2QEX3

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qex300
3CC43 1NJI4 3CCU3 3CXC2 1VQO3 3OW22 1M1K4 1K9M4 3CD63 1S723 2QEX3 3G4S3 3CMA3 1VQ63 1Q864 1JJ22 2OTL3 3G713 3CC73 3CC23 1VQP3 1KC84 1VQ43 3CCV3 1VQ73 1YJW3 1YHQ3 1YJ93 1QVF2 3CCJ3 2QA43 1VQM3 1M904 3CPW2 1Q7Y4 1Q814 1K8A4 1KQS2 3CME3 3I553 1N8R4 1YI23 1YJN3 1VQL3 1KD14 1VQN3 1Q824 1VQK3 1YIT3 3CCQ3 1YIJ3 1QVG2 3CCR3 1VQ83 3I563 1W2B2 3CCM3 3G6E3 1VQ53 1VQ93 3CCS3 3CCL3 2OTJ3 3CCE3 1K734
chains in the Genus database with same CATH superfamily
4KT3B 1IVXA 1G96A 2KF5A 3HZPA 4I5QA 1NB3I 1ZX2A 2XR8B 1CH0A 1AV4A 1QJGA 4AEQA 3T0UA 4ORLA 1MWRA 2GEXA 2KCDA 3G16A 1RNTA 3OV4A 3UL5A 3FZWA 2WGOA 1T3BA 4EW5A 1Y4KA 2B24B 1HZ1A 1BSDA 1TUHA 3X3XA 1NB5I 1A2PA 3NBJA 1GMRA 2Z7AA 1K28A 2OQEC 5IENA 1RGGA 3QK9A 1OGXA 3X41A 3F40A 3UL6A 2L4VA 3FH1A 1RNBA 1VQ83 1FA3A 1JKGA 3BU4A 5JPUA 2CW9A 1VQ53 1I0XA 1NDOB 5JBSA 3CCE3 1PU4A 1YVSA 2BIRA 3FG4A 1UUVB 1BNGA 4JF8A 1GY6A 1I2FA 2CG1A 4FMDA 5AEWB 4HM7B 4IT7A 3LZAA 1DMQA 3MPHA 1OHOA 4GSPA 4N6MA 1M9GA 1ROAA 3STDA 4NHFA 5CXOA 2SBLA 1AY7A 1Q42A 5KP4A 1B2XA 1IU7A 3BIRA 3MHEA 4J5GA 5G1LA 2P0MA 3QRDA 3RNTA 1WMPA 2K3DA 1UI7A 3AMOB 1EG9B 2K0MA 2KF6A 4LYLB 4O02B 1YI23 1ZS7A 2ZHXB 1Q824 1N9EA 1TFKA 3FGYA 5AIGA 3CCR3 1JNQA 3PGBA 3MG1A 3Q90A 1BVIA 3V99A 2F86B 2CWUA 1O7WB 2ML6A 3F7XA 4FMBA 1IVUA 2WGQA 3X42A 2PNCA 2ZDJA 4O8SA 4O3VA 1FGQA 1K9M4 2XFSA 1MOLA 3EJVA 5ELUA 2QEX3 3IJEB 4H3UA 2FNQA 2GEYA 3JUMA 3KIIA 4J8TA 4WHAA 2CC3A 1QALA 2XSHB 5CF1A 3RGRA 3G713 2HMLB 3E99A 2OWPA 4N6OB 5STDA 2Y73A 4JRFA 1DYUA 3I0YA 3EBTA 4FMAA 4LZIA 3ZG0A 1SJWA 1OPYA 3NBRA 4K1VA 2WO0A 1X1WA 1RDSA 3S28A 2GXFA 3K0ZA 2E2UA 2M7OA 3BNEA 1WTHA 2YX9A 1GD3A 3KE7A 1LNIA 2CKFB 3AHWA 3ECFA 3Q1CA 2OOVA 1WMOA 2OTJ3 1GS3A 4BL3A 1BRGA 5IEOA 2BT3A 3LYGA 3A5EA 1VQO3 3OW22 5IW9A 1FUTA 3JVCA 1B21A 1B2ZA 2F99A 5EEOA 3VF1A 1YVBI 1SQWA 3MKIA 4QWTA 3WODG 2CFWA 2JDIH 1D6UA 1SARA 4FMCA 4HM4B 1BAOA 1W5ZA 2QGUA 2KF3A 2P38A 3LOYA 1GOVA 3BB9A 2GU3A 2W04A 1UDII 2H0HA 1RMSA 1N8QA 3DH2A 4KVHA 1A2KA 3FLJA 8CHOA 4HKVB 1CEWI 1DMNA 3V92A 1OHPA 3JUNA 1EQKA 3HX8A 4BTWA 4TX4A 2BMQB 2L1SA 2MF7A 3MG2A 3DGYA 5LC6A 1OHSA 1UI8A 1K734 1JBSA 1I0VA 1B27A 3F8XA 1I2GA 5G2GA 3LTCA 4N6TA 1O7PB 4N6LA 1FUSA 4XB5A 1CYVA 1BRJA 3EX9A 4X2HA 1VQP3 4OUQA 4J9AA 3DGOA 1BRIA 1RSNA 2R4IA 3CPW2 2GBWB 3ALAA 8RNTA 5DREA 2RNTA 3B7CA 1LQMB 2W03A 4BTYA 1BNRA 2R41A 1IK3A 1BRSA 3FF0A 3SOYA 1EEJA 3N8BA 5AIFA 2GU1A 1PY3A 4HM1B 1US1A 1ULJB 1IVVA 3GZYB 1T2IA 5ELJA 4HM6B 1Q7HA 1WMNA 2C4BA 3MG3A 3TDGA 1BNEA 2V1LA 4FCMA 3BLZA 3KCHA 1IVWA 2YFJB 3H3HA 1Q864 1TIJA 4FR9A 3CC73 3HIGA 1KC84 3CCV3 2RFRA 3EHCA 4G1MB 1BSCA 1MNLA 2XH9A 2SARA 3ROBA 1VQM3 5G1KA 5AYSC 1GSPA 2C10A 3BNBA 5IF6A 1KQS2 4R80A 3CME3 1KD14 1N5PA 4BU4A 2GBXB 1YIJ3 1RN7A 2BU4A 3K9MC 4GHOA 4MJDA 1YJ93 3AGOA 3HK4A 3NXJA 3D5IA 1TU5A 3K7CA 3OX9A 1N5HA 4XBTA 1IT7A 1OGZA 4MEIA 3F9SA 4MMYB 1STDA 1W4NA 1ZO2A 7GSPA 1YJW3 4PEJA 1GOYA 2ZL8A 1IT8A 5IEPA 1K8A4 1LXEA 3MYTA 3D5GA 3AHSA 1FGMA 1GYBA 1Q7Y4 4BTXA 4HBRA 5BIRA 2C11A 5FW5A 1MWSA 1RGKA 4L7KA 1BGSA 3LT8A 4AKZA 1RGLA 6GSPA 2OOVC 4K90B 3FG1A 1BANA 2W56B 4HZBB 3DUKA 3WA3A 5EQLA 3CNXA 3AMOA 1FZUA 1IV7A 3N54B 1Q9EA 3X3YA 3KFQC 1VQ93 4ILFA 3RDEA 1RCLA 5D83A 3PCRA 4Q53A 3HOHA 1B3SA 2CWTA 4WWUC 1L5GB 2HMJB 4EXRA 1W6GA 4LEHA 3GRDA 4HM8B 4HAAA 3DXOA 3X3ZA 4CCVA 2W9QA 3O8YA 1F8NA 2IYJA 3X40A 5I97A 1M904 3SXXA 1I8VA 3BNDA 2RSXA 1LRAA 2CFKA 5AI1A 1ISKA 3LTBA 2STDA 3I553 2BHMA 3PXMA 2IUJA 2OQEA 2XEPA 1NNVA 1FUWA 5BXQA 4CJNA 3FSDA 1LOXA 3CCS3 1DMMA 2W9PA 1X1YA 1IQYA 2I9WA 2XGLA 3NM7A 3V98A 3CC43 1TFOA 1NJI4 1M1K4 3G4S3 3S29A 1OCVA 1V74A 3D3LA 3IPTA 1Q40B 2HMOB 1AVLA 3D9RA 3URPA 5BVBA 1BNFA 4U13A 3WR2A 4R9LA 2AADA 3DGLA 1JV2B 4L8PA 3NBBA 1GY5A 1RGAA 3AGNA 5IG3A 2AAEA 2YFIB 1BNJA 2UX0A 3HIIA 3KSPA 5EVHA 2KF4A 3EBYA 2IA7A 1JBTA 1VQN3 2LYXA 1SIIA 2XGNA 1BU4A 3CCQ3 3HI7A 3G6E3 1BIRA 1O7HB 2CH9A 4XDWA 1SIHA 1N9JA 4KFEA 5KP1A 4K61A 1TRQA 2Z77A 2HMKB 1BOXA 1W02A 1JRQA 3CC23 3NX0A 1BSEA 5D81A 2BMOB 3KSED 1BRHA 5DRVA 1GMPA 1UGHI 1QAKA 2Z76A 3FKAA 1RJOA 4LMIA 1AR0A 1GY7A 4ZM8A 3F14A 4K1UA 2O3OA 2ZA4A 3J7Yd 3RGAA 3B8LA 1B2UA 3M8CA 3G0KA 1NO3A 2PZVA 3WA2X 3KKGA 3NV0B 4FCJA 2HOHA 2Y74A 4HM3B 1VQK3 1IV9A 1JZDA 4XBXA 3I563 4OVMA 2E2VA 1JN5B 1UCJA 1DVCA 2FGTA 3T8UA 5HOHA 5LC7A 1AVKA 1X1UA 1T5YA 2F5MA 2WOHA 4EV5A 3B4PA 3DMCA 7STDA 4XM4A 3NHXA 3PS8A 1QMAA 3SVAA 1OF5B 4AKYA 1G0TA 1I3FA 2CHCA 2CFLA 2F4YA 3K5TA 4FCZA 4IIAA 4IPBA 5AYRB 3ZG5A 3CCJ3 4EBGA 1D6ZA 2CWVA 1RKYA 2KAAA 4NREA 2XFTA 1R4CA 1E3VA 4DKIA 4HM0B 2UGIA 1BSBA 1UCLA 5AIIA 5BU4A 1U8CB 4WYKB 1Q814 1VZZA 2O9UX 4HM5B 3VGNA 3DY5A 1YNVX 2J8XB 1BUJA 3MWZA 1TP6A 5CLKA 3SLUA 4I4KA 1LOVA 1I3IA 3PCSA 5M18A 1NWWA 2CX1A 3EB8A 1UCIA 1DE3A 3SYUA 3JUOA 2CFDA 3K63A 4HJLB 2JQ5A 1S723 1FYSA 3BNCA 4HOHA 3CMA3 1VQ63 1W7CA 4R4KA 3DM8A 1VQ43 3CU3A 1YHQ3 3CPOA 1QAFA 1O7GB 2F98A 2WOFA 2CG0A 4NPBA 2MC8A 3EN1B 5GSPA 1KSIA 1JB4A 4H61A 1M1XB 2RGQA 3F7SA 1UUGB 3GSPA 3OWUA 3B4OA 4RNZA 3S67A 1JKGB 2IY2A 2CX0A 4R9KA 2HMNB 1C7HA 4HYZA 4MMXB 1Z1SA 2KRTA 3KN4A 1MWUA 3S27A 3PYJA 4WFOA 1YGWA 1QVG2 1OH0A 3CCM3 1MGWA 1A90A 2H0IA 4XBYA 2W56A 4X2OA 1G02A 2XSOB 6RNTA 1K41A 1I70A 1JB5A 3WOFB 2F5WA 3D79A 1BUQA 4OK0A 1C54A 2OTL3 1LOYA 3U97A 4BIRA 1BSAA 1GD4A 1RRHA 4EV2A 2Q07A 4RNTA 1S5AA 1QVF2 1KWIA 3VSYA 2QA43 5IG4A 1LVNA 1SPUA 1ZGXA 3A76A 5JPPA 3OWYA 4CPKA 3T8NA 1RGEA 3UB1A 3L0RA 3D4AA 4N6NB 1W00A 2P09A 3WOEB 4HM2B 1T2HA 3EN8A 3G8ZA 3SOAA 1O7MB 1FW7A 2H0GA 4J5KA 1ASKA 3FCSB 3Q2PA 1BNIA 4N3VA 1W2B2 1RCKA 1FGTA 2IMJA 4STDA 2CIUA 1YGEA 3F8HA 1IQ8A 4EC6A 1HKXA 1BRNL 4KFDA 3FG3A 1E3RA 2XF3A 1ROVA 2FXTA 3GZRA 3JUPA 6STDA 3CXC2 1JBRA 1FGOA 4KZ1A 3ER7A 1DVDA 2BMRB 1MGRA 1R4YA 1AQZA 3NQZA 1MWTA 1DETA 3LXUX 1VQ73 3WHOA 2CK3H 3GWRA 4HVNA 4LSOA 4N6UA 4KFFA 4XDVA 5AIHA 1HYFA 1Q40A 1NU3A 5RNTA 2CFGA 5TGNA 3LTDA 1B2SA 5IG0A 2BO9B 1W6YA 2W2CA 3KZTA 4O2HA 3EQQB 3LMLA 4WP5A 2Z6BA 5FGOA 3UNLA 3DGMA 1W01A 3DZLA 1B2MA 1RRLA 2ML5A 1ULIB 1BNSA 1VQQA 3WMDA 4RZMA 3CCL3 1A2VA 2P05A 3DGNA 1EA2A 3EF8A 3IMAB 3SX1A 5CF2A 3EE1A 3CCU3 2OCTA 1HU9A 9RNTA 1O7NB 1V58A 3GZXB 2GSPA 2HMMB 1I2EA 1TTOA 1BRKA 1RGFA 2INXA 1IQXA 2W0QA 3NUVA 1GMQA 4N6V0 1LNHA 2RBIA 3FF2A 2BNGA 5M19A 1UUWB 5AEUB 2W6JH 1RLSA 1FGRA 3N9HA 4RBNA 1CYUA 3LH4A 1RHLA 1TJDA 2UUGC 4L8OA 4MMZB 5A0OB 5IG5A 1WQLB 1EUIC 3CNMA 3MSOA 2D1WA 2KXGA 1B20A 4CDLA 3U1WA 1N8R4 3NM2A 1V57A 5HGRA 2QIYA 4RNYA 5IERA 3EC9A 3LT9A 4GL6A 2LQVA 3NV0A 3PZWA 3LTAA 5KP3A 1UW1A 2B1XB 1IDPA 1PYLA 3S5CA 2YFLB 1JB2A 1E97A 2E2TA 2F56A 1U5OA 4GB5A 3CD63 3GZBA 3JUQA 1UGIA 1RGCA 1A67A 1JN5A 1PFPA 1JJ22 1RTUA 1WNHA 2XRXB 3UJMA 2A15A 3WDGB 1RN1A 1GOUA 4LGQA 5M1AA 1D6YA 1EKMA 1OF5A 2D42A 4BL2A 1W2ZA 7RNTA 1W6CA 1RGHA 4EYCA 5D82A 1TRPA 3ZFZA 3H51A 1JZOA 2K54A 1STFI 4HZ9B 1J2BA 3OXAA 1IYYA 3OWSA 1YJN3 1VQL3 3Q3FA 2P0XA 3SEDA 1UCKA 5CK6A 4WYKA 1YIT3 1OACA 1OUNA 4R1KA 1RN4A 3GAXA 1X1XA 1LOWA 2IUKA 1LQGC 2RCDA 1CQSA 3NQYA
chains in the Genus database with same CATH topology
1IVXA 1G96A 3HZPA 1NB3I 1ZX2A 2XR8B 1AV4A 1QJGA 4AEQA 3T0UA 4ORLA 2GEXA 2KCDA 3G16A 3UL5A 3OV4A 3FZWA 2WGOA 1Y4KA 2B24B 1TUHA 3X3XA 1NB5I 3NBJA 2Z7AA 1K28A 2OQEC 5IENA 3QK9A 1OGXA 3X41A 3F40A 3UL6A 2L4VA 3FH1A 1VQ83 1FA3A 1JKGA 5JPUA 1VQ53 2CW9A 5JBSA 1NDOB 3CCE3 1PU4A 3FG4A 1UUVB 4JF8A 1GY6A 2CG1A 4FMDA 5AEWB 4HM7B 4IT7A 3LZAA 1DMQA 3MPHA 1OHOA 4N6MA 1M9GA 1ROAA 3STDA 4NHFA 5CXOA 2SBLA 1Q42A 5KP4A 1IU7A 3MHEA 2P0MA 3QRDA 1WMPA 1UI7A 3AMOB 1EG9B 2K0MA 4O02B 1YI23 1Q824 1N9EA 1TFKA 3FGYA 5AIGA 3CCR3 1JNQA 3PGBA 3MG1A 3Q90A 3V99A 2F86B 2CWUA 1O7WB 2ML6A 3F7XA 4FMBA 1IVUA 2WGQA 3X42A 2PNCA 2ZDJA 4O8SA 4O3VA 1FGQA 1K9M4 2XFSA 1MOLA 3EJVA 5ELUA 2QEX3 3IJEB 4H3UA 2FNQA 2GEYA 3JUMA 3KIIA 4J8TA 4WHAA 2CC3A 1QALA 2XSHB 5CF1A 3RGRA 3G713 2HMLB 3E99A 2OWPA 4N6OB 5STDA 2Y73A 4JRFA 1DYUA 3I0YA 3EBTA 4FMAA 4LZIA 1SJWA 1OPYA 3NBRA 4K1VA 2WO0A 3S28A 2GXFA 3K0ZA 2E2UA 2M7OA 3BNEA 1WTHA 2YX9A 1GD3A 3KE7A 3ECFA 2CKFB 3Q1CA 2OOVA 1WMOA 2OTJ3 1GS3A 5IEOA 2BT3A 3LYGA 1VQO3 3OW22 5IW9A 3JVCA 2F99A 5EEOA 3VF1A 1YVBI 1SQWA 3MKIA 4QWTA 3WODG 2CFWA 2JDIH 1D6UA 4FMCA 4HM4B 1W5ZA 2QGUA 2P38A 3LOYA 3BB9A 2GU3A 2W04A 1N8QA 4KVHA 8CHOA 1A2KA 3FLJA 4HKVB 1CEWI 1DMNA 3V92A 1OHPA 3JUNA 1EQKA 3HX8A 4BTWA 4TX4A 2BMQB 2MF7A 3MG2A 5LC6A 1OHSA 1UI8A 1K734 3F8XA 5G2GA 3LTCA 4N6TA 1O7PB 4N6LA 4XB5A 1CYVA 3EX9A 4X2HA 1VQP3 4OUQA 4J9AA 3DGOA 2R4IA 3CPW2 2GBWB 3ALAA 5DREA 3B7CA 2W03A 4BTYA 1IK3A 3FF0A 3SOYA 3N8BA 5AIFA 2GU1A 4HM1B 1US1A 1ULJB 1IVVA 3GZYB 4HM6B 1WMNA 3MG3A 3TDGA 2V1LA 4FCMA 3BLZA 1IVWA 2YFJB 3H3HA 1Q864 1TIJA 4FR9A 3CC73 3HIGA 1KC84 3CCV3 2RFRA 3EHCA 4G1MB 1MNLA 2XH9A 3ROBA 1VQM3 5IF6A 5AYSC 1KQS2 2C10A 3BNBA 4R80A 3CME3 1KD14 1N5PA 2GBXB 1YIJ3 1RN7A 3K9MC 4MJDA 1YJ93 3HK4A 3NXJA 1TU5A 3K7CA 3OX9A 1N5HA 4XBTA 1IT7A 1OGZA 4MEIA 3F9SA 4MMYB 1STDA 1W4NA 1ZO2A 1YJW3 4PEJA 2ZL8A 1IT8A 5IEPA 1K8A4 1LXEA 3MYTA 1FGMA 1GYBA 1Q7Y4 4BTXA 4HBRA 2C11A 5FW5A 4L7KA 4AKZA 3LT8A 2OOVC 4K90B 3FG1A 2W56B 4HZBB 3DUKA 3WA3A 5EQLA 3CNXA 3AMOA 3N54B 1IV7A 1VQ93 3X3YA 3KFQC 3RDEA 5D83A 3PCRA 4Q53A 2CWTA 4WWUC 1L5GB 2HMJB 4EXRA 1W6GA 4LEHA 3GRDA 4HM8B 3X3ZA 3DXOA 4CCVA 2W9QA 3O8YA 1F8NA 3X40A 5I97A 1M904 3SXXA 3BNDA 2RSXA 2CFKA 5AI1A 1ISKA 3LTBA 2STDA 3I553 2BHMA 3PXMA 2IUJA 2OQEA 2XEPA 1FUWA 5BXQA 3FSDA 1LOXA 3CCS3 1DMMA 2W9PA 1IQYA 2I9WA 2XGLA 3NM7A 3V98A 3CC43 1TFOA 1NJI4 1M1K4 3G4S3 3S29A 1OCVA 1V74A 3D3LA 3IPTA 1Q40B 2HMOB 1AVLA 3D9RA 5BVBA 4U13A 4R9LA 3DGLA 1JV2B 4L8PA 3NBBA 1GY5A 5IG3A 5EVHA 2YFIB 2UX0A 3HIIA 3KSPA 3EBYA 2IA7A 1VQN3 2LYXA 1SIIA 2XGNA 3CCQ3 3HI7A 3G6E3 1O7HB 2CH9A 4XDWA 1SIHA 1N9JA 4KFEA 5KP1A 4K61A 2Z77A 2HMKB 1W02A 1JRQA 3CC23 3NX0A 5D81A 2BMOB 3KSED 5DRVA 2Z76A 1QAKA 3FKAA 1RJOA 4LMIA 1AR0A 1GY7A 4ZM8A 3F14A 4K1UA 2O3OA 3J7Yd 3RGAA 3B8LA 3M8CA 3G0KA 1NO3A 2PZVA 3WA2X 3KKGA 3NV0B 4FCJA 2Y74A 4HM3B 1VQK3 1IV9A 4XBXA 3I563 4OVMA 2E2VA 1JN5B 2FGTA 1DVCA 3T8UA 5LC7A 1AVKA 2WOHA 1T5YA 4EV5A 3B4PA 3DMCA 7STDA 4XM4A 3NHXA 3PS8A 1QMAA 3SVAA 1OF5B 4AKYA 2CHCA 2CFLA 3K5TA 4FCZA 4IIAA 4IPBA 5AYRB 3CCJ3 4EBGA 1D6ZA 2CWVA 1RKYA 4NREA 2XFTA 1R4CA 1E3VA 4HM0B 1Q814 5AIIA 1U8CB 4WYKB 1VZZA 2O9UX 4HM5B 3VGNA 3DY5A 3MWZA 1TP6A 5CLKA 3SLUA 4I4KA 3PCSA 1NWWA 3EB8A 3JUOA 2CFDA 3K63A 4HJLB 2JQ5A 1S723 3BNCA 3CMA3 1VQ63 1W7CA 4R4KA 3DM8A 1VQ43 3CU3A 1YHQ3 3CPOA 1QAFA 1O7GB 2F98A 2WOFA 2CG0A 2MC8A 3EN1B 1KSIA 1JB4A 4H61A 1M1XB 2RGQA 3F7SA 3OWUA 4RNZA 5ELJA 3B4OA 3S67A 1JKGB 4R9KA 2HMNB 1C7HA 4HYZA 4MMXB 1Z1SA 2KRTA 3KN4A 3S27A 3PYJA 4WFOA 1QVG2 1OH0A 3CCM3 1A90A 4XBYA 2W56A 4X2OA 2XSOB 1K41A 1JB5A 3WOFB 1BUQA 4OK0A 2OTL3 3U97A 1GD4A 1RRHA 4EV2A 2Q07A 1S5AA 1QVF2 1KWIA 3VSYA 2QA43 5IG4A 1LVNA 1SPUA 3A76A 5JPPA 3OWYA 3T8NA 3UB1A 3L0RA 4N6NB 1W00A 2P09A 3WOEB 4HM2B 3EN8A 3G8ZA 3SOAA 1O7MB 4N3VA 1ASKA 3FCSB 3Q2PA 1W2B2 2IMJA 1FGTA 4STDA 2CIUA 1YGEA 3F8HA 1IQ8A 4EC6A 1HKXA 4KFDA 3FG3A 1E3RA 2XF3A 1ROVA 2FXTA 3GZRA 3JUPA 6STDA 3CXC2 1FGOA 4KZ1A 3ER7A 1DVDA 2BMRB 3NQZA 3LXUX 1VQ73 2CK3H 3GWRA 4HVNA 4LSOA 4N6UA 4KFFA 4XDVA 5AIHA 1Q40A 1NU3A 2CFGA 5TGNA 3LTDA 5IG0A 2BO9B 1W6YA 2W2CA 3KZTA 4O2HA 3EQQB 3LMLA 4WP5A 2Z6BA 5FGOA 3UNLA 3DGMA 1W01A 3DZLA 1RRLA 2ML5A 1ULIB 3WMDA 4RZMA 3CCL3 1A2VA 2P05A 3DGNA 1EA2A 3EF8A 3IMAB 3SX1A 5CF2A 3EE1A 3CCU3 2OCTA 1HU9A 1O7NB 3GZXB 2HMMB 2INXA 1IQXA 2W0QA 3NUVA 4N6V0 1LNHA 3FF2A 2BNGA 1UUWB 5AEUB 2W6JH 1FGRA 3N9HA 4RBNA 1CYUA 3LH4A 4L8OA 4MMZB 5A0OB 5IG5A 1WQLB 3CNMA 3MSOA 2D1WA 2KXGA 4CDLA 3U1WA 3NM2A 5HGRA 2QIYA 4RNYA 5IERA 3EC9A 3LT9A 4GL6A 2LQVA 3NV0A 3PZWA 3LTAA 5KP3A 1UW1A 2B1XB 1IDPA 3S5CA 2YFLB 1JB2A 1E97A 2E2TA 1U5OA 4GB5A 3CD63 3GZBA 3JUQA 1A67A 1JN5A 1PFPA 1JJ22 1WNHA 2XRXB 3UJMA 2A15A 3WDGB 4LGQA 1D6YA 1EKMA 1OF5A 2D42A 1W2ZA 1W6CA 4EYCA 5D82A 3H51A 1J2BA 2K54A 1STFI 4HZ9B 3OXAA 3OWSA 1YJN3 1VQL3 2P0XA 3SEDA 5CK6A 4WYKA 1YIT3 1OACA 1OUNA 4R1KA 3GAXA 1N8R4 2IUKA 2RCDA 1CQSA 3NQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 3;  1NJI 4;  3CCU 3;  3CXC 2;  1VQO 3;  3OW2 2;  1M1K 4;  1K9M 4;  3CD6 3;  1S72 3;  2QEX 3;  3G4S 3;  3CMA 3;  1VQ6 3;  1Q86 4;  1JJ2 2;  2OTL 3;  3G71 3;  3CC7 3;  3CC2 3;  1VQP 3;  1KC8 4;  1VQ4 3;  3CCV 3;  1VQ7 3;  1YJW 3;  1YHQ 3;  1YJ9 3;  1QVF 2;  3CCJ 3;  2QA4 3;  1VQM 3;  1M90 4;  3CPW 2;  1Q7Y 4;  1Q81 4;  1K8A 4;  1KQS 2;  3CME 3;  3I55 3;  1N8R 4;  1YI2 3;  1YJN 3;  1VQL 3;  1KD1 4;  1VQN 3;  1Q82 4;  1VQK 3;  1YIT 3;  3CCQ 3;  1YIJ 3;  1QVG 2;  3CCR 3;  1VQ8 3;  3I56 3;  1W2B 2;  3CCM 3;  3G6E 3;  1VQ5 3;  1VQ9 3;  3CCS 3;  3CCL 3;  2OTJ 3;  3CCE 3;  1K73 4; 
#chains in the Genus database with same CATH topology
 4KT3 B;  1IVX A;  1G96 A;  2KF5 A;  3HZP A;  4I5Q A;  1NB3 I;  1ZX2 A;  2XR8 B;  1CH0 A;  1AV4 A;  1QJG A;  4AEQ A;  3T0U A;  4ORL A;  1MWR A;  2GEX A;  2KCD A;  3G16 A;  1RNT A;  3OV4 A;  3UL5 A;  3FZW A;  2WGO A;  1T3B A;  4EW5 A;  1Y4K A;  2B24 B;  1HZ1 A;  1BSD A;  1TUH A;  3X3X A;  1NB5 I;  1A2P A;  3NBJ A;  1GMR A;  2Z7A A;  1K28 A;  2OQE C;  5IEN A;  1RGG A;  3QK9 A;  1OGX A;  3X41 A;  3F40 A;  3UL6 A;  2L4V A;  3FH1 A;  1RNB A;  1VQ8 3;  1FA3 A;  1JKG A;  3BU4 A;  5JPU A;  2CW9 A;  1VQ5 3;  1I0X A;  1NDO B;  5JBS A;  3CCE 3;  1PU4 A;  1YVS A;  2BIR A;  3FG4 A;  1UUV B;  1BNG A;  4JF8 A;  1GY6 A;  1I2F A;  2CG1 A;  4FMD A;  5AEW B;  4HM7 B;  4IT7 A;  3LZA A;  1DMQ A;  3MPH A;  1OHO A;  4GSP A;  4N6M A;  1M9G A;  1ROA A;  3STD A;  4NHF A;  5CXO A;  2SBL A;  1AY7 A;  1Q42 A;  5KP4 A;  1B2X A;  1IU7 A;  3BIR A;  3MHE A;  4J5G A;  5G1L A;  2P0M A;  3QRD A;  3RNT A;  1WMP A;  2K3D A;  1UI7 A;  3AMO B;  1EG9 B;  2K0M A;  2KF6 A;  4LYL B;  4O02 B;  1YI2 3;  1ZS7 A;  2ZHX B;  1Q82 4;  1N9E A;  1TFK A;  3FGY A;  5AIG A;  3CCR 3;  1JNQ A;  3PGB A;  3MG1 A;  3Q90 A;  1BVI A;  3V99 A;  2F86 B;  2CWU A;  1O7W B;  2ML6 A;  3F7X A;  4FMB A;  1IVU A;  2WGQ A;  3X42 A;  2PNC A;  2ZDJ A;  4O8S A;  4O3V A;  1FGQ A;  1K9M 4;  2XFS A;  1MOL A;  3EJV A;  5ELU A;  2QEX 3;  3IJE B;  4H3U A;  2FNQ A;  2GEY A;  3JUM A;  3KII A;  4J8T A;  4WHA A;  2CC3 A;  1QAL A;  2XSH B;  5CF1 A;  3RGR A;  3G71 3;  2HML B;  3E99 A;  2OWP A;  4N6O B;  5STD A;  2Y73 A;  4JRF A;  1DYU A;  3I0Y A;  3EBT A;  4FMA A;  4LZI A;  3ZG0 A;  1SJW A;  1OPY A;  3NBR A;  4K1V A;  2WO0 A;  1X1W A;  1RDS A;  3S28 A;  2GXF A;  3K0Z A;  2E2U A;  2M7O A;  3BNE A;  1WTH A;  2YX9 A;  1GD3 A;  3KE7 A;  1LNI A;  2CKF B;  3AHW A;  3ECF A;  3Q1C A;  2OOV A;  1WMO A;  2OTJ 3;  1GS3 A;  4BL3 A;  1BRG A;  5IEO A;  2BT3 A;  3LYG A;  3A5E A;  1VQO 3;  3OW2 2;  5IW9 A;  1FUT A;  3JVC A;  1B21 A;  1B2Z A;  2F99 A;  5EEO A;  3VF1 A;  1YVB I;  1SQW A;  3MKI A;  4QWT A;  3WOD G;  2CFW A;  2JDI H;  1D6U A;  1SAR A;  4FMC A;  4HM4 B;  1BAO A;  1W5Z A;  2QGU A;  2KF3 A;  2P38 A;  3LOY A;  1GOV A;  3BB9 A;  2GU3 A;  2W04 A;  1UDI I;  2H0H A;  1RMS A;  1N8Q A;  3DH2 A;  4KVH A;  1A2K A;  3FLJ A;  8CHO A;  4HKV B;  1CEW I;  1DMN A;  3V92 A;  1OHP A;  3JUN A;  1EQK A;  3HX8 A;  4BTW A;  4TX4 A;  2BMQ B;  2L1S A;  2MF7 A;  3MG2 A;  3DGY A;  5LC6 A;  1OHS A;  1UI8 A;  1K73 4;  1JBS A;  1I0V A;  1B27 A;  3F8X A;  1I2G A;  5G2G A;  3LTC A;  4N6T A;  1O7P B;  4N6L A;  1FUS A;  4XB5 A;  1CYV A;  1BRJ A;  3EX9 A;  4X2H A;  1VQP 3;  4OUQ A;  4J9A A;  3DGO A;  1BRI A;  1RSN A;  2R4I A;  3CPW 2;  2GBW B;  3ALA A;  8RNT A;  5DRE A;  2RNT A;  3B7C A;  1LQM B;  2W03 A;  4BTY A;  1BNR A;  2R41 A;  1IK3 A;  1BRS A;  3FF0 A;  3SOY A;  1EEJ A;  3N8B A;  5AIF A;  2GU1 A;  1PY3 A;  4HM1 B;  1US1 A;  1ULJ B;  1IVV A;  3GZY B;  1T2I A;  5ELJ A;  4HM6 B;  1Q7H A;  1WMN A;  2C4B A;  3MG3 A;  3TDG A;  1BNE A;  2V1L A;  4FCM A;  3BLZ A;  3KCH A;  1IVW A;  2YFJ B;  3H3H A;  1Q86 4;  1TIJ A;  4FR9 A;  3CC7 3;  3HIG A;  1KC8 4;  3CCV 3;  2RFR A;  3EHC A;  4G1M B;  1BSC A;  1MNL A;  2XH9 A;  2SAR A;  3ROB A;  1VQM 3;  5G1K A;  5AYS C;  1GSP A;  2C10 A;  3BNB A;  5IF6 A;  1KQS 2;  4R80 A;  3CME 3;  1KD1 4;  1N5P A;  4BU4 A;  2GBX B;  1YIJ 3;  1RN7 A;  2BU4 A;  3K9M C;  4GHO A;  4MJD A;  1YJ9 3;  3AGO A;  3HK4 A;  3NXJ A;  3D5I A;  1TU5 A;  3K7C A;  3OX9 A;  1N5H A;  4XBT A;  1IT7 A;  1OGZ A;  4MEI A;  3F9S A;  4MMY B;  1STD A;  1W4N A;  1ZO2 A;  7GSP A;  1YJW 3;  4PEJ A;  1GOY A;  2ZL8 A;  1IT8 A;  5IEP A;  1K8A 4;  1LXE A;  3MYT A;  3D5G A;  3AHS A;  1FGM A;  1GYB A;  1Q7Y 4;  4BTX A;  4HBR A;  5BIR A;  2C11 A;  5FW5 A;  1MWS A;  1RGK A;  4L7K A;  1BGS A;  3LT8 A;  4AKZ A;  1RGL A;  6GSP A;  2OOV C;  4K90 B;  3FG1 A;  1BAN A;  2W56 B;  4HZB B;  3DUK A;  3WA3 A;  5EQL A;  3CNX A;  3AMO A;  1FZU A;  1IV7 A;  3N54 B;  1Q9E A;  3X3Y A;  3KFQ C;  1VQ9 3;  4ILF A;  3RDE A;  1RCL A;  5D83 A;  3PCR A;  4Q53 A;  3HOH A;  1B3S A;  2CWT A;  4WWU C;  1L5G B;  2HMJ B;  4EXR A;  1W6G A;  4LEH A;  3GRD A;  4HM8 B;  4HAA A;  3DXO A;  3X3Z A;  4CCV A;  2W9Q A;  3O8Y A;  1F8N A;  2IYJ A;  3X40 A;  5I97 A;  1M90 4;  3SXX A;  1I8V A;  3BND A;  2RSX A;  1LRA A;  2CFK A;  5AI1 A;  1ISK A;  3LTB A;  2STD A;  3I55 3;  2BHM A;  3PXM A;  2IUJ A;  2OQE A;  2XEP A;  1NNV A;  1FUW A;  5BXQ A;  4CJN A;  3FSD A;  1LOX A;  3CCS 3;  1DMM A;  2W9P A;  1X1Y A;  1IQY A;  2I9W A;  2XGL A;  3NM7 A;  3V98 A;  3CC4 3;  1TFO A;  1NJI 4;  1M1K 4;  3G4S 3;  3S29 A;  1OCV A;  1V74 A;  3D3L A;  3IPT A;  1Q40 B;  2HMO B;  1AVL A;  3D9R A;  3URP A;  5BVB A;  1BNF A;  4U13 A;  3WR2 A;  4R9L A;  2AAD A;  3DGL A;  1JV2 B;  4L8P A;  3NBB A;  1GY5 A;  1RGA A;  3AGN A;  5IG3 A;  2AAE A;  2YFI B;  1BNJ A;  2UX0 A;  3HII A;  3KSP A;  5EVH A;  2KF4 A;  3EBY A;  2IA7 A;  1JBT A;  1VQN 3;  2LYX A;  1SII A;  2XGN A;  1BU4 A;  3CCQ 3;  3HI7 A;  3G6E 3;  1BIR A;  1O7H B;  2CH9 A;  4XDW A;  1SIH A;  1N9J A;  4KFE A;  5KP1 A;  4K61 A;  1TRQ A;  2Z77 A;  2HMK B;  1BOX A;  1W02 A;  1JRQ A;  3CC2 3;  3NX0 A;  1BSE A;  5D81 A;  2BMO B;  3KSE D;  1BRH A;  5DRV A;  1GMP A;  1UGH I;  1QAK A;  2Z76 A;  3FKA A;  1RJO A;  4LMI A;  1AR0 A;  1GY7 A;  4ZM8 A;  3F14 A;  4K1U A;  2O3O A;  2ZA4 A;  3J7Y d;  3RGA A;  3B8L A;  1B2U A;  3M8C A;  3G0K A;  1NO3 A;  2PZV A;  3WA2 X;  3KKG A;  3NV0 B;  4FCJ A;  2HOH A;  2Y74 A;  4HM3 B;  1VQK 3;  1IV9 A;  1JZD A;  4XBX A;  3I56 3;  4OVM A;  2E2V A;  1JN5 B;  1UCJ A;  1DVC A;  2FGT A;  3T8U A;  5HOH A;  5LC7 A;  1AVK A;  1X1U A;  1T5Y A;  2F5M A;  2WOH A;  4EV5 A;  3B4P A;  3DMC A;  7STD A;  4XM4 A;  3NHX A;  3PS8 A;  1QMA A;  3SVA A;  1OF5 B;  4AKY A;  1G0T A;  1I3F A;  2CHC A;  2CFL A;  2F4Y A;  3K5T A;  4FCZ A;  4IIA A;  4IPB A;  5AYR B;  3ZG5 A;  3CCJ 3;  4EBG A;  1D6Z A;  2CWV A;  1RKY A;  2KAA A;  4NRE A;  2XFT A;  1R4C A;  1E3V A;  4DKI A;  4HM0 B;  2UGI A;  1BSB A;  1UCL A;  5AII A;  5BU4 A;  1U8C B;  4WYK B;  1Q81 4;  1VZZ A;  2O9U X;  4HM5 B;  3VGN A;  3DY5 A;  1YNV X;  2J8X B;  1BUJ A;  3MWZ A;  1TP6 A;  5CLK A;  3SLU A;  4I4K A;  1LOV A;  1I3I A;  3PCS A;  5M18 A;  1NWW A;  2CX1 A;  3EB8 A;  1UCI A;  1DE3 A;  3SYU A;  3JUO A;  2CFD A;  3K63 A;  4HJL B;  2JQ5 A;  1S72 3;  1FYS A;  3BNC A;  4HOH A;  3CMA 3;  1VQ6 3;  1W7C A;  4R4K A;  3DM8 A;  1VQ4 3;  3CU3 A;  1YHQ 3;  3CPO A;  1QAF A;  1O7G B;  2F98 A;  2WOF A;  2CG0 A;  4NPB A;  2MC8 A;  3EN1 B;  5GSP A;  1KSI A;  1JB4 A;  4H61 A;  1M1X B;  2RGQ A;  3F7S A;  1UUG B;  3GSP A;  3OWU A;  3B4O A;  4RNZ A;  3S67 A;  1JKG B;  2IY2 A;  2CX0 A;  4R9K A;  2HMN B;  1C7H A;  4HYZ A;  4MMX B;  1Z1S A;  2KRT A;  3KN4 A;  1MWU A;  3S27 A;  3PYJ A;  4WFO A;  1YGW A;  1QVG 2;  1OH0 A;  3CCM 3;  1MGW A;  1A90 A;  2H0I A;  4XBY A;  2W56 A;  4X2O A;  1G02 A;  2XSO B;  6RNT A;  1K41 A;  1I70 A;  1JB5 A;  3WOF B;  2F5W A;  3D79 A;  1BUQ A;  4OK0 A;  1C54 A;  2OTL 3;  1LOY A;  3U97 A;  4BIR A;  1BSA A;  1GD4 A;  1RRH A;  4EV2 A;  2Q07 A;  4RNT A;  1S5A A;  1QVF 2;  1KWI A;  3VSY A;  2QA4 3;  5IG4 A;  1LVN A;  1SPU A;  1ZGX A;  3A76 A;  5JPP A;  3OWY A;  4CPK A;  3T8N A;  1RGE A;  3UB1 A;  3L0R A;  3D4A A;  4N6N B;  1W00 A;  2P09 A;  3WOE B;  4HM2 B;  1T2H A;  3EN8 A;  3G8Z A;  3SOA A;  1O7M B;  1FW7 A;  2H0G A;  4J5K A;  1ASK A;  3FCS B;  3Q2P A;  1BNI A;  4N3V A;  1W2B 2;  1RCK A;  1FGT A;  2IMJ A;  4STD A;  2CIU A;  1YGE A;  3F8H A;  1IQ8 A;  4EC6 A;  1HKX A;  1BRN L;  4KFD A;  3FG3 A;  1E3R A;  2XF3 A;  1ROV A;  2FXT A;  3GZR A;  3JUP A;  6STD A;  3CXC 2;  1JBR A;  1FGO A;  4KZ1 A;  3ER7 A;  1DVD A;  2BMR B;  1MGR A;  1R4Y A;  1AQZ A;  3NQZ A;  1MWT A;  1DET A;  3LXU X;  1VQ7 3;  3WHO A;  2CK3 H;  3GWR A;  4HVN A;  4LSO A;  4N6U A;  4KFF A;  4XDV A;  5AIH A;  1HYF A;  1Q40 A;  1NU3 A;  5RNT A;  2CFG A;  5TGN A;  3LTD A;  1B2S A;  5IG0 A;  2BO9 B;  1W6Y A;  2W2C A;  3KZT A;  4O2H A;  3EQQ B;  3LML A;  4WP5 A;  2Z6B A;  5FGO A;  3UNL A;  3DGM A;  1W01 A;  3DZL A;  1B2M A;  1RRL A;  2ML5 A;  1ULI B;  1BNS A;  1VQQ A;  3WMD A;  4RZM A;  3CCL 3;  1A2V A;  2P05 A;  3DGN A;  1EA2 A;  3EF8 A;  3IMA B;  3SX1 A;  5CF2 A;  3EE1 A;  3CCU 3;  2OCT A;  1HU9 A;  9RNT A;  1O7N B;  1V58 A;  3GZX B;  2GSP A;  2HMM B;  1I2E A;  1TTO A;  1BRK A;  1RGF A;  2INX A;  1IQX A;  2W0Q A;  3NUV A;  1GMQ A;  4N6V 0;  1LNH A;  2RBI A;  3FF2 A;  2BNG A;  5M19 A;  1UUW B;  5AEU B;  2W6J H;  1RLS A;  1FGR A;  3N9H A;  4RBN A;  1CYU A;  3LH4 A;  1RHL A;  1TJD A;  2UUG C;  4L8O A;  4MMZ B;  5A0O B;  5IG5 A;  1WQL B;  1EUI C;  3CNM A;  3MSO A;  2D1W A;  2KXG A;  1B20 A;  4CDL A;  3U1W A;  1N8R 4;  3NM2 A;  1V57 A;  5HGR A;  2QIY A;  4RNY A;  5IER A;  3EC9 A;  3LT9 A;  4GL6 A;  2LQV A;  3NV0 A;  3PZW A;  3LTA A;  5KP3 A;  1UW1 A;  2B1X B;  1IDP A;  1PYL A;  3S5C A;  2YFL B;  1JB2 A;  1E97 A;  2E2T A;  2F56 A;  1U5O A;  4GB5 A;  3CD6 3;  3GZB A;  3JUQ A;  1UGI A;  1RGC A;  1A67 A;  1JN5 A;  1PFP A;  1JJ2 2;  1RTU A;  1WNH A;  2XRX B;  3UJM A;  2A15 A;  3WDG B;  1RN1 A;  1GOU A;  4LGQ A;  5M1A A;  1D6Y A;  1EKM A;  1OF5 A;  2D42 A;  4BL2 A;  1W2Z A;  7RNT A;  1W6C A;  1RGH A;  4EYC A;  5D82 A;  1TRP A;  3ZFZ A;  3H51 A;  1JZO A;  2K54 A;  1STF I;  4HZ9 B;  1J2B A;  3OXA A;  1IYY A;  3OWS A;  1YJN 3;  1VQL 3;  3Q3F A;  2P0X A;  3SED A;  1UCK A;  5CK6 A;  4WYK A;  1YIT 3;  1OAC A;  1OUN A;  4R1K A;  1RN4 A;  3GAX A;  1X1X A;  1LOW A;  2IUK A;  1LQG C;  2RCD A;  1CQS A;  3NQY A; 
#chains in the Genus database with same CATH homology
 1IVX A;  1G96 A;  3HZP A;  1NB3 I;  1ZX2 A;  2XR8 B;  1AV4 A;  1QJG A;  4AEQ A;  3T0U A;  4ORL A;  2GEX A;  2KCD A;  3G16 A;  3UL5 A;  3OV4 A;  3FZW A;  2WGO A;  1Y4K A;  2B24 B;  1TUH A;  3X3X A;  1NB5 I;  3NBJ A;  2Z7A A;  1K28 A;  2OQE C;  5IEN A;  3QK9 A;  1OGX A;  3X41 A;  3F40 A;  3UL6 A;  2L4V A;  3FH1 A;  1VQ8 3;  1FA3 A;  1JKG A;  5JPU A;  1VQ5 3;  2CW9 A;  5JBS A;  1NDO B;  3CCE 3;  1PU4 A;  3FG4 A;  1UUV B;  4JF8 A;  1GY6 A;  2CG1 A;  4FMD A;  5AEW B;  4HM7 B;  4IT7 A;  3LZA A;  1DMQ A;  3MPH A;  1OHO A;  4N6M A;  1M9G A;  1ROA A;  3STD A;  4NHF A;  5CXO A;  2SBL A;  1Q42 A;  5KP4 A;  1IU7 A;  3MHE A;  2P0M A;  3QRD A;  1WMP A;  1UI7 A;  3AMO B;  1EG9 B;  2K0M A;  4O02 B;  1YI2 3;  1Q82 4;  1N9E A;  1TFK A;  3FGY A;  5AIG A;  3CCR 3;  1JNQ A;  3PGB A;  3MG1 A;  3Q90 A;  3V99 A;  2F86 B;  2CWU A;  1O7W B;  2ML6 A;  3F7X A;  4FMB A;  1IVU A;  2WGQ A;  3X42 A;  2PNC A;  2ZDJ A;  4O8S A;  4O3V A;  1FGQ A;  1K9M 4;  2XFS A;  1MOL A;  3EJV A;  5ELU A;  2QEX 3;  3IJE B;  4H3U A;  2FNQ A;  2GEY A;  3JUM A;  3KII A;  4J8T A;  4WHA A;  2CC3 A;  1QAL A;  2XSH B;  5CF1 A;  3RGR A;  3G71 3;  2HML B;  3E99 A;  2OWP A;  4N6O B;  5STD A;  2Y73 A;  4JRF A;  1DYU A;  3I0Y A;  3EBT A;  4FMA A;  4LZI A;  1SJW A;  1OPY A;  3NBR A;  4K1V A;  2WO0 A;  3S28 A;  2GXF A;  3K0Z A;  2E2U A;  2M7O A;  3BNE A;  1WTH A;  2YX9 A;  1GD3 A;  3KE7 A;  3ECF A;  2CKF B;  3Q1C A;  2OOV A;  1WMO A;  2OTJ 3;  1GS3 A;  5IEO A;  2BT3 A;  3LYG A;  1VQO 3;  3OW2 2;  5IW9 A;  3JVC A;  2F99 A;  5EEO A;  3VF1 A;  1YVB I;  1SQW A;  3MKI A;  4QWT A;  3WOD G;  2CFW A;  2JDI H;  1D6U A;  4FMC A;  4HM4 B;  1W5Z A;  2QGU A;  2P38 A;  3LOY A;  3BB9 A;  2GU3 A;  2W04 A;  1N8Q A;  4KVH A;  8CHO A;  1A2K A;  3FLJ A;  4HKV B;  1CEW I;  1DMN A;  3V92 A;  1OHP A;  3JUN A;  1EQK A;  3HX8 A;  4BTW A;  4TX4 A;  2BMQ B;  2MF7 A;  3MG2 A;  5LC6 A;  1OHS A;  1UI8 A;  1K73 4;  3F8X A;  5G2G A;  3LTC A;  4N6T A;  1O7P B;  4N6L A;  4XB5 A;  1CYV A;  3EX9 A;  4X2H A;  1VQP 3;  4OUQ A;  4J9A A;  3DGO A;  2R4I A;  3CPW 2;  2GBW B;  3ALA A;  5DRE A;  3B7C A;  2W03 A;  4BTY A;  1IK3 A;  3FF0 A;  3SOY A;  3N8B A;  5AIF A;  2GU1 A;  4HM1 B;  1US1 A;  1ULJ B;  1IVV A;  3GZY B;  4HM6 B;  1WMN A;  3MG3 A;  3TDG A;  2V1L A;  4FCM A;  3BLZ A;  1IVW A;  2YFJ B;  3H3H A;  1Q86 4;  1TIJ A;  4FR9 A;  3CC7 3;  3HIG A;  1KC8 4;  3CCV 3;  2RFR A;  3EHC A;  4G1M B;  1MNL A;  2XH9 A;  3ROB A;  1VQM 3;  5IF6 A;  5AYS C;  1KQS 2;  2C10 A;  3BNB A;  4R80 A;  3CME 3;  1KD1 4;  1N5P A;  2GBX B;  1YIJ 3;  1RN7 A;  3K9M C;  4MJD A;  1YJ9 3;  3HK4 A;  3NXJ A;  1TU5 A;  3K7C A;  3OX9 A;  1N5H A;  4XBT A;  1IT7 A;  1OGZ A;  4MEI A;  3F9S A;  4MMY B;  1STD A;  1W4N A;  1ZO2 A;  1YJW 3;  4PEJ A;  2ZL8 A;  1IT8 A;  5IEP A;  1K8A 4;  1LXE A;  3MYT A;  1FGM A;  1GYB A;  1Q7Y 4;  4BTX A;  4HBR A;  2C11 A;  5FW5 A;  4L7K A;  4AKZ A;  3LT8 A;  2OOV C;  4K90 B;  3FG1 A;  2W56 B;  4HZB B;  3DUK A;  3WA3 A;  5EQL A;  3CNX A;  3AMO A;  3N54 B;  1IV7 A;  1VQ9 3;  3X3Y A;  3KFQ C;  3RDE A;  5D83 A;  3PCR A;  4Q53 A;  2CWT A;  4WWU C;  1L5G B;  2HMJ B;  4EXR A;  1W6G A;  4LEH A;  3GRD A;  4HM8 B;  3X3Z A;  3DXO A;  4CCV A;  2W9Q A;  3O8Y A;  1F8N A;  3X40 A;  5I97 A;  1M90 4;  3SXX A;  3BND A;  2RSX A;  2CFK A;  5AI1 A;  1ISK A;  3LTB A;  2STD A;  3I55 3;  2BHM A;  3PXM A;  2IUJ A;  2OQE A;  2XEP A;  1FUW A;  5BXQ A;  3FSD A;  1LOX A;  3CCS 3;  1DMM A;  2W9P A;  1IQY A;  2I9W A;  2XGL A;  3NM7 A;  3V98 A;  3CC4 3;  1TFO A;  1NJI 4;  1M1K 4;  3G4S 3;  3S29 A;  1OCV A;  1V74 A;  3D3L A;  3IPT A;  1Q40 B;  2HMO B;  1AVL A;  3D9R A;  5BVB A;  4U13 A;  4R9L A;  3DGL A;  1JV2 B;  4L8P A;  3NBB A;  1GY5 A;  5IG3 A;  5EVH A;  2YFI B;  2UX0 A;  3HII A;  3KSP A;  3EBY A;  2IA7 A;  1VQN 3;  2LYX A;  1SII A;  2XGN A;  3CCQ 3;  3HI7 A;  3G6E 3;  1O7H B;  2CH9 A;  4XDW A;  1SIH A;  1N9J A;  4KFE A;  5KP1 A;  4K61 A;  2Z77 A;  2HMK B;  1W02 A;  1JRQ A;  3CC2 3;  3NX0 A;  5D81 A;  2BMO B;  3KSE D;  5DRV A;  2Z76 A;  1QAK A;  3FKA A;  1RJO A;  4LMI A;  1AR0 A;  1GY7 A;  4ZM8 A;  3F14 A;  4K1U A;  2O3O A;  3J7Y d;  3RGA A;  3B8L A;  3M8C A;  3G0K A;  1NO3 A;  2PZV A;  3WA2 X;  3KKG A;  3NV0 B;  4FCJ A;  2Y74 A;  4HM3 B;  1VQK 3;  1IV9 A;  4XBX A;  3I56 3;  4OVM A;  2E2V A;  1JN5 B;  2FGT A;  1DVC A;  3T8U A;  5LC7 A;  1AVK A;  2WOH A;  1T5Y A;  4EV5 A;  3B4P A;  3DMC A;  7STD A;  4XM4 A;  3NHX A;  3PS8 A;  1QMA A;  3SVA A;  1OF5 B;  4AKY A;  2CHC A;  2CFL A;  3K5T A;  4FCZ A;  4IIA A;  4IPB A;  5AYR B;  3CCJ 3;  4EBG A;  1D6Z A;  2CWV A;  1RKY A;  4NRE A;  2XFT A;  1R4C A;  1E3V A;  4HM0 B;  1Q81 4;  5AII A;  1U8C B;  4WYK B;  1VZZ A;  2O9U X;  4HM5 B;  3VGN A;  3DY5 A;  3MWZ A;  1TP6 A;  5CLK A;  3SLU A;  4I4K A;  3PCS A;  1NWW A;  3EB8 A;  3JUO A;  2CFD A;  3K63 A;  4HJL B;  2JQ5 A;  1S72 3;  3BNC A;  3CMA 3;  1VQ6 3;  1W7C A;  4R4K A;  3DM8 A;  1VQ4 3;  3CU3 A;  1YHQ 3;  3CPO A;  1QAF A;  1O7G B;  2F98 A;  2WOF A;  2CG0 A;  2MC8 A;  3EN1 B;  1KSI A;  1JB4 A;  4H61 A;  1M1X B;  2RGQ A;  3F7S A;  3OWU A;  4RNZ A;  5ELJ A;  3B4O A;  3S67 A;  1JKG B;  4R9K A;  2HMN B;  1C7H A;  4HYZ A;  4MMX B;  1Z1S A;  2KRT A;  3KN4 A;  3S27 A;  3PYJ A;  4WFO A;  1QVG 2;  1OH0 A;  3CCM 3;  1A90 A;  4XBY A;  2W56 A;  4X2O A;  2XSO B;  1K41 A;  1JB5 A;  3WOF B;  1BUQ A;  4OK0 A;  2OTL 3;  3U97 A;  1GD4 A;  1RRH A;  4EV2 A;  2Q07 A;  1S5A A;  1QVF 2;  1KWI A;  3VSY A;  2QA4 3;  5IG4 A;  1LVN A;  1SPU A;  3A76 A;  5JPP A;  3OWY A;  3T8N A;  3UB1 A;  3L0R A;  4N6N B;  1W00 A;  2P09 A;  3WOE B;  4HM2 B;  3EN8 A;  3G8Z A;  3SOA A;  1O7M B;  4N3V A;  1ASK A;  3FCS B;  3Q2P A;  1W2B 2;  2IMJ A;  1FGT A;  4STD A;  2CIU A;  1YGE A;  3F8H A;  1IQ8 A;  4EC6 A;  1HKX A;  4KFD A;  3FG3 A;  1E3R A;  2XF3 A;  1ROV A;  2FXT A;  3GZR A;  3JUP A;  6STD A;  3CXC 2;  1FGO A;  4KZ1 A;  3ER7 A;  1DVD A;  2BMR B;  3NQZ A;  3LXU X;  1VQ7 3;  2CK3 H;  3GWR A;  4HVN A;  4LSO A;  4N6U A;  4KFF A;  4XDV A;  5AIH A;  1Q40 A;  1NU3 A;  2CFG A;  5TGN A;  3LTD A;  5IG0 A;  2BO9 B;  1W6Y A;  2W2C A;  3KZT A;  4O2H A;  3EQQ B;  3LML A;  4WP5 A;  2Z6B A;  5FGO A;  3UNL A;  3DGM A;  1W01 A;  3DZL A;  1RRL A;  2ML5 A;  1ULI B;  3WMD A;  4RZM A;  3CCL 3;  1A2V A;  2P05 A;  3DGN A;  1EA2 A;  3EF8 A;  3IMA B;  3SX1 A;  5CF2 A;  3EE1 A;  3CCU 3;  2OCT A;  1HU9 A;  1O7N B;  3GZX B;  2HMM B;  2INX A;  1IQX A;  2W0Q A;  3NUV A;  4N6V 0;  1LNH A;  3FF2 A;  2BNG A;  1UUW B;  5AEU B;  2W6J H;  1FGR A;  3N9H A;  4RBN A;  1CYU A;  3LH4 A;  4L8O A;  4MMZ B;  5A0O B;  5IG5 A;  1WQL B;  3CNM A;  3MSO A;  2D1W A;  2KXG A;  4CDL A;  3U1W A;  3NM2 A;  5HGR A;  2QIY A;  4RNY A;  5IER A;  3EC9 A;  3LT9 A;  4GL6 A;  2LQV A;  3NV0 A;  3PZW A;  3LTA A;  5KP3 A;  1UW1 A;  2B1X B;  1IDP A;  3S5C A;  2YFL B;  1JB2 A;  1E97 A;  2E2T A;  1U5O A;  4GB5 A;  3CD6 3;  3GZB A;  3JUQ A;  1A67 A;  1JN5 A;  1PFP A;  1JJ2 2;  1WNH A;  2XRX B;  3UJM A;  2A15 A;  3WDG B;  4LGQ A;  1D6Y A;  1EKM A;  1OF5 A;  2D42 A;  1W2Z A;  1W6C A;  4EYC A;  5D82 A;  3H51 A;  1J2B A;  2K54 A;  1STF I;  4HZ9 B;  3OXA A;  3OWS A;  1YJN 3;  1VQL 3;  2P0X A;  3SED A;  5CK6 A;  4WYK A;  1YIT 3;  1OAC A;  1OUN A;  4R1K A;  3GAX A;  1N8R 4;  2IUK A;  2RCD A;  1CQS A;  3NQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...