK9 A;  4F82 A;  2I9H A;  1UN2 A;  4OO5 A;  1ZYQ B;  1YJ6 A;  2FGX A;  4GSS A;  1ILO A;  2DKI A;  2RUF A;  2ZCT A;  4GTU A;  1FVK A;  2P31 A;  1BG5 A;  2YZH A;  3C8E A;  1Z6N A;  5IOX A;  1EV9 A;  2LNT A;  1ST9 A;  2VLU A;  3GX0 A;  5DBQ A;  2RUE A;  5HR0 A;  4HQS A;  2IMI A;  3KP8 A;  3FK8 A;  1R5P A;  3IE3 A;  4XS4 A;  2KUC A;  3TJK A;  4Q5N A;  2C1Y A;  2GQM A;  5CRG A;  4LMV A;  3A2X A;  3TDG A;  2H19 A;  1FO5 A;  2ON5 A;  5J4U A;  2A4H A;  4POL A;  3BOA A;  1QQ2 A;  4MJE A;  4AF2 A;  3UMA A;  2LJK A;  1MTC A;  4DSR A;  5L71 A;  2K8S A;  1TRS A;  3TJF A;  3IHQ A;  4GSN A;  2XPD A;  3G7Y A;  3K8N A;  4HDE A;  3F3Q A;  3Q18 A;  1GTB A;  2O8V B;  1XW6 A;  3LWA A;  2V41 A;  5BMU A;  2CVK A;  1TU8 A;  4F03 A;  5CRD A;  3I69 A;  1OAZ A;  2K6V A;  4K5S A;  2KHP A;  1TU7 A;  2REM A;  2V6O A;  5D9T A;  2YJH A;  4XIH A;  1PSQ A;  4MDC A;  4K0G A;  2IME A;  4XRA A;  2B1L A;  4EKZ A;  5GAN D;  3WYW A;  4JR6 A;  1M2D A;  1PGT A;  3TRX A;  3LXZ A;  4K7N A;  3RBT A;  1HNC A;  2TIR A;  4K8M A;  4OD7 A;  3GN3 A;  4LLR A;  2RLI A;  2A2S A;  3DGQ A;  3TOU A;  3G7I A;  2HLS A;  2HNL A;  4JBB A;  1B9X C;  3KM6 A;  3GNJ A;  3EPT A;  3S9F A;  5F06 A;  2P0G A;  1A8Y A;  1T00 A;  2FUG 2;  1USB A;  1K0N A;  5J9C A;  4L8E A;  4F9Z A;  2PUK C;  2PPT A;  4NMU A;  1VF1 A;  2DJJ A;  4MPG A;  4NAX A;  3HVX A;  2C3Q A;  2CAI A;  5FWG A;  2FNO A;  3C71 A;  4TW5 A;  1O7U A;  3GUS A;  2DLX A;  4P3Y B;  1QMV A;  4I2T A;  3GTU A;  1SD8 A;  2DBC A;  3LEF A;  2LTK A;  1GNW A;  2YN1 A;  2H76 A;  1NHY A;  4MK3 A;  5G1L A;  4Q5F A;  4X0X A;  2FLS A;  1ZOF A;  2LQO A;  3CSH A;  5F05 A;  3MNG A;  3WT1 A;  5LCZ A;  3FZ9 A;  1BAY A;  5D8I A;  2AYT A;  5CRH A;  2PER A;  1VF3 A;  3J7Y b;  5A4W A;  2H70 A;  5JCU A;  4IHU A;  2HRF A;  4RQR A;  2XHF A;  2VAF A;  5LD0 A;  4MP4 A;  1T4Z A;  2LUS A;  1ZMA A;  4BVX A;  2VLV A;  1H75 A;  3TRQ A;  2VOC A;  1SK1 A;  4KA0 A;  2O87 A;  1K0A A;  2QKE A;  1URM A;  1MD3 A;  3W6G A;  4PUA A;  5DAL A;  1GSD A;  2FCH A;  3QAW A;  1WRY A;  4PQ1 A;  2CZ3 A;  1R4W A;  2HE3 A;  3LOR A;  2HXK A;  1EEJ A;  2YCD A;  3VPT A;  1F6M C;  4K0N A;  3HZ4 A;  4JR4 A;  4D73 A;  1ON4 A;  1SJZ A;  3J7Y k;  4XS4 B;  2VL3 A;  4TXO B;  3FZ5 A;  4WF5 A;  1FB6 A;  2YP6 A;  4HEA 2;  2CA8 A;  4POK A;  5ECO B;  3HKR A;  2H0G A;  3W8S A;  2KOK A;  3HDC A;  1A0F A;  1N2A A;  3KD0 A;  3FZ4 A;  2R0C A;  1F3B A;  4Z7X A;  1ERT A;  1PMT A;  3PR8 A;  3PH9 A;  4LA1 A;  3LYP A;  3TJG A;  4FYC A;  1KNG A;  1ZYN A;  1G6Y A;  3DIE A;  4BVY A;  3L4N A;  4ECI A;  3BBY A;  1EOG A;  4DSS B;  3R2Q A;  1OE7 A;  2L5L A;  5EL8 A;  2DJ0 A;  1QXH A;  2AJQ B;  2IFQ A;  2DMM A;  4ACS A;  1FHE A;  3VWV A;  1Y6E A;  4FYB A;  3CTG A;  1EWX A;  3DKS A;  3M0F A;  1GTA A;  3IK9 A;  1OKD A;  4PGT A;  3FR9 A;  1JZR A;  3F4S A;  1EZK A;  3QDN A;  1THX A;  4L0U A;  5G31 A;  3FHK A;  5AGY A;  3UBK A;  1N8J A;  5HFK A;  3KP9 A;  1AIU A;  2A2P A;  4PTS A;  4NWY A;  1J08 A;  3KZQ A;  1A0R P;  4IKH A;  1BQ7 A;  2P5R A;  1JZO A;  2WRT A;  3DRN A;  1THO A;  5DJM A;  4ZBB A;  4WR4 A;  2H01 A;  1ZL9 A;  2B6M A;  2CVD A;  4GWR A;  4TR4 A;  2H1A A;  3QPM A;  3H8Q A;  2YWN A;  3DVX A;  1GP1 A;  1FB0 A;  6GSV A;  3ZFL A;  3KTL A;  3ZMK A;  2OBK A;  4BWS A;  3F63 A;  3TUE A;  1JHB A;  2RM6 A;  3VWX A;  1XBS A;  2O89 A;  4XTS A;  4ECB A;  3TRP A;  5IMA A;  3Q6O A;  3GST A;  3WT2 A;  3D4T A;  3GTU B;  3HXS A;  4IJI A;  2R2J A;  4N0Z A;  4WBJ A;  5HR3 A;  1GSQ A;  1UA5 A;  2YJ7 A;  4LL1 B;  3ZIT A;  4QL9 A;  3APQ A;  2F8F A;  2R37 A;  1GNE A;  1NM3 A;  2C3T A;  1XWK A;  2H73 A;  3HY2 A;  2GT5 A;  2GT6 A;  3M9K A;  2E2G A;  2MZC A;  1ERV A;  1OC8 A;  4MF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...