2H0IA

Crystal structure of dsbg v216m mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAMGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbG
total genus 65
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0iA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0iA02
3VPTA 3ME8A 1OYJA 3KIJA 4MZWA 2KOKA 9GSSA 1PX7A 4ILFA 4HQZA 4QL7A 1ERUA 4YH2A 1GSQA 2WDUA 4BWSA 2MYGA 2VIMA 3FYGA 3KZQA 1WOUA 2IMIA 1C72A 2JADA 2LQOA 3LGCA 4NMUA 4ULXA 4GRFA 3GKKA 1FHEA 4GLTA 1K0AA 3E0UA 3TDGA 3GV1A 3CXGA 4I8BA 20GSA 1O7UA 3ZTLA 3DEXA 5IOWA 3WT1A 2YP6A 2PERA 3FZ9A 3GH9A 2BTOT 4MH3A 2RUFA 2M80A 3DRNA 3BBYA 3HZ4A 3W8SA 1F3BA 2OBKA 2EIOA 1Z7RA 2JSZA 4IBPA 2VCQA 1Z5YE 4NAXA 4MDCA 1TK0B 1GL8A 1M99A 4MJAA 3TB2A 5DDLA 2H76A 3M8NA 2LJAA 1SK2A 3HJMA 4MF5A 2H1GA 3IOSA 1EGRA 2VD1A 2CVBA 5DCGA 4HU9A 2GVPA 2IMDA 1X5DA 2GGTA 5JWOB 2HZEA 5D9XA 2O7KA 4KB3A 1MD3A 5EY6A 2OBIA 2TRCP 5ECPB 1YF1A 2PVQA 7GSSA 1UC7A 2YPMA 1TK5B 4XHMA 2CAIA 2DJKA 3HD5A 2G0FA 2FWHA 2H66A 1TRSA 3LWAA 4IHUA 3GRXA 4L0WA 3GIXA 2GZYA 5HFIA 3NZNA 1FB6A 2YN1A 4NHZA 2L4CA 2H0HA 3F4TA 2CX4A 4LA1A 4ZIJA 1RK4A 2JSYA 2V41A 1MD4A 4IP1A 4ZB6A 2HLSA 4OD7A 1KTEA 1NM3A 4JE1A 2C8UA 1G6YA 2RUEA 3KEBA 2NTOA 2FA4A 1M9BA 3WGEA 1ML6A 3TCOA 2GTUA 1USBA 1EOGA 3MSZA 3M3MA 12GSA 2VD0A 1AQVA 4PURA 4N10A 3R2QA 2G2QA 2R37A 1U88A 1BQ7A 2FNOA 2MMNA 4KDYA 1FG4A 5G1LA 3C73A 3ED3A 3RAZA 1QMVA 19GSA 4HZ4A 4GF0A 2WCIA 2GQMA 2XBQA 5ID2A 1PRXA 4KCEA 4RUVA 6GSWA 5ECRB 1EEMA 2YOIA 1XWGA 3UEMA 2JZSA 2I81A 1SJIA 1GNWA 5B8AA 4L8EA 4NV5A 1F37A 3C1SA 3HXSA 2J9HA 2BJXA 2H71A 4WR5A 1F3AA 4LMVA 4ZB9A 3Q74A 5ECHB 3PGTA 1XCCA 3D6IA 4TVEA 2TRXA 3IAM2 1O73A 4TR1A 3P7XA 2FLSA 1WE0A 1EV9A 3Q6OA 1BYEA 4ML1A 3D5JA 1S3CA 5F8BA 4YQVA 4FIWA 1JZWA 1GSFA 2ON5A 5CRHA 3UJ1A 1SL2B 3IA1A 5JCGA 3UL3A 1XPVA 2R3XA 1HYUA 2PUKC 4KE3A 2AYTA 1ZYEA 2XPDA 2EIRA 1THXA 2X8HA 3TRPA 4L5OA 2MMZA 1FW1A 2REMA 2ZCTA 4JZQA 4F9ZA 2M72A 1O85A 1EEJA 1ILOA 4OCFA 1YZXA 2GSRA 2XHFA 3HVSA 1V2AA 2GQLA 1OKTA 4TXVA 4GQCA 2ZNMA 3EC3A 3GYKA 4TR0A 3GKXA 1TI1A 3LQ7A 1X9MB 2HZFA 5IMAA 1FB0A 4O32A 5H5QA 2DJ0A 2JACA 3ZL5A 1PQNA 5ENUA 1XZOA 4K1FA 5KN1A 2L5OA 4EO3A 3QMXA 3VFIA 1YDKA 5ELAA 2B1KA 1V98A 1U3AA 2B5YA 5HQPA 1K3YA 5IOXA 2H0GA 1FOVA 3O6TA 4MF6A 1LBKA 5CAXA 3UVTA 4L0UA 4XRDA 2CT6A 3TJGA 1GLQA 3TOUA 4J2FA 2IFQA 1PL1A 3TKSA 4HZ2A 3WGXA 3ZVJD 4IJ3A 1OE7A 2CVDA 5H5SA 3S9FA 3W8JA 1R5PA 4O92A 1K3OA 1AIUA 2PMTA 2DJ1A 4GSTA 2AAWA 1M9AA 3JCML 1PSQA 4D73B 4OFMA 5B6MA 1O6JA 2OACA 1NHYA 3QPMA 3HJPA 2RM5A 2F51A 1S3AA 3US3A 2YWOA 2HT9A 4PUFC 4I2TA 2L59A 4IKHA 4RQRA 4O7HA 1JLVA 2R2JA 3EINA 4IJIA 1AUCA 2P5RA 3HJOA 3M0FA 4YAVA 5HR2A 2CX3A 4PX1A 2F8AA 1U87A 5IMFA 4QL9A 4BA7A 1Z9HA 3H4KA 4WBRD 4MABA 5J9CA 2KP2A 2E2MA 1OKDA 5DCHA 3U6VA 1M2AA 1XWKA 2L6CA 3TKPA 1FAAA 5ECQB 2VO4A 3PR8A 1SJ6A 3F8UA 5ECLB 1MDKA 2I3YA 1WMJA 13GSA 1XW6A 3VWVA 2HRNA 1OVNA 3GFKA 2C80A 2GSQA 6GSTA 1QK8A 1CQGA 1QUWA 5ECOB 4WKWA 1RW1A 2YWMA 5IO2A 3VI5A 3QOUA 1EOHA 4KGIA 1X5EA 5F0GA 3EURA 1UN2A 3W6GA 3TJJA 3GTUA 4EDZA 3CMIA 2V6KA 2GQKA 4POMA 1NSWA 4MH2A 2I1UA 1PMTA 1DE1A 2AV4A 4KX4A 4ID0A 1N8JA 3VWXA 2R4VA 2DSAA 4KCAA 4E8EA 5G31A 2GDRA 1JZOA 3GTUB 2VCXA 3L9VA 3KP9A 1TKDB 4HUAA 4MP4A 2MBSA 3LG6A 3EVIA 2GZPA 3APOA 2FWFA 2LTKA 1GTBA 1H4OA 2WJUA 2L5LA 4L5LA 5HR3A 1M7TA 3K8NA 3M9JA 1B4PA 2RM6A 1ERWA 4BVXA 5GSTA 2PBJA 5DAKB 2Z9SA 3FR3A 4FYCA 5IPGA 1AQWA 5E4WA 1WIKA 4BL7A 2LQQA 6GSXA 4ZB8A 4HOJA 4FYUA 2AJQB 5IQYA 1K0BA 1SYXA 5G5EA 3AY8A 3GMFA 3WYWA 5G1KA 2FUG2 3PINA 3N5OA 1NHOA 1SL1B 1O8WA 3GNJA 1XOBA 4TXOB 1HNAA 3EMPA 2D2ZA 2XPEA 2H6YA 4PGTA 3WT2A 3G7IA 4HDEA 4RQXA 4MPGA 3IK7A 3ZYWA 1XIYA 2FWEA 4NHWA 3UAPA 4AJ6A 3ZMLA 3ERFA 2K18A 2H1DA 2TIRA 3EWLA 4N30A 3UARA 1G7OA 3VI7A 5EVOA 1OC9B 2PVOC 4Q5RA 1GUHA 5IMCA 3RPPA 4NXIA 4F82A 4ZL7A 1QXHA 4D73A 4TXOA 4AJ8A 2LRTA 2IMEA 1A0FA 2IY2A 2NBSA 3LYPA 2YANA 1T4YA 3TKSC 5A4VA 3QAGA 2H72A 2VCZA 4V2LA 1ZOFA 1TRUA 1V58A 2PN8A 3GURA 2VL2A 1A2MA 1AXDA 3GL5A 2F3MA 5E59A 3Q19A 3I43A 2YWNA 4IELA 5IPHA 1TI3A 1MEKA 3G9BA 3CSIA 2DC5A 3BOAA 1J9BA 1E6BA 1GTIA 2YNXA 3IXRA 4WBJA 5D73A 2B5XA 4K7IA 4JBBA 1GWCA 3UIWA 4KH7A 4K8MA 5IMZA 1B4QA 2C4JA 1MTCA 1Y6EA 1PA3A 2KP1A 1QFNA 5EPFA 4TN8A 4EXJA 1ZYQB 2K9FA 1WWJA 3O3TA 4V2NA 1HD2A 3P2AA 5IMDA 4XIHA 3TJFA 3ZVJA 3J7Yk 4PQHA 2PGTA 4GXZA 2CVKA 1O8XA 2WB9A 2OADA 2HYXA 3KGKA 3TKSE 4ECBA 17GSA 4G9HA 1XBSA 1JZDA 1XWCA 3ZIJA 4MF7A 4KSMA 2WZ9A 1YKCA 1GSEA 3ERGA 3CBUA 3GUSA 2HSHA 4NPBA 3IV4A 3RBTA 2LJRA 2A2RA 3SWLA 4J56E 1T8EB 1T1VA 3HCZA 2QC7A 1M2BA 4WF4A 2L4QA 3QR6A 1PKWA 1VF4A 2B1LA 1SK0A 1WPIA 4POLA 1FVJA 2LJKA 4TR1B 2OE3A 2GSSA 3J7Yb 3DXBA 2L6DA 2GT6A 3EU3A 5AIVA 4G10A 5KEJA 5F07A 4EE0A 5CRDA 3CYNA 4OFTA 3KH7A 3G7JA 2V2GA 1M2DA 2R5GA 5J41A 4HEA2 1HNCA 3CRUA 2YJ7A 3A2WA 1BEDA 2FD3A 2B7KA 1FO5A 1JFUA 3GKMA 4BVYA 1A23A 4GWRA 5AIXA 3E3EA 4H86A 3EYTA 2KUCA 1YF0A 2HSYA 1NW2A 1ERTA 1YEPA 2EIQA 4I2UA 1R7HA 1TRWA 4WR4A 3GA4A 2IMKA 2MZCA 1XOAA 3IAS2 4XS4B 2ZUPA 1S3DA 2VCWA 1EZKA 3BCIA 4AJ7A 1TK8B 2NDOA 2H74A 3RPNA 4ZILA 3G7YA 3A5WA 1PN9A 3HHVA 4K7OA 3VPQA 4GSSA 5JCWA 5J9BA 3H1NA 1EV4A 1CQHA 3FR6A 2ALBA 5ELGA 3UOMA 5H5RA 3F6FA 1PKZA 4WETA 1X5CA 1XWBA 4MJBA 1TOFA 3LYKA 4KW6A 4X43A 5JWQB 4ZL8A 3FK8A 2C3TA 2E0QA 1SENA 6GSUA 4GSNA 2MBTA 5AGYA 4HJMA 3BD2A 1WP0A 3TJKA 2NPBA 4BPYA 1V9WA 3P8WA 1EP8A 2WS2A 2PU9C 3GX8A 1PX6A 4DEJA 2N5FA 4TRXA 5FHIA 3A3TA 4AGSA 3ZIVA 2X8CA 2HZEB 4ECJA 3IE3A 3DVWA 3D21A 3I69A 3H79A 4IP6A 1BG5A 3CSHA 1ABAA 4O5RA 2ES7A 3CTFA 1R4WA 1AC1A 5CP1A 3ZMKA 4MZCA 2LS5A 2I4AA 3IR4A 2H70A 1ZCPA 4GTUA 1GUKA 3NOFA 5COHA 1SJZA 6GSVA 3RHCA 4HU7A 2EC4A 1WJKA 4MLYA 3MAKA 1ZGNA 3GH6A 3FKFA 1GTAA 5GZZB 1LJRA 2LSTA 5INYA 3EMXA 3FZAA 2N5AA 4KAEA 3QAWA 5G30A 5HFGA 2FCHA 2OE0A 3ZITA 1R5AA 1Z3EA 5CRGA 1MDJA 3ZZXA 3CTGA 3APSA 1A2LA 2JU5A 5CYYA 2WFCA 1HQOA 4DSQA 2GS3A 4ISDA 5D9VA 6GSYA 2DBCA 1K0CA 1EGOA 1BX9A 1VF3A 4ACSA 3ZREA 5ID2B 16GSA 2MMAA 4P3YB 4V1Ap 2HXKA 3C8EA 3OR5A 3HA9A 2AHEA 3EU4A 3HYPA 4RI7A 4LMWA 2ON7A 6GSSA 5DVBA 4EF0A 3DD3A 2C3QA 1F9MA 4POBA 2RIIA 2K6VA 5GSSA 2GSTA 2R6KA 3FW2A 4XTSA 4EL1A 4IW9A 2NVLA 1GSSA 2YWIA 2C0EA 2XBIA 2OKAA 2B5EA 2OE1A 4OO4A 2A2SA 3L9SA 5A5KA 2IWTA 4LL1B 1VF1A 2KLXA 5KN2A 1EWXA 1B9XC 3QCPA 5G5FA 2P31A 4ZBAA 3Q18A 1EP7A 2JZRA 4HQSA 2E7PA 2AUVA 3ZFBA 2HRFA 2IJYA 3VWUA 4K6XA 4HS1A 4FYBA 1JZRA 1G6WA 2A4VA 4MCUA 3DKSA 1SKWB 3L4NA 1OC3A 4Q5NA 3HY2A 3DVXA 5HR0A 2C3NA 3IC4A 1THOA 2DIYA 4I97A 5ECNB 3ZFLA 4NWYA 4IQAA 3GKNA 1SU9A 14GSA 5GAND 2F9SA 4TR4A 1ACVA 2FGXA 5IM9A 1OE8A 2FA8A 3TUEA 2VLVA 4ECCA 1K0DA 4CDOA 1A2JA 1E2YA 3RDWA 1G7EA 4OFNA 4OO5A 1GSYA 1XFLA 2IN3A 3DMLA 2YCDA 4Q5FA 3DYRA 2I9HA 3MNGA 4HI7A 1KEBA 3D4TA 4XS1A 1GP1A 1Q98A 4ECIA 3QFAC 3O76A 2O8VB 3M9KA 3I9V2 5FT3A 2VL2C 2H1AA 4N0ZA 4I5QA 11GSA 4EUYA 1GLPA 1X0RA 5DALA 2P5QA 3LFLA 2IPAA 5IMVA 2CZ2A 2LEGA 3KM6A 4J57E 3HKRA 5A4WA 3TRQA 4ML6A 2WULA 2J23A 4KUNA 4LL4B 3IDVA 5IIZA 2P0GA 4K0NA 4TOPA 2JZTA 3LJRA 1ON4A 5ECMB 2VL9A 3PH9A 5D8IA 1I9DA 2M46A 1R26A 2VL3A 4V2MA 5C04A 1DE2A 1I5GA 1UA5A 1G0TA 1YQ1A 2IYJA 5FWGA 1B48A 2H19A 2QKEA 3KMOA 2C0GA 1YKAA 2O89A 1RQMA 4TR3A 4XS4A 3E9JB 1SKRB 3TKRA 3N9JA 4E8HA 3RHBA 2H73A 4FO5A 2KHPA 4HJ2A 4N0VA 1TU7A 1XVWA 22GSA 4MJEA 1SD8A 4ZXGA 2CAQA 3I6AA 5DBQA 4PQ1A 1URMA 2DMLA 2CA8A 4PNGA 3LXZA 2B7JA 3QAVA 2X8GA 1T4ZA 1T7PB 2VUPA 3A2VA 2O87A 4XS6A 1YJ6A 1X9WB 4K9ZA 4X0XA 1SD9A 3FHKA 3ISOA 3KMNA 1OC9A 3DGQA 2PPTA 2N5BA 4X1UA 5HFKA 3MDKA 5L71A 2VOCA 1AAZA 1Z6NA 1GSUA 3IPZA 5EL8A 5JCUA 5B8BA 1TW9A 4F0CA 2GT5A 5D93A 3D4MA 5GAPD 4BWQA 1A24A 1TRVA 2VLUA 3V1WA 2H1BA 4WXTA 3GL3A 4NV2A 3FEUA 3TKQA 2GZZA 4G2EA 3WD6A 1MDIA 1W89A 2C0DA 2K8SA 3LORA 3DIEA 2B6MA 4PNFA 3CSJA 3DWVA 3SBCA 1IYIA 2HNLA 3F3QA 4WF5A 3LSZA 2H8LA 3FZ5A 1W4VA 3IHQA 2IMFA 3L78A 5DAKA 5C00A 1B9YC 1V40A 3P90A 3MWHA 4OMVA 3F0IA 2H75A 1A8YA 1A0RP 2H6XA 3VWWA 1VRSD 2LUSA 1J0FA 1K0NA 1IYHA 5A4UA 4MPFA 3GSSA 3F4RA 1X9SB 3KJYA 2DLXA 4KSOA 1O81A 4KDXA 4GQFA 2IIYA 2C1YA 3ME7A 4EC0A 4DSSA 5IO0A 3UMAA 2DJJA 1U6TA 2VCTA 4F03A 4PQIA 1ZZYA 3GSTA 3EE2A 4IVFA 3IK9A 1DUGA 1Q4JA 4OWYA 1XWAA 1TP9A 2VLTA 3KP8A 2V6OA 2H0IA 5G2ZA 3BCKA 1GTUA 4K0GA 4V1Ag 1TU8A 4G19A 2H30A 1KBNA 3A2XA 1JLWA 2HI7A 5AISA 3F4SA 2CZ3A 3HDCA 3KTBA 5B6NA 2VM2A 1GRXA 3F63A 3D22A 3H8QA 4IGJA 3QD9A 4K7NA 4MJCA 3C71A 4KNDA 3GX0A 3GN3A 2B3SA 3FRCA 5DQYA 1GH2A 1LU4A 1M0UA 4I6XA 3M1GA 1UVZA 1AQXA 4EVMA 2V32A 2PWJA 3L9UA 1ERVA 2YJHA 1PGTA 2VAFA 4OCEA 4JU5A 3TOTA 5J5NA 3VLNA 3HVVA 1N2AA 1J08A 3C1RA 5CNWA 2LKUA 4JR4A 3TGZA 3D0ZA 2YV9A 4ZL9A 1PL2A 3FY7A 3QFBC 3UBKA 3IBHA 3IRAA 10GSA 4CHSA 1XXUA 3KXOA 5J4UA 2L57A 1QQ2A 3NIVA 4IQ1A 2YZHA 3C7MA 4YQUA 2C0FA 5DJMA 4F0BA 5ECIB 1QGVA 5F06A 5B7CA 2O85A 1SYRA 3ERWA 4RI6A 4DVCA 3TRXA 4IN0A 2FWGA 4GCIA 3UVHA 3LEFA 2AB6A 4MA9A 4Z7XA 2FY6A 3HZ8A 4MZBA 1XW5A 4CW9A 2IFQB 1K0MA 1U3IA 4ZBDA 3ZLPA 4K2DA 2LRCA 5KN0A 1ST9A 4FH8A 2OA7A 5ECKB 4IS0A 18GSA 1VF2A 1A8LA 2JL4A 2V1MA 3KTLA 4YAPA 5LD0A 4DSRA 1T3BA 3LXTA 1GULA 2QGVA 3FZ4A 2YV7A 4WEYA 4YQMA 1GUMA 1TJDA 2CQ9A 5J3RA 4EKZA 2LNTA 1YEXA 1SK1A 4JRRA 3U5RE 4Q5QA 2H01A 4MK3A 1XVQA 3VK9A 4QQ7A 3UBLA 3CRTA 3FR9A 1K0OA 5ABRA 4TW5A 2HE3A 1DSBA 4LLRA 1XW9A 2H6ZA 4DSSB 1JHBA 2X64A 1OC8A 5AN1A 5DALB 3TJBA 3KCMA 3L0HA 3KD0A 1OAZA 2WRTA 1TTZA 5LCZA 4JR6A 2IL3A 1PD21 1H75A 4POKA 5DQSA 3ZRDA 1Z7PA 3KH9A 1SKSB 2CV4A 1TXXA 2F8FA 5DJLA 3APQA 1V57A 2LRNA 2VM1A 2FHEA 2X99A 1DBYA 4AF2A 1T00A 3F3RA 4PUAA 4ZBBA 2DJ3A 2YZUA 5HR1A 2XC2A 4EDYA 1WRYA 1HNBA 4MMMA 5F05A 4N11A 2LNSA 5JWRB 4XCSA 1YY7A 5D9WA 3F6DA 4PXOA 1Y25A 3VURA 4KDUA 3H93A 1K3LA 8GSSA 5LNKe 2RLIA 5CO3A 4XRAA 1F6MC 2E2GA 1AW9A 5CREA 2OJLA 2HFDA 3QDNA 5CRWA 2LV3A 2DJ2A 1TDIA 1Z6MA 2MMOA 2BMXA 3BJ5A 2QSIA 2VCVA 3GHAA 2GLRA 2K8VA 4KA0A 1ZMAA 3WGDA 1VGLA 2DMMA 5KN3A 1B8XA 1GNEA 1FVKA 1GSDA 5D96A 1KNGA 4JEDA 1ZL9A 3HVXA 1BAYA 4TKYA 4F2IA 2WGRA 2DIZA 1SL0B 1F2EA 5ECSA 1BJXA 3F9UA 5D9TA
chains in the Genus database with same CATH superfamily
3VPTA 1LNIA 3ME8A 2O3OA 1OYJA 4HM2B 3KIJA 4MZWA 2XSOB 2KOKA 9GSSA 3GWRA 1YHQ3 1PX7A 4ILFA 3RNTA 1OPYA 4HQZA 4QL7A 1ERUA 4YH2A 4R4KA 1GSQA 2WDUA 4BWSA 4YKGA 2MYGA 2VIMA 3FYGA 3KZQA 1WOUA 2IMIA 1C72A 2PNCA 2JADA 2LQOA 3X3XA 1BNGA 3LGCA 4NMUA 4ULXA 4GRFA 1B27A 3FKAA 4GHOA 3GKKA 1BNJA 1FHEA 4GLTA 1K0AA 1TU5A 2BMOB 1HKXA 3B4OA 1N9EA 3E0UA 4O3VA 3TDGA 3RGAA 3S5CA 1RGLA 3GV1A 5JPUA 3CXGA 3MYDA 1CH0A 4I8BA 20GSA 1O7UA 3ZTLA 3DEXA 3D3LA 5M18A 2ML5A 5IOWA 2P09A 5M19A 1FZUA 3WT1A 1W7CA 1JKGB 2YP6A 1HZ1A 4K5SA 2PERA 1LVNA 3FZ9A 3GH9A 2BTOT 1TRPA 2RUFA 5CXOA 4MH3A 2UZ8A 1R4YA 2M80A 3DRNA 1IT7A 3BBYA 3HZ4A 3KIIA 3W8SA 1RGGA 1F3BA 4GB5A 2OBKA 2EIOA 1B2SA 1STFI 1DVDA 1Z7RA 2JSZA 4IBPA 2VCQA 1Z5YE 4NAXA 4MDCA 1BANA 5IENA 1TK0B 1GL8A 1M99A 4MJAA 3TB2A 5DDLA 1RNBA 1ZYNA 2H76A 3M8NA 2LJAA 1SK2A 4HKVB 3HJMA 4LSOA 2H1GA 3IOSA 4MF5A 2VD1A 2CVBA 1EGRA 5DCGA 4HU9A 1NDOB 5HGRA 2GVPA 2IMDA 1X5DA 2GGTA 5JWOB 2HZEA 5D9XA 2O7KA 2KCDA 4KB3A 1I8VA 1MD3A 5EY6A 3CCJ3 2OBIA 2TRCP 1VQL3 5ECPB 2SBLA 5IERA 2OWPA 1YF1A 4G0KA 2PVQA 7GSSA 1UC7A 1BSEA 2YPMA 1I70A 5AI1A 1TK5B 4XHMA 2GBWB 2GBXB 2CAIA 2DJKA 3AGNA 3HD5A 2G0FA 4G0IA 2FWHA 2H66A 1TRSA 3LWAA 4IHUA 1IT8A 3GRXA 4L0WA 3GIXA 1GOYA 1JKGA 1MOLA 2GZYA 3UJMA 1RRHA 1RGAA 5HFIA 3JUMA 3F8HA 4WYKA 1FB6A 3NZNA 2YN1A 2Z6BA 4NHZA 2L4CA 2GSPA 4STDA 2H0HA 3F4TA 1KD14 2CX4A 4LA1A 4ZIJA 1RK4A 5A0OB 1VQN3 2JSYA 2V41A 1MD4A 1M3JA 4IP1A 4ZB6A 2WOFA 4N6NB 2HLSA 4OD7A 3DGOA 1KTEA 1NM3A 4Z2TA 4FR9A 3V99A 4JE1A 3HIIA 3I553 2C8UA 1G6YA 2RUEA 3KEBA 3ER7A 3F14A 2NTOA 2FA4A 1M9BA 3J7Yd 1LQMB 3WGEA 1ML6A 3TCOA 3FG4A 2GTUA 1CYUA 1USBA 1EOGA 3MSZA 3M3MA 12GSA 3FSDA 2VD0A 3V92A 1QJGA 1AQVA 5EQLA 4PURA 4N10A 1VQ43 3R2QA 2G2QA 2R37A 1U88A 1BQ7A 1NNVA 1RCKA 1WQLB 3K63A 2FNOA 3CD63 2MMNA 4KDYA 1FG4A 5G1LA 3EX9A 3C73A 3ED3A 1DYUA 5CF1A 3RAZA 1EG9B 1I0VA 3EN8A 1QMVA 3CCS3 19GSA 4HZ4A 4GF0A 2WCIA 2GQMA 2XBQA 5ID2A 1PRXA 4KCEA 4RUVA 3O8YA 2YFIB 2WO0A 2BHMA 4BL2A 1LNHA 4FCMA 6GSWA 1KWIA 4BVYB 5ECRB 3KCHA 1EEMA 2YOIA 1BRKA 1XWGA 2JZSA 3UEMA 2XGNA 1M9GA 3LT8A 3GZXB 2I81A 1TTOA 3JUQA 4IPBA 4L7KA 1SJIA 1GNWA 5B8AA 4L8EA 2XH9A 4NV5A 1F37A 3C1SA 3HXSA 2J9HA 2BJXA 1BSDA 3AGOA 2H71A 4WR5A 1IDPA 1GOVA 1RKYA 1F3AA 2LQVA 4LMVA 5KOXA 4ZB9A 3Q74A 5ECHB 4WFOA 1DE3A 3PGTA 1XCCA 3D6IA 4TVEA 2TRXA 3IAM2 3MYTA 3AHSA 1O73A 1ZO2A 4TR1A 3P7XA 1UI8A 1GY7A 2FLSA 1CQSA 1WE0A 1EV9A 3Q6OA 1BYEA 4ML1A 3D5JA 3SLUA 1S3CA 5F8BA 4YQVA 1UGIA 2W56A 4FIWA 4FMCA 1JZWA 1GSFA 1J2BA 2ON5A 5CRHA 3UJ1A 2R0PA 2CH9A 1SL2B 3IA1A 5JCGA 3NXJA 3UL3A 1XPVA 2R3XA 2Y74A 1HYUA 2PUKC 5D82A 4KE3A 5CLKA 2AYTA 1ZYEA 2XPDA 2EIRA 3D9RA 3OW22 1BSCA 3AHWA 1THXA 2X8HA 3TRPA 4L5OA 2MMZA 1FW1A 2REMA 2P0MA 2ZCTA 4JZQA 4K5RA 4F9ZA 1MWRA 2ZHXB 2M72A 1O85A 1EEJA 1ILOA 4OCFA 1YZXA 2GSRA 2XHFA 1F8NA 3HVSA 1GYBA 1V2AA 2GQLA 1OKTA 4GQCA 4TXVA 3NM2A 1BNEA 4R1KA 2ZNMA 3FH1A 2CKFB 3EC3A 3GYKA 4TR0A 4HAAA 3GKXA 1TI1A 3LQ7A 3NUVA 2Y73A 1X9MB 2HZFA 5IMAA 1FB0A 4O32A 1ULJB 5H5QA 2DJ0A 1Q42A 1YGWA 2JACA 3ZL5A 1PQNA 5ENUA 1XZOA 5M1AA 1SIHA 4K1FA 5KN1A 1OACA 2OCTA 2L5OA 4EO3A 2OOVA 3KSED 3QMXA 3VFIA 1YDKA 4CCVA 5ELAA 5AIGA 2B1KA 1V98A 1U3AA 2B5YA 5HQPA 1FGQA 1U5OA 2HMMB 1K3YA 5IOXA 2H0GA 1FOVA 3O6TA 1Q9EA 4MF6A 2GEYA 3FF2A 1FUTA 1LBKA 1IK3A 2XEPA 3IC8A 3IHGA 3SVAA 1RN7A 5CAXA 1VQ83 3UVTA 4L0UA 3V98A 4XRDA 3U97A 2CT6A 3TJGA 1GLQA 3TOUA 4J2FA 1UI7A 2IFQA 1PL1A 3TKSA 4HZ2A 3WGXA 3ZVJD 3FG3A 4IJ3A 1OE7A 3IPTA 2CVDA 5H5SA 3S9FA 1OHPA 5BVBA 5CF2A 1R5PA 4O92A 3W8JA 1GD4A 3EB8A 1K3OA 1JV2B 1OHOA 3G0KA 1AIUA 2PMTA 1LOWA 2CK3H 2DJ1A 4GSTA 2AAWA 1M9AA 3JCML 1PSQA 4D73B 4OFMA 2RSXA 5B6MA 1O6JA 2OACA 1NHYA 3QPMA 5IG3A 2KF4A 1FOHA 3HJPA 2RM5A 2F51A 1S3AA 3US3A 2YWOA 4GL6A 2HT9A 4PUFC 1KSIA 1ZGXA 4I2TA 3X41A 2L59A 3KE7A 1W2ZA 4IKHA 4LMIA 3N9HA 3WMDA 1EKMA 3T0UA 2HOHA 4O7HA 1JLVA 2R2JA 4RQRA 1JB2A 3EINA 4H3UA 4IJIA 1AUCA 2P5RA 1AY7A 1BRIA 5AEWB 4KT3B 4AEQA 3HJOA 3M0FA 4YAVA 5HR2A 1I2FA 2RCDA 4N6V0 2CX3A 4PX1A 2F8AA 5FW5A 3G713 1DMQA 1U87A 5IMFA 4QL9A 1NU3A 2BMRB 4HOHA 4BA7A 1Z9HA 4OK0A 1K9M4 3H4KA 4WBRD 4MABA 5J9CA 2KP2A 2E2MA 1OKDA 5DCHA 1K41A 3U6VA 1M2AA 4HM0B 1XWKA 1WMPA 2L6CA 3TKPA 1IU7A 1FAAA 5ECQB 3EPTA 2VO4A 3PR8A 1SJ6A 3F8UA 5ECLB 3GZRA 5LC6A 1M904 1Z1SA 4I4KA 3CCE3 1MDKA 2JDIH 2I3YA 1WMJA 13GSA 3CCU3 3WODG 4DKIA 2BU4A 1XW6A 3VWVA 2HRNA 1OVNA 4BVXB 3GFKA 2C80A 2GSQA 6GSTA 2YFLB 1W6CA 1QK8A 4BIKA 1CQGA 1QUWA 5ECOB 4WKWA 4PEJA 3WA2X 1MWSA 1RW1A 2YWMA 5IO2A 3VI5A 2YFJB 3QOUA 3K9MC 2RBIA 1EOHA 4KGIA 1X5EA 5F0GA 4AKYA 3EURA 1UN2A 2F5WA 3W6GA 3TJJA 3OWYA 3STDA 1N5HA 4IT7A 3GTUA 4EDZA 3CMIA 2V6KA 2GQKA 4R9LA 1VQ63 1JBRA 4POMA 1UUGB 1NSWA 4MH2A 2I1UA 1RN4A 4OVMA 1PMTA 1DE1A 2WOHA 3WDGB 2AV4A 4KX4A 4ID0A 1N8JA 3LTBA 4KFFA 3E99A 3VWXA 2R4VA 2C4BA 3PS8A 2DSAA 4KCAA 1D6ZA 4E8EA 4O8SA 3ALAA 5G31A 2GDRA 1JZOA 3IMAB 3LTAA 1JB4A 3GTUB 2C10A 2VCXA 4CY8A 3L9VA 3KP9A 5ELJA 1TKDB 4HUAA 4MP4A 1Q40A 2MBSA 6GSPA 1IVVA 3LG6A 2W9QA 3EVIA 2GZPA 3APOA 2FWFA 2LTKA 1OGZA 1GTBA 1H4OA 2WJUA 3KSPA 1A90A 2L5LA 4L5LA 5HR3A 1LXEA 2K3DA 1M7TA 3K8NA 3M9JA 1B4PA 2RM6A 1ERWA 4BVXA 2M7OA 5GSTA 1UCIA 2XR8B 1GY6A 2PBJA 1ZS7A 3S28A 5DAKB 3S27A 2Z9SA 3FR3A 4FYCA 1IQ8A 5IPGA 3BB9A 1AQWA 5E4WA 1WIKA 4BL7A 3HZPA 3SEDA 2LQQA 3PGBA 2R0CA 4ZB8A 6GSXA 1B2ZA 1LOVA 4HOJA 3EE1A 4FYUA 2AJQB 5IQYA 1K0BA 3HIGA 1SYXA 1B2MA 5G5EA 3AY8A 4K90B 4ORLA 3GMFA 3WYWA 5G1KA 2FUG2 4RZMA 3KN4A 2KF5A 3PINA 4OUQA 3N5OA 1NHOA 3FGYA 1SL1B 2ZDJA 1O8WA 3GNJA 3UL6A 1XOBA 4J5KA 1MWTA 4TXOB 1HNAA 3EMPA 2D2ZA 1IV9A 2XPEA 3S67A 2H6YA 4PGTA 3WT2A 3HX8A 3NBBA 3G7IA 4HDEA 4BIRA 4RQXA 3HVNA 4MPGA 3IK7A 1EA2A 3ZYWA 1XIYA 2FWEA 1A2VA 4NHWA 2CFDA 3K5TA 3UAPA 3CPW2 4AJ6A 3ZMLA 5D83A 3H3HA 3ERFA 1RGEA 2K18A 2H1DA 2TIRA 3EWLA 4N30A 3F7XA 3UARA 2DKHA 1G7OA 1T5YA 2L4VA 3VI7A 3D5IA 5EVOA 1OC9B 2PVOC 4Q5RA 3UL5A 1PFPA 1CEWI 4CDLA 4HM5B 2FGTA 3AMOB 1GUHA 1X1YA 5IMCA 3RPPA 3DZLA 3BNEA 4NXIA 4F82A 4ZL7A 1LOYA 1NB3I 4RNYA 1QXHA 4D73A 4TXOA 4AJ8A 2LRTA 2IMEA 5IG5A 1A0FA 2K54A 2IY2A 2NBSA 3LYPA 2YANA 1BAOA 1T4YA 2IA7A 3TKSC 2F5MA 6RNTA 1T2IA 1RMSA 5A4VA 3QAGA 2H72A 4EYCA 3WHOA 2VCZA 2SARA 4V2LA 1ZOFA 4HM4B 1Q864 1TRUA 1V58A 2PN8A 3FCSB 3GURA 4MNNA 1RHLA 3MKIA 2VL2A 1A2MA 1AXDA 3GL5A 3FLJA 1RTUA 2F3MA 3JUOA 2AAEA 5E59A 1YNVX 3Q19A 2CHCA 3I43A 2YWNA 4IELA 1YI23 5IPHA 1TI3A 1MEKA 2WGQA 3G9BA 2CFLA 3CSIA 4NHFA 1W5ZA 2DC5A 3BOAA 1J9BA 2CC3A 1E6BA 1GTIA 2YNXA 3IXRA 4WBJA 3CCQ3 5D73A 2B5XA 4K7IA 1BNIA 4JBBA 1GWCA 4KZ1A 3NM7A 3UIWA 4KH7A 1BUQA 4K8MA 1BOXA 4N3VA 5IMZA 3H51A 3G6E3 1B4QA 2C4JA 1MTCA 1Y6EA 1PA3A 2KP1A 2BIRA 1QFNA 5EPFA 4TN8A 4EXJA 5DRVA 1ZYQB 4XBTA 3A5IA 2K9FA 1WWJA 3O3TA 4V2NA 1HD2A 3P2AA 5IMDA 4XIHA 3TJFA 1N8R4 3ZVJA 1MGRA 3J7Yk 4PQHA 1HU9A 1B2UA 2PGTA 3MSOA 2CX0A 1JN5B 5D81A 3F8XA 4GXZA 4K1UA 3LXUX 2CVKA 1E97A 2QIYA 2XSHB 1O8XA 2OADA 2WB9A 2HYXA 3KGKA 3TKSE 3RGRA 4ECBA 2C11A 17GSA 4G9HA 1BRJA 1XBSA 1W00A 1JZDA 1OUNA 1XWCA 4MF7A 3ZIJA 4KSMA 5FGOA 2WZ9A 1YKCA 3CC73 1GSEA 3ERGA 1E3VA 3CBUA 3GUSA 2HSHA 3DM8A 4NPBA 3IV4A 3RBTA 1ASKA 2LJRA 1G96A 2CG0A 2A2RA 3SWLA 1MNLA 4J56E 1T8EB 1T1VA 1M1XB 3HCZA 2QC7A 1WMOA 3N8BA 1M2BA 1AR0A 5AYSC 4WF4A 2PZVA 2L4QA 1Y4KA 1C54A 3QR6A 1PKWA 4WP5A 4HZBB 1VF4A 1RGHA 2B1LA 2OQEC 1SK0A 3D79A 2UUGC 4XB5A 1WPIA 2UGIA 4POLA 4XM4A 1FVJA 2LJKA 1BRSA 2OTL3 4KF9A 4TR1B 2OE3A 3CQFA 2GSSA 3J7Yb 3DXBA 2L6DA 2GT6A 3EU3A 5AIVA 4G10A 5KEJA 2BNGA 5F07A 4EE0A 5CRDA 1PY3A 3CYNA 4OFTA 4L8OA 1IQXA 3MPHA 3OXAA 3KH7A 3UB1A 2P0XA 3PCSA 3G7JA 2V2GA 5G2GA 1M2DA 2R5GA 5J41A 2F98A 4HEA2 1HNCA 3CRUA 1M1K4 2YJ7A 3A2WA 1BEDA 2FD3A 2B7KA 1FO5A 3OWSA 1JFUA 3GKMA 4BVYA 5CK6A 1A23A 1S5AA 3EQQB 4GWRA 5AIXA 3VF1A 3E3EA 4H86A 3EYTA 1X1WA 2KUCA 1BNSA 5EVHA 1YF0A 2HSYA 1A2PA 4LYLB 1NW2A 1ERTA 1YEPA 3MWZA 1LRAA 4K2XA 5BIRA 2EIQA 4I2UA 1R7HA 1TRWA 4WR4A 1W6YA 3GA4A 2IMKA 2W6JH 1O7PB 2MZCA 4EC6A 1STDA 1XOAA 3IAS2 4XS4B 2ZUPA 4HBRA 1S3DA 2GEXA 1RJOA 2VCWA 2CFKA 1EZKA 3NBJA 3BCIA 4AJ7A 1TK8B 2NDOA 2H74A 3RPNA 4ZILA 3G7YA 3A5WA 1YJW3 1VQM3 3G8ZA 1PN9A 3HHVA 4K7OA 3VPQA 4GSSA 5JCWA 5J9BA 3SXXA 3G16A 3H1NA 1AV4A 1V74A 1CQHA 1EV4A 3FR6A 1OGXA 1OHSA 2ALBA 2XRXB 5ELGA 4CY6A 3UOMA 5DREA 5H5RA 3F6FA 2STDA 1PKZA 3LT9A 4WETA 1X5CA 3CPOA 1XWBA 4MJBA 1BNFA 1TOFA 3LYKA 1TRQA 3Q1CA 9RNTA 4KW6A 4X43A 5JWQB 4ZL8A 3FK8A 4JRFA 3A5EA 1IV7A 1IVWA 2C3TA 2E0QA 2V1LA 2QA2A 1SENA 6GSUA 2FNQA 4GSNA 2MBTA 5AGYA 3S29A 4HJMA 3BD2A 1I2EA 8RNTA 1WP0A 3NV0B 3TJKA 2NPBA 2A4HA 4BPYA 1V9WA 1L5GB 3P8WA 1EP8A 3CNXA 2WS2A 2RFRA 2PU9C 3X40A 3GX8A 3FG1A 2AADA 1PX6A 4DEJA 2N5FA 4HSCX 1NWWA 4TRXA 5FHIA 3A3TA 4AGSA 3ZIVA 2X8CA 2HZEB 4ECJA 3IE3A 3DVWA 4TX4A 3D21A 3I69A 1GMRA 1QVF2 3H79A 2CG1A 4IP6A 1BG5A 3CSHA 1ABAA 4XBXA 4O5RA 2KAAA 1NJI4 2ES7A 3CTFA 1FGMA 1R4WA 5IF6A 1AC1A 5CP1A 3ZMKA 1ROAA 4O5QA 1PU4A 1FGRA 4MZCA 2LS5A 2I4AA 3IR4A 2H70A 3QRDA 1ZCPA 1A67A 3BNDA 4GTUA 1GUKA 3NOFA 5COHA 1ROVA 3EC9A 1SJZA 6GSVA 3RHCA 4HU7A 7STDA 2EC4A 1WJKA 4MLYA 3MAKA 1BNRA 1ZGNA 2KF3A 3CC43 3GH6A 4ZM8A 3FKFA 1GTAA 4MJDA 5GZZB 1LJRA 5GSPA 2LSTA 5INYA 3EMXA 3FZAA 2N5AA 4KAEA 3QAWA 5G30A 4YKFA 2FCHA 2OE0A 5HFGA 1R5AA 3ZITA 1Z3EA 5CRGA 1MDJA 3ZZXA 3CTGA 1DMNA 3APSA 1A2LA 3LTCA 2A15A 2JU5A 5CYYA 2WFCA 3VGNA 1B2XA 1X1XA 1HQOA 4DSQA 2GS3A 1GS3A 3EBTA 4ISDA 5D9VA 4ICYA 6GSYA 2DBCA 1K0CA 1EGOA 1PFOA 1BX9A 1IVXA 1BSAA 1VF3A 1C7HA 4ACSA 3ZREA 5ID2B 16GSA 2MMAA 2X4AA 4IIAA 4P3YB 1BIRA 4V1Ap 2HXKA 3C8EA 4J9AA 3ZG5A 3OR5A 1N8QA 2R0GA 3HA9A 4FMAA 1RGKA 1B20A 2AHEA 4EV5A 3LW9A 3EU4A 3HYPA 4RI7A 3WA3A 4LMWA 2ON7A 6GSSA 4XBYA 5DVBA 4MMXB 1M3IA 3DD3A 2C3QA 4EF0A 3X42A 1TIJA 1Q7Y4 1F9MA 1KC84 4POBA 2RIIA 2K6VA 3UNLA 5GSSA 2GSTA 2R6KA 3D5GA 3FW2A 4XTSA 4EL1A 4IW9A 2NVLA 1YJ93 1GSSA 2YWIA 3EBYA 2C0EA 1FGOA 2MF7A 2R4IA 2XBIA 2OKAA 2JQ5A 2B5EA 1N9JA 3JVCA 2OE1A 2CWUA 4OO4A 5KOWA 2A2SA 2W2CA 3L9SA 5A5KA 2IWTA 4LL1B 1VF1A 1R4CA 2KLXA 1BRGA 5KN2A 1O7MB 1NB5I 1EWXA 1B9XC 3QCPA 5G5FA 2P31A 4ZBAA 1X1UA 3K7CA 5AYRB 1AVKA 3IJEB 3Q18A 1EP7A 2JZRA 1JBTA 4HQSA 2E7PA 2AUVA 4JF8A 3WOFB 2CIUA 3ZFBA 2HRFA 2IJYA 3VWUA 4K6XA 4HS1A 4FYBA 1JZRA 1G6WA 2A4VA 4MCUA 3DKSA 1SKWB 3L4NA 1OC3A 4Q5NA 2Z76A 3PXMA 4WYKB 3HY2A 3DVXA 5HR0A 2C3NA 5I97A 3IC4A 1Q7HA 1VZZA 3EHCA 3OWUA 1JJ22 4XDVA 1THOA 1TP6A 2F56A 3CCR3 1D6UA 2DIYA 4N6MA 3CXC2 4I97A 5ECNB 3ZFLA 4NWYA 4IQAA 3GKNA 1SU9A 14GSA 2KRTA 4KVHA 5GAND 2F9SA 1K734 4TR4A 1GMQA 1OH0A 1ACVA 1SARA 2FGXA 5IM9A 1OE8A 2FA8A 3TUEA 2VLVA 3BLZA 4ECCA 1ZYPA 1WNHA 2HMNB 3KKGA 3F9SA 1K0DA 3BU4A 3CCV3 4CDOA 1QAKA 2OOVC 2QA1A 1A2JA 1E2YA 3RDWA 3N54B 1B3SA 3HOHA 4OFNA 3ZG0A 1FA3A 1G7EA 2R41A 1U8CB 1ZX2A 5IEPA 4OO5A 1UUVB 1GSYA 1QMAA 1XFLA 2IMJA 2IN3A 3B7CA 3DMLA 2YCDA 4Q5FA 3DYRA 5IEOA 3CCM3 2I9HA 3MNGA 4HI7A 1KEBA 4X4JA 4KFEA 3D4TA 4XS1A 1GP1A 1Q98A 4XDWA 4EV2A 4ECIA 3BNCA 3QFAC 3O76A 1JN5A 1YVSA 2O8VB 2XF3A 1OF5B 5LC7A 3D4AA 3M9KA 3I9V2 5FT3A 2VL2C 2H1AA 4N0ZA 4I5QA 11GSA 4EUYA 1GLPA 1X0RA 5DALA 2P5QA 3LFLA 2IPAA 1RDSA 2LYXA 5IMVA 3NV0A 2CZ2A 4R9KA 2LEGA 3KM6A 3Q2PA 1YIJ3 2OTJ3 4J57E 3HKRA 5A4WA 5KP1A 3TRQA 3DGMA 1I3FA 4ML6A 2WULA 3BNBA 2J23A 5EEOA 4KUNA 4LL4B 3IDVA 1G02A 5IIZA 2P0GA 4K0NA 4TOPA 2JZTA 3LJRA 2E2TA 1VQK3 3A76A 1ON4A 2UX0A 5ECMB 2VL9A 2ML6A 1FUWA 3Q3FA 3PH9A 1I9DA 2M46A 5D8IA 3EF8A 1R26A 2GU3A 4BU4A 2VL3A 2QGUA 4V2MA 5C04A 1BUJA 1DE2A 3OV4A 3SYUA 1I5GA 1DETA 4N6LA 1UA5A 1WTHA 4FCJA 1G0TA 3LH4A 1YQ1A 4U13A 2IYJA 5FWGA 1B48A 1BVIA 2H19A 3R3EA 2QKEA 2F86B 3WOEB 4O02B 4O2HA 1K8A4 3KMOA 2Z77A 3CMA3 1YJN3 2C0GA 1VQO3 1UW1A 5TGNA 1Q824 3F7SA 1YKAA 2O89A 5IG4A 1RQMA 4TR3A 3Q90A 7GSPA 4XS4A 3E9JB 1SKRB 3TKRA 3N9JA 1JB5A 4E8HA 3RHBA 2H73A 3SOAA 2KHPA 4FO5A 4HJ2A 4N0VA 1TU7A 1XVWA 22GSA 4MJEA 3U1WA 3NX0A 1SD8A 4ZXGA 2CAQA 3I6AA 5DBQA 4PQ1A 1GOUA 3CU3A 1URMA 1RN1A 2DMLA 2CA8A 1FYSA 1YGEA 3LXZA 4PNGA 2B7JA 5KP3A 3QAVA 2X8GA 1T4ZA 1T7PB 2VUPA 4L8PA 3A2VA 2O87A 4XS6A 1YJ6A 4EIPA 1X9WB 2L1SA 4HZ9B 1B21A 4K9ZA 4X0XA 1SD9A 3FHKA 3ISOA 3KMNA 1UGHI 1OC9A 3EN1B 2J8XB 3DGQA 2PPTA 2E2VA 3NHXA 1PN0A 2N5BA 4EXRA 5AIHA 2OQEA 1SIIA 2RNTA 4X1UA 1SQWA 4RBNA 5HFKA 3MDKA 5L71A 2VOCA 3GRDA 2D42A 1AAZA 1Z6NA 1GSUA 3IPZA 2F4YA 5EL8A 3MHEA 4FMDA 3T8UA 5JCUA 5B8BA 1VQQA 1TW9A 4F0CA 2ZL8A 2GT5A 5D93A 2BT3A 3D4MA 5GAPD 2W0QA 4FMBA 1UDII 4BWQA 1A24A 1TRVA 2VLUA 1ULIB 3V1WA 1DMMA 5ELUA 2H1BA 4WXTA 2KF6A 3GL3A 4FQUA 4NV2A 1RNTA 1JBSA 4HM6B 6STDA 4KFDA 3FEUA 1S723 3TKQA 2QEX3 2GZZA 4G2EA 3WD6A 1MDIA 1W89A 2C0DA 3ECFA 8CHOA 4BTWA 2D1WA 2K8SA 3LORA 3DIEA 2B6MA 1FUSA 3LYGA 4Q53A 3FMWA 4PNFA 3CSJA 3DWVA 3SBCA 1QALA 1IYIA 2HNLA 3F3QA 4WF5A 3ZFZA 3LSZA 2H8LA 3FZ5A 4HVNA 1W4VA 1BGSA 4GSPA 3IHQA 4BTXA 2IMFA 4O5UA 3L0RA 3KZTA 3L78A 5DAKA 5C00A 1B9YC 1V40A 3P90A 5BMUA 1VQP3 3EJVA 3HI7A 3MWHA 4OMVA 1GSPA 2WGOA 3F0IA 2MC8A 2H75A 1A8YA 1US1A 3I0YA 1A0RP 2W04A 2H6XA 3GSPA 4LEHA 2HMJB 3BIRA 3VWWA 1I2GA 1VRSD 2LUSA 3LOYA 1RGCA 2K0MA 1J0FA 5BU4A 3LTDA 1K0NA 2B24B 1IYHA 5A4UA 3VSYA 4MPFA 3GSSA 3F4RA 4BL3A 4WHAA 3KJYA 3B8LA 2DLXA 4KSOA 1X9SB 3DGNA 1O81A 4KDXA 4GQFA 2IIYA 2ZA4A 1I3IA 2C1YA 1FW7A 3ME7A 4EC0A 3CME3 4DSSA 5IO0A 4BTYA 3URPA 3QK9A 3UMAA 2FXTA 2DJJA 1U6TA 2VCTA 4F03A 4PQIA 1W4NA 1ZZYA 3GSTA 3EE2A 4IVFA 3SX1A 3IK9A 1GMPA 1DUGA 1Q4JA 4OWYA 1XWAA 1TP9A 1XG8A 2VLTA 3KP8A 2V6OA 2HMOB 2H0IA 5AIIA 1MWUA 5G2ZA 4G1MB 4HM1B 4MMYB 1E3RA 3RDEA 1IYYA 1GTUA 4MEIA 3BCKA 3B4PA 2CX1A 4K0GA 1TU8A 1BRNL 4V1Ag 4G19A 2H30A 1KBNA 3A2XA 1JLWA 2HI7A 2E2UA 1LOXA 1EQKA 7RNTA 5AISA 3F4SA 3X3YA 2CZ3A 3HDCA 1TUHA 3KTBA 5B6NA 3NBRA 2VM2A 1O7HB 1GRXA 3F63A 1AVLA 3D22A 3GZYB 3H8QA 3QD9A 4IGJA 4K7NA 3C71A 4MJCA 4KNDA 4RNZA 3GX0A 4WWUC 3GN3A 5IW9A 3CCL3 5AIFA 4Z2RA 1IVUA 2B3SA 3FRCA 5DQYA 1O7NB 3LZAA 1GH2A 1LU4A 2KXGA 4LZIA 1M0UA 4I6XA 3K0ZA 3M1GA 3KFQC 1Q814 1TFKA 5HOHA 1UVZA 1VQ93 1SPUA 1AQXA 4EVMA 5BRTA 3JUPA 3MG2A 2PWJA 2V32A 3L9UA 3WR2A 1W02A 1ERVA 2YJHA 1PGTA 3AMOA 2VAFA 1WMNA 4OCEA 4JU5A 3G4S3 3TOTA 5J5NA 3VLNA 3HVVA 1UCLA 1N2AA 1J08A 3DGLA 2CWTA 1HYFA 3DGYA 3C1RA 5CNWA 1PYLA 1KQS2 2LKUA 4LGQA 4JR4A 3TGZA 3D0ZA 3SOYA 2YV9A 4ZL9A 1PL2A 3FY7A 2RGQA 3QFBC 3UBKA 1SJWA 3IBHA 3IRAA 10GSA 4CHSA 4PTSA 1XXUA 3KXOA 5J4UA 3PPUA 2L57A 1QQ2A 3NIVA 4IQ1A 3GZBA 2YZHA 3C7MA 4YQUA 2C0FA 5DJMA 4F0BA 1YVBI 1JNQA 5ECIB 1W2B2 5AEUB 4G0LA 1QGVA 5F06A 5B7CA 3NQZA 5IG0A 1SYRA 2O85A 3ERWA 4RI6A 1VQ53 1RRLA 4DVCA 2X49A 3TRXA 1N5PA 4IN0A 2I9WA 2FWGA 1VQ73 2YX9A 4GCIA 3UVHA 3LEFA 1YIT3 2AB6A 4MA9A 4Z7XA 2FY6A 3HZ8A 2GU1A 4MZBA 2CWVA 1RGFA 2IUJA 1XW5A 3MG3A 4X2HA 4BL7B 4H61A 2HMKB 4CW9A 1T2HA 1BRHA 2IFQB 1K0MA 1U3IA 4ZBDA 4MMZB 3ZLPA 1IQYA 4EBGA 3PCRA 5STDA 3DUKA 2F99A 4K2DA 1O7WB 5KP4A 2LRCA 5KN0A 2W9PA 1ST9A 4FH8A 4FCZA 2OA7A 5ECKB 4IS0A 18GSA 1VF2A 1A8LA 2JL4A 2V1MA 3KTLA 3DH2A 1RSNA 4RNTA 4YAPA 5LD0A 2P38A 4DSRA 4HJLB 1T3BA 3LXTA 2GXFA 1GULA 2QGVA 3FZ4A 2YV7A 4WEYA 4YQMA 1DVCA 2A2PA 1Q40B 1GUMA 1TJDA 2CQ9A 4HM3B 5J3RA 4EKZA 2LNTA 1UCJA 3LMLA 1SK1A 1YEXA 3MIXA 4JRRA 1AQZA 3FF0A 3U5RE 4Q5QA 2H01A 2XFSA 2HRAA 4MK3A 1XVQA 3VK9A 2XGLA 4K61A 4QQ7A 3UBLA 3CRTA 4X2OA 3FR9A 1K0OA 5ABRA 2CW9A 4TW5A 2HE3A 1DSBA 4LLRA 1XW9A 2H6ZA 4DSSB 1JHBA 2X64A 1OC8A 5JPPA 5AN1A 5DALB 3TJBA 3KCMA 4J5GA 3L0HA 3NQYA 1UCKA 3KD0A 1OAZA 2WRTA 1OF5A 3DY5A 1TTZA 4K1VA 2O9UX 3M8CA 5LCZA 4JR6A 2IL3A 1PD21 1H75A 1RLSA 4POKA 5DQSA 1BSBA 3ZRDA 1Z7PA 4CPKA 4Z2UA 2Z7AA 3KH9A 1SKSB 1BU4A 2CV4A 1TXXA 1QAFA 3I563 2F8FA 5DJLA 3APQA 2HMLB 1EUIC 1FGTA 2CFGA 1V57A 4NREA 2LRNA 2VM1A 2Q07A 1ISKA 1JRQA 2CFWA 2QA43 1W01A 2FHEA 4HM7B 2X99A 4QWTA 3X3ZA 4N6UA 1DBYA 1RCLA 3GAXA 1S3RA 4A5PA 2IUKA 4EW5A 5RNTA 3FZWA 4AF2A 1T00A 3F3RA 4PUAA 4ZBBA 3PZWA 4N6TA 2DJ3A 2YZUA 2HRKA 5HR1A 4HM8B 2XC2A 2W56B 4EDYA 1WRYA 1HNBA 4MMMA 5F05A 2XFTA 4AKZA 3DXOA 2HSMA 4N11A 2LNSA 3CNMA 5JBSA 5JWRB 4XCSA 1YY7A 1LQGC 5D9WA 3F6DA 4PXOA 1CYVA 2INXA 4CJNA 3JUNA 1Y25A 3VURA 4KDUA 3DMCA 3H93A 4HYZA 2P05A 1K3LA 8GSSA 1A2KA 2RLIA 5LNKe 5CO3A 4XRAA 1F6MC 3ROBA 2E2GA 1QVG2 1AW9A 5CREA 5BXQA 1GD3A 1NO3A 2OJLA 2HFDA 3MG1A 3QDNA 5CRWA 1MGWA 1UUWB 2LV3A 2BO9B 2DJ2A 1I0XA 1TDIA 1Z6MA 2MMOA 1O7GB 2BMXA 2QSIA 3BJ5A 2B1XB 2VCVA 1OCVA 3GHAA 1K28A 2GLRA 2K8VA 1GY5A 4KA0A 1ZMAA 3WGDA 3HK4A 1VGLA 2DMMA 4USSA 1W6GA 5KN3A 1B8XA 1GNEA 3F40A 1FVKA 2W03A 2BMQB 1GSDA 5D96A 3PYJA 3CC23 1KNGA 4N6OB 4JEDA 1TFOA 1ZL9A 3T8NA 3HVXA 1BAYA 4TKYA 2DKIA 2WGRA 4F2IA 2DIZA 1SL0B 1F2EA 4R80A 5ECSA 1BJXA 4J8TA 3F9UA 4EIQA 3OX9A 5D9TA 1D6YA
chains in the Genus database with same CATH topology
3VPTA 3ME8A 1OYJA 3KIJA 4MZWA 2KOKA 9GSSA 1PX7A 4ILFA 4HQZA 4QL7A 1ERUA 4YH2A 1GSQA 2WDUA 4BWSA 4YKGA 2MYGA 2VIMA 3FYGA 3KZQA 1WOUA 2IMIA 1C72A 2JADA 2LQOA 3LGCA 4NMUA 4ULXA 4GRFA 3GKKA 1FHEA 4GLTA 1K0AA 3E0UA 3TDGA 3GV1A 3CXGA 3MYDA 4I8BA 20GSA 1O7UA 3ZTLA 3DEXA 5IOWA 3WT1A 2YP6A 4K5SA 2PERA 3FZ9A 3GH9A 2BTOT 4MH3A 2RUFA 2UZ8A 2M80A 3DRNA 3BBYA 3HZ4A 3W8SA 1F3BA 2OBKA 2EIOA 1Z7RA 2JSZA 4IBPA 2VCQA 1Z5YE 4NAXA 4MDCA 1TK0B 1GL8A 1M99A 4MJAA 3TB2A 5DDLA 1ZYNA 2H76A 3M8NA 2LJAA 1SK2A 3HJMA 4MF5A 2H1GA 3IOSA 1EGRA 2VD1A 2CVBA 5DCGA 4HU9A 2GVPA 2IMDA 1X5DA 2GGTA 5JWOB 2HZEA 5D9XA 2O7KA 4KB3A 1MD3A 5EY6A 2OBIA 2TRCP 5ECPB 1YF1A 4G0KA 2PVQA 7GSSA 1UC7A 2YPMA 1TK5B 4XHMA 2CAIA 2DJKA 3HD5A 2G0FA 4G0IA 2FWHA 2H66A 1TRSA 3LWAA 4IHUA 3GRXA 4L0WA 3GIXA 2GZYA 5HFIA 3NZNA 1FB6A 2YN1A 4NHZA 2L4CA 2H0HA 3F4TA 2CX4A 4LA1A 4ZIJA 1RK4A 2JSYA 2V41A 1MD4A 4IP1A 4ZB6A 2HLSA 4OD7A 1KTEA 1NM3A 4Z2TA 4JE1A 2C8UA 1G6YA 2RUEA 3KEBA 2NTOA 2FA4A 1M9BA 3WGEA 1ML6A 3TCOA 2GTUA 1USBA 1EOGA 3MSZA 3M3MA 12GSA 2VD0A 1AQVA 4PURA 4N10A 3R2QA 2G2QA 2R37A 1U88A 1BQ7A 2FNOA 2MMNA 4KDYA 1FG4A 5G1LA 3C73A 3ED3A 3RAZA 1QMVA 19GSA 4HZ4A 4GF0A 2WCIA 2GQMA 2XBQA 5ID2A 1PRXA 4KCEA 4RUVA 6GSWA 4BVYB 5ECRB 1EEMA 2YOIA 1XWGA 3UEMA 2JZSA 2I81A 1SJIA 1GNWA 5B8AA 4L8EA 4NV5A 1F37A 3C1SA 3HXSA 2J9HA 2BJXA 2H71A 4WR5A 1F3AA 4LMVA 5KOXA 4ZB9A 3Q74A 5ECHB 3PGTA 1XCCA 3D6IA 4TVEA 2TRXA 3IAM2 1O73A 4TR1A 3P7XA 2FLSA 1WE0A 1EV9A 3Q6OA 1BYEA 4ML1A 3D5JA 1S3CA 5F8BA 4YQVA 4FIWA 1JZWA 1GSFA 2ON5A 5CRHA 3UJ1A 2R0PA 1SL2B 3IA1A 5JCGA 3UL3A 1XPVA 2R3XA 1HYUA 2PUKC 4KE3A 2AYTA 1ZYEA 2XPDA 2EIRA 1THXA 2X8HA 3TRPA 4L5OA 2MMZA 1FW1A 2REMA 2ZCTA 4JZQA 4K5RA 4F9ZA 2M72A 1O85A 1EEJA 1ILOA 4OCFA 1YZXA 2GSRA 2XHFA 3HVSA 1V2AA 2GQLA 1OKTA 4TXVA 4GQCA 2ZNMA 3EC3A 3GYKA 4TR0A 3GKXA 1TI1A 3LQ7A 1X9MB 2HZFA 5IMAA 1FB0A 4O32A 5H5QA 2DJ0A 2JACA 3ZL5A 1PQNA 5ENUA 1XZOA 4K1FA 5KN1A 2L5OA 4EO3A 3QMXA 3VFIA 1YDKA 5ELAA 2B1KA 1V98A 1U3AA 2B5YA 5HQPA 1K3YA 5IOXA 2H0GA 1FOVA 3O6TA 4MF6A 1LBKA 3IC8A 3IHGA 5CAXA 3UVTA 4L0UA 4XRDA 2CT6A 3TJGA 1GLQA 3TOUA 4J2FA 2IFQA 1PL1A 3TKSA 4HZ2A 3WGXA 3ZVJD 4IJ3A 1OE7A 2CVDA 5H5SA 3S9FA 1R5PA 3W8JA 4O92A 1K3OA 1AIUA 2PMTA 2DJ1A 4GSTA 2AAWA 1M9AA 3JCML 1PSQA 4D73B 4OFMA 5B6MA 1O6JA 2OACA 1NHYA 3QPMA 1FOHA 3HJPA 2RM5A 2F51A 1S3AA 3US3A 2YWOA 2HT9A 4PUFC 4I2TA 2L59A 4IKHA 4RQRA 4O7HA 1JLVA 2R2JA 3EINA 4IJIA 1AUCA 2P5RA 3HJOA 3M0FA 4YAVA 5HR2A 2CX3A 4PX1A 2F8AA 1U87A 5IMFA 4QL9A 4BA7A 1Z9HA 3H4KA 4WBRD 4MABA 5J9CA 2KP2A 2E2MA 1OKDA 5DCHA 3U6VA 1M2AA 1XWKA 2L6CA 3TKPA 1FAAA 5ECQB 3EPTA 2VO4A 3PR8A 1SJ6A 3F8UA 5ECLB 1MDKA 2I3YA 1WMJA 13GSA 1XW6A 3VWVA 2HRNA 1OVNA 4BVXB 3GFKA 2C80A 2GSQA 6GSTA 1QK8A 1CQGA 1QUWA 5ECOB 4WKWA 1RW1A 2YWMA 5IO2A 3VI5A 3QOUA 1EOHA 4KGIA 1X5EA 5F0GA 3EURA 1UN2A 3W6GA 3TJJA 3GTUA 4EDZA 3CMIA 2V6KA 2GQKA 4POMA 1NSWA 4MH2A 2I1UA 1PMTA 1DE1A 2AV4A 4KX4A 4ID0A 1N8JA 3VWXA 2R4VA 2DSAA 4KCAA 4E8EA 5G31A 2GDRA 1JZOA 3GTUB 2VCXA 4CY8A 3L9VA 3KP9A 1TKDB 4HUAA 4MP4A 2MBSA 3LG6A 3EVIA 2GZPA 3APOA 2FWFA 2LTKA 1GTBA 1H4OA 2WJUA 2L5LA 4L5LA 5HR3A 1M7TA 3K8NA 3M9JA 1B4PA 2RM6A 1ERWA 4BVXA 5GSTA 2PBJA 5DAKB 2Z9SA 3FR3A 4FYCA 5IPGA 1AQWA 5E4WA 1WIKA 4BL7A 2LQQA 2R0CA 6GSXA 4ZB8A 4HOJA 4FYUA 2AJQB 5IQYA 1K0BA 1SYXA 5G5EA 3AY8A 3GMFA 3WYWA 5G1KA 2FUG2 3PINA 3N5OA 1NHOA 1SL1B 1O8WA 3GNJA 1XOBA 4TXOB 1HNAA 3EMPA 2D2ZA 2XPEA 2H6YA 4PGTA 3WT2A 3G7IA 4HDEA 4RQXA 4MPGA 3IK7A 3ZYWA 1XIYA 2FWEA 4NHWA 3UAPA 4AJ6A 3ZMLA 3ERFA 2K18A 2H1DA 2TIRA 3EWLA 4N30A 3UARA 2DKHA 1G7OA 3VI7A 5EVOA 1OC9B 2PVOC 4Q5RA 1GUHA 5IMCA 3RPPA 4NXIA 4F82A 4ZL7A 1QXHA 4D73A 4TXOA 4AJ8A 2LRTA 2IMEA 1A0FA 2IY2A 2NBSA 3LYPA 2YANA 1T4YA 3TKSC 5A4VA 3QAGA 2H72A 2VCZA 4V2LA 1ZOFA 1TRUA 1V58A 2PN8A 3GURA 4MNNA 2VL2A 1A2MA 1AXDA 3GL5A 2F3MA 5E59A 3Q19A 3I43A 2YWNA 4IELA 5IPHA 1TI3A 1MEKA 3G9BA 3CSIA 2DC5A 3BOAA 1J9BA 1E6BA 1GTIA 2YNXA 3IXRA 4WBJA 5D73A 2B5XA 4K7IA 4JBBA 1GWCA 3UIWA 4KH7A 4K8MA 5IMZA 1B4QA 2C4JA 1MTCA 1Y6EA 1PA3A 2KP1A 1QFNA 5EPFA 4TN8A 4EXJA 1ZYQB 3A5IA 2K9FA 1WWJA 3O3TA 4V2NA 1HD2A 3P2AA 5IMDA 4XIHA 3TJFA 3ZVJA 3J7Yk 4PQHA 2PGTA 4GXZA 2CVKA 1O8XA 2WB9A 2OADA 2HYXA 3KGKA 3TKSE 4ECBA 17GSA 4G9HA 1XBSA 1JZDA 1XWCA 4MF7A 3ZIJA 4KSMA 2WZ9A 1YKCA 1GSEA 3ERGA 3CBUA 3GUSA 2HSHA 4NPBA 3IV4A 3RBTA 2LJRA 2A2RA 3SWLA 4J56E 1T8EB 1T1VA 3HCZA 2QC7A 1M2BA 4WF4A 2L4QA 3QR6A 1PKWA 1VF4A 2B1LA 1SK0A 1WPIA 4POLA 1FVJA 2LJKA 4KF9A 4TR1B 2OE3A 2GSSA 3J7Yb 3DXBA 2L6DA 2GT6A 3EU3A 5AIVA 4G10A 5KEJA 5F07A 4EE0A 5CRDA 3CYNA 4OFTA 3KH7A 3G7JA 2V2GA 1M2DA 2R5GA 5J41A 4HEA2 1HNCA 3CRUA 2YJ7A 3A2WA 1BEDA 2FD3A 2B7KA 1FO5A 1JFUA 3GKMA 4BVYA 1A23A 4GWRA 5AIXA 3E3EA 4H86A 3EYTA 2KUCA 1YF0A 2HSYA 1NW2A 1ERTA 1YEPA 4K2XA 2EIQA 4I2UA 1R7HA 1TRWA 4WR4A 3GA4A 2IMKA 2MZCA 1XOAA 3IAS2 4XS4B 2ZUPA 1S3DA 2VCWA 1EZKA 3BCIA 4AJ7A 1TK8B 2NDOA 2H74A 3RPNA 4ZILA 3G7YA 3A5WA 1PN9A 3HHVA 4K7OA 3VPQA 4GSSA 5JCWA 5J9BA 3H1NA 1EV4A 1CQHA 3FR6A 2ALBA 5ELGA 4CY6A 3UOMA 5H5RA 3F6FA 1PKZA 4WETA 1X5CA 1XWBA 4MJBA 1TOFA 3LYKA 4KW6A 4X43A 5JWQB 4ZL8A 3FK8A 2C3TA 2E0QA 2QA2A 1SENA 6GSUA 4GSNA 2MBTA 5AGYA 4HJMA 3BD2A 1WP0A 3TJKA 2NPBA 2A4HA 4BPYA 1V9WA 3P8WA 1EP8A 2WS2A 2PU9C 3GX8A 1PX6A 4DEJA 2N5FA 4TRXA 5FHIA 3A3TA 4AGSA 3ZIVA 2X8CA 2HZEB 4ECJA 3IE3A 3DVWA 3D21A 3I69A 3H79A 4IP6A 1BG5A 3CSHA 1ABAA 4O5RA 2ES7A 3CTFA 1R4WA 1AC1A 5CP1A 3ZMKA 4O5QA 4MZCA 2LS5A 2I4AA 3IR4A 2H70A 1ZCPA 4GTUA 1GUKA 3NOFA 5COHA 1SJZA 6GSVA 3RHCA 4HU7A 2EC4A 1WJKA 4MLYA 3MAKA 1ZGNA 3GH6A 3FKFA 1GTAA 5GZZB 1LJRA 2LSTA 5INYA 3EMXA 3FZAA 2N5AA 4KAEA 3QAWA 5G30A 4YKFA 2FCHA 2OE0A 5HFGA 1R5AA 3ZITA 1Z3EA 5CRGA 1MDJA 3ZZXA 3CTGA 3APSA 1A2LA 2JU5A 5CYYA 2WFCA 1HQOA 4DSQA 2GS3A 4ISDA 5D9VA 4ICYA 6GSYA 2DBCA 1K0CA 1EGOA 1BX9A 1VF3A 4ACSA 3ZREA 5ID2B 16GSA 2MMAA 2X4AA 4P3YB 4V1Ap 2HXKA 3C8EA 3OR5A 2R0GA 3HA9A 2AHEA 3LW9A 3EU4A 3HYPA 4RI7A 4LMWA 2ON7A 6GSSA 5DVBA 4EF0A 3DD3A 2C3QA 1F9MA 4POBA 2RIIA 2K6VA 5GSSA 2GSTA 2R6KA 3FW2A 4XTSA 4EL1A 4IW9A 2NVLA 1GSSA 2YWIA 2C0EA 2XBIA 2OKAA 2B5EA 2OE1A 4OO4A 5KOWA 2A2SA 3L9SA 5A5KA 2IWTA 4LL1B 1VF1A 2KLXA 5KN2A 1EWXA 1B9XC 3QCPA 5G5FA 2P31A 4ZBAA 3Q18A 1EP7A 2JZRA 4HQSA 2E7PA 2AUVA 3ZFBA 2HRFA 2IJYA 3VWUA 4K6XA 4HS1A 4FYBA 1JZRA 1G6WA 2A4VA 4MCUA 3DKSA 1SKWB 3L4NA 1OC3A 4Q5NA 3HY2A 3DVXA 5HR0A 2C3NA 3IC4A 1THOA 2DIYA 4I97A 5ECNB 3ZFLA 4NWYA 4IQAA 3GKNA 1SU9A 14GSA 5GAND 2F9SA 4TR4A 1ACVA 2FGXA 5IM9A 1OE8A 2FA8A 3TUEA 2VLVA 4ECCA 1ZYPA 1K0DA 4CDOA 2QA1A 1A2JA 1E2YA 3RDWA 1G7EA 4OFNA 4OO5A 1GSYA 1XFLA 2IN3A 3DMLA 2YCDA 4Q5FA 3DYRA 2I9HA 3MNGA 4HI7A 1KEBA 4X4JA 3D4TA 4XS1A 1GP1A 1Q98A 4ECIA 3QFAC 3O76A 2O8VB 3M9KA 3I9V2 5FT3A 2VL2C 2H1AA 4N0ZA 4I5QA 11GSA 4EUYA 1GLPA 1X0RA 5DALA 2P5QA 3LFLA 2IPAA 5IMVA 2CZ2A 2LEGA 3KM6A 4J57E 3HKRA 5A4WA 3TRQA 4ML6A 2WULA 2J23A 4KUNA 4LL4B 3IDVA 5IIZA 2P0GA 4K0NA 4TOPA 2JZTA 3LJRA 1ON4A 5ECMB 2VL9A 3PH9A 5D8IA 1I9DA 2M46A 1R26A 2VL3A 4V2MA 5C04A 1DE2A 1I5GA 1UA5A 1G0TA 1YQ1A 2IYJA 5FWGA 1B48A 2H19A 3R3EA 2QKEA 3KMOA 2C0GA 1YKAA 2O89A 1RQMA 4TR3A 4XS4A 3E9JB 1SKRB 3TKRA 3N9JA 4E8HA 3RHBA 2H73A 4FO5A 2KHPA 4HJ2A 4N0VA 1TU7A 1XVWA 22GSA 4MJEA 1SD8A 4ZXGA 2CAQA 3I6AA 5DBQA 4PQ1A 1URMA 2DMLA 2CA8A 4PNGA 3LXZA 2B7JA 3QAVA 2X8GA 1T4ZA 1T7PB 2VUPA 3A2VA 2O87A 4XS6A 1YJ6A 4EIPA 1X9WB 4K9ZA 4X0XA 1SD9A 3FHKA 3ISOA 3KMNA 1OC9A 3DGQA 2PPTA 1PN0A 2N5BA 4X1UA 5HFKA 3MDKA 5L71A 2VOCA 1AAZA 1Z6NA 1GSUA 3IPZA 5EL8A 5JCUA 5B8BA 1TW9A 4F0CA 2GT5A 5D93A 3D4MA 5GAPD 4BWQA 1A24A 1TRVA 2VLUA 3V1WA 2H1BA 4WXTA 3GL3A 4FQUA 4NV2A 3FEUA 3TKQA 2GZZA 4G2EA 3WD6A 1MDIA 1W89A 2C0DA 2K8SA 3LORA 3DIEA 2B6MA 3FMWA 4PNFA 3CSJA 3DWVA 3SBCA 1IYIA 2HNLA 3F3QA 4WF5A 3LSZA 2H8LA 3FZ5A 1W4VA 3IHQA 2IMFA 4O5UA 3L78A 5DAKA 5C00A 1B9YC 1V40A 3P90A 5BMUA 3MWHA 4OMVA 3F0IA 2H75A 1A8YA 1A0RP 2H6XA 3VWWA 1VRSD 2LUSA 1J0FA 1K0NA 1IYHA 5A4UA 4MPFA 3GSSA 3F4RA 1X9SB 3KJYA 2DLXA 4KSOA 1O81A 4KDXA 4GQFA 2IIYA 2C1YA 3ME7A 4EC0A 4DSSA 5IO0A 3UMAA 2DJJA 1U6TA 2VCTA 4F03A 4PQIA 1ZZYA 3GSTA 3EE2A 4IVFA 3IK9A 1DUGA 1Q4JA 4OWYA 1XWAA 1TP9A 2VLTA 3KP8A 2V6OA 2H0IA 5G2ZA 3BCKA 1GTUA 4K0GA 4V1Ag 1TU8A 4G19A 2H30A 1KBNA 3A2XA 1JLWA 2HI7A 5AISA 3F4SA 2CZ3A 3HDCA 3KTBA 5B6NA 2VM2A 1GRXA 3F63A 3D22A 3H8QA 4IGJA 3QD9A 4K7NA 4MJCA 3C71A 4KNDA 3GX0A 3GN3A 4Z2RA 2B3SA 3FRCA 5DQYA 1GH2A 1LU4A 1M0UA 4I6XA 3M1GA 1UVZA 1AQXA 4EVMA 5BRTA 2V32A 2PWJA 3L9UA 1ERVA 2YJHA 1PGTA 2VAFA 4OCEA 4JU5A 3TOTA 5J5NA 3VLNA 3HVVA 1N2AA 1J08A 3C1RA 5CNWA 2LKUA 4JR4A 3TGZA 3D0ZA 2YV9A 4ZL9A 1PL2A 3FY7A 3QFBC 3UBKA 3IBHA 3IRAA 10GSA 4CHSA 4PTSA 1XXUA 3KXOA 5J4UA 3PPUA 2L57A 1QQ2A 3NIVA 4IQ1A 2YZHA 3C7MA 4YQUA 2C0FA 5DJMA 4F0BA 5ECIB 4G0LA 1QGVA 5F06A 5B7CA 2O85A 1SYRA 3ERWA 4RI6A 4DVCA 2X49A 3TRXA 4IN0A 2FWGA 4GCIA 3UVHA 3LEFA 2AB6A 4MA9A 4Z7XA 2FY6A 3HZ8A 4MZBA 1XW5A 4BL7B 4CW9A 2IFQB 1K0MA 1U3IA 4ZBDA 3ZLPA 4K2DA 2LRCA 5KN0A 1ST9A 4FH8A 2OA7A 5ECKB 4IS0A 18GSA 1VF2A 1A8LA 2JL4A 2V1MA 3KTLA 4YAPA 5LD0A 4DSRA 1T3BA 3LXTA 1GULA 2QGVA 3FZ4A 2YV7A 4WEYA 4YQMA 2A2PA 1GUMA 1TJDA 2CQ9A 5J3RA 4EKZA 2LNTA 1YEXA 1SK1A 3MIXA 4JRRA 3U5RE 4Q5QA 2H01A 2HRAA 4MK3A 1XVQA 3VK9A 4QQ7A 3UBLA 3CRTA 3FR9A 1K0OA 5ABRA 4TW5A 2HE3A 1DSBA 4LLRA 1XW9A 2H6ZA 4DSSB 1JHBA 2X64A 1OC8A 5AN1A 5DALB 3TJBA 3KCMA 3L0HA 3KD0A 1OAZA 2WRTA 1TTZA 5LCZA 4JR6A 2IL3A 1PD21 1H75A 4POKA 5DQSA 3ZRDA 1Z7PA 4Z2UA 3KH9A 1SKSB 2CV4A 1TXXA 2F8FA 5DJLA 3APQA 1V57A 2LRNA 2VM1A 2FHEA 2X99A 1DBYA 4A5PA 4AF2A 1T00A 3F3RA 4PUAA 4ZBBA 2DJ3A 2YZUA 2HRKA 5HR1A 2XC2A 4EDYA 1WRYA 1HNBA 4MMMA 5F05A 2HSMA 4N11A 2LNSA 5JWRB 4XCSA 1YY7A 5D9WA 3F6DA 4PXOA 1Y25A 3VURA 4KDUA 3H93A 1K3LA 8GSSA 5LNKe 2RLIA 5CO3A 4XRAA 1F6MC 2E2GA 1AW9A 5CREA 2OJLA 2HFDA 3QDNA 5CRWA 2LV3A 2DJ2A 1TDIA 1Z6MA 2MMOA 2BMXA 3BJ5A 2QSIA 2VCVA 3GHAA 2GLRA 2K8VA 4KA0A 1ZMAA 3WGDA 1VGLA 2DMMA 4USSA 5KN3A 1B8XA 1GNEA 1FVKA 1GSDA 5D96A 1KNGA 4JEDA 1ZL9A 3HVXA 1BAYA 4TKYA 2DKIA 2WGRA 4F2IA 2DIZA 1SL0B 1F2EA 5ECSA 1BJXA 3F9UA 4EIQA 5D9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VPT A;  3ME8 A;  1OYJ A;  3KIJ A;  4MZW A;  2KOK A;  9GSS A;  1PX7 A;  4ILF A;  4HQZ A;  4QL7 A;  1ERU A;  4YH2 A;  1GSQ A;  2WDU A;  4BWS A;  2MYG A;  2VIM A;  3FYG A;  3KZQ A;  1WOU A;  2IMI A;  1C72 A;  2JAD A;  2LQO A;  3LGC A;  4NMU A;  4ULX A;  4GRF A;  3GKK A;  1FHE A;  4GLT A;  1K0A A;  3E0U A;  3TDG A;  3GV1 A;  3CXG A;  4I8B A;  20GS A;  1O7U A;  3ZTL A;  3DEX A;  5IOW A;  3WT1 A;  2YP6 A;  2PER A;  3FZ9 A;  3GH9 A;  2BTO T;  4MH3 A;  2RUF A;  2M80 A;  3DRN A;  3BBY A;  3HZ4 A;  3W8S A;  1F3B A;  2OBK A;  2EIO A;  1Z7R A;  2JSZ A;  4IBP A;  2VCQ A;  1Z5Y E;  4NAX A;  4MDC A;  1TK0 B;  1GL8 A;  1M99 A;  4MJA A;  3TB2 A;  5DDL A;  2H76 A;  3M8N A;  2LJA A;  1SK2 A;  3HJM A;  4MF5 A;  2H1G A;  3IOS A;  1EGR A;  2VD1 A;  2CVB A;  5DCG A;  4HU9 A;  2GVP A;  2IMD A;  1X5D A;  2GGT A;  5JWO B;  2HZE A;  5D9X A;  2O7K A;  4KB3 A;  1MD3 A;  5EY6 A;  2OBI A;  2TRC P;  5ECP B;  1YF1 A;  2PVQ A;  7GSS A;  1UC7 A;  2YPM A;  1TK5 B;  4XHM A;  2CAI A;  2DJK A;  3HD5 A;  2G0F A;  2FWH A;  2H66 A;  1TRS A;  3LWA A;  4IHU A;  3GRX A;  4L0W A;  3GIX A;  2GZY A;  5HFI A;  3NZN A;  1FB6 A;  2YN1 A;  4NHZ A;  2L4C A;  2H0H A;  3F4T A;  2CX4 A;  4LA1 A;  4ZIJ A;  1RK4 A;  2JSY A;  2V41 A;  1MD4 A;  4IP1 A;  4ZB6 A;  2HLS A;  4OD7 A;  1KTE A;  1NM3 A;  4JE1 A;  2C8U A;  1G6Y A;  2RUE A;  3KEB A;  2NTO A;  2FA4 A;  1M9B A;  3WGE A;  1ML6 A;  3TCO A;  2GTU A;  1USB A;  1EOG A;  3MSZ A;  3M3M A;  12GS A;  2VD0 A;  1AQV A;  4PUR A;  4N10 A;  3R2Q A;  2G2Q A;  2R37 A;  1U88 A;  1BQ7 A;  2FNO A;  2MMN A;  4KDY A;  1FG4 A;  5G1L A;  3C73 A;  3ED3 A;  3RAZ A;  1QMV A;  19GS A;  4HZ4 A;  4GF0 A;  2WCI A;  2GQM A;  2XBQ A;  5ID2 A;  1PRX A;  4KCE A;  4RUV A;  6GSW A;  5ECR B;  1EEM A;  2YOI A;  1XWG A;  3UEM A;  2JZS A;  2I81 A;  1SJI A;  1GNW A;  5B8A A;  4L8E A;  4NV5 A;  1F37 A;  3C1S A;  3HXS A;  2J9H A;  2BJX A;  2H71 A;  4WR5 A;  1F3A A;  4LMV A;  4ZB9 A;  3Q74 A;  5ECH B;  3PGT A;  1XCC A;  3D6I A;  4TVE A;  2TRX A;  3IAM 2;  1O73 A;  4TR1 A;  3P7X A;  2FLS A;  1WE0 A;  1EV9 A;  3Q6O A;  1BYE A;  4ML1 A;  3D5J A;  1S3C A;  5F8B A;  4YQV A;  4FIW A;  1JZW A;  1GSF A;  2ON5 A;  5CRH A;  3UJ1 A;  1SL2 B;  3IA1 A;  5JCG A;  3UL3 A;  1XPV A;  2R3X A;  1HYU A;  2PUK C;  4KE3 A;  2AYT A;  1ZYE A;  2XPD A;  2EIR A;  1THX A;  2X8H A;  3TRP A;  4L5O A;  2MMZ A;  1FW1 A;  2REM A;  2ZCT A;  4JZQ A;  4F9Z A;  2M72 A;  1O85 A;  1EEJ A;  1ILO A;  4OCF A;  1YZX A;  2GSR A;  2XHF A;  3HVS A;  1V2A A;  2GQL A;  1OKT A;  4TXV A;  4GQC A;  2ZNM A;  3EC3 A;  3GYK A;  4TR0 A;  3GKX A;  1TI1 A;  3LQ7 A;  1X9M B;  2HZF A;  5IMA A;  1FB0 A;  4O32 A;  5H5Q A;  2DJ0 A;  2JAC A;  3ZL5 A;  1PQN A;  5ENU A;  1XZO A;  4K1F A;  5KN1 A;  2L5O A;  4EO3 A;  3QMX A;  3VFI A;  1YDK A;  5ELA A;  2B1K A;  1V98 A;  1U3A A;  2B5Y A;  5HQP A;  1K3Y A;  5IOX A;  2H0G A;  1FOV A;  3O6T A;  4MF6 A;  1LBK A;  5CAX A;  3UVT A;  4L0U A;  4XRD A;  2CT6 A;  3TJG A;  1GLQ A;  3TOU A;  4J2F A;  2IFQ A;  1PL1 A;  3TKS A;  4HZ2 A;  3WGX A;  3ZVJ D;  4IJ3 A;  1OE7 A;  2CVD A;  5H5S A;  3S9F A;  3W8J A;  1R5P A;  4O92 A;  1K3O A;  1AIU A;  2PMT A;  2DJ1 A;  4GST A;  2AAW A;  1M9A A;  3JCM L;  1PSQ A;  4D73 B;  4OFM A;  5B6M A;  1O6J A;  2OAC A;  1NHY A;  3QPM A;  3HJP A;  2RM5 A;  2F51 A;  1S3A A;  3US3 A;  2YWO A;  2HT9 A;  4PUF C;  4I2T A;  2L59 A;  4IKH A;  4RQR A;  4O7H A;  1JLV A;  2R2J A;  3EIN A;  4IJI A;  1AUC A;  2P5R A;  3HJO A;  3M0F A;  4YAV A;  5HR2 A;  2CX3 A;  4PX1 A;  2F8A A;  1U87 A;  5IMF A;  4QL9 A;  4BA7 A;  1Z9H A;  3H4K A;  4WBR D;  4MAB A;  5J9C A;  2KP2 A;  2E2M A;  1OKD A;  5DCH A;  3U6V A;  1M2A A;  1XWK A;  2L6C A;  3TKP A;  1FAA A;  5ECQ B;  2VO4 A;  3PR8 A;  1SJ6 A;  3F8U A;  5ECL B;  1MDK A;  2I3Y A;  1WMJ A;  13GS A;  1XW6 A;  3VWV A;  2HRN A;  1OVN A;  3GFK A;  2C80 A;  2GSQ A;  6GST A;  1QK8 A;  1CQG A;  1QUW A;  5ECO B;  4WKW A;  1RW1 A;  2YWM A;  5IO2 A;  3VI5 A;  3QOU A;  1EOH A;  4KGI A;  1X5E A;  5F0G A;  3EUR A;  1UN2 A;  3W6G A;  3TJJ A;  3GTU A;  4EDZ A;  3CMI A;  2V6K A;  2GQK A;  4POM A;  1NSW A;  4MH2 A;  2I1U A;  1PMT A;  1DE1 A;  2AV4 A;  4KX4 A;  4ID0 A;  1N8J A;  3VWX A;  2R4V A;  2DSA A;  4KCA A;  4E8E A;  5G31 A;  2GDR A;  1JZO A;  3GTU B;  2VCX A;  3L9V A;  3KP9 A;  1TKD B;  4HUA A;  4MP4 A;  2MBS A;  3LG6 A;  3EVI A;  2GZP A;  3APO A;  2FWF A;  2LTK A;  1GTB A;  1H4O A;  2WJU A;  2L5L A;  4L5L A;  5HR3 A;  1M7T A;  3K8N A;  3M9J A;  1B4P A;  2RM6 A;  1ERW A;  4BVX A;  5GST A;  2PBJ A;  5DAK B;  2Z9S A;  3FR3 A;  4FYC A;  5IPG A;  1AQW A;  5E4W A;  1WIK A;  4BL7 A;  2LQQ A;  6GSX A;  4ZB8 A;  4HOJ A;  4FYU A;  2AJQ B;  5IQY A;  1K0B A;  1SYX A;  5G5E A;  3AY8 A;  3GMF A;  3WYW A;  5G1K A;  2FUG 2;  3PIN A;  3N5O A;  1NHO A;  1SL1 B;  1O8W A;  3GNJ A;  1XOB A;  4TXO B;  1HNA A;  3EMP A;  2D2Z A;  2XPE A;  2H6Y A;  4PGT A;  3WT2 A;  3G7I A;  4HDE A;  4RQX A;  4MPG A;  3IK7 A;  3ZYW A;  1XIY A;  2FWE A;  4NHW A;  3UAP A;  4AJ6 A;  3ZML A;  3ERF A;  2K18 A;  2H1D A;  2TIR A;  3EWL A;  4N30 A;  3UAR A;  1G7O A;  3VI7 A;  5EVO A;  1OC9 B;  2PVO C;  4Q5R A;  1GUH A;  5IMC A;  3RPP A;  4NXI A;  4F82 A;  4ZL7 A;  1QXH A;  4D73 A;  4TXO A;  4AJ8 A;  2LRT A;  2IME A;  1A0F A;  2IY2 A;  2NBS A;  3LYP A;  2YAN A;  1T4Y A;  3TKS C;  5A4V A;  3QAG A;  2H72 A;  2VCZ A;  4V2L A;  1ZOF A;  1TRU A;  1V58 A;  2PN8 A;  3GUR A;  2VL2 A;  1A2M A;  1AXD A;  3GL5 A;  2F3M A;  5E59 A;  3Q19 A;  3I43 A;  2YWN A;  4IEL A;  5IPH A;  1TI3 A;  1MEK A;  3G9B A;  3CSI A;  2DC5 A;  3BOA A;  1J9B A;  1E6B A;  1GTI A;  2YNX A;  3IXR A;  4WBJ A;  5D73 A;  2B5X A;  4K7I A;  4JBB A;  1GWC A;  3UIW A;  4KH7 A;  4K8M A;  5IMZ A;  1B4Q A;  2C4J A;  1MTC A;  1Y6E A;  1PA3 A;  2KP1 A;  1QFN A;  5EPF A;  4TN8 A;  4EXJ A;  1ZYQ B;  2K9F A;  1WWJ A;  3O3T A;  4V2N A;  1HD2 A;  3P2A A;  5IMD A;  4XIH A;  3TJF A;  3ZVJ A;  3J7Y k;  4PQH A;  2PGT A;  4GXZ A;  2CVK A;  1O8X A;  2WB9 A;  2OAD A;  2HYX A;  3KGK A;  3TKS E;  4ECB A;  17GS A;  4G9H A;  1XBS A;  1JZD A;  1XWC A;  3ZIJ A;  4MF7 A;  4KSM A;  2WZ9 A;  1YKC A;  1GSE A;  3ERG A;  3CBU A;  3GUS A;  2HSH A;  4NPB A;  3IV4 A;  3RBT A;  2LJR A;  2A2R A;  3SWL A;  4J56 E;  1T8E B;  1T1V A;  3HCZ A;  2QC7 A;  1M2B A;  4WF4 A;  2L4Q A;  3QR6 A;  1PKW A;  1VF4 A;  2B1L A;  1SK0 A;  1WPI A;  4POL A;  1FVJ A;  2LJK A;  4TR1 B;  2OE3 A;  2GSS A;  3J7Y b;  3DXB A;  2L6D A;  2GT6 A;  3EU3 A;  5AIV A;  4G10 A;  5KEJ A;  5F07 A;  4EE0 A;  5CRD A;  3CYN A;  4OFT A;  3KH7 A;  3G7J A;  2V2G A;  1M2D A;  2R5G A;  5J41 A;  4HEA 2;  1HNC A;  3CRU A;  2YJ7 A;  3A2W A;  1BED A;  2FD3 A;  2B7K A;  1FO5 A;  1JFU A;  3GKM A;  4BVY A;  1A23 A;  4GWR A;  5AIX A;  3E3E A;  4H86 A;  3EYT A;  2KUC A;  1YF0 A;  2HSY A;  1NW2 A;  1ERT A;  1YEP A;  2EIQ A;  4I2U A;  1R7H A;  1TRW A;  4WR4 A;  3GA4 A;  2IMK A;  2MZC A;  1XOA A;  3IAS 2;  4XS4 B;  2ZUP A;  1S3D A;  2VCW A;  1EZK A;  3BCI A;  4AJ7 A;  1TK8 B;  2NDO A;  2H74 A;  3RPN A;  4ZIL A;  3G7Y A;  3A5W A;  1PN9 A;  3HHV A;  4K7O A;  3VPQ A;  4GSS A;  5JCW A;  5J9B A;  3H1N A;  1EV4 A;  1CQH A;  3FR6 A;  2ALB A;  5ELG A;  3UOM A;  5H5R A;  3F6F A;  1PKZ A;  4WET A;  1X5C A;  1XWB A;  4MJB A;  1TOF A;  3LYK A;  4KW6 A;  4X43 A;  5JWQ B;  4ZL8 A;  3FK8 A;  2C3T A;  2E0Q A;  1SEN A;  6GSU A;  4GSN A;  2MBT A;  5AGY A;  4HJM A;  3BD2 A;  1WP0 A;  3TJK A;  2NPB A;  4BPY A;  1V9W A;  3P8W A;  1EP8 A;  2WS2 A;  2PU9 C;  3GX8 A;  1PX6 A;  4DEJ A;  2N5F A;  4TRX A;  5FHI A;  3A3T A;  4AGS A;  3ZIV A;  2X8C A;  2HZE B;  4ECJ A;  3IE3 A;  3DVW A;  3D21 A;  3I69 A;  3H79 A;  4IP6 A;  1BG5 A;  3CSH A;  1ABA A;  4O5R A;  2ES7 A;  3CTF A;  1R4W A;  1AC1 A;  5CP1 A;  3ZMK A;  4MZC A;  2LS5 A;  2I4A A;  3IR4 A;  2H70 A;  1ZCP A;  4GTU A;  1GUK A;  3NOF A;  5COH A;  1SJZ A;  6GSV A;  3RHC A;  4HU7 A;  2EC4 A;  1WJK A;  4MLY A;  3MAK A;  1ZGN A;  3GH6 A;  3FKF A;  1GTA A;  5GZZ B;  1LJR A;  2LST A;  5INY A;  3EMX A;  3FZA A;  2N5A A;  4KAE A;  3QAW A;  5G30 A;  5HFG A;  2FCH A;  2OE0 A;  3ZIT A;  1R5A A;  1Z3E A;  5CRG A;  1MDJ A;  3ZZX A;  3CTG A;  3APS A;  1A2L A;  2JU5 A;  5CYY A;  2WFC A;  1HQO A;  4DSQ A;  2GS3 A;  4ISD A;  5D9V A;  6GSY A;  2DBC A;  1K0C A;  1EGO A;  1BX9 A;  1VF3 A;  4ACS A;  3ZRE A;  5ID2 B;  16GS A;  2MMA A;  4P3Y B;  4V1A p;  2HXK A;  3C8E A;  3OR5 A;  3HA9 A;  2AHE A;  3EU4 A;  3HYP A;  4RI7 A;  4LMW A;  2ON7 A;  6GSS A;  5DVB A;  4EF0 A;  3DD3 A;  2C3Q A;  1F9M A;  4POB A;  2RII A;  2K6V A;  5GSS A;  2GST A;  2R6K A;  3FW2 A;  4XTS A;  4EL1 A;  4IW9 A;  2NVL A;  1GSS A;  2YWI A;  2C0E A;  2XBI A;  2OKA A;  2B5E A;  2OE1 A;  4OO4 A;  2A2S A;  3L9S A;  5A5K A;  2IWT A;  4LL1 B;  1VF1 A;  2KLX A;  5KN2 A;  1EWX A;  1B9X C;  3QCP A;  5G5F A;  2P31 A;  4ZBA A;  3Q18 A;  1EP7 A;  2JZR A;  4HQS A;  2E7P A;  2AUV A;  3ZFB A;  2HRF A;  2IJY A;  3VWU A;  4K6X A;  4HS1 A;  4FYB A;  1JZR A;  1G6W A;  2A4V A;  4MCU A;  3DKS A;  1SKW B;  3L4N A;  1OC3 A;  4Q5N A;  3HY2 A;  3DVX A;  5HR0 A;  2C3N A;  3IC4 A;  1THO A;  2DIY A;  4I97 A;  5ECN B;  3ZFL A;  4NWY A;  4IQA A;  3GKN A;  1SU9 A;  14GS A;  5GAN D;  2F9S A;  4TR4 A;  1ACV A;  2FGX A;  5IM9 A;  1OE8 A;  2FA8 A;  3TUE A;  2VLV A;  4ECC A;  1K0D A;  4CDO A;  1A2J A;  1E2Y A;  3RDW A;  1G7E A;  4OFN A;  4OO5 A;  1GSY A;  1XFL A;  2IN3 A;  3DML A;  2YCD A;  4Q5F A;  3DYR A;  2I9H A;  3MNG A;  4HI7 A;  1KEB A;  3D4T A;  4XS1 A;  1GP1 A;  1Q98 A;  4ECI A;  3QFA C;  3O76 A;  2O8V B;  3M9K A;  3I9V 2;  5FT3 A;  2VL2 C;  2H1A A;  4N0Z A;  4I5Q A;  11GS A;  4EUY A;  1GLP A;  1X0R A;  5DAL A;  2P5Q A;  3LFL A;  2IPA A;  5IMV A;  2CZ2 A;  2LEG A;  3KM6 A;  4J57 E;  3HKR A;  5A4W A;  3TRQ A;  4ML6 A;  2WUL A;  2J23 A;  4KUN A;  4LL4 B;  3IDV A;  5IIZ A;  2P0G A;  4K0N A;  4TOP A;  2JZT A;  3LJR A;  1ON4 A;  5ECM B;  2VL9 A;  3PH9 A;  5D8I A;  1I9D A;  2M46 A;  1R26 A;  2VL3 A;  4V2M A;  5C04 A;  1DE2 A;  1I5G A;  1UA5 A;  1G0T A;  1YQ1 A;  2IYJ A;  5FWG A;  1B48 A;  2H19 A;  2QKE A;  3KMO A;  2C0G A;  1YKA A;  2O89 A;  1RQM A;  4TR3 A;  4XS4 A;  3E9J B;  1SKR B;  3TKR A;  3N9J A;  4E8H A;  3RHB A;  2H73 A;  4FO5 A;  2KHP A;  4HJ2 A;  4N0V A;  1TU7 A;  1XVW A;  22GS A;  4MJE A;  1SD8 A;  4ZXG A;  2CAQ A;  3I6A A;  5DBQ A;  4PQ1 A;  1URM A;  2DML A;  2CA8 A;  4PNG A;  3LXZ A;  2B7J A;  3QAV A;  2X8G A;  1T4Z A;  1T7P B;  2VUP A;  3A2V A;  2O87 A;  4XS6 A;  1YJ6 A;  1X9W B;  4K9Z A;  4X0X A;  1SD9 A;  3FHK A;  3ISO A;  3KMN A;  1OC9 A;  3DGQ A;  2PPT A;  2N5B A;  4X1U A;  5HFK A;  3MDK A;  5L71 A;  2VOC A;  1AAZ A;  1Z6N A;  1GSU A;  3IPZ A;  5EL8 A;  5JCU A;  5B8B A;  1TW9 A;  4F0C A;  2GT5 A;  5D93 A;  3D4M A;  5GAP D;  4BWQ A;  1A24 A;  1TRV A;  2VLU A;  3V1W A;  2H1B A;  4WXT A;  3GL3 A;  4NV2 A;  3FEU A;  3TKQ A;  2GZZ A;  4G2E A;  3WD6 A;  1MDI A;  1W89 A;  2C0D A;  2K8S A;  3LOR A;  3DIE A;  2B6M A;  4PNF A;  3CSJ A;  3DWV A;  3SBC A;  1IYI A;  2HNL A;  3F3Q A;  4WF5 A;  3LSZ A;  2H8L A;  3FZ5 A;  1W4V A;  3IHQ A;  2IMF A;  3L78 A;  5DAK A;  5C00 A;  1B9Y C;  1V40 A;  3P90 A;  3MWH A;  4OMV A;  3F0I A;  2H75 A;  1A8Y A;  1A0R P;  2H6X A;  3VWW A;  1VRS D;  2LUS A;  1J0F A;  1K0N A;  1IYH A;  5A4U A;  4MPF A;  3GSS A;  3F4R A;  1X9S B;  3KJY A;  2DLX A;  4KSO A;  1O81 A;  4KDX A;  4GQF A;  2IIY A;  2C1Y A;  3ME7 A;  4EC0 A;  4DSS A;  5IO0 A;  3UMA A;  2DJJ A;  1U6T A;  2VCT A;  4F03 A;  4PQI A;  1ZZY A;  3GST A;  3EE2 A;  4IVF A;  3IK9 A;  1DUG A;  1Q4J A;  4OWY A;  1XWA A;  1TP9 A;  2VLT A;  3KP8 A;  2V6O A;  2H0I A;  5G2Z A;  3BCK A;  1GTU A;  4K0G A;  4V1A g;  1TU8 A;  4G19 A;  2H30 A;  1KBN A;  3A2X A;  1JLW A;  2HI7 A;  5AIS A;  3F4S A;  2CZ3 A;  3HDC A;  3KTB A;  5B6N A;  2VM2 A;  1GRX A;  3F63 A;  3D22 A;  3H8Q A;  4IGJ A;  3QD9 A;  4K7N A;  4MJC A;  3C71 A;  4KND A;  3GX0 A;  3GN3 A;  2B3S A;  3FRC A;  5DQY A;  1GH2 A;  1LU4 A;  1M0U A;  4I6X A;  3M1G A;  1UVZ A;  1AQX A;  4EVM A;  2V32 A;  2PWJ A;  3L9U A;  1ERV A;  2YJH A;  1PGT A;  2VAF A;  4OCE A;  4JU5 A;  3TOT A;  5J5N A;  3VLN A;  3HVV A;  1N2A A;  1J08 A;  3C1R A;  5CNW A;  2LKU A;  4JR4 A;  3TGZ A;  3D0Z A;  2YV9 A;  4ZL9 A;  1PL2 A;  3FY7 A;  3QFB C;  3UBK A;  3IBH A;  3IRA A;  10GS A;  4CHS A;  1XXU A;  3KXO A;  5J4U A;  2L57 A;  1QQ2 A;  3NIV A;  4IQ1 A;  2YZH A;  3C7M A;  4YQU A;  2C0F A;  5DJM A;  4F0B A;  5ECI B;  1QGV A;  5F06 A;  5B7C A;  2O85 A;  1SYR A;  3ERW A;  4RI6 A;  4DVC A;  3TRX A;  4IN0 A;  2FWG A;  4GCI A;  3UVH A;  3LEF A;  2AB6 A;  4MA9 A;  4Z7X A;  2FY6 A;  3HZ8 A;  4MZB A;  1XW5 A;  4CW9 A;  2IFQ B;  1K0M A;  1U3I A;  4ZBD A;  3ZLP A;  4K2D A;  2LRC A;  5KN0 A;  1ST9 A;  4FH8 A;  2OA7 A;  5ECK B;  4IS0 A;  18GS A;  1VF2 A;  1A8L A;  2JL4 A;  2V1M A;  3KTL A;  4YAP A;  5LD0 A;  4DSR A;  1T3B A;  3LXT A;  1GUL A;  2QGV A;  3FZ4 A;  2YV7 A;  4WEY A;  4YQM A;  1GUM A;  1TJD A;  2CQ9 A;  5J3R A;  4EKZ A;  2LNT A;  1YEX A;  1SK1 A;  4JRR A;  3U5R E;  4Q5Q A;  2H01 A;  4MK3 A;  1XVQ A;  3VK9 A;  4QQ7 A;  3UBL A;  3CRT A;  3FR9 A;  1K0O A;  5ABR A;  4TW5 A;  2HE3 A;  1DSB A;  4LLR A;  1XW9 A;  2H6Z A;  4DSS B;  1JHB A;  2X64 A;  1OC8 A;  5AN1 A;  5DAL B;  3TJB A;  3KCM A;  3L0H A;  3KD0 A;  1OAZ A;  2WRT A;  1TTZ A;  5LCZ A;  4JR6 A;  2IL3 A;  1PD2 1;  1H75 A;  4POK A;  5DQS A;  3ZRD A;  1Z7P A;  3KH9 A;  1SKS B;  2CV4 A;  1TXX A;  2F8F A;  5DJL A;  3APQ A;  1V57 A;  2LRN A;  2VM1 A;  2FHE A;  2X99 A;  1DBY A;  4AF2 A;  1T00 A;  3F3R A;  4PUA A;  4ZBB A;  2DJ3 A;  2YZU A;  5HR1 A;  2XC2 A;  4EDY A;  1WRY A;  1HNB A;  4MMM A;  5F05 A;  4N11 A;  2LNS A;  5JWR B;  4XCS A;  1YY7 A;  5D9W A;  3F6D A;  4PXO A;  1Y25 A;  3VUR A;  4KDU A;  3H93 A;  1K3L A;  8GSS A;  5LNK e;  2RLI A;  5CO3 A;  4XRA A;  1F6M C;  2E2G A;  1AW9 A;  5CRE A;  2OJL A;  2HFD A;  3QDN A;  5CRW A;  2LV3 A;  2DJ2 A;  1TDI A;  1Z6M A;  2MMO A;  2BMX A;  3BJ5 A;  2QSI A;  2VCV A;  3GHA A;  2GLR A;  2K8V A;  4KA0 A;  1ZMA A;  3WGD A;  1VGL A;  2DMM A;  5KN3 A;  1B8X A;  1GNE A;  1FVK A;  1GSD A;  5D96 A;  1KNG A;  4JED A;  1ZL9 A;  3HVX A;  1BAY A;  4TKY A;  4F2I A;  2WGR A;  2DIZ A;  1SL0 B;  1F2E A;  5ECS A;  1BJX A;  3F9U A;  5D9T A; 
#chains in the Genus database with same CATH topology
 3VPT A;  1LNI A;  3ME8 A;  2O3O A;  1OYJ A;  4HM2 B;  3KIJ A;  4MZW A;  2XSO B;  2KOK A;  9GSS A;  3GWR A;  1YHQ 3;  1PX7 A;  4ILF A;  3RNT A;  1OPY A;  4HQZ A;  4QL7 A;  1ERU A;  4YH2 A;  4R4K A;  1GSQ A;  2WDU A;  4BWS A;  4YKG A;  2MYG A;  2VIM A;  3FYG A;  3KZQ A;  1WOU A;  2IMI A;  1C72 A;  2PNC A;  2JAD A;  2LQO A;  3X3X A;  1BNG A;  3LGC A;  4NMU A;  4ULX A;  4GRF A;  1B27 A;  3FKA A;  4GHO A;  3GKK A;  1BNJ A;  1FHE A;  4GLT A;  1K0A A;  1TU5 A;  2BMO B;  1HKX A;  3B4O A;  1N9E A;  3E0U A;  4O3V A;  3TDG A;  3RGA A;  3S5C A;  1RGL A;  3GV1 A;  5JPU A;  3CXG A;  3MYD A;  1CH0 A;  4I8B A;  20GS A;  1O7U A;  3ZTL A;  3DEX A;  3D3L A;  5M18 A;  2ML5 A;  5IOW A;  2P09 A;  5M19 A;  1FZU A;  3WT1 A;  1W7C A;  1JKG B;  2YP6 A;  1HZ1 A;  4K5S A;  2PER A;  1LVN A;  3FZ9 A;  3GH9 A;  2BTO T;  1TRP A;  2RUF A;  5CXO A;  4MH3 A;  2UZ8 A;  1R4Y A;  2M80 A;  3DRN A;  1IT7 A;  3BBY A;  3HZ4 A;  3KII A;  3W8S A;  1RGG A;  1F3B A;  4GB5 A;  2OBK A;  2EIO A;  1B2S A;  1STF I;  1DVD A;  1Z7R A;  2JSZ A;  4IBP A;  2VCQ A;  1Z5Y E;  4NAX A;  4MDC A;  1BAN A;  5IEN A;  1TK0 B;  1GL8 A;  1M99 A;  4MJA A;  3TB2 A;  5DDL A;  1RNB A;  1ZYN A;  2H76 A;  3M8N A;  2LJA A;  1SK2 A;  4HKV B;  3HJM A;  4LSO A;  2H1G A;  3IOS A;  4MF5 A;  2VD1 A;  2CVB A;  1EGR A;  5DCG A;  4HU9 A;  1NDO B;  5HGR A;  2GVP A;  2IMD A;  1X5D A;  2GGT A;  5JWO B;  2HZE A;  5D9X A;  2O7K A;  2KCD A;  4KB3 A;  1I8V A;  1MD3 A;  5EY6 A;  3CCJ 3;  2OBI A;  2TRC P;  1VQL 3;  5ECP B;  2SBL A;  5IER A;  2OWP A;  1YF1 A;  4G0K A;  2PVQ A;  7GSS A;  1UC7 A;  1BSE A;  2YPM A;  1I70 A;  5AI1 A;  1TK5 B;  4XHM A;  2GBW B;  2GBX B;  2CAI A;  2DJK A;  3AGN A;  3HD5 A;  2G0F A;  4G0I A;  2FWH A;  2H66 A;  1TRS A;  3LWA A;  4IHU A;  1IT8 A;  3GRX A;  4L0W A;  3GIX A;  1GOY A;  1JKG A;  1MOL A;  2GZY A;  3UJM A;  1RRH A;  1RGA A;  5HFI A;  3JUM A;  3F8H A;  4WYK A;  1FB6 A;  3NZN A;  2YN1 A;  2Z6B A;  4NHZ A;  2L4C A;  2GSP A;  4STD A;  2H0H A;  3F4T A;  1KD1 4;  2CX4 A;  4LA1 A;  4ZIJ A;  1RK4 A;  5A0O B;  1VQN 3;  2JSY A;  2V41 A;  1MD4 A;  1M3J A;  4IP1 A;  4ZB6 A;  2WOF A;  4N6N B;  2HLS A;  4OD7 A;  3DGO A;  1KTE A;  1NM3 A;  4Z2T A;  4FR9 A;  3V99 A;  4JE1 A;  3HII A;  3I55 3;  2C8U A;  1G6Y A;  2RUE A;  3KEB A;  3ER7 A;  3F14 A;  2NTO A;  2FA4 A;  1M9B A;  3J7Y d;  1LQM B;  3WGE A;  1ML6 A;  3TCO A;  3FG4 A;  2GTU A;  1CYU A;  1USB A;  1EOG A;  3MSZ A;  3M3M A;  12GS A;  3FSD A;  2VD0 A;  3V92 A;  1QJG A;  1AQV A;  5EQL A;  4PUR A;  4N10 A;  1VQ4 3;  3R2Q A;  2G2Q A;  2R37 A;  1U88 A;  1BQ7 A;  1NNV A;  1RCK A;  1WQL B;  3K63 A;  2FNO A;  3CD6 3;  2MMN A;  4KDY A;  1FG4 A;  5G1L A;  3EX9 A;  3C73 A;  3ED3 A;  1DYU A;  5CF1 A;  3RAZ A;  1EG9 B;  1I0V A;  3EN8 A;  1QMV A;  3CCS 3;  19GS A;  4HZ4 A;  4GF0 A;  2WCI A;  2GQM A;  2XBQ A;  5ID2 A;  1PRX A;  4KCE A;  4RUV A;  3O8Y A;  2YFI B;  2WO0 A;  2BHM A;  4BL2 A;  1LNH A;  4FCM A;  6GSW A;  1KWI A;  4BVY B;  5ECR B;  3KCH A;  1EEM A;  2YOI A;  1BRK A;  1XWG A;  2JZS A;  3UEM A;  2XGN A;  1M9G A;  3LT8 A;  3GZX B;  2I81 A;  1TTO A;  3JUQ A;  4IPB A;  4L7K A;  1SJI A;  1GNW A;  5B8A A;  4L8E A;  2XH9 A;  4NV5 A;  1F37 A;  3C1S A;  3HXS A;  2J9H A;  2BJX A;  1BSD A;  3AGO A;  2H71 A;  4WR5 A;  1IDP A;  1GOV A;  1RKY A;  1F3A A;  2LQV A;  4LMV A;  5KOX A;  4ZB9 A;  3Q74 A;  5ECH B;  4WFO A;  1DE3 A;  3PGT A;  1XCC A;  3D6I A;  4TVE A;  2TRX A;  3IAM 2;  3MYT A;  3AHS A;  1O73 A;  1ZO2 A;  4TR1 A;  3P7X A;  1UI8 A;  1GY7 A;  2FLS A;  1CQS A;  1WE0 A;  1EV9 A;  3Q6O A;  1BYE A;  4ML1 A;  3D5J A;  3SLU A;  1S3C A;  5F8B A;  4YQV A;  1UGI A;  2W56 A;  4FIW A;  4FMC A;  1JZW A;  1GSF A;  1J2B A;  2ON5 A;  5CRH A;  3UJ1 A;  2R0P A;  2CH9 A;  1SL2 B;  3IA1 A;  5JCG A;  3NXJ A;  3UL3 A;  1XPV A;  2R3X A;  2Y74 A;  1HYU A;  2PUK C;  5D82 A;  4KE3 A;  5CLK A;  2AYT A;  1ZYE A;  2XPD A;  2EIR A;  3D9R A;  3OW2 2;  1BSC A;  3AHW A;  1THX A;  2X8H A;  3TRP A;  4L5O A;  2MMZ A;  1FW1 A;  2REM A;  2P0M A;  2ZCT A;  4JZQ A;  4K5R A;  4F9Z A;  1MWR A;  2ZHX B;  2M72 A;  1O85 A;  1EEJ A;  1ILO A;  4OCF A;  1YZX A;  2GSR A;  2XHF A;  1F8N A;  3HVS A;  1GYB A;  1V2A A;  2GQL A;  1OKT A;  4GQC A;  4TXV A;  3NM2 A;  1BNE A;  4R1K A;  2ZNM A;  3FH1 A;  2CKF B;  3EC3 A;  3GYK A;  4TR0 A;  4HAA A;  3GKX A;  1TI1 A;  3LQ7 A;  3NUV A;  2Y73 A;  1X9M B;  2HZF A;  5IMA A;  1FB0 A;  4O32 A;  1ULJ B;  5H5Q A;  2DJ0 A;  1Q42 A;  1YGW A;  2JAC A;  3ZL5 A;  1PQN A;  5ENU A;  1XZO A;  5M1A A;  1SIH A;  4K1F A;  5KN1 A;  1OAC A;  2OCT A;  2L5O A;  4EO3 A;  2OOV A;  3KSE D;  3QMX A;  3VFI A;  1YDK A;  4CCV A;  5ELA A;  5AIG A;  2B1K A;  1V98 A;  1U3A A;  2B5Y A;  5HQP A;  1FGQ A;  1U5O A;  2HMM B;  1K3Y A;  5IOX A;  2H0G A;  1FOV A;  3O6T A;  1Q9E A;  4MF6 A;  2GEY A;  3FF2 A;  1FUT A;  1LBK A;  1IK3 A;  2XEP A;  3IC8 A;  3IHG A;  3SVA A;  1RN7 A;  5CAX A;  1VQ8 3;  3UVT A;  4L0U A;  3V98 A;  4XRD A;  3U97 A;  2CT6 A;  3TJG A;  1GLQ A;  3TOU A;  4J2F A;  1UI7 A;  2IFQ A;  1PL1 A;  3TKS A;  4HZ2 A;  3WGX A;  3ZVJ D;  3FG3 A;  4IJ3 A;  1OE7 A;  3IPT A;  2CVD A;  5H5S A;  3S9F A;  1OHP A;  5BVB A;  5CF2 A;  1R5P A;  4O92 A;  3W8J A;  1GD4 A;  3EB8 A;  1K3O A;  1JV2 B;  1OHO A;  3G0K A;  1AIU A;  2PMT A;  1LOW A;  2CK3 H;  2DJ1 A;  4GST A;  2AAW A;  1M9A A;  3JCM L;  1PSQ A;  4D73 B;  4OFM A;  2RSX A;  5B6M A;  1O6J A;  2OAC A;  1NHY A;  3QPM A;  5IG3 A;  2KF4 A;  1FOH A;  3HJP A;  2RM5 A;  2F51 A;  1S3A A;  3US3 A;  2YWO A;  4GL6 A;  2HT9 A;  4PUF C;  1KSI A;  1ZGX A;  4I2T A;  3X41 A;  2L59 A;  3KE7 A;  1W2Z A;  4IKH A;  4LMI A;  3N9H A;  3WMD A;  1EKM A;  3T0U A;  2HOH A;  4O7H A;  1JLV A;  2R2J A;  4RQR A;  1JB2 A;  3EIN A;  4H3U A;  4IJI A;  1AUC A;  2P5R A;  1AY7 A;  1BRI A;  5AEW B;  4KT3 B;  4AEQ A;  3HJO A;  3M0F A;  4YAV A;  5HR2 A;  1I2F A;  2RCD A;  4N6V 0;  2CX3 A;  4PX1 A;  2F8A A;  5FW5 A;  3G71 3;  1DMQ A;  1U87 A;  5IMF A;  4QL9 A;  1NU3 A;  2BMR B;  4HOH A;  4BA7 A;  1Z9H A;  4OK0 A;  1K9M 4;  3H4K A;  4WBR D;  4MAB A;  5J9C A;  2KP2 A;  2E2M A;  1OKD A;  5DCH A;  1K41 A;  3U6V A;  1M2A A;  4HM0 B;  1XWK A;  1WMP A;  2L6C A;  3TKP A;  1IU7 A;  1FAA A;  5ECQ B;  3EPT A;  2VO4 A;  3PR8 A;  1SJ6 A;  3F8U A;  5ECL B;  3GZR A;  5LC6 A;  1M90 4;  1Z1S A;  4I4K A;  3CCE 3;  1MDK A;  2JDI H;  2I3Y A;  1WMJ A;  13GS A;  3CCU 3;  3WOD G;  4DKI A;  2BU4 A;  1XW6 A;  3VWV A;  2HRN A;  1OVN A;  4BVX B;  3GFK A;  2C80 A;  2GSQ A;  6GST A;  2YFL B;  1W6C A;  1QK8 A;  4BIK A;  1CQG A;  1QUW A;  5ECO B;  4WKW A;  4PEJ A;  3WA2 X;  1MWS A;  1RW1 A;  2YWM A;  5IO2 A;  3VI5 A;  2YFJ B;  3QOU A;  3K9M C;  2RBI A;  1EOH A;  4KGI A;  1X5E A;  5F0G A;  4AKY A;  3EUR A;  1UN2 A;  2F5W A;  3W6G A;  3TJJ A;  3OWY A;  3STD A;  1N5H A;  4IT7 A;  3GTU A;  4EDZ A;  3CMI A;  2V6K A;  2GQK A;  4R9L A;  1VQ6 3;  1JBR A;  4POM A;  1UUG B;  1NSW A;  4MH2 A;  2I1U A;  1RN4 A;  4OVM A;  1PMT A;  1DE1 A;  2WOH A;  3WDG B;  2AV4 A;  4KX4 A;  4ID0 A;  1N8J A;  3LTB A;  4KFF A;  3E99 A;  3VWX A;  2R4V A;  2C4B A;  3PS8 A;  2DSA A;  4KCA A;  1D6Z A;  4E8E A;  4O8S A;  3ALA A;  5G31 A;  2GDR A;  1JZO A;  3IMA B;  3LTA A;  1JB4 A;  3GTU B;  2C10 A;  2VCX A;  4CY8 A;  3L9V A;  3KP9 A;  5ELJ A;  1TKD B;  4HUA A;  4MP4 A;  1Q40 A;  2MBS A;  6GSP A;  1IVV A;  3LG6 A;  2W9Q A;  3EVI A;  2GZP A;  3APO A;  2FWF A;  2LTK A;  1OGZ A;  1GTB A;  1H4O A;  2WJU A;  3KSP A;  1A90 A;  2L5L A;  4L5L A;  5HR3 A;  1LXE A;  2K3D A;  1M7T A;  3K8N A;  3M9J A;  1B4P A;  2RM6 A;  1ERW A;  4BVX A;  2M7O A;  5GST A;  1UCI A;  2XR8 B;  1GY6 A;  2PBJ A;  1ZS7 A;  3S28 A;  5DAK B;  3S27 A;  2Z9S A;  3FR3 A;  4FYC A;  1IQ8 A;  5IPG A;  3BB9 A;  1AQW A;  5E4W A;  1WIK A;  4BL7 A;  3HZP A;  3SED A;  2LQQ A;  3PGB A;  2R0C A;  4ZB8 A;  6GSX A;  1B2Z A;  1LOV A;  4HOJ A;  3EE1 A;  4FYU A;  2AJQ B;  5IQY A;  1K0B A;  3HIG A;  1SYX A;  1B2M A;  5G5E A;  3AY8 A;  4K90 B;  4ORL A;  3GMF A;  3WYW A;  5G1K A;  2FUG 2;  4RZM A;  3KN4 A;  2KF5 A;  3PIN A;  4OUQ A;  3N5O A;  1NHO A;  3FGY A;  1SL1 B;  2ZDJ A;  1O8W A;  3GNJ A;  3UL6 A;  1XOB A;  4J5K A;  1MWT A;  4TXO B;  1HNA A;  3EMP A;  2D2Z A;  1IV9 A;  2XPE A;  3S67 A;  2H6Y A;  4PGT A;  3WT2 A;  3HX8 A;  3NBB A;  3G7I A;  4HDE A;  4BIR A;  4RQX A;  3HVN A;  4MPG A;  3IK7 A;  1EA2 A;  3ZYW A;  1XIY A;  2FWE A;  1A2V A;  4NHW A;  2CFD A;  3K5T A;  3UAP A;  3CPW 2;  4AJ6 A;  3ZML A;  5D83 A;  3H3H A;  3ERF A;  1RGE A;  2K18 A;  2H1D A;  2TIR A;  3EWL A;  4N30 A;  3F7X A;  3UAR A;  2DKH A;  1G7O A;  1T5Y A;  2L4V A;  3VI7 A;  3D5I A;  5EVO A;  1OC9 B;  2PVO C;  4Q5R A;  3UL5 A;  1PFP A;  1CEW I;  4CDL A;  4HM5 B;  2FGT A;  3AMO B;  1GUH A;  1X1Y A;  5IMC A;  3RPP A;  3DZL A;  3BNE A;  4NXI A;  4F82 A;  4ZL7 A;  1LOY A;  1NB3 I;  4RNY A;  1QXH A;  4D73 A;  4TXO A;  4AJ8 A;  2LRT A;  2IME A;  5IG5 A;  1A0F A;  2K54 A;  2IY2 A;  2NBS A;  3LYP A;  2YAN A;  1BAO A;  1T4Y A;  2IA7 A;  3TKS C;  2F5M A;  6RNT A;  1T2I A;  1RMS A;  5A4V A;  3QAG A;  2H72 A;  4EYC A;  3WHO A;  2VCZ A;  2SAR A;  4V2L A;  1ZOF A;  4HM4 B;  1Q86 4;  1TRU A;  1V58 A;  2PN8 A;  3FCS B;  3GUR A;  4MNN A;  1RHL A;  3MKI A;  2VL2 A;  1A2M A;  1AXD A;  3GL5 A;  3FLJ A;  1RTU A;  2F3M A;  3JUO A;  2AAE A;  5E59 A;  1YNV X;  3Q19 A;  2CHC A;  3I43 A;  2YWN A;  4IEL A;  1YI2 3;  5IPH A;  1TI3 A;  1MEK A;  2WGQ A;  3G9B A;  2CFL A;  3CSI A;  4NHF A;  1W5Z A;  2DC5 A;  3BOA A;  1J9B A;  2CC3 A;  1E6B A;  1GTI A;  2YNX A;  3IXR A;  4WBJ A;  3CCQ 3;  5D73 A;  2B5X A;  4K7I A;  1BNI A;  4JBB A;  1GWC A;  4KZ1 A;  3NM7 A;  3UIW A;  4KH7 A;  1BUQ A;  4K8M A;  1BOX A;  4N3V A;  5IMZ A;  3H51 A;  3G6E 3;  1B4Q A;  2C4J A;  1MTC A;  1Y6E A;  1PA3 A;  2KP1 A;  2BIR A;  1QFN A;  5EPF A;  4TN8 A;  4EXJ A;  5DRV A;  1ZYQ B;  4XBT A;  3A5I A;  2K9F A;  1WWJ A;  3O3T A;  4V2N A;  1HD2 A;  3P2A A;  5IMD A;  4XIH A;  3TJF A;  1N8R 4;  3ZVJ A;  1MGR A;  3J7Y k;  4PQH A;  1HU9 A;  1B2U A;  2PGT A;  3MSO A;  2CX0 A;  1JN5 B;  5D81 A;  3F8X A;  4GXZ A;  4K1U A;  3LXU X;  2CVK A;  1E97 A;  2QIY A;  2XSH B;  1O8X A;  2OAD A;  2WB9 A;  2HYX A;  3KGK A;  3TKS E;  3RGR A;  4ECB A;  2C11 A;  17GS A;  4G9H A;  1BRJ A;  1XBS A;  1W00 A;  1JZD A;  1OUN A;  1XWC A;  4MF7 A;  3ZIJ A;  4KSM A;  5FGO A;  2WZ9 A;  1YKC A;  3CC7 3;  1GSE A;  3ERG A;  1E3V A;  3CBU A;  3GUS A;  2HSH A;  3DM8 A;  4NPB A;  3IV4 A;  3RBT A;  1ASK A;  2LJR A;  1G96 A;  2CG0 A;  2A2R A;  3SWL A;  1MNL A;  4J56 E;  1T8E B;  1T1V A;  1M1X B;  3HCZ A;  2QC7 A;  1WMO A;  3N8B A;  1M2B A;  1AR0 A;  5AYS C;  4WF4 A;  2PZV A;  2L4Q A;  1Y4K A;  1C54 A;  3QR6 A;  1PKW A;  4WP5 A;  4HZB B;  1VF4 A;  1RGH A;  2B1L A;  2OQE C;  1SK0 A;  3D79 A;  2UUG C;  4XB5 A;  1WPI A;  2UGI A;  4POL A;  4XM4 A;  1FVJ A;  2LJK A;  1BRS A;  2OTL 3;  4KF9 A;  4TR1 B;  2OE3 A;  3CQF A;  2GSS A;  3J7Y b;  3DXB A;  2L6D A;  2GT6 A;  3EU3 A;  5AIV A;  4G10 A;  5KEJ A;  2BNG A;  5F07 A;  4EE0 A;  5CRD A;  1PY3 A;  3CYN A;  4OFT A;  4L8O A;  1IQX A;  3MPH A;  3OXA A;  3KH7 A;  3UB1 A;  2P0X A;  3PCS A;  3G7J A;  2V2G A;  5G2G A;  1M2D A;  2R5G A;  5J41 A;  2F98 A;  4HEA 2;  1HNC A;  3CRU A;  1M1K 4;  2YJ7 A;  3A2W A;  1BED A;  2FD3 A;  2B7K A;  1FO5 A;  3OWS A;  1JFU A;  3GKM A;  4BVY A;  5CK6 A;  1A23 A;  1S5A A;  3EQQ B;  4GWR A;  5AIX A;  3VF1 A;  3E3E A;  4H86 A;  3EYT A;  1X1W A;  2KUC A;  1BNS A;  5EVH A;  1YF0 A;  2HSY A;  1A2P A;  4LYL B;  1NW2 A;  1ERT A;  1YEP A;  3MWZ A;  1LRA A;  4K2X A;  5BIR A;  2EIQ A;  4I2U A;  1R7H A;  1TRW A;  4WR4 A;  1W6Y A;  3GA4 A;  2IMK A;  2W6J H;  1O7P B;  2MZC A;  4EC6 A;  1STD A;  1XOA A;  3IAS 2;  4XS4 B;  2ZUP A;  4HBR A;  1S3D A;  2GEX A;  1RJO A;  2VCW A;  2CFK A;  1EZK A;  3NBJ A;  3BCI A;  4AJ7 A;  1TK8 B;  2NDO A;  2H74 A;  3RPN A;  4ZIL A;  3G7Y A;  3A5W A;  1YJW 3;  1VQM 3;  3G8Z A;  1PN9 A;  3HHV A;  4K7O A;  3VPQ A;  4GSS A;  5JCW A;  5J9B A;  3SXX A;  3G16 A;  3H1N A;  1AV4 A;  1V74 A;  1CQH A;  1EV4 A;  3FR6 A;  1OGX A;  1OHS A;  2ALB A;  2XRX B;  5ELG A;  4CY6 A;  3UOM A;  5DRE A;  5H5R A;  3F6F A;  2STD A;  1PKZ A;  3LT9 A;  4WET A;  1X5C A;  3CPO A;  1XWB A;  4MJB A;  1BNF A;  1TOF A;  3LYK A;  1TRQ A;  3Q1C A;  9RNT A;  4KW6 A;  4X43 A;  5JWQ B;  4ZL8 A;  3FK8 A;  4JRF A;  3A5E A;  1IV7 A;  1IVW A;  2C3T A;  2E0Q A;  2V1L A;  2QA2 A;  1SEN A;  6GSU A;  2FNQ A;  4GSN A;  2MBT A;  5AGY A;  3S29 A;  4HJM A;  3BD2 A;  1I2E A;  8RNT A;  1WP0 A;  3NV0 B;  3TJK A;  2NPB A;  2A4H A;  4BPY A;  1V9W A;  1L5G B;  3P8W A;  1EP8 A;  3CNX A;  2WS2 A;  2RFR A;  2PU9 C;  3X40 A;  3GX8 A;  3FG1 A;  2AAD A;  1PX6 A;  4DEJ A;  2N5F A;  4HSC X;  1NWW A;  4TRX A;  5FHI A;  3A3T A;  4AGS A;  3ZIV A;  2X8C A;  2HZE B;  4ECJ A;  3IE3 A;  3DVW A;  4TX4 A;  3D21 A;  3I69 A;  1GMR A;  1QVF 2;  3H79 A;  2CG1 A;  4IP6 A;  1BG5 A;  3CSH A;  1ABA A;  4XBX A;  4O5R A;  2KAA A;  1NJI 4;  2ES7 A;  3CTF A;  1FGM A;  1R4W A;  5IF6 A;  1AC1 A;  5CP1 A;  3ZMK A;  1ROA A;  4O5Q A;  1PU4 A;  1FGR A;  4MZC A;  2LS5 A;  2I4A A;  3IR4 A;  2H70 A;  3QRD A;  1ZCP A;  1A67 A;  3BND A;  4GTU A;  1GUK A;  3NOF A;  5COH A;  1ROV A;  3EC9 A;  1SJZ A;  6GSV A;  3RHC A;  4HU7 A;  7STD A;  2EC4 A;  1WJK A;  4MLY A;  3MAK A;  1BNR A;  1ZGN A;  2KF3 A;  3CC4 3;  3GH6 A;  4ZM8 A;  3FKF A;  1GTA A;  4MJD A;  5GZZ B;  1LJR A;  5GSP A;  2LST A;  5INY A;  3EMX A;  3FZA A;  2N5A A;  4KAE A;  3QAW A;  5G30 A;  4YKF A;  2FCH A;  2OE0 A;  5HFG A;  1R5A A;  3ZIT A;  1Z3E A;  5CRG A;  1MDJ A;  3ZZX A;  3CTG A;  1DMN A;  3APS A;  1A2L A;  3LTC A;  2A15 A;  2JU5 A;  5CYY A;  2WFC A;  3VGN A;  1B2X A;  1X1X A;  1HQO A;  4DSQ A;  2GS3 A;  1GS3 A;  3EBT A;  4ISD A;  5D9V A;  4ICY A;  6GSY A;  2DBC A;  1K0C A;  1EGO A;  1PFO A;  1BX9 A;  1IVX A;  1BSA A;  1VF3 A;  1C7H A;  4ACS A;  3ZRE A;  5ID2 B;  16GS A;  2MMA A;  2X4A A;  4IIA A;  4P3Y B;  1BIR A;  4V1A p;  2HXK A;  3C8E A;  4J9A A;  3ZG5 A;  3OR5 A;  1N8Q A;  2R0G A;  3HA9 A;  4FMA A;  1RGK A;  1B20 A;  2AHE A;  4EV5 A;  3LW9 A;  3EU4 A;  3HYP A;  4RI7 A;  3WA3 A;  4LMW A;  2ON7 A;  6GSS A;  4XBY A;  5DVB A;  4MMX B;  1M3I A;  3DD3 A;  2C3Q A;  4EF0 A;  3X42 A;  1TIJ A;  1Q7Y 4;  1F9M A;  1KC8 4;  4POB A;  2RII A;  2K6V A;  3UNL A;  5GSS A;  2GST A;  2R6K A;  3D5G A;  3FW2 A;  4XTS A;  4EL1 A;  4IW9 A;  2NVL A;  1YJ9 3;  1GSS A;  2YWI A;  3EBY A;  2C0E A;  1FGO A;  2MF7 A;  2R4I A;  2XBI A;  2OKA A;  2JQ5 A;  2B5E A;  1N9J A;  3JVC A;  2OE1 A;  2CWU A;  4OO4 A;  5KOW A;  2A2S A;  2W2C A;  3L9S A;  5A5K A;  2IWT A;  4LL1 B;  1VF1 A;  1R4C A;  2KLX A;  1BRG A;  5KN2 A;  1O7M B;  1NB5 I;  1EWX A;  1B9X C;  3QCP A;  5G5F A;  2P31 A;  4ZBA A;  1X1U A;  3K7C A;  5AYR B;  1AVK A;  3IJE B;  3Q18 A;  1EP7 A;  2JZR A;  1JBT A;  4HQS A;  2E7P A;  2AUV A;  4JF8 A;  3WOF B;  2CIU A;  3ZFB A;  2HRF A;  2IJY A;  3VWU A;  4K6X A;  4HS1 A;  4FYB A;  1JZR A;  1G6W A;  2A4V A;  4MCU A;  3DKS A;  1SKW B;  3L4N A;  1OC3 A;  4Q5N A;  2Z76 A;  3PXM A;  4WYK B;  3HY2 A;  3DVX A;  5HR0 A;  2C3N A;  5I97 A;  3IC4 A;  1Q7H A;  1VZZ A;  3EHC A;  3OWU A;  1JJ2 2;  4XDV A;  1THO A;  1TP6 A;  2F56 A;  3CCR 3;  1D6U A;  2DIY A;  4N6M A;  3CXC 2;  4I97 A;  5ECN B;  3ZFL A;  4NWY A;  4IQA A;  3GKN A;  1SU9 A;  14GS A;  2KRT A;  4KVH A;  5GAN D;  2F9S A;  1K73 4;  4TR4 A;  1GMQ A;  1OH0 A;  1ACV A;  1SAR A;  2FGX A;  5IM9 A;  1OE8 A;  2FA8 A;  3TUE A;  2VLV A;  3BLZ A;  4ECC A;  1ZYP A;  1WNH A;  2HMN B;  3KKG A;  3F9S A;  1K0D A;  3BU4 A;  3CCV 3;  4CDO A;  1QAK A;  2OOV C;  2QA1 A;  1A2J A;  1E2Y A;  3RDW A;  3N54 B;  1B3S A;  3HOH A;  4OFN A;  3ZG0 A;  1FA3 A;  1G7E A;  2R41 A;  1U8C B;  1ZX2 A;  5IEP A;  4OO5 A;  1UUV B;  1GSY A;  1QMA A;  1XFL A;  2IMJ A;  2IN3 A;  3B7C A;  3DML A;  2YCD A;  4Q5F A;  3DYR A;  5IEO A;  3CCM 3;  2I9H A;  3MNG A;  4HI7 A;  1KEB A;  4X4J A;  4KFE A;  3D4T A;  4XS1 A;  1GP1 A;  1Q98 A;  4XDW A;  4EV2 A;  4ECI A;  3BNC A;  3QFA C;  3O76 A;  1JN5 A;  1YVS A;  2O8V B;  2XF3 A;  1OF5 B;  5LC7 A;  3D4A A;  3M9K A;  3I9V 2;  5FT3 A;  2VL2 C;  2H1A A;  4N0Z A;  4I5Q A;  11GS A;  4EUY A;  1GLP A;  1X0R A;  5DAL A;  2P5Q A;  3LFL A;  2IPA A;  1RDS A;  2LYX A;  5IMV A;  3NV0 A;  2CZ2 A;  4R9K A;  2LEG A;  3KM6 A;  3Q2P A;  1YIJ 3;  2OTJ 3;  4J57 E;  3HKR A;  5A4W A;  5KP1 A;  3TRQ A;  3DGM A;  1I3F A;  4ML6 A;  2WUL A;  3BNB A;  2J23 A;  5EEO A;  4KUN A;  4LL4 B;  3IDV A;  1G02 A;  5IIZ A;  2P0G A;  4K0N A;  4TOP A;  2JZT A;  3LJR A;  2E2T A;  1VQK 3;  3A76 A;  1ON4 A;  2UX0 A;  5ECM B;  2VL9 A;  2ML6 A;  1FUW A;  3Q3F A;  3PH9 A;  1I9D A;  2M46 A;  5D8I A;  3EF8 A;  1R26 A;  2GU3 A;  4BU4 A;  2VL3 A;  2QGU A;  4V2M A;  5C04 A;  1BUJ A;  1DE2 A;  3OV4 A;  3SYU A;  1I5G A;  1DET A;  4N6L A;  1UA5 A;  1WTH A;  4FCJ A;  1G0T A;  3LH4 A;  1YQ1 A;  4U13 A;  2IYJ A;  5FWG A;  1B48 A;  1BVI A;  2H19 A;  3R3E A;  2QKE A;  2F86 B;  3WOE B;  4O02 B;  4O2H A;  1K8A 4;  3KMO A;  2Z77 A;  3CMA 3;  1YJN 3;  2C0G A;  1VQO 3;  1UW1 A;  5TGN A;  1Q82 4;  3F7S A;  1YKA A;  2O89 A;  5IG4 A;  1RQM A;  4TR3 A;  3Q90 A;  7GSP A;  4XS4 A;  3E9J B;  1SKR B;  3TKR A;  3N9J A;  1JB5 A;  4E8H A;  3RHB A;  2H73 A;  3SOA A;  2KHP A;  4FO5 A;  4HJ2 A;  4N0V A;  1TU7 A;  1XVW A;  22GS A;  4MJE A;  3U1W A;  3NX0 A;  1SD8 A;  4ZXG A;  2CAQ A;  3I6A A;  5DBQ A;  4PQ1 A;  1GOU A;  3CU3 A;  1URM A;  1RN1 A;  2DML A;  2CA8 A;  1FYS A;  1YGE A;  3LXZ A;  4PNG A;  2B7J A;  5KP3 A;  3QAV A;  2X8G A;  1T4Z A;  1T7P B;  2VUP A;  4L8P A;  3A2V A;  2O87 A;  4XS6 A;  1YJ6 A;  4EIP A;  1X9W B;  2L1S A;  4HZ9 B;  1B21 A;  4K9Z A;  4X0X A;  1SD9 A;  3FHK A;  3ISO A;  3KMN A;  1UGH I;  1OC9 A;  3EN1 B;  2J8X B;  3DGQ A;  2PPT A;  2E2V A;  3NHX A;  1PN0 A;  2N5B A;  4EXR A;  5AIH A;  2OQE A;  1SII A;  2RNT A;  4X1U A;  1SQW A;  4RBN A;  5HFK A;  3MDK A;  5L71 A;  2VOC A;  3GRD A;  2D42 A;  1AAZ A;  1Z6N A;  1GSU A;  3IPZ A;  2F4Y A;  5EL8 A;  3MHE A;  4FMD A;  3T8U A;  5JCU A;  5B8B A;  1VQQ A;  1TW9 A;  4F0C A;  2ZL8 A;  2GT5 A;  5D93 A;  2BT3 A;  3D4M A;  5GAP D;  2W0Q A;  4FMB A;  1UDI I;  4BWQ A;  1A24 A;  1TRV A;  2VLU A;  1ULI B;  3V1W A;  1DMM A;  5ELU A;  2H1B A;  4WXT A;  2KF6 A;  3GL3 A;  4FQU A;  4NV2 A;  1RNT A;  1JBS A;  4HM6 B;  6STD A;  4KFD A;  3FEU A;  1S72 3;  3TKQ A;  2QEX 3;  2GZZ A;  4G2E A;  3WD6 A;  1MDI A;  1W89 A;  2C0D A;  3ECF A;  8CHO A;  4BTW A;  2D1W A;  2K8S A;  3LOR A;  3DIE A;  2B6M A;  1FUS A;  3LYG A;  4Q53 A;  3FMW A;  4PNF A;  3CSJ A;  3DWV A;  3SBC A;  1QAL A;  1IYI A;  2HNL A;  3F3Q A;  4WF5 A;  3ZFZ A;  3LSZ A;  2H8L A;  3FZ5 A;  4HVN A;  1W4V A;  1BGS A;  4GSP A;  3IHQ A;  4BTX A;  2IMF A;  4O5U A;  3L0R A;  3KZT A;  3L78 A;  5DAK A;  5C00 A;  1B9Y C;  1V40 A;  3P90 A;  5BMU A;  1VQP 3;  3EJV A;  3HI7 A;  3MWH A;  4OMV A;  1GSP A;  2WGO A;  3F0I A;  2MC8 A;  2H75 A;  1A8Y A;  1US1 A;  3I0Y A;  1A0R P;  2W04 A;  2H6X A;  3GSP A;  4LEH A;  2HMJ B;  3BIR A;  3VWW A;  1I2G A;  1VRS D;  2LUS A;  3LOY A;  1RGC A;  2K0M A;  1J0F A;  5BU4 A;  3LTD A;  1K0N A;  2B24 B;  1IYH A;  5A4U A;  3VSY A;  4MPF A;  3GSS A;  3F4R A;  4BL3 A;  4WHA A;  3KJY A;  3B8L A;  2DLX A;  4KSO A;  1X9S B;  3DGN A;  1O81 A;  4KDX A;  4GQF A;  2IIY A;  2ZA4 A;  1I3I A;  2C1Y A;  1FW7 A;  3ME7 A;  4EC0 A;  3CME 3;  4DSS A;  5IO0 A;  4BTY A;  3URP A;  3QK9 A;  3UMA A;  2FXT A;  2DJJ A;  1U6T A;  2VCT A;  4F03 A;  4PQI A;  1W4N A;  1ZZY A;  3GST A;  3EE2 A;  4IVF A;  3SX1 A;  3IK9 A;  1GMP A;  1DUG A;  1Q4J A;  4OWY A;  1XWA A;  1TP9 A;  1XG8 A;  2VLT A;  3KP8 A;  2V6O A;  2HMO B;  2H0I A;  5AII A;  1MWU A;  5G2Z A;  4G1M B;  4HM1 B;  4MMY B;  1E3R A;  3RDE A;  1IYY A;  1GTU A;  4MEI A;  3BCK A;  3B4P A;  2CX1 A;  4K0G A;  1TU8 A;  1BRN L;  4V1A g;  4G19 A;  2H30 A;  1KBN A;  3A2X A;  1JLW A;  2HI7 A;  2E2U A;  1LOX A;  1EQK A;  7RNT A;  5AIS A;  3F4S A;  3X3Y A;  2CZ3 A;  3HDC A;  1TUH A;  3KTB A;  5B6N A;  3NBR A;  2VM2 A;  1O7H B;  1GRX A;  3F63 A;  1AVL A;  3D22 A;  3GZY B;  3H8Q A;  3QD9 A;  4IGJ A;  4K7N A;  3C71 A;  4MJC A;  4KND A;  4RNZ A;  3GX0 A;  4WWU C;  3GN3 A;  5IW9 A;  3CCL 3;  5AIF A;  4Z2R A;  1IVU A;  2B3S A;  3FRC A;  5DQY A;  1O7N B;  3LZA A;  1GH2 A;  1LU4 A;  2KXG A;  4LZI A;  1M0U A;  4I6X A;  3K0Z A;  3M1G A;  3KFQ C;  1Q81 4;  1TFK A;  5HOH A;  1UVZ A;  1VQ9 3;  1SPU A;  1AQX A;  4EVM A;  5BRT A;  3JUP A;  3MG2 A;  2PWJ A;  2V32 A;  3L9U A;  3WR2 A;  1W02 A;  1ERV A;  2YJH A;  1PGT A;  3AMO A;  2VAF A;  1WMN A;  4OCE A;  4JU5 A;  3G4S 3;  3TOT A;  5J5N A;  3VLN A;  3HVV A;  1UCL A;  1N2A A;  1J08 A;  3DGL A;  2CWT A;  1HYF A;  3DGY A;  3C1R A;  5CNW A;  1PYL A;  1KQS 2;  2LKU A;  4LGQ A;  4JR4 A;  3TGZ A;  3D0Z A;  3SOY A;  2YV9 A;  4ZL9 A;  1PL2 A;  3FY7 A;  2RGQ A;  3QFB C;  3UBK A;  1SJW A;  3IBH A;  3IRA A;  10GS A;  4CHS A;  4PTS A;  1XXU A;  3KXO A;  5J4U A;  3PPU A;  2L57 A;  1QQ2 A;  3NIV A;  4IQ1 A;  3GZB A;  2YZH A;  3C7M A;  4YQU A;  2C0F A;  5DJM A;  4F0B A;  1YVB I;  1JNQ A;  5ECI B;  1W2B 2;  5AEU B;  4G0L A;  1QGV A;  5F06 A;  5B7C A;  3NQZ A;  5IG0 A;  1SYR A;  2O85 A;  3ERW A;  4RI6 A;  1VQ5 3;  1RRL A;  4DVC A;  2X49 A;  3TRX A;  1N5P A;  4IN0 A;  2I9W A;  2FWG A;  1VQ7 3;  2YX9 A;  4GCI A;  3UVH A;  3LEF A;  1YIT 3;  2AB6 A;  4MA9 A;  4Z7X A;  2FY6 A;  3HZ8 A;  2GU1 A;  4MZB A;  2CWV A;  1RGF A;  2IUJ A;  1XW5 A;  3MG3 A;  4X2H A;  4BL7 B;  4H61 A;  2HMK B;  4CW9 A;  1T2H A;  1BRH A;  2IFQ B;  1K0M A;  1U3I A;  4ZBD A;  4MMZ B;  3ZLP A;  1IQY A;  4EBG A;  3PCR A;  5STD A;  3DUK A;  2F99 A;  4K2D A;  1O7W B;  5KP4 A;  2LRC A;  5KN0 A;  2W9P A;  1ST9 A;  4FH8 A;  4FCZ A;  2OA7 A;  5ECK B;  4IS0 A;  18GS A;  1VF2 A;  1A8L A;  2JL4 A;  2V1M A;  3KTL A;  3DH2 A;  1RSN A;  4RNT A;  4YAP A;  5LD0 A;  2P38 A;  4DSR A;  4HJL B;  1T3B A;  3LXT A;  2GXF A;  1GUL A;  2QGV A;  3FZ4 A;  2YV7 A;  4WEY A;  4YQM A;  1DVC A;  2A2P A;  1Q40 B;  1GUM A;  1TJD A;  2CQ9 A;  4HM3 B;  5J3R A;  4EKZ A;  2LNT A;  1UCJ A;  3LML A;  1SK1 A;  1YEX A;  3MIX A;  4JRR A;  1AQZ A;  3FF0 A;  3U5R E;  4Q5Q A;  2H01 A;  2XFS A;  2HRA A;  4MK3 A;  1XVQ A;  3VK9 A;  2XGL A;  4K61 A;  4QQ7 A;  3UBL A;  3CRT A;  4X2O A;  3FR9 A;  1K0O A;  5ABR A;  2CW9 A;  4TW5 A;  2HE3 A;  1DSB A;  4LLR A;  1XW9 A;  2H6Z A;  4DSS B;  1JHB A;  2X64 A;  1OC8 A;  5JPP A;  5AN1 A;  5DAL B;  3TJB A;  3KCM A;  4J5G A;  3L0H A;  3NQY A;  1UCK A;  3KD0 A;  1OAZ A;  2WRT A;  1OF5 A;  3DY5 A;  1TTZ A;  4K1V A;  2O9U X;  3M8C A;  5LCZ A;  4JR6 A;  2IL3 A;  1PD2 1;  1H75 A;  1RLS A;  4POK A;  5DQS A;  1BSB A;  3ZRD A;  1Z7P A;  4CPK A;  4Z2U A;  2Z7A A;  3KH9 A;  1SKS B;  1BU4 A;  2CV4 A;  1TXX A;  1QAF A;  3I56 3;  2F8F A;  5DJL A;  3APQ A;  2HML B;  1EUI C;  1FGT A;  2CFG A;  1V57 A;  4NRE A;  2LRN A;  2VM1 A;  2Q07 A;  1ISK A;  1JRQ A;  2CFW A;  2QA4 3;  1W01 A;  2FHE A;  4HM7 B;  2X99 A;  4QWT A;  3X3Z A;  4N6U A;  1DBY A;  1RCL A;  3GAX A;  1S3R A;  4A5P A;  2IUK A;  4EW5 A;  5RNT A;  3FZW A;  4AF2 A;  1T00 A;  3F3R A;  4PUA A;  4ZBB A;  3PZW A;  4N6T A;  2DJ3 A;  2YZU A;  2HRK A;  5HR1 A;  4HM8 B;  2XC2 A;  2W56 B;  4EDY A;  1WRY A;  1HNB A;  4MMM A;  5F05 A;  2XFT A;  4AKZ A;  3DXO A;  2HSM A;  4N11 A;  2LNS A;  3CNM A;  5JBS A;  5JWR B;  4XCS A;  1YY7 A;  1LQG C;  5D9W A;  3F6D A;  4PXO A;  1CYV A;  2INX A;  4CJN A;  3JUN A;  1Y25 A;  3VUR A;  4KDU A;  3DMC A;  3H93 A;  4HYZ A;  2P05 A;  1K3L A;  8GSS A;  1A2K A;  2RLI A;  5LNK e;  5CO3 A;  4XRA A;  1F6M C;  3ROB A;  2E2G A;  1QVG 2;  1AW9 A;  5CRE A;  5BXQ A;  1GD3 A;  1NO3 A;  2OJL A;  2HFD A;  3MG1 A;  3QDN A;  5CRW A;  1MGW A;  1UUW B;  2LV3 A;  2BO9 B;  2DJ2 A;  1I0X A;  1TDI A;  1Z6M A;  2MMO A;  1O7G B;  2BMX A;  2QSI A;  3BJ5 A;  2B1X B;  2VCV A;  1OCV A;  3GHA A;  1K28 A;  2GLR A;  2K8V A;  1GY5 A;  4KA0 A;  1ZMA A;  3WGD A;  3HK4 A;  1VGL A;  2DMM A;  4USS A;  1W6G A;  5KN3 A;  1B8X A;  1GNE A;  3F40 A;  1FVK A;  2W03 A;  2BMQ B;  1GSD A;  5D96 A;  3PYJ A;  3CC2 3;  1KNG A;  4N6O B;  4JED A;  1TFO A;  1ZL9 A;  3T8N A;  3HVX A;  1BAY A;  4TKY A;  2DKI A;  2WGR A;  4F2I A;  2DIZ A;  1SL0 B;  1F2E A;  4R80 A;  5ECS A;  1BJX A;  4J8T A;  3F9U A;  4EIQ A;  3OX9 A;  5D9T A;  1D6Y A; 
#chains in the Genus database with same CATH homology
 3VPT A;  3ME8 A;  1OYJ A;  3KIJ A;  4MZW A;  2KOK A;  9GSS A;  1PX7 A;  4ILF A;  4HQZ A;  4QL7 A;  1ERU A;  4YH2 A;  1GSQ A;  2WDU A;  4BWS A;  4YKG A;  2MYG A;  2VIM A;  3FYG A;  3KZQ A;  1WOU A;  2IMI A;  1C72 A;  2JAD A;  2LQO A;  3LGC A;  4NMU A;  4ULX A;  4GRF A;  3GKK A;  1FHE A;  4GLT A;  1K0A A;  3E0U A;  3TDG A;  3GV1 A;  3CXG A;  3MYD A;  4I8B A;  20GS A;  1O7U A;  3ZTL A;  3DEX A;  5IOW A;  3WT1 A;  2YP6 A;  4K5S A;  2PER A;  3FZ9 A;  3GH9 A;  2BTO T;  4MH3 A;  2RUF A;  2UZ8 A;  2M80 A;  3DRN A;  3BBY A;  3HZ4 A;  3W8S A;  1F3B A;  2OBK A;  2EIO A;  1Z7R A;  2JSZ A;  4IBP A;  2VCQ A;  1Z5Y E;  4NAX A;  4MDC A;  1TK0 B;  1GL8 A;  1M99 A;  4MJA A;  3TB2 A;  5DDL A;  1ZYN A;  2H76 A;  3M8N A;  2LJA A;  1SK2 A;  3HJM A;  4MF5 A;  2H1G A;  3IOS A;  1EGR A;  2VD1 A;  2CVB A;  5DCG A;  4HU9 A;  2GVP A;  2IMD A;  1X5D A;  2GGT A;  5JWO B;  2HZE A;  5D9X A;  2O7K A;  4KB3 A;  1MD3 A;  5EY6 A;  2OBI A;  2TRC P;  5ECP B;  1YF1 A;  4G0K A;  2PVQ A;  7GSS A;  1UC7 A;  2YPM A;  1TK5 B;  4XHM A;  2CAI A;  2DJK A;  3HD5 A;  2G0F A;  4G0I A;  2FWH A;  2H66 A;  1TRS A;  3LWA A;  4IHU A;  3GRX A;  4L0W A;  3GIX A;  2GZY A;  5HFI A;  3NZN A;  1FB6 A;  2YN1 A;  4NHZ A;  2L4C A;  2H0H A;  3F4T A;  2CX4 A;  4LA1 A;  4ZIJ A;  1RK4 A;  2JSY A;  2V41 A;  1MD4 A;  4IP1 A;  4ZB6 A;  2HLS A;  4OD7 A;  1KTE A;  1NM3 A;  4Z2T A;  4JE1 A;  2C8U A;  1G6Y A;  2RUE A;  3KEB A;  2NTO A;  2FA4 A;  1M9B A;  3WGE A;  1ML6 A;  3TCO A;  2GTU A;  1USB A;  1EOG A;  3MSZ A;  3M3M A;  12GS A;  2VD0 A;  1AQV A;  4PUR A;  4N10 A;  3R2Q A;  2G2Q A;  2R37 A;  1U88 A;  1BQ7 A;  2FNO A;  2MMN A;  4KDY A;  1FG4 A;  5G1L A;  3C73 A;  3ED3 A;  3RAZ A;  1QMV A;  19GS A;  4HZ4 A;  4GF0 A;  2WCI A;  2GQM A;  2XBQ A;  5ID2 A;  1PRX A;  4KCE A;  4RUV A;  6GSW A;  4BVY B;  5ECR B;  1EEM A;  2YOI A;  1XWG A;  3UEM A;  2JZS A;  2I81 A;  1SJI A;  1GNW A;  5B8A A;  4L8E A;  4NV5 A;  1F37 A;  3C1S A;  3HXS A;  2J9H A;  2BJX A;  2H71 A;  4WR5 A;  1F3A A;  4LMV A;  5KOX A;  4ZB9 A;  3Q74 A;  5ECH B;  3PGT A;  1XCC A;  3D6I A;  4TVE A;  2TRX A;  3IAM 2;  1O73 A;  4TR1 A;  3P7X A;  2FLS A;  1WE0 A;  1EV9 A;  3Q6O A;  1BYE A;  4ML1 A;  3D5J A;  1S3C A;  5F8B A;  4YQV A;  4FIW A;  1JZW A;  1GSF A;  2ON5 A;  5CRH A;  3UJ1 A;  2R0P A;  1SL2 B;  3IA1 A;  5JCG A;  3UL3 A;  1XPV A;  2R3X A;  1HYU A;  2PUK C;  4KE3 A;  2AYT A;  1ZYE A;  2XPD A;  2EIR A;  1THX A;  2X8H A;  3TRP A;  4L5O A;  2MMZ A;  1FW1 A;  2REM A;  2ZCT A;  4JZQ A;  4K5R A;  4F9Z A;  2M72 A;  1O85 A;  1EEJ A;  1ILO A;  4OCF A;  1YZX A;  2GSR A;  2XHF A;  3HVS A;  1V2A A;  2GQL A;  1OKT A;  4TXV A;  4GQC A;  2ZNM A;  3EC3 A;  3GYK A;  4TR0 A;  3GKX A;  1TI1 A;  3LQ7 A;  1X9M B;  2HZF A;  5IMA A;  1FB0 A;  4O32 A;  5H5Q A;  2DJ0 A;  2JAC A;  3ZL5 A;  1PQN A;  5ENU A;  1XZO A;  4K1F A;  5KN1 A;  2L5O A;  4EO3 A;  3QMX A;  3VFI A;  1YDK A;  5ELA A;  2B1K A;  1V98 A;  1U3A A;  2B5Y A;  5HQP A;  1K3Y A;  5IOX A;  2H0G A;  1FOV A;  3O6T A;  4MF6 A;  1LBK A;  3IC8 A;  3IHG A;  5CAX A;  3UVT A;  4L0U A;  4XRD A;  2CT6 A;  3TJG A;  1GLQ A;  3TOU A;  4J2F A;  2IFQ A;  1PL1 A;  3TKS A;  4HZ2 A;  3WGX A;  3ZVJ D;  4IJ3 A;  1OE7 A;  2CVD A;  5H5S A;  3S9F A;  1R5P A;  3W8J A;  4O92 A;  1K3O A;  1AIU A;  2PMT A;  2DJ1 A;  4GST A;  2AAW A;  1M9A A;  3JCM L;  1PSQ A;  4D73 B;  4OFM A;  5B6M A;  1O6J A;  2OAC A;  1NHY A;  3QPM A;  1FOH A;  3HJP A;  2RM5 A;  2F51 A;  1S3A A;  3US3 A;  2YWO A;  2HT9 A;  4PUF C;  4I2T A;  2L59 A;  4IKH A;  4RQR A;  4O7H A;  1JLV A;  2R2J A;  3EIN A;  4IJI A;  1AUC A;  2P5R A;  3HJO A;  3M0F A;  4YAV A;  5HR2 A;  2CX3 A;  4PX1 A;  2F8A A;  1U87 A;  5IMF A;  4QL9 A;  4BA7 A;  1Z9H A;  3H4K A;  4WBR D;  4MAB A;  5J9C A;  2KP2 A;  2E2M A;  1OKD A;  5DCH A;  3U6V A;  1M2A A;  1XWK A;  2L6C A;  3TKP A;  1FAA A;  5ECQ B;  3EPT A;  2VO4 A;  3PR8 A;  1SJ6 A;  3F8U A;  5ECL B;  1MDK A;  2I3Y A;  1WMJ A;  13GS A;  1XW6 A;  3VWV A;  2HRN A;  1OVN A;  4BVX B;  3GFK A;  2C80 A;  2GSQ A;  6GST A;  1QK8 A;  1CQG A;  1QUW A;  5ECO B;  4WKW A;  1RW1 A;  2YWM A;  5IO2 A;  3VI5 A;  3QOU A;  1EOH A;  4KGI A;  1X5E A;  5F0G A;  3EUR A;  1UN2 A;  3W6G A;  3TJJ A;  3GTU A;  4EDZ A;  3CMI A;  2V6K A;  2GQK A;  4POM A;  1NSW A;  4MH2 A;  2I1U A;  1PMT A;  1DE1 A;  2AV4 A;  4KX4 A;  4ID0 A;  1N8J A;  3VWX A;  2R4V A;  2DSA A;  4KCA A;  4E8E A;  5G31 A;  2GDR A;  1JZO A;  3GTU B;  2VCX A;  4CY8 A;  3L9V A;  3KP9 A;  1TKD B;  4HUA A;  4MP4 A;  2MBS A;  3LG6 A;  3EVI A;  2GZP A;  3APO A;  2FWF A;  2LTK A;  1GTB A;  1H4O A;  2WJU A;  2L5L A;  4L5L A;  5HR3 A;  1M7T A;  3K8N A;  3M9J A;  1B4P A;  2RM6 A;  1ERW A;  4BVX A;  5GST A;  2PBJ A;  5DAK B;  2Z9S A;  3FR3 A;  4FYC A;  5IPG A;  1AQW A;  5E4W A;  1WIK A;  4BL7 A;  2LQQ A;  2R0C A;  6GSX A;  4ZB8 A;  4HOJ A;  4FYU A;  2AJQ B;  5IQY A;  1K0B A;  1SYX A;  5G5E A;  3AY8 A;  3GMF A;  3WYW A;  5G1K A;  2FUG 2;  3PIN A;  3N5O A;  1NHO A;  1SL1 B;  1O8W A;  3GNJ A;  1XOB A;  4TXO B;  1HNA A;  3EMP A;  2D2Z A;  2XPE A;  2H6Y A;  4PGT A;  3WT2 A;  3G7I A;  4HDE A;  4RQX A;  4MPG A;  3IK7 A;  3ZYW A;  1XIY A;  2FWE A;  4NHW A;  3UAP A;  4AJ6 A;  3ZML A;  3ERF A;  2K18 A;  2H1D A;  2TIR A;  3EWL A;  4N30 A;  3UAR A;  2DKH A;  1G7O A;  3VI7 A;  5EVO A;  1OC9 B;  2PVO C;  4Q5R A;  1GUH A;  5IMC A;  3RPP A;  4NXI A;  4F82 A;  4ZL7 A;  1QXH A;  4D73 A;  4TXO A;  4AJ8 A;  2LRT A;  2IME A;  1A0F A;  2IY2 A;  2NBS A;  3LYP A;  2YAN A;  1T4Y A;  3TKS C;  5A4V A;  3QAG A;  2H72 A;  2VCZ A;  4V2L A;  1ZOF A;  1TRU A;  1V58 A;  2PN8 A;  3GUR A;  4MNN A;  2VL2 A;  1A2M A;  1AXD A;  3GL5 A;  2F3M A;  5E59 A;  3Q19 A;  3I43 A;  2YWN A;  4IEL A;  5IPH A;  1TI3 A;  1MEK A;  3G9B A;  3CSI A;  2DC5 A;  3BOA A;  1J9B A;  1E6B A;  1GTI A;  2YNX A;  3IXR A;  4WBJ A;  5D73 A;  2B5X A;  4K7I A;  4JBB A;  1GWC A;  3UIW A;  4KH7 A;  4K8M A;  5IMZ A;  1B4Q A;  2C4J A;  1MTC A;  1Y6E A;  1PA3 A;  2KP1 A;  1QFN A;  5EPF A;  4TN8 A;  4EXJ A;  1ZYQ B;  3A5I A;  2K9F A;  1WWJ A;  3O3T A;  4V2N A;  1HD2 A;  3P2A A;  5IMD A;  4XIH A;  3TJF A;  3ZVJ A;  3J7Y k;  4PQH A;  2PGT A;  4GXZ A;  2CVK A;  1O8X A;  2WB9 A;  2OAD A;  2HYX A;  3KGK A;  3TKS E;  4ECB A;  17GS A;  4G9H A;  1XBS A;  1JZD A;  1XWC A;  4MF7 A;  3ZIJ A;  4KSM A;  2WZ9 A;  1YKC A;  1GSE A;  3ERG A;  3CBU A;  3GUS A;  2HSH A;  4NPB A;  3IV4 A;  3RBT A;  2LJR A;  2A2R A;  3SWL A;  4J56 E;  1T8E B;  1T1V A;  3HCZ A;  2QC7 A;  1M2B A;  4WF4 A;  2L4Q A;  3QR6 A;  1PKW A;  1VF4 A;  2B1L A;  1SK0 A;  1WPI A;  4POL A;  1FVJ A;  2LJK A;  4KF9 A;  4TR1 B;  2OE3 A;  2GSS A;  3J7Y b;  3DXB A;  2L6D A;  2GT6 A;  3EU3 A;  5AIV A;  4G10 A;  5KEJ A;  5F07 A;  4EE0 A;  5CRD A;  3CYN A;  4OFT A;  3KH7 A;  3G7J A;  2V2G A;  1M2D A;  2R5G A;  5J41 A;  4HEA 2;  1HNC A;  3CRU A;  2YJ7 A;  3A2W A;  1BED A;  2FD3 A;  2B7K A;  1FO5 A;  1JFU A;  3GKM A;  4BVY A;  1A23 A;  4GWR A;  5AIX A;  3E3E A;  4H86 A;  3EYT A;  2KUC A;  1YF0 A;  2HSY A;  1NW2 A;  1ERT A;  1YEP A;  4K2X A;  2EIQ A;  4I2U A;  1R7H A;  1TRW A;  4WR4 A;  3GA4 A;  2IMK A;  2MZC A;  1XOA A;  3IAS 2;  4XS4 B;  2ZUP A;  1S3D A;  2VCW A;  1EZK A;  3BCI A;  4AJ7 A;  1TK8 B;  2NDO A;  2H74 A;  3RPN A;  4ZIL A;  3G7Y A;  3A5W A;  1PN9 A;  3HHV A;  4K7O A;  3VPQ A;  4GSS A;  5JCW A;  5J9B A;  3H1N A;  1EV4 A;  1CQH A;  3FR6 A;  2ALB A;  5ELG A;  4CY6 A;  3UOM A;  5H5R A;  3F6F A;  1PKZ A;  4WET A;  1X5C A;  1XWB A;  4MJB A;  1TOF A;  3LYK A;  4KW6 A;  4X43 A;  5JWQ B;  4ZL8 A;  3FK8 A;  2C3T A;  2E0Q A;  2QA2 A;  1SEN A;  6GSU A;  4GSN A;  2MBT A;  5AGY A;  4HJM A;  3BD2 A;  1WP0 A;  3TJK A;  2NPB A;  2A4H A;  4BPY A;  1V9W A;  3P8W A;  1EP8 A;  2WS2 A;  2PU9 C;  3GX8 A;  1PX6 A;  4DEJ A;  2N5F A;  4TRX A;  5FHI A;  3A3T A;  4AGS A;  3ZIV A;  2X8C A;  2HZE B;  4ECJ A;  3IE3 A;  3DVW A;  3D21 A;  3I69 A;  3H79 A;  4IP6 A;  1BG5 A;  3CSH A;  1ABA A;  4O5R A;  2ES7 A;  3CTF A;  1R4W A;  1AC1 A;  5CP1 A;  3ZMK A;  4O5Q A;  4MZC A;  2LS5 A;  2I4A A;  3IR4 A;  2H70 A;  1ZCP A;  4GTU A;  1GUK A;  3NOF A;  5COH A;  1SJZ A;  6GSV A;  3RHC A;  4HU7 A;  2EC4 A;  1WJK A;  4MLY A;  3MAK A;  1ZGN A;  3GH6 A;  3FKF A;  1GTA A;  5GZZ B;  1LJR A;  2LST A;  5INY A;  3EMX A;  3FZA A;  2N5A A;  4KAE A;  3QAW A;  5G30 A;  4YKF A;  2FCH A;  2OE0 A;  5HFG A;  1R5A A;  3ZIT A;  1Z3E A;  5CRG A;  1MDJ A;  3ZZX A;  3CTG A;  3APS A;  1A2L A;  2JU5 A;  5CYY A;  2WFC A;  1HQO A;  4DSQ A;  2GS3 A;  4ISD A;  5D9V A;  4ICY A;  6GSY A;  2DBC A;  1K0C A;  1EGO A;  1BX9 A;  1VF3 A;  4ACS A;  3ZRE A;  5ID2 B;  16GS A;  2MMA A;  2X4A A;  4P3Y B;  4V1A p;  2HXK A;  3C8E A;  3OR5 A;  2R0G A;  3HA9 A;  2AHE A;  3LW9 A;  3EU4 A;  3HYP A;  4RI7 A;  4LMW A;  2ON7 A;  6GSS A;  5DVB A;  4EF0 A;  3DD3 A;  2C3Q A;  1F9M A;  4POB A;  2RII A;  2K6V A;  5GSS A;  2GST A;  2R6K A;  3FW2 A;  4XTS A;  4EL1 A;  4IW9 A;  2NVL A;  1GSS A;  2YWI A;  2C0E A;  2XBI A;  2OKA A;  2B5E A;  2OE1 A;  4OO4 A;  5KOW A;  2A2S A;  3L9S A;  5A5K A;  2IWT A;  4LL1 B;  1VF1 A;  2KLX A;  5KN2 A;  1EWX A;  1B9X C;  3QCP A;  5G5F A;  2P31 A;  4ZBA A;  3Q18 A;  1EP7 A;  2JZR A;  4HQS A;  2E7P A;  2AUV A;  3ZFB A;  2HRF A;  2IJY A;  3VWU A;  4K6X A;  4HS1 A;  4FYB A;  1JZR A;  1G6W A;  2A4V A;  4MCU A;  3DKS A;  1SKW B;  3L4N A;  1OC3 A;  4Q5N A;  3HY2 A;  3DVX A;  5HR0 A;  2C3N A;  3IC4 A;  1THO A;  2DIY A;  4I97 A;  5ECN B;  3ZFL A;  4NWY A;  4IQA A;  3GKN A;  1SU9 A;  14GS A;  5GAN D;  2F9S A;  4TR4 A;  1ACV A;  2FGX A;  5IM9 A;  1OE8 A;  2FA8 A;  3TUE A;  2VLV A;  4ECC A;  1ZYP A;  1K0D A;  4CDO A;  2QA1 A;  1A2J A;  1E2Y A;  3RDW A;  1G7E A;  4OFN A;  4OO5 A;  1GSY A;  1XFL A;  2IN3 A;  3DML A;  2YCD A;  4Q5F A;  3DYR A;  2I9H A;  3MNG A;  4HI7 A;  1KEB A;  4X4J A;  3D4T A;  4XS1 A;  1GP1 A;  1Q98 A;  4ECI A;  3QFA C;  3O76 A;  2O8V B;  3M9K A;  3I9V 2;  5FT3 A;  2VL2 C;  2H1A A;  4N0Z A;  4I5Q A;  11GS A;  4EUY A;  1GLP A;  1X0R A;  5DAL A;  2P5Q A;  3LFL A;  2IPA A;  5IMV A;  2CZ2 A;  2LEG A;  3KM6 A;  4J57 E;  3HKR A;  5A4W A;  3TRQ A;  4ML6 A;  2WUL A;  2J23 A;  4KUN A;  4LL4 B;  3IDV A;  5IIZ A;  2P0G A;  4K0N A;  4TOP A;  2JZT A;  3LJR A;  1ON4 A;  5ECM B;  2VL9 A;  3PH9 A;  5D8I A;  1I9D A;  2M46 A;  1R26 A;  2VL3 A;  4V2M A;  5C04 A;  1DE2 A;  1I5G A;  1UA5 A;  1G0T A;  1YQ1 A;  2IYJ A;  5FWG A;  1B48 A;  2H19 A;  3R3E A;  2QKE A;  3KMO A;  2C0G A;  1YKA A;  2O89 A;  1RQM A;  4TR3 A;  4XS4 A;  3E9J B;  1SKR B;  3TKR A;  3N9J A;  4E8H A;  3RHB A;  2H73 A;  4FO5 A;  2KHP A;  4HJ2 A;  4N0V A;  1TU7 A;  1XVW A;  22GS A;  4MJE A;  1SD8 A;  4ZXG A;  2CAQ A;  3I6A A;  5DBQ A;  4PQ1 A;  1URM A;  2DML A;  2CA8 A;  4PNG A;  3LXZ A;  2B7J A;  3QAV A;  2X8G A;  1T4Z A;  1T7P B;  2VUP A;  3A2V A;  2O87 A;  4XS6 A;  1YJ6 A;  4EIP A;  1X9W B;  4K9Z A;  4X0X A;  1SD9 A;  3FHK A;  3ISO A;  3KMN A;  1OC9 A;  3DGQ A;  2PPT A;  1PN0 A;  2N5B A;  4X1U A;  5HFK A;  3MDK A;  5L71 A;  2VOC A;  1AAZ A;  1Z6N A;  1GSU A;  3IPZ A;  5EL8 A;  5JCU A;  5B8B A;  1TW9 A;  4F0C A;  2GT5 A;  5D93 A;  3D4M A;  5GAP D;  4BWQ A;  1A24 A;  1TRV A;  2VLU A;  3V1W A;  2H1B A;  4WXT A;  3GL3 A;  4FQU A;  4NV2 A;  3FEU A;  3TKQ A;  2GZZ A;  4G2E A;  3WD6 A;  1MDI A;  1W89 A;  2C0D A;  2K8S A;  3LOR A;  3DIE A;  2B6M A;  3FMW A;  4PNF A;  3CSJ A;  3DWV A;  3SBC A;  1IYI A;  2HNL A;  3F3Q A;  4WF5 A;  3LSZ A;  2H8L A;  3FZ5 A;  1W4V A;  3IHQ A;  2IMF A;  4O5U A;  3L78 A;  5DAK A;  5C00 A;  1B9Y C;  1V40 A;  3P90 A;  5BMU A;  3MWH A;  4OMV A;  3F0I A;  2H75 A;  1A8Y A;  1A0R P;  2H6X A;  3VWW A;  1VRS D;  2LUS A;  1J0F A;  1K0N A;  1IYH A;  5A4U A;  4MPF A;  3GSS A;  3F4R A;  1X9S B;  3KJY A;  2DLX A;  4KSO A;  1O81 A;  4KDX A;  4GQF A;  2IIY A;  2C1Y A;  3ME7 A;  4EC0 A;  4DSS A;  5IO0 A;  3UMA A;  2DJJ A;  1U6T A;  2VCT A;  4F03 A;  4PQI A;  1ZZY A;  3GST A;  3EE2 A;  4IVF A;  3IK9 A;  1DUG A;  1Q4J A;  4OWY A;  1XWA A;  1TP9 A;  2VLT A;  3KP8 A;  2V6O A;  2H0I A;  5G2Z A;  3BCK A;  1GTU A;  4K0G A;  4V1A g;  1TU8 A;  4G19 A;  2H30 A;  1KBN A;  3A2X A;  1JLW A;  2HI7 A;  5AIS A;  3F4S A;  2CZ3 A;  3HDC A;  3KTB A;  5B6N A;  2VM2 A;  1GRX A;  3F63 A;  3D22 A;  3H8Q A;  4IGJ A;  3QD9 A;  4K7N A;  4MJC A;  3C71 A;  4KND A;  3GX0 A;  3GN3 A;  4Z2R A;  2B3S A;  3FRC A;  5DQY A;  1GH2 A;  1LU4 A;  1M0U A;  4I6X A;  3M1G A;  1UVZ A;  1AQX A;  4EVM A;  5BRT A;  2V32 A;  2PWJ A;  3L9U A;  1ERV A;  2YJH A;  1PGT A;  2VAF A;  4OCE A;  4JU5 A;  3TOT A;  5J5N A;  3VLN A;  3HVV A;  1N2A A;  1J08 A;  3C1R A;  5CNW A;  2LKU A;  4JR4 A;  3TGZ A;  3D0Z A;  2YV9 A;  4ZL9 A;  1PL2 A;  3FY7 A;  3QFB C;  3UBK A;  3IBH A;  3IRA A;  10GS A;  4CHS A;  4PTS A;  1XXU A;  3KXO A;  5J4U A;  3PPU A;  2L57 A;  1QQ2 A;  3NIV A;  4IQ1 A;  2YZH A;  3C7M A;  4YQU A;  2C0F A;  5DJM A;  4F0B A;  5ECI B;  4G0L A;  1QGV A;  5F06 A;  5B7C A;  2O85 A;  1SYR A;  3ERW A;  4RI6 A;  4DVC A;  2X49 A;  3TRX A;  4IN0 A;  2FWG A;  4GCI A;  3UVH A;  3LEF A;  2AB6 A;  4MA9 A;  4Z7X A;  2FY6 A;  3HZ8 A;  4MZB A;  1XW5 A;  4BL7 B;  4CW9 A;  2IFQ B;  1K0M A;  1U3I A;  4ZBD A;  3ZLP A;  4K2D A;  2LRC A;  5KN0 A;  1ST9 A;  4FH8 A;  2OA7 A;  5ECK B;  4IS0 A;  18GS A;  1VF2 A;  1A8L A;  2JL4 A;  2V1M A;  3KTL A;  4YAP A;  5LD0 A;  4DSR A;  1T3B A;  3LXT A;  1GUL A;  2QGV A;  3FZ4 A;  2YV7 A;  4WEY A;  4YQM A;  2A2P A;  1GUM A;  1TJD A;  2CQ9 A;  5J3R A;  4EKZ A;  2LNT A;  1YEX A;  1SK1 A;  3MIX A;  4JRR A;  3U5R E;  4Q5Q A;  2H01 A;  2HRA A;  4MK3 A;  1XVQ A;  3VK9 A;  4QQ7 A;  3UBL A;  3CRT A;  3FR9 A;  1K0O A;  5ABR A;  4TW5 A;  2HE3 A;  1DSB A;  4LLR A;  1XW9 A;  2H6Z A;  4DSS B;  1JHB A;  2X64 A;  1OC8 A;  5AN1 A;  5DAL B;  3TJB A;  3KCM A;  3L0H A;  3KD0 A;  1OAZ A;  2WRT A;  1TTZ A;  5LCZ A;  4JR6 A;  2IL3 A;  1PD2 1;  1H75 A;  4POK A;  5DQS A;  3ZRD A;  1Z7P A;  4Z2U A;  3KH9 A;  1SKS B;  2CV4 A;  1TXX A;  2F8F A;  5DJL A;  3APQ A;  1V57 A;  2LRN A;  2VM1 A;  2FHE A;  2X99 A;  1DBY A;  4A5P A;  4AF2 A;  1T00 A;  3F3R A;  4PUA A;  4ZBB A;  2DJ3 A;  2YZU A;  2HRK A;  5HR1 A;  2XC2 A;  4EDY A;  1WRY A;  1HNB A;  4MMM A;  5F05 A;  2HSM A;  4N11 A;  2LNS A;  5JWR B;  4XCS A;  1YY7 A;  5D9W A;  3F6D A;  4PXO A;  1Y25 A;  3VUR A;  4KDU A;  3H93 A;  1K3L A;  8GSS A;  5LNK e;  2RLI A;  5CO3 A;  4XRA A;  1F6M C;  2E2G A;  1AW9 A;  5CRE A;  2OJL A;  2HFD A;  3QDN A;  5CRW A;  2LV3 A;  2DJ2 A;  1TDI A;  1Z6M A;  2MMO A;  2BMX A;  3BJ5 A;  2QSI A;  2VCV A;  3GHA A;  2GLR A;  2K8V A;  4KA0 A;  1ZMA A;  3WGD A;  1VGL A;  2DMM A;  4USS A;  5KN3 A;  1B8X A;  1GNE A;  1FVK A;  1GSD A;  5D96 A;  1KNG A;  4JED A;  1ZL9 A;  3HVX A;  1BAY A;  4TKY A;  2DKI A;  2WGR A;  4F2I A;  2DIZ A;  1SL0 B;  1F2E A;  5ECS A;  1BJX A;  3F9U A;  4EIQ A;  5D9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...