2QEX3

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qex300
3G4S3 1VQ53 3CCU3 3G6E3 3CME3 1N8R4 1VQ73 1YJ93 1VQ63 1VQO3 1YJW3 3CMA3 1VQK3 1QVG2 1KD14 1M1K4 2OTL3 3CCR3 1K734 1VQM3 1QVF2 2OTJ3 1VQ83 3CC23 3CCL3 3G713 3CPW2 3CCQ3 1YHQ3 3CC73 1M904 1KQS2 1VQL3 1JJ22 3CCE3 1YI23 3CCV3 3CCM3 3CCJ3 1VQN3 1Q7Y4 1YIT3 1VQ93 3CXC2 3CC43 3CCS3 1VQP3 2QEX3 1S723 3CD63 2QA43 3OW22 1Q814 1Q864 1W2B2 1Q824 1K9M4 1YJN3 3I563 1YIJ3 1NJI4 1K8A4 1KC84 3I553 1VQ43
chains in the Genus database with same CATH superfamily
3AGNA 3FSDA 1A90A 4KFDA 2WGQA 4NHFA 1Q7HA 1JZOA 3EE1A 1UCLA 1SPUA 4N6UA 4RNZA 1RKYA 3DGYA 1OHSA 4NPBA 1S5AA 4DKIA 6RNTA 1TIJA 4HJLB 3OXAA 3HK4A 4N6MA 3B7CA 1A2VA 1DE3A 1DMMA 3OWSA 1BANA 3CCM3 2F56A 3KSED 3SLUA 2XF3A 3PS8A 1BNRA 3A5EA 1YIT3 3KKGA 4Q53A 1W4NA 3ER7A 1N5PA 3JUMA 1Q824 4LMIA 4EV2A 3D3LA 2Q07A 1TRPA 1YIJ3 5G2GA 1KC84 3AHWA 3LTAA 4KT3B 1W6CA 1W6GA 2CFWA 1QMAA 1I2FA 2CG1A 1BRHA 2IUKA 5IG5A 2KF3A 2W56A 4LEHA 2BT3A 1OH0A 1LNIA 1BRJA 2R41A 3CCR3 1O7WB 1YNVX 1BOXA 2GU1A 2W6JH 2W04A 3F40A 4FCZA 1DMNA 3S67A 1YHQ3 1D6ZA 1KQS2 1JNQA 3M8CA 4MMZB 4KFFA 2J8XB 3FH1A 3F7XA 1W7CA 1NO3A 1YGEA 2AADA 2KXGA 3OWYA 1RRLA 4IIAA 1UW1A 3LTCA 3SOYA 1CQSA 2QGUA 2HMLB 2R4IA 1FGQA 3E99A 5G1KA 1IT7A 1JV2B 1RGAA 1X1XA 3DH2A 4BL2A 4U13A 3JUQA 2XSHB 1K8A4 1FYSA 1FGOA 1ZGXA 1G0TA 3WA3A 3NQYA 1U8CB 1CH0A 1B2ZA 4BTYA 1PY3A 7STDA 1GD4A 1QALA 5CF2A 3FG4A 5DRVA 1ASKA 2CC3A 4WYKB 3GZYB 5ELUA 4HM8B 4N3VA 1IU7A 1N5HA 2RFRA 5EVHA 2FNQA 3IJEB 1DYUA 2BMOB 3AMOA 3OV4A 3CPW2 1RNTA 4ORLA 2P0XA 2XH9A 2D1WA 1VQL3 2WGOA 1NB3I 1YI23 1PFPA 3H3HA 3HIIA 1RGFA 3CCJ3 3URPA 4RNTA 1BSDA 2CFDA 5ELJA 4HVNA 3CC43 1ZX2A 9RNTA 1CYUA 5D82A 5DREA 4CJNA 5HOHA 1M1XB 3LH4A 3MWZA 2JDIH 3WDGB 3CD63 1NWWA 3DZLA 3G8ZA 3K9MC 2RGQA 1V58A 4FMDA 1FA3A 3VF1A 2C4BA 2C10A 1BNSA 2CH9A 3FLJA 3HX8A 4LYLB 1MWSA 4FMCA 4OUQA 3VGNA 3BNEA 2H0IA 3WR2A 3GZRA 3CPOA 3DGOA 4O8SA 1YJ93 7GSPA 1RGEA 1GY6A 1YJW3 3LXUX 1GMPA 1BRNL 1O7NB 1WQLB 1B27A 3NQZA 1JBSA 1RGCA 2OQEC 3EN1B 3S29A 4CPKA 2CFGA 1RGHA 4RZMA 1LVNA 4HM4B 4EYCA 4EXRA 3PCRA 1JKGB 1OF5B 3BU4A 3CCE3 1K28A 4XDVA 2GEYA 1W5ZA 4KVHA 4JRFA 4H61A 1UI8A 4FCMA 4BTWA 2CIUA 1RN7A 4WP5A 2D42A 5FGOA 1GY5A 1GS3A 1US1A 1UGIA 3NBRA 1C7HA 3I0YA 4I5QA 3RGAA 2WO0A 1UUGB 2BMQB 2YFJB 4HM2B 1LQGC 2M7OA 2Z76A 3ZFZA 1VQ43 4ZM8A 3MG2A 5AIHA 1VQQA 3DM8A 3WOFB 3H51A 1FUSA 3NHXA 3Q1CA 1X1UA 1BUQA 2K54A 3BIRA 2BO9B 1G02A 3NM2A 2SBLA 4WFOA 3X42A 3BNDA 2ZDJA 1RDSA 3RGRA 3F8XA 1A67A 2CX0A 2F98A 1YVBI 1T2HA 5AEUB 2XGLA 1NB5I 1MWRA 2KRTA 1NDOB 3SOAA 1V57A 2H0HA 5IG3A 2PNCA 3UJMA 4FMBA 1STDA 4HM5B 1JN5B 1WMPA 4LZIA 5CK6A 2W2CA 2Y73A 3FCSB 3DGLA 2MC8A 5KP1A 1IYYA 1OACA 1STFI 3ALAA 1TFKA 4O3VA 3KCHA 4RNYA 1FZUA 4GL6A 4AKYA 4XBTA 3S27A 1AR0A 1VQO3 5I97A 3S28A 2CKFB 2QIYA 2IY2A 1B3SA 5GSPA 2BIRA 4STDA 1LNHA 1MWTA 1OHPA 1EKMA 3CCL3 5STDA 2B1XB 1NU3A 4HAAA 3PXMA 3TDGA 4HM0B 1TUHA 3WHOA 4XM4A 6STDA 2Z7AA 1SARA 2C11A 3OX9A 2ZA4A 3GWRA 1VQ93 3CCS3 1FUTA 6GSPA 3WOEB 1RMSA 5HGRA 1UCIA 4N6TA 3ZG5A 1N9JA 3X3ZA 3D5IA 1UUVB 4IT7A 4MMXB 1BU4A 2Z6BA 3B4OA 4TX4A 5JPPA 2XSOB 1OHOA 3F8HA 2LQVA 2IMJA 2BHMA 1L5GB 2HMKB 1BRKA 3WODG 1IT8A 1MGWA 3Q90A 3AMOB 1IVXA 3LTDA 4HKVB 2RBIA 1JBTA 2IA7A 1K41A 5CXOA 1GD3A 1IVWA 1FGTA 3EX9A 3HIGA 4LSOA 3LMLA 1JBRA 3JUNA 1VQ83 2CX1A 1N8QA 1BSEA 2W9QA 4J8TA 1YGWA 5IERA 5A0OB 1VQN3 1Q7Y4 2K0MA 3SVAA 2YFIB 1WNHA 4GSPA 3WMDA 3T8UA 2FGTA 4O02B 5CF1A 1QJGA 4EW5A 5AYSC 1NNVA 3EBYA 1M9GA 2GBWB 2ML6A 1DMQA 1JB5A 3N9HA 1I3FA 1T5YA 3L0RA 2AAEA 1B2SA 3F9SA 1WMOA 4EBGA 4MMYB 5LC6A 2UX0A 3X3YA 8RNTA 3CME3 3IMAB 3RDEA 3U97A 3ZG0A 3B4PA 2GEXA 3WA2X 1VQK3 1CEWI 2KCDA 4KZ1A 2FXTA 2H0GA 3JUOA 1IQ8A 3LYGA 4K90B 3SYUA 1QVF2 2OTJ3 4O2HA 4FCJA 1I3IA 2CG0A 4WHAA 5IW9A 1AY7A 1GMQA 1UCJA 3SXXA 2W03A 1JRQA 3ROBA 1OCVA 3MG3A 4HM3B 3MYTA 4L7KA 3LT9A 2IUJA 1BSCA 1W2B2 1BIRA 2OWPA 2GBXB 2OOVC 1AVLA 1RGLA 3EF8A 2GSPA 1TJDA 3K5TA 1HZ1A 4HM6B 4R80A 1RJOA 3BNCA 2KF6A 1X1YA 1X1WA 5D83A 1C54A 3BNBA 4X2OA 2E2TA 2KF4A 3T0UA 4BTXA 1FUWA 1Y4KA 1V74A 3V99A 5M18A 1BGSA 3X40A 3UNLA 1IDPA 3UL5A 1FW7A 2CFKA 3O8YA 5IF6A 4WWUC 1K734 2A15A 4H3UA 1IQXA 1I0VA 1I70A 1SIHA 3GRDA 1B2XA 3LTBA 1Q9EA 1M904 3CCV3 1EEJA 1AQZA 1I8VA 4G1MB 1E3RA 3T8NA 1S723 2W0QA 1UUWB 3MPHA 1F8NA 4HZBB 5BIRA 8CHOA 3DUKA 1N9EA 1ROVA 3HOHA 1NJI4 4XBYA 1JB2A 2P05A 1GOUA 1BNGA 1WTHA 3EJVA 5FW5A 3G4S3 1VZZA 5AYRB 1WMNA 4XB5A 4J9AA 1VQ73 2XGNA 2KAAA 2P0MA 1RGGA 1W2ZA 1B20A 5M1AA 1Z1SA 1KD14 4K1UA 3PGBA 3CMA3 1LOXA 2BU4A 3X3XA 5JPUA 4K61A 4AKZA 3N8BA 1B2UA 4LGQA 2LYXA 1E3VA 1UCKA 2F99A 1OPYA 1T2IA 3JUPA 1DVCA 1HYFA 2HMJB 3CU3A 3SX1A 1BRIA 2WOFA 4JF8A 2F5MA 2O9UX 3DGMA 5BU4A 3EN8A 1YVSA 4L8PA 1UDII 1BRGA 5IENA 3I563 4QWTA 5KP3A 2YX9A 4HM7B 3FZWA 4J5KA 2WOHA 4R1KA 3N54B 3BB9A 1BRSA 2BMRB 3KSPA 3CCU3 1VQ53 1RGKA 1Q40B 2P38A 2RNTA 1RN1A 5IG0A 3NV0B 1RNBA 1KWIA 1PYLA 3LOYA 5IEPA 4R4KA 3K0ZA 3K7CA 3NUVA 5IEOA 3DGNA 4HZ9B 1AVKA 3DXOA 1SQWA 4HYZA 1JB4A 1BNIA 4WYKA 3NV0A 3LT8A 3V92A 1Q814 4N6NB 2HOHA 1B2MA 3CNMA 1K9M4 3G0KA 2CWUA 3HZPA 4AEQA 1LQMB 2CK3H 4BIRA 1YJN3 2INXA 3B8LA 2ZHXB 1MOLA 4FR9A 1MNLA 3I553 4R9KA 4N6LA 3IPTA 1IVUA 2GXFA 4GHOA 5LC7A 2V1LA 3G6E3 2I9WA 1N8R4 1TTOA 5BVBA 4HOHA 4EV5A 1QVG2 2OTL3 4ILFA 3KIIA 1RCKA 1W6YA 1MWUA 1R4CA 1RN4A 5BXQA 1DETA 3F14A 4RBNA 3PYJA 2L1SA 1JJ22 1OUNA 2IYJA 1IK3A 2Z77A 4BU4A 2OQEA 4CDLA 1O7MB 3CXC2 3A76A 4I4KA 2CFLA 3KE7A 1JN5A 2STDA 1EA2A 4BL3A 1D6YA 1LOWA 1SIIA 3PCSA 1KSIA 1GOYA 2ML5A 5D81A 1TP6A 1BVIA 1FGMA 3OWUA 4MEIA 1GSPA 1IV7A 3EB8A 1AV4A 3EHCA 2OCTA 3PZWA 1BSBA 1QAKA 1ULIB 3LZAA 3FF2A 3NBJA 4GB5A 3D5GA 3NM7A 4CCVA 1J2BA 3Q2PA 1BNJA 3HI7A 3EQQB 2CWTA 3MKIA 5M19A 2K3DA 4R9LA 1U5OA 3G16A 1EUIC 1RSNA 1ULJB 1W00A 2GU3A 2UGIA 1GOVA 1ROAA 1VQP3 1HKXA 5RNTA 2QA43 2UUGC 4N6OB 2KF5A 1I0XA 2MF7A 1BSAA 1TU5A 2BNGA 1LRAA 1O7GB 3AHSA 2CHCA 3FKAA 4HBRA 5EEOA 1G96A 1JKGA 1OF5A 1PU4A 2HMOB 2XFSA 3GAXA 2E2UA 3D4AA 3ECFA 1VQ63 2RSXA 3EBTA 2P09A 3FGYA 4PEJA 1RLSA 2PZVA 2ZL8A 1B21A 3JVCA 3MG1A 3MHEA 4FMAA 4X2HA 1IV9A 4XDWA 3SEDA 3UB1A 1O7HB 1VQM3 2RCDA 5CLKA 3GSPA 2Y74A 3D79A 3J7Yd 1BAOA 1LOVA 3NXJA 2CWVA 4XBXA 3QK9A 5EQLA 1RRHA 3EC9A 5G1LA 3DY5A 2QEX3 1W01A 3UL6A 1FGRA 4HM1B 2F4YA 5AIIA 3GZXB 1D6UA 3FG1A 3BLZA 1GYBA 2O3OA 5TGNA 1OGXA 5JBSA 3V98A 3FG3A 2YFLB 3Q3FA 1CYVA 1A2PA 2JQ5A 3VSYA 3QRDA 2XEPA 3RNTA 2SARA 3U1WA 4N6V0 1Q40A 2XRXB 1TFOA 4MJDA 1BNFA 1EQKA 1BNEA 2XR8B 3K63A 3FF0A 5KP4A 4IPBA 2B24B 3X41A 3OW22 1Q864 2W9PA 2XFTA 3KN4A 3S5CA 1JZDA 1RTUA 3CNXA 1DVDA 1IVVA 1BUJA 2HMNB 4EC6A 1MGRA 3AGOA 3KZTA 3NBBA 1UGHI 1Q42A 1GMRA 4J5GA 1ISKA 5AIFA 1I2GA 2F86B 2F5WA 2W56B 5AI1A 3NX0A 3CC23 1R4YA 1HU9A 3MSOA 4L8OA 5AIGA 1EG9B 3G713 3D9RA 1RHLA 2HMMB 3DMCA 4NREA 3CC73 3CCQ3 4OK0A 2L4VA 2CW9A 1LXEA 3F7SA 7RNTA 1UI7A 1IQYA 1OGZA 4OVMA 5AEWB 1A2KA 1T3BA 3GZBA 3STDA 1SJWA 1I2EA 1RCLA 1O7PB 1W02A 4K1VA 1ZO2A 1GY7A 1TRQA 1E97A 2E2VA 4KFEA 1QAFA 1ZS7A 1M1K4 3KFQC 5IG4A 1LOYA 2OOVA
chains in the Genus database with same CATH topology
3FSDA 1A90A 4KFDA 2WGQA 4NHFA 4RNZA 3EE1A 1SPUA 4N6UA 1RKYA 1OHSA 1S5AA 1TIJA 4HJLB 3OXAA 3HK4A 4N6MA 3B7CA 1A2VA 1DMMA 3OWSA 3CCM3 3KSED 3SLUA 2XF3A 3PS8A 1YIT3 3KKGA 4Q53A 1W4NA 3ER7A 1N5PA 3JUMA 1Q824 4LMIA 4EV2A 3D3LA 2Q07A 1YIJ3 5G2GA 1KC84 3LTAA 1W6CA 1W6GA 2CFWA 1QMAA 2CG1A 2IUKA 5IG5A 2W56A 4LEHA 2BT3A 1OH0A 3CCR3 1O7WB 2GU1A 2W6JH 3F40A 2W04A 4FCZA 1DMNA 3S67A 1YHQ3 1D6ZA 1KQS2 1JNQA 3M8CA 4MMZB 4KFFA 3FH1A 3F7XA 1W7CA 1NO3A 1YGEA 2KXGA 3OWYA 4IIAA 1RRLA 1UW1A 3LTCA 3SOYA 1CQSA 2QGUA 2HMLB 2R4IA 1FGQA 3E99A 1IT7A 1JV2B 4U13A 3JUQA 2XSHB 1K8A4 1FGOA 3WA3A 3NQYA 1U8CB 4BTYA 7STDA 1GD4A 1QALA 5CF2A 3FG4A 5DRVA 1ASKA 2CC3A 4WYKB 3GZYB 5ELUA 4HM8B 4N3VA 1IU7A 1N5HA 2RFRA 5EVHA 2FNQA 3IJEB 1DYUA 2BMOB 3AMOA 3OV4A 3CPW2 4ORLA 2P0XA 2XH9A 2D1WA 1VQL3 2WGOA 1NB3I 1YI23 1PFPA 3H3HA 3HIIA 3CCJ3 5ELJA 2CFDA 4HVNA 3CC43 1ZX2A 1CYUA 5D82A 5DREA 3CD63 1M1XB 3LH4A 3MWZA 2JDIH 3WDGB 1NWWA 3DZLA 3G8ZA 3K9MC 2RGQA 4FMDA 1FA3A 3VF1A 2C10A 2CH9A 3FLJA 3HX8A 3VGNA 4FMCA 4OUQA 3BNEA 3GZRA 3CPOA 3DGOA 4O8SA 1YJ93 1YJW3 1GY6A 3LXUX 1O7NB 1WQLB 3NQZA 3S29A 2OQEC 3EN1B 2CFGA 4RZMA 4EXRA 1LVNA 4HM4B 4EYCA 3CCE3 3PCRA 1JKGB 1OF5B 1K28A 4XDVA 2GEYA 1W5ZA 4KVHA 4JRFA 4H61A 1UI8A 4FCMA 4BTWA 1RN7A 2CIUA 4WP5A 2D42A 5FGOA 1GY5A 1GS3A 1US1A 3NBRA 1C7HA 3I0YA 3RGAA 2WO0A 2YFJB 2BMQB 4HM2B 2Z76A 2M7OA 1VQ43 4ZM8A 3MG2A 5AIHA 3DM8A 3WOFB 3H51A 3NHXA 3Q1CA 1BUQA 2K54A 2BO9B 3NM2A 2SBLA 4WFOA 3X42A 3BNDA 2ZDJA 3RGRA 3F8XA 1A67A 2F98A 1YVBI 5AEUB 2XGLA 1NB5I 2KRTA 1NDOB 3SOAA 5IG3A 2PNCA 3UJMA 4FMBA 1STDA 4HM5B 1JN5B 1WMPA 4LZIA 5CK6A 2W2CA 2Y73A 3FCSB 3DGLA 2MC8A 5KP1A 1OACA 1STFI 3ALAA 1TFKA 4O3VA 4RNYA 4GL6A 4AKYA 4XBTA 3S27A 1AR0A 1VQO3 5I97A 3S28A 2CKFB 2QIYA 4STDA 1LNHA 1OHPA 1EKMA 3CCL3 5STDA 2B1XB 1NU3A 3PXMA 3TDGA 4HM0B 1TUHA 4XM4A 6STDA 2Z7AA 2C11A 3OX9A 3GWRA 1VQ93 3CCS3 3WOEB 5HGRA 4N6TA 1N9JA 3X3ZA 4IT7A 1UUVB 4MMXB 3B4OA 2Z6BA 4TX4A 5JPPA 2XSOB 1OHOA 3F8HA 2LQVA 2IMJA 2BHMA 1L5GB 2HMKB 3WODG 1IT8A 3Q90A 3AMOB 1IVXA 3LTDA 4HKVB 2IA7A 1K41A 5CXOA 1GD3A 1IVWA 1FGTA 3EX9A 3HIGA 4LSOA 3LMLA 3JUNA 1VQ83 1N8QA 2W9QA 4J8TA 5IERA 5A0OB 1VQN3 1Q7Y4 2K0MA 3SVAA 2YFIB 1WNHA 3WMDA 3T8UA 2FGTA 4O02B 5CF1A 1QJGA 5AYSC 3EBYA 1M9GA 2GBWB 2ML6A 1DMQA 1JB5A 3N9HA 1T5YA 3L0RA 3F9SA 1WMOA 4EBGA 4MMYB 5LC6A 2UX0A 3X3YA 3CME3 3IMAB 3RDEA 3U97A 3B4PA 2GEXA 3WA2X 1VQK3 1CEWI 2KCDA 4KZ1A 2FXTA 3JUOA 3LYGA 1IQ8A 4K90B 1QVF2 2OTJ3 4O2HA 4FCJA 2CG0A 5IW9A 3SXXA 2W03A 1JRQA 3ROBA 1OCVA 3MG3A 4HM3B 3MYTA 4L7KA 3LT9A 2IUJA 1W2B2 2OWPA 2GBXB 2OOVC 1AVLA 3EF8A 3K5TA 4HM6B 4R80A 3BNCA 1RJOA 5D83A 3BNBA 4X2OA 2E2TA 3T0UA 4BTXA 1FUWA 1Y4KA 1V74A 3V99A 3X40A 3UNLA 1IDPA 3UL5A 2CFKA 3O8YA 5IF6A 4WWUC 1K734 2A15A 4H3UA 1IQXA 1SIHA 3GRDA 3LTBA 1M904 3CCV3 4G1MB 1E3RA 3T8NA 1S723 2W0QA 1UUWB 3MPHA 1F8NA 4HZBB 8CHOA 3DUKA 1N9EA 1ROVA 1NJI4 4XBYA 1JB2A 2P05A 1WTHA 3EJVA 5FW5A 3G4S3 1VZZA 5AYRB 1WMNA 4XB5A 4J9AA 1VQ73 2XGNA 2P0MA 1W2ZA 3CMA3 1Z1SA 1KD14 4K1UA 3PGBA 1LOXA 5JPUA 3X3XA 4K61A 4AKZA 3N8BA 4LGQA 2LYXA 1E3VA 2F99A 1OPYA 3JUPA 1DVCA 2HMJB 3CU3A 3SX1A 2WOFA 4JF8A 2O9UX 3DGMA 3EN8A 4L8PA 5IENA 3I563 4QWTA 5KP3A 2YX9A 4HM7B 3FZWA 2WOHA 4R1KA 3N54B 3BB9A 2BMRB 3KSPA 3CCU3 1VQ53 1Q40B 2P38A 5IG0A 3NV0B 1KWIA 3LOYA 5IEPA 4R4KA 3K0ZA 3K7CA 3NUVA 5IEOA 3DGNA 4HZ9B 1AVKA 3DXOA 1SQWA 4HYZA 1JB4A 4WYKA 3NV0A 3LT8A 3V92A 1Q814 4N6NB 3CNMA 1K9M4 3G0KA 2CWUA 3HZPA 4AEQA 2CK3H 1YJN3 2INXA 3B8LA 1MOLA 4FR9A 1MNLA 3I553 4R9KA 4N6LA 3IPTA 1IVUA 2GXFA 5LC7A 2V1LA 3G6E3 2I9WA 1N8R4 5BVBA 4EV5A 1QVG2 2OTL3 3KIIA 1W6YA 1R4CA 5BXQA 3F14A 4RBNA 3PYJA 1JJ22 1OUNA 1IK3A 2Z77A 2OQEA 4CDLA 1O7MB 3CXC2 4I4KA 2CFLA 3KE7A 1JN5A 2STDA 1EA2A 1D6YA 1SIIA 3PCSA 1KSIA 2ML5A 5D81A 1TP6A 1FGMA 3OWUA 4MEIA 1IV7A 3EB8A 1AV4A 3EHCA 2OCTA 3PZWA 1ULIB 1QAKA 3LZAA 3NBJA 3FF2A 4GB5A 4CCVA 3NM7A 1J2BA 3Q2PA 3HI7A 3EQQB 2CWTA 3MKIA 4R9LA 1U5OA 3G16A 1ULJB 1W00A 2GU3A 1ROAA 1VQP3 1HKXA 2QA43 4N6OB 2MF7A 1TU5A 2BNGA 1O7GB 2CHCA 3FKAA 4HBRA 5EEOA 1G96A 1JKGA 1OF5A 1PU4A 2HMOB 2XFSA 3GAXA 2E2UA 1VQ63 3ECFA 2RSXA 3EBTA 2P09A 3FGYA 4PEJA 2PZVA 2ZL8A 3JVCA 3MG1A 3MHEA 4FMAA 4X2HA 4XDWA 1IV9A 3SEDA 3UB1A 1VQM3 1O7HB 2RCDA 5CLKA 2Y74A 3J7Yd 3NXJA 2CWVA 4XBXA 3QK9A 5EQLA 1RRHA 3EC9A 3DY5A 2QEX3 1W01A 3UL6A 1FGRA 4HM1B 5AIIA 3GZXB 1D6UA 3FG1A 3BLZA 1GYBA 2O3OA 5TGNA 1OGXA 5JBSA 3V98A 3FG3A 2YFLB 1CYVA 2JQ5A 3VSYA 3QRDA 2XEPA 3U1WA 4N6V0 1Q40A 2XRXB 1TFOA 4MJDA 1EQKA 2XR8B 3K63A 3FF0A 5KP4A 4IPBA 2B24B 3X41A 3OW22 1Q864 2W9PA 2XFTA 3KN4A 3S5CA 3CNXA 1DVDA 1IVVA 2HMNB 4EC6A 3KZTA 3NBBA 1Q42A 1QAFA 1ISKA 5AIFA 2F86B 2W56B 5AI1A 3NX0A 3CC23 1HU9A 3MSOA 4L8OA 5AIGA 1EG9B 3G713 3D9RA 3DMCA 2HMMB 4NREA 3CC73 3CCQ3 4OK0A 2L4VA 2CW9A 1LXEA 3F7SA 1UI7A 1IQYA 1OGZA 4OVMA 5AEWB 1A2KA 3GZBA 3STDA 1SJWA 1O7PB 1W02A 4K1VA 1ZO2A 1GY7A 1E97A 2E2VA 4KFEA 3A76A 1M1K4 3KFQC 5IG4A 4WHAA 2OOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S 3;  1VQ5 3;  3CCU 3;  3G6E 3;  3CME 3;  1N8R 4;  1VQ7 3;  1YJ9 3;  1VQ6 3;  1VQO 3;  1YJW 3;  3CMA 3;  1VQK 3;  1QVG 2;  1KD1 4;  1M1K 4;  2OTL 3;  3CCR 3;  1K73 4;  1VQM 3;  1QVF 2;  2OTJ 3;  1VQ8 3;  3CC2 3;  3CCL 3;  3G71 3;  3CPW 2;  3CCQ 3;  1YHQ 3;  3CC7 3;  1M90 4;  1KQS 2;  1VQL 3;  1JJ2 2;  3CCE 3;  1YI2 3;  3CCV 3;  3CCM 3;  3CCJ 3;  1VQN 3;  1Q7Y 4;  1YIT 3;  1VQ9 3;  3CXC 2;  3CC4 3;  3CCS 3;  1VQP 3;  2QEX 3;  1S72 3;  3CD6 3;  2QA4 3;  3OW2 2;  1Q81 4;  1Q86 4;  1W2B 2;  1Q82 4;  1K9M 4;  1YJN 3;  3I56 3;  1YIJ 3;  1NJI 4;  1K8A 4;  1KC8 4;  3I55 3;  1VQ4 3; 
#chains in the Genus database with same CATH topology
 3AGN A;  3FSD A;  1A90 A;  4KFD A;  2WGQ A;  4NHF A;  1Q7H A;  1JZO A;  3EE1 A;  1UCL A;  1SPU A;  4N6U A;  4RNZ A;  1RKY A;  3DGY A;  1OHS A;  4NPB A;  1S5A A;  4DKI A;  6RNT A;  1TIJ A;  4HJL B;  3OXA A;  3HK4 A;  4N6M A;  3B7C A;  1A2V A;  1DE3 A;  1DMM A;  3OWS A;  1BAN A;  3CCM 3;  2F56 A;  3KSE D;  3SLU A;  2XF3 A;  3PS8 A;  1BNR A;  3A5E A;  1YIT 3;  3KKG A;  4Q53 A;  1W4N A;  3ER7 A;  1N5P A;  3JUM A;  1Q82 4;  4LMI A;  4EV2 A;  3D3L A;  2Q07 A;  1TRP A;  1YIJ 3;  5G2G A;  1KC8 4;  3AHW A;  3LTA A;  4KT3 B;  1W6C A;  1W6G A;  2CFW A;  1QMA A;  1I2F A;  2CG1 A;  1BRH A;  2IUK A;  5IG5 A;  2KF3 A;  2W56 A;  4LEH A;  2BT3 A;  1OH0 A;  1LNI A;  1BRJ A;  2R41 A;  3CCR 3;  1O7W B;  1YNV X;  1BOX A;  2GU1 A;  2W6J H;  2W04 A;  3F40 A;  4FCZ A;  1DMN A;  3S67 A;  1YHQ 3;  1D6Z A;  1KQS 2;  1JNQ A;  3M8C A;  4MMZ B;  4KFF A;  2J8X B;  3FH1 A;  3F7X A;  1W7C A;  1NO3 A;  1YGE A;  2AAD A;  2KXG A;  3OWY A;  1RRL A;  4IIA A;  1UW1 A;  3LTC A;  3SOY A;  1CQS A;  2QGU A;  2HML B;  2R4I A;  1FGQ A;  3E99 A;  5G1K A;  1IT7 A;  1JV2 B;  1RGA A;  1X1X A;  3DH2 A;  4BL2 A;  4U13 A;  3JUQ A;  2XSH B;  1K8A 4;  1FYS A;  1FGO A;  1ZGX A;  1G0T A;  3WA3 A;  3NQY A;  1U8C B;  1CH0 A;  1B2Z A;  4BTY A;  1PY3 A;  7STD A;  1GD4 A;  1QAL A;  5CF2 A;  3FG4 A;  5DRV A;  1ASK A;  2CC3 A;  4WYK B;  3GZY B;  5ELU A;  4HM8 B;  4N3V A;  1IU7 A;  1N5H A;  2RFR A;  5EVH A;  2FNQ A;  3IJE B;  1DYU A;  2BMO B;  3AMO A;  3OV4 A;  3CPW 2;  1RNT A;  4ORL A;  2P0X A;  2XH9 A;  2D1W A;  1VQL 3;  2WGO A;  1NB3 I;  1YI2 3;  1PFP A;  3H3H A;  3HII A;  1RGF A;  3CCJ 3;  3URP A;  4RNT A;  1BSD A;  2CFD A;  5ELJ A;  4HVN A;  3CC4 3;  1ZX2 A;  9RNT A;  1CYU A;  5D82 A;  5DRE A;  4CJN A;  5HOH A;  1M1X B;  3LH4 A;  3MWZ A;  2JDI H;  3WDG B;  3CD6 3;  1NWW A;  3DZL A;  3G8Z A;  3K9M C;  2RGQ A;  1V58 A;  4FMD A;  1FA3 A;  3VF1 A;  2C4B A;  2C10 A;  1BNS A;  2CH9 A;  3FLJ A;  3HX8 A;  4LYL B;  1MWS A;  4FMC A;  4OUQ A;  3VGN A;  3BNE A;  2H0I A;  3WR2 A;  3GZR A;  3CPO A;  3DGO A;  4O8S A;  1YJ9 3;  7GSP A;  1RGE A;  1GY6 A;  1YJW 3;  3LXU X;  1GMP A;  1BRN L;  1O7N B;  1WQL B;  1B27 A;  3NQZ A;  1JBS A;  1RGC A;  2OQE C;  3EN1 B;  3S29 A;  4CPK A;  2CFG A;  1RGH A;  4RZM A;  1LVN A;  4HM4 B;  4EYC A;  4EXR A;  3PCR A;  1JKG B;  1OF5 B;  3BU4 A;  3CCE 3;  1K28 A;  4XDV A;  2GEY A;  1W5Z A;  4KVH A;  4JRF A;  4H61 A;  1UI8 A;  4FCM A;  4BTW A;  2CIU A;  1RN7 A;  4WP5 A;  2D42 A;  5FGO A;  1GY5 A;  1GS3 A;  1US1 A;  1UGI A;  3NBR A;  1C7H A;  3I0Y A;  4I5Q A;  3RGA A;  2WO0 A;  1UUG B;  2BMQ B;  2YFJ B;  4HM2 B;  1LQG C;  2M7O A;  2Z76 A;  3ZFZ A;  1VQ4 3;  4ZM8 A;  3MG2 A;  5AIH A;  1VQQ A;  3DM8 A;  3WOF B;  3H51 A;  1FUS A;  3NHX A;  3Q1C A;  1X1U A;  1BUQ A;  2K54 A;  3BIR A;  2BO9 B;  1G02 A;  3NM2 A;  2SBL A;  4WFO A;  3X42 A;  3BND A;  2ZDJ A;  1RDS A;  3RGR A;  3F8X A;  1A67 A;  2CX0 A;  2F98 A;  1YVB I;  1T2H A;  5AEU B;  2XGL A;  1NB5 I;  1MWR A;  2KRT A;  1NDO B;  3SOA A;  1V57 A;  2H0H A;  5IG3 A;  2PNC A;  3UJM A;  4FMB A;  1STD A;  4HM5 B;  1JN5 B;  1WMP A;  4LZI A;  5CK6 A;  2W2C A;  2Y73 A;  3FCS B;  3DGL A;  2MC8 A;  5KP1 A;  1IYY A;  1OAC A;  1STF I;  3ALA A;  1TFK A;  4O3V A;  3KCH A;  4RNY A;  1FZU A;  4GL6 A;  4AKY A;  4XBT A;  3S27 A;  1AR0 A;  1VQO 3;  5I97 A;  3S28 A;  2CKF B;  2QIY A;  2IY2 A;  1B3S A;  5GSP A;  2BIR A;  4STD A;  1LNH A;  1MWT A;  1OHP A;  1EKM A;  3CCL 3;  5STD A;  2B1X B;  1NU3 A;  4HAA A;  3PXM A;  3TDG A;  4HM0 B;  1TUH A;  3WHO A;  4XM4 A;  6STD A;  2Z7A A;  1SAR A;  2C11 A;  3OX9 A;  2ZA4 A;  3GWR A;  1VQ9 3;  3CCS 3;  1FUT A;  6GSP A;  3WOE B;  1RMS A;  5HGR A;  1UCI A;  4N6T A;  3ZG5 A;  1N9J A;  3X3Z A;  3D5I A;  1UUV B;  4IT7 A;  4MMX B;  1BU4 A;  2Z6B A;  3B4O A;  4TX4 A;  5JPP A;  2XSO B;  1OHO A;  3F8H A;  2LQV A;  2IMJ A;  2BHM A;  1L5G B;  2HMK B;  1BRK A;  3WOD G;  1IT8 A;  1MGW A;  3Q90 A;  3AMO B;  1IVX A;  3LTD A;  4HKV B;  2RBI A;  1JBT A;  2IA7 A;  1K41 A;  5CXO A;  1GD3 A;  1IVW A;  1FGT A;  3EX9 A;  3HIG A;  4LSO A;  3LML A;  1JBR A;  3JUN A;  1VQ8 3;  2CX1 A;  1N8Q A;  1BSE A;  2W9Q A;  4J8T A;  1YGW A;  5IER A;  5A0O B;  1VQN 3;  1Q7Y 4;  2K0M A;  3SVA A;  2YFI B;  1WNH A;  4GSP A;  3WMD A;  3T8U A;  2FGT A;  4O02 B;  5CF1 A;  1QJG A;  4EW5 A;  5AYS C;  1NNV A;  3EBY A;  1M9G A;  2GBW B;  2ML6 A;  1DMQ A;  1JB5 A;  3N9H A;  1I3F A;  1T5Y A;  3L0R A;  2AAE A;  1B2S A;  3F9S A;  1WMO A;  4EBG A;  4MMY B;  5LC6 A;  2UX0 A;  3X3Y A;  8RNT A;  3CME 3;  3IMA B;  3RDE A;  3U97 A;  3ZG0 A;  3B4P A;  2GEX A;  3WA2 X;  1VQK 3;  1CEW I;  2KCD A;  4KZ1 A;  2FXT A;  2H0G A;  3JUO A;  1IQ8 A;  3LYG A;  4K90 B;  3SYU A;  1QVF 2;  2OTJ 3;  4O2H A;  4FCJ A;  1I3I A;  2CG0 A;  4WHA A;  5IW9 A;  1AY7 A;  1GMQ A;  1UCJ A;  3SXX A;  2W03 A;  1JRQ A;  3ROB A;  1OCV A;  3MG3 A;  4HM3 B;  3MYT A;  4L7K A;  3LT9 A;  2IUJ A;  1BSC A;  1W2B 2;  1BIR A;  2OWP A;  2GBX B;  2OOV C;  1AVL A;  1RGL A;  3EF8 A;  2GSP A;  1TJD A;  3K5T A;  1HZ1 A;  4HM6 B;  4R80 A;  1RJO A;  3BNC A;  2KF6 A;  1X1Y A;  1X1W A;  5D83 A;  1C54 A;  3BNB A;  4X2O A;  2E2T A;  2KF4 A;  3T0U A;  4BTX A;  1FUW A;  1Y4K A;  1V74 A;  3V99 A;  5M18 A;  1BGS A;  3X40 A;  3UNL A;  1IDP A;  3UL5 A;  1FW7 A;  2CFK A;  3O8Y A;  5IF6 A;  4WWU C;  1K73 4;  2A15 A;  4H3U A;  1IQX A;  1I0V A;  1I70 A;  1SIH A;  3GRD A;  1B2X A;  3LTB A;  1Q9E A;  1M90 4;  3CCV 3;  1EEJ A;  1AQZ A;  1I8V A;  4G1M B;  1E3R A;  3T8N A;  1S72 3;  2W0Q A;  1UUW B;  3MPH A;  1F8N A;  4HZB B;  5BIR A;  8CHO A;  3DUK A;  1N9E A;  1ROV A;  3HOH A;  1NJI 4;  4XBY A;  1JB2 A;  2P05 A;  1GOU A;  1BNG A;  1WTH A;  3EJV A;  5FW5 A;  3G4S 3;  1VZZ A;  5AYR B;  1WMN A;  4XB5 A;  4J9A A;  1VQ7 3;  2XGN A;  2KAA A;  2P0M A;  1RGG A;  1W2Z A;  1B20 A;  5M1A A;  1Z1S A;  1KD1 4;  4K1U A;  3PGB A;  3CMA 3;  1LOX A;  2BU4 A;  3X3X A;  5JPU A;  4K61 A;  4AKZ A;  3N8B A;  1B2U A;  4LGQ A;  2LYX A;  1E3V A;  1UCK A;  2F99 A;  1OPY A;  1T2I A;  3JUP A;  1DVC A;  1HYF A;  2HMJ B;  3CU3 A;  3SX1 A;  1BRI A;  2WOF A;  4JF8 A;  2F5M A;  2O9U X;  3DGM A;  5BU4 A;  3EN8 A;  1YVS A;  4L8P A;  1UDI I;  1BRG A;  5IEN A;  3I56 3;  4QWT A;  5KP3 A;  2YX9 A;  4HM7 B;  3FZW A;  4J5K A;  2WOH A;  4R1K A;  3N54 B;  3BB9 A;  1BRS A;  2BMR B;  3KSP A;  3CCU 3;  1VQ5 3;  1RGK A;  1Q40 B;  2P38 A;  2RNT A;  1RN1 A;  5IG0 A;  3NV0 B;  1RNB A;  1KWI A;  1PYL A;  3LOY A;  5IEP A;  4R4K A;  3K0Z A;  3K7C A;  3NUV A;  5IEO A;  3DGN A;  4HZ9 B;  1AVK A;  3DXO A;  1SQW A;  4HYZ A;  1JB4 A;  1BNI A;  4WYK A;  3NV0 A;  3LT8 A;  3V92 A;  1Q81 4;  4N6N B;  2HOH A;  1B2M A;  3CNM A;  1K9M 4;  3G0K A;  2CWU A;  3HZP A;  4AEQ A;  1LQM B;  2CK3 H;  4BIR A;  1YJN 3;  2INX A;  3B8L A;  2ZHX B;  1MOL A;  4FR9 A;  1MNL A;  3I55 3;  4R9K A;  4N6L A;  3IPT A;  1IVU A;  2GXF A;  4GHO A;  5LC7 A;  2V1L A;  3G6E 3;  2I9W A;  1N8R 4;  1TTO A;  5BVB A;  4HOH A;  4EV5 A;  1QVG 2;  2OTL 3;  4ILF A;  3KII A;  1RCK A;  1W6Y A;  1MWU A;  1R4C A;  1RN4 A;  5BXQ A;  1DET A;  3F14 A;  4RBN A;  3PYJ A;  2L1S A;  1JJ2 2;  1OUN A;  2IYJ A;  1IK3 A;  2Z77 A;  4BU4 A;  2OQE A;  4CDL A;  1O7M B;  3CXC 2;  3A76 A;  4I4K A;  2CFL A;  3KE7 A;  1JN5 A;  2STD A;  1EA2 A;  4BL3 A;  1D6Y A;  1LOW A;  1SII A;  3PCS A;  1KSI A;  1GOY A;  2ML5 A;  5D81 A;  1TP6 A;  1BVI A;  1FGM A;  3OWU A;  4MEI A;  1GSP A;  1IV7 A;  3EB8 A;  1AV4 A;  3EHC A;  2OCT A;  3PZW A;  1BSB A;  1QAK A;  1ULI B;  3LZA A;  3FF2 A;  3NBJ A;  4GB5 A;  3D5G A;  3NM7 A;  4CCV A;  1J2B A;  3Q2P A;  1BNJ A;  3HI7 A;  3EQQ B;  2CWT A;  3MKI A;  5M19 A;  2K3D A;  4R9L A;  1U5O A;  3G16 A;  1EUI C;  1RSN A;  1ULJ B;  1W00 A;  2GU3 A;  2UGI A;  1GOV A;  1ROA A;  1VQP 3;  1HKX A;  5RNT A;  2QA4 3;  2UUG C;  4N6O B;  2KF5 A;  1I0X A;  2MF7 A;  1BSA A;  1TU5 A;  2BNG A;  1LRA A;  1O7G B;  3AHS A;  2CHC A;  3FKA A;  4HBR A;  5EEO A;  1G96 A;  1JKG A;  1OF5 A;  1PU4 A;  2HMO B;  2XFS A;  3GAX A;  2E2U A;  3D4A A;  3ECF A;  1VQ6 3;  2RSX A;  3EBT A;  2P09 A;  3FGY A;  4PEJ A;  1RLS A;  2PZV A;  2ZL8 A;  1B21 A;  3JVC A;  3MG1 A;  3MHE A;  4FMA A;  4X2H A;  1IV9 A;  4XDW A;  3SED A;  3UB1 A;  1O7H B;  1VQM 3;  2RCD A;  5CLK A;  3GSP A;  2Y74 A;  3D79 A;  3J7Y d;  1BAO A;  1LOV A;  3NXJ A;  2CWV A;  4XBX A;  3QK9 A;  5EQL A;  1RRH A;  3EC9 A;  5G1L A;  3DY5 A;  2QEX 3;  1W01 A;  3UL6 A;  1FGR A;  4HM1 B;  2F4Y A;  5AII A;  3GZX B;  1D6U A;  3FG1 A;  3BLZ A;  1GYB A;  2O3O A;  5TGN A;  1OGX A;  5JBS A;  3V98 A;  3FG3 A;  2YFL B;  3Q3F A;  1CYV A;  1A2P A;  2JQ5 A;  3VSY A;  3QRD A;  2XEP A;  3RNT A;  2SAR A;  3U1W A;  4N6V 0;  1Q40 A;  2XRX B;  1TFO A;  4MJD A;  1BNF A;  1EQK A;  1BNE A;  2XR8 B;  3K63 A;  3FF0 A;  5KP4 A;  4IPB A;  2B24 B;  3X41 A;  3OW2 2;  1Q86 4;  2W9P A;  2XFT A;  3KN4 A;  3S5C A;  1JZD A;  1RTU A;  3CNX A;  1DVD A;  1IVV A;  1BUJ A;  2HMN B;  4EC6 A;  1MGR A;  3AGO A;  3KZT A;  3NBB A;  1UGH I;  1Q42 A;  1GMR A;  4J5G A;  1ISK A;  5AIF A;  1I2G A;  2F86 B;  2F5W A;  2W56 B;  5AI1 A;  3NX0 A;  3CC2 3;  1R4Y A;  1HU9 A;  3MSO A;  4L8O A;  5AIG A;  1EG9 B;  3G71 3;  3D9R A;  1RHL A;  2HMM B;  3DMC A;  4NRE A;  3CC7 3;  3CCQ 3;  4OK0 A;  2L4V A;  2CW9 A;  1LXE A;  3F7S A;  7RNT A;  1UI7 A;  1IQY A;  1OGZ A;  4OVM A;  5AEW B;  1A2K A;  1T3B A;  3GZB A;  3STD A;  1SJW A;  1I2E A;  1RCL A;  1O7P B;  1W02 A;  4K1V A;  1ZO2 A;  1GY7 A;  1TRQ A;  1E97 A;  2E2V A;  4KFE A;  1QAF A;  1ZS7 A;  1M1K 4;  3KFQ C;  5IG4 A;  1LOY A;  2OOV A; 
#chains in the Genus database with same CATH homology
 3FSD A;  1A90 A;  4KFD A;  2WGQ A;  4NHF A;  4RNZ A;  3EE1 A;  1SPU A;  4N6U A;  1RKY A;  1OHS A;  1S5A A;  1TIJ A;  4HJL B;  3OXA A;  3HK4 A;  4N6M A;  3B7C A;  1A2V A;  1DMM A;  3OWS A;  3CCM 3;  3KSE D;  3SLU A;  2XF3 A;  3PS8 A;  1YIT 3;  3KKG A;  4Q53 A;  1W4N A;  3ER7 A;  1N5P A;  3JUM A;  1Q82 4;  4LMI A;  4EV2 A;  3D3L A;  2Q07 A;  1YIJ 3;  5G2G A;  1KC8 4;  3LTA A;  1W6C A;  1W6G A;  2CFW A;  1QMA A;  2CG1 A;  2IUK A;  5IG5 A;  2W56 A;  4LEH A;  2BT3 A;  1OH0 A;  3CCR 3;  1O7W B;  2GU1 A;  2W6J H;  3F40 A;  2W04 A;  4FCZ A;  1DMN A;  3S67 A;  1YHQ 3;  1D6Z A;  1KQS 2;  1JNQ A;  3M8C A;  4MMZ B;  4KFF A;  3FH1 A;  3F7X A;  1W7C A;  1NO3 A;  1YGE A;  2KXG A;  3OWY A;  4IIA A;  1RRL A;  1UW1 A;  3LTC A;  3SOY A;  1CQS A;  2QGU A;  2HML B;  2R4I A;  1FGQ A;  3E99 A;  1IT7 A;  1JV2 B;  4U13 A;  3JUQ A;  2XSH B;  1K8A 4;  1FGO A;  3WA3 A;  3NQY A;  1U8C B;  4BTY A;  7STD A;  1GD4 A;  1QAL A;  5CF2 A;  3FG4 A;  5DRV A;  1ASK A;  2CC3 A;  4WYK B;  3GZY B;  5ELU A;  4HM8 B;  4N3V A;  1IU7 A;  1N5H A;  2RFR A;  5EVH A;  2FNQ A;  3IJE B;  1DYU A;  2BMO B;  3AMO A;  3OV4 A;  3CPW 2;  4ORL A;  2P0X A;  2XH9 A;  2D1W A;  1VQL 3;  2WGO A;  1NB3 I;  1YI2 3;  1PFP A;  3H3H A;  3HII A;  3CCJ 3;  5ELJ A;  2CFD A;  4HVN A;  3CC4 3;  1ZX2 A;  1CYU A;  5D82 A;  5DRE A;  3CD6 3;  1M1X B;  3LH4 A;  3MWZ A;  2JDI H;  3WDG B;  1NWW A;  3DZL A;  3G8Z A;  3K9M C;  2RGQ A;  4FMD A;  1FA3 A;  3VF1 A;  2C10 A;  2CH9 A;  3FLJ A;  3HX8 A;  3VGN A;  4FMC A;  4OUQ A;  3BNE A;  3GZR A;  3CPO A;  3DGO A;  4O8S A;  1YJ9 3;  1YJW 3;  1GY6 A;  3LXU X;  1O7N B;  1WQL B;  3NQZ A;  3S29 A;  2OQE C;  3EN1 B;  2CFG A;  4RZM A;  4EXR A;  1LVN A;  4HM4 B;  4EYC A;  3CCE 3;  3PCR A;  1JKG B;  1OF5 B;  1K28 A;  4XDV A;  2GEY A;  1W5Z A;  4KVH A;  4JRF A;  4H61 A;  1UI8 A;  4FCM A;  4BTW A;  1RN7 A;  2CIU A;  4WP5 A;  2D42 A;  5FGO A;  1GY5 A;  1GS3 A;  1US1 A;  3NBR A;  1C7H A;  3I0Y A;  3RGA A;  2WO0 A;  2YFJ B;  2BMQ B;  4HM2 B;  2Z76 A;  2M7O A;  1VQ4 3;  4ZM8 A;  3MG2 A;  5AIH A;  3DM8 A;  3WOF B;  3H51 A;  3NHX A;  3Q1C A;  1BUQ A;  2K54 A;  2BO9 B;  3NM2 A;  2SBL A;  4WFO A;  3X42 A;  3BND A;  2ZDJ A;  3RGR A;  3F8X A;  1A67 A;  2F98 A;  1YVB I;  5AEU B;  2XGL A;  1NB5 I;  2KRT A;  1NDO B;  3SOA A;  5IG3 A;  2PNC A;  3UJM A;  4FMB A;  1STD A;  4HM5 B;  1JN5 B;  1WMP A;  4LZI A;  5CK6 A;  2W2C A;  2Y73 A;  3FCS B;  3DGL A;  2MC8 A;  5KP1 A;  1OAC A;  1STF I;  3ALA A;  1TFK A;  4O3V A;  4RNY A;  4GL6 A;  4AKY A;  4XBT A;  3S27 A;  1AR0 A;  1VQO 3;  5I97 A;  3S28 A;  2CKF B;  2QIY A;  4STD A;  1LNH A;  1OHP A;  1EKM A;  3CCL 3;  5STD A;  2B1X B;  1NU3 A;  3PXM A;  3TDG A;  4HM0 B;  1TUH A;  4XM4 A;  6STD A;  2Z7A A;  2C11 A;  3OX9 A;  3GWR A;  1VQ9 3;  3CCS 3;  3WOE B;  5HGR A;  4N6T A;  1N9J A;  3X3Z A;  4IT7 A;  1UUV B;  4MMX B;  3B4O A;  2Z6B A;  4TX4 A;  5JPP A;  2XSO B;  1OHO A;  3F8H A;  2LQV A;  2IMJ A;  2BHM A;  1L5G B;  2HMK B;  3WOD G;  1IT8 A;  3Q90 A;  3AMO B;  1IVX A;  3LTD A;  4HKV B;  2IA7 A;  1K41 A;  5CXO A;  1GD3 A;  1IVW A;  1FGT A;  3EX9 A;  3HIG A;  4LSO A;  3LML A;  3JUN A;  1VQ8 3;  1N8Q A;  2W9Q A;  4J8T A;  5IER A;  5A0O B;  1VQN 3;  1Q7Y 4;  2K0M A;  3SVA A;  2YFI B;  1WNH A;  3WMD A;  3T8U A;  2FGT A;  4O02 B;  5CF1 A;  1QJG A;  5AYS C;  3EBY A;  1M9G A;  2GBW B;  2ML6 A;  1DMQ A;  1JB5 A;  3N9H A;  1T5Y A;  3L0R A;  3F9S A;  1WMO A;  4EBG A;  4MMY B;  5LC6 A;  2UX0 A;  3X3Y A;  3CME 3;  3IMA B;  3RDE A;  3U97 A;  3B4P A;  2GEX A;  3WA2 X;  1VQK 3;  1CEW I;  2KCD A;  4KZ1 A;  2FXT A;  3JUO A;  3LYG A;  1IQ8 A;  4K90 B;  1QVF 2;  2OTJ 3;  4O2H A;  4FCJ A;  2CG0 A;  5IW9 A;  3SXX A;  2W03 A;  1JRQ A;  3ROB A;  1OCV A;  3MG3 A;  4HM3 B;  3MYT A;  4L7K A;  3LT9 A;  2IUJ A;  1W2B 2;  2OWP A;  2GBX B;  2OOV C;  1AVL A;  3EF8 A;  3K5T A;  4HM6 B;  4R80 A;  3BNC A;  1RJO A;  5D83 A;  3BNB A;  4X2O A;  2E2T A;  3T0U A;  4BTX A;  1FUW A;  1Y4K A;  1V74 A;  3V99 A;  3X40 A;  3UNL A;  1IDP A;  3UL5 A;  2CFK A;  3O8Y A;  5IF6 A;  4WWU C;  1K73 4;  2A15 A;  4H3U A;  1IQX A;  1SIH A;  3GRD A;  3LTB A;  1M90 4;  3CCV 3;  4G1M B;  1E3R A;  3T8N A;  1S72 3;  2W0Q A;  1UUW B;  3MPH A;  1F8N A;  4HZB B;  8CHO A;  3DUK A;  1N9E A;  1ROV A;  1NJI 4;  4XBY A;  1JB2 A;  2P05 A;  1WTH A;  3EJV A;  5FW5 A;  3G4S 3;  1VZZ A;  5AYR B;  1WMN A;  4XB5 A;  4J9A A;  1VQ7 3;  2XGN A;  2P0M A;  1W2Z A;  3CMA 3;  1Z1S A;  1KD1 4;  4K1U A;  3PGB A;  1LOX A;  5JPU A;  3X3X A;  4K61 A;  4AKZ A;  3N8B A;  4LGQ A;  2LYX A;  1E3V A;  2F99 A;  1OPY A;  3JUP A;  1DVC A;  2HMJ B;  3CU3 A;  3SX1 A;  2WOF A;  4JF8 A;  2O9U X;  3DGM A;  3EN8 A;  4L8P A;  5IEN A;  3I56 3;  4QWT A;  5KP3 A;  2YX9 A;  4HM7 B;  3FZW A;  2WOH A;  4R1K A;  3N54 B;  3BB9 A;  2BMR B;  3KSP A;  3CCU 3;  1VQ5 3;  1Q40 B;  2P38 A;  5IG0 A;  3NV0 B;  1KWI A;  3LOY A;  5IEP A;  4R4K A;  3K0Z A;  3K7C A;  3NUV A;  5IEO A;  3DGN A;  4HZ9 B;  1AVK A;  3DXO A;  1SQW A;  4HYZ A;  1JB4 A;  4WYK A;  3NV0 A;  3LT8 A;  3V92 A;  1Q81 4;  4N6N B;  3CNM A;  1K9M 4;  3G0K A;  2CWU A;  3HZP A;  4AEQ A;  2CK3 H;  1YJN 3;  2INX A;  3B8L A;  1MOL A;  4FR9 A;  1MNL A;  3I55 3;  4R9K A;  4N6L A;  3IPT A;  1IVU A;  2GXF A;  5LC7 A;  2V1L A;  3G6E 3;  2I9W A;  1N8R 4;  5BVB A;  4EV5 A;  1QVG 2;  2OTL 3;  3KII A;  1W6Y A;  1R4C A;  5BXQ A;  3F14 A;  4RBN A;  3PYJ A;  1JJ2 2;  1OUN A;  1IK3 A;  2Z77 A;  2OQE A;  4CDL A;  1O7M B;  3CXC 2;  4I4K A;  2CFL A;  3KE7 A;  1JN5 A;  2STD A;  1EA2 A;  1D6Y A;  1SII A;  3PCS A;  1KSI A;  2ML5 A;  5D81 A;  1TP6 A;  1FGM A;  3OWU A;  4MEI A;  1IV7 A;  3EB8 A;  1AV4 A;  3EHC A;  2OCT A;  3PZW A;  1ULI B;  1QAK A;  3LZA A;  3NBJ A;  3FF2 A;  4GB5 A;  4CCV A;  3NM7 A;  1J2B A;  3Q2P A;  3HI7 A;  3EQQ B;  2CWT A;  3MKI A;  4R9L A;  1U5O A;  3G16 A;  1ULJ B;  1W00 A;  2GU3 A;  1ROA A;  1VQP 3;  1HKX A;  2QA4 3;  4N6O B;  2MF7 A;  1TU5 A;  2BNG A;  1O7G B;  2CHC A;  3FKA A;  4HBR A;  5EEO A;  1G96 A;  1JKG A;  1OF5 A;  1PU4 A;  2HMO B;  2XFS A;  3GAX A;  2E2U A;  1VQ6 3;  3ECF A;  2RSX A;  3EBT A;  2P09 A;  3FGY A;  4PEJ A;  2PZV A;  2ZL8 A;  3JVC A;  3MG1 A;  3MHE A;  4FMA A;  4X2H A;  4XDW A;  1IV9 A;  3SED A;  3UB1 A;  1VQM 3;  1O7H B;  2RCD A;  5CLK A;  2Y74 A;  3J7Y d;  3NXJ A;  2CWV A;  4XBX A;  3QK9 A;  5EQL A;  1RRH A;  3EC9 A;  3DY5 A;  2QEX 3;  1W01 A;  3UL6 A;  1FGR A;  4HM1 B;  5AII A;  3GZX B;  1D6U A;  3FG1 A;  3BLZ A;  1GYB A;  2O3O A;  5TGN A;  1OGX A;  5JBS A;  3V98 A;  3FG3 A;  2YFL B;  1CYV A;  2JQ5 A;  3VSY A;  3QRD A;  2XEP A;  3U1W A;  4N6V 0;  1Q40 A;  2XRX B;  1TFO A;  4MJD A;  1EQK A;  2XR8 B;  3K63 A;  3FF0 A;  5KP4 A;  4IPB A;  2B24 B;  3X41 A;  3OW2 2;  1Q86 4;  2W9P A;  2XFT A;  3KN4 A;  3S5C A;  3CNX A;  1DVD A;  1IVV A;  2HMN B;  4EC6 A;  3KZT A;  3NBB A;  1Q42 A;  1QAF A;  1ISK A;  5AIF A;  2F86 B;  2W56 B;  5AI1 A;  3NX0 A;  3CC2 3;  1HU9 A;  3MSO A;  4L8O A;  5AIG A;  1EG9 B;  3G71 3;  3D9R A;  3DMC A;  2HMM B;  4NRE A;  3CC7 3;  3CCQ 3;  4OK0 A;  2L4V A;  2CW9 A;  1LXE A;  3F7S A;  1UI7 A;  1IQY A;  1OGZ A;  4OVM A;  5AEW B;  1A2K A;  3GZB A;  3STD A;  1SJW A;  1O7P B;  1W02 A;  4K1V A;  1ZO2 A;  1GY7 A;  1E97 A;  2E2V A;  4KFE A;  3A76 A;  1M1K 4;  3KFQ C;  5IG4 A;  4WHA A;  2OOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...