2QEX3

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qex300
3CC23 3CCL3 1VQP3 1VQ63 3CCE3 1KD14 1Q864 1YI23 1K8A4 1VQK3 3CCS3 3CPW2 2QEX3 1VQ83 2OTL3 2OTJ3 2QA43 1YIJ3 1YIT3 3CC73 1YHQ3 1YJN3 1N8R4 1VQ93 1VQN3 3G4S3 1Q814 3CCJ3 3CXC2 3CC43 1VQO3 1VQM3 3CCR3 3CCV3 3G6E3 3G713 1S723 1W2B2 1K9M4 1QVG2 1VQ53 3CCU3 1VQL3 3I563 3CCM3 1VQ73 1M904 1NJI4 1YJW3 1KC84 3CCQ3 3CD63 1VQ43 3I553 1Q7Y4 3OW22 1M1K4 1KQS2 3CMA3 1QVF2 1Q824 1YJ93 1K734 3CME3 1JJ22
chains in the Genus database with same CATH superfamily
1RGGA 2V1LA 4K1VA 1VQ63 2CFKA 1N9JA 1UW1A 2XR8B 1W00A 2BHMA 1BNIA 5IERA 3NX0A 1FUTA 1VQ83 3KZTA 2BMRB 2O3OA 4JF8A 3MKIA 2F56A 3NM2A 1JBSA 1NB5I 4HZBB 2L1SA 1PY3A 2CIUA 3LXUX 3T8NA 1O7WB 3MHEA 3G4S3 3LYGA 3KN4A 1MWRA 2F99A 2Z7AA 3NXJA 3CCR3 1W2B2 1TFKA 1BSDA 5CXOA 1IVXA 1QAFA 3S27A 3K0ZA 2F98A 5IG5A 1I0VA 2Q07A 2W6JH 3NUVA 1OCVA 3NBRA 1HKXA 5JBSA 1IK3A 4O02B 5BU4A 1EQKA 3U1WA 3JUQA 1DYUA 1ULIB 3E99A 3MG1A 3CCL3 4HM4B 3T8UA 3B7CA 5HGRA 1G0TA 1Q864 2FGTA 1UUVB 3HIIA 4N6OB 2RFRA 1DMQA 3UJMA 1BUJA 1OGZA 3U97A 1BNRA 1FW7A 1TFOA 1FGMA 2W04A 5G1KA 1T2HA 3X41A 3WA3A 4XB5A 2XH9A 4NHFA 3D4AA 1IVUA 5A0OB 3BIRA 3LT8A 1AR0A 3BB9A 2GSPA 2PNCA 2CH9A 2KF4A 2LYXA 1QVG2 1VQ53 3D5IA 4N6TA 3EN1B 2W2CA 2F5MA 4KT3B 4STDA 2YFLB 3NM7A 2P0MA 1AVLA 1NWWA 3MG2A 2R41A 4IT7A 4N6V0 1JBRA 3DZLA 1GOUA 4N6UA 3AHWA 4XDWA 4AKZA 3CNMA 4WWUC 4WYKA 1Z1SA 1DE3A 5IG0A 1BRNL 2WGOA 1JKGA 4J9AA 1I2EA 1S5AA 2CX1A 2JQ5A 3K7CA 3EF8A 4GL6A 1F8NA 3F40A 3HX8A 1BNGA 3LTDA 2ZDJA 1O7HB 3G8ZA 1TRPA 2XRXB 5AIIA 4NPBA 1VZZA 4U13A 2MC8A 3WOEB 5D81A 3CC73 3OWSA 1I8VA 3AMOB 4EC6A 2RNTA 2HMKB 3OWUA 4FMBA 2KXGA 3AHSA 3KSED 3MPHA 5ELJA 1EG9B 1VQQA 4N6MA 5CLKA 3DMCA 5GSPA 1NJI4 3H51A 3FGYA 2Z76A 3D3LA 3F9SA 4HM0B 3J7Yd 7RNTA 3HIGA 1IV9A 2CG1A 4ZM8A 1W02A 5I97A 3DGOA 2LQVA 1JN5B 3CCE3 1DMNA 2W9PA 2OOVC 1N9EA 4OVMA 1MGWA 2H0HA 1I70A 1QALA 1ROVA 4XBTA 5D83A 3KCHA 1K8A4 3CCS3 1KWIA 3GZYB 3X40A 2CKFB 4K61A 4LGQA 3Q2PA 2Z6BA 3B8LA 2MF7A 5IEPA 4LZIA 2INXA 2P09A 5FGOA 3HOHA 4FCJA 2Y73A 4CPKA 1PFPA 3MSOA 1QMAA 4LYLB 2BT3A 5CF2A 1FGQA 3FCSB 3D9RA 4J5KA 3S29A 1A2PA 1LOXA 4BIRA 4FMDA 5ELUA 3QK9A 4HM2B 4RNYA 3CCU3 4BTYA 1BGSA 1ZGXA 2CWTA 2RGQA 1W5ZA 1M1K4 1CYVA 1X1XA 2AAEA 1YJ93 3TDGA 3S28A 1BRSA 2UGIA 4EXRA 3N9HA 4K1UA 3V98A 1VQP3 1W6YA 1C54A 1BRKA 2UX0A 1LOWA 1B27A 1UCJA 3H3HA 3ROBA 3FF2A 1RGLA 4HOHA 1YI23 1V58A 1RDSA 1AVKA 2P05A 1QJGA 4H61A 4I5QA 4HZ9B 4XM4A 1YIJ3 4R9KA 5EVHA 5IENA 3GZXB 4HKVB 1N8R4 1Q7HA 1V57A 1BAOA 3B4PA 4RNTA 1GOYA 1JRQA 3M8CA 1S723 1CEWI 1E3RA 2CFGA 1SARA 1BANA 1STFI 1UGHI 4LMIA 4GB5A 2KCDA 1W7CA 1VQ43 5AYRB 1LOYA 3FSDA 3BNCA 2RCDA 2XGLA 1I3FA 1W01A 2A15A 4BTWA 1W4NA 3EB8A 3SEDA 1I0XA 5D82A 3V99A 3OXAA 1FYSA 2H0IA 3QRDA 1EKMA 4MEIA 4HM1B 3GRDA 1MWSA 4R1KA 3GWRA 3KE7A 3UL5A 2OTL3 3O8YA 4BL2A 5TGNA 1WQLB 3SOAA 4WYKB 3MWZA 3A5EA 1UDII 3GSPA 3PS8A 3CC43 1JKGB 1TJDA 4WP5A 3PCSA 1DETA 4J8TA 1BSAA 1LXEA 1M904 3Q90A 4MJDA 1YJW3 1RCLA 4HM3B 4L7KA 3PXMA 1IDPA 3F14A 1RRHA 1BSCA 3FH1A 3CMA3 1GY7A 1DVCA 1JV2B 2W03A 1IT8A 2HOHA 4WFOA 5LC7A 3DGLA 2CC3A 5CK6A 3WR2A 4O3VA 2BO9B 2CW9A 5BXQA 1I2FA 2ZHXB 3LZAA 3WMDA 1US1A 3F8XA 1B21A 1EEJA 2OQEC 3BLZA 1GD4A 2CWVA 2YX9A 2RBIA 1G02A 3FF0A 4L8PA 1A2VA 2QGUA 2XSHB 1VQ93 1IU7A 1IT7A 1OF5A 1R4YA 3WA2X 1WNHA 4HBRA 4WHAA 3UL6A 1OGXA 4R9LA 1JZDA 3JVCA 1Q40A 4AKYA 1SQWA 1B20A 3VF1A 1BRJA 1LQMB 1NDOB 3JUPA 2HMMB 3N54B 5STDA 1T3BA 3NV0A 4G1MB 1OACA 3S67A 1RCKA 4AEQA 1RRLA 2GBWB 3HZPA 1RN1A 2KRTA 3Q3FA 1OHOA 1FGOA 4J5GA 1KD14 1X1UA 1EA2A 3EJVA 3FG4A 4H3UA 3SVAA 4FCZA 5RNTA 1NO3A 2FNQA 1M9GA 3DH2A 2XFTA 3EQQB 3OX9A 1Y4KA 1L5GB 3RGRA 3EHCA 2E2VA 1UCLA 3KIIA 1OHPA 1IVVA 3DXOA 2CWUA 1VQO3 1A90A 2XF3A 3SYUA 1UI7A 2KF6A 1W2ZA 2YFIB 5AIHA 3IPTA 2ML6A 5AYSC 4EYCA 2B24B 3DGYA 2K3DA 3HK4A 1BNEA 3LTBA 4HYZA 3CCM3 1BNFA 1JB2A 2F86B 1UCIA 1G96A 3DGMA 4N6LA 5M18A 3FG3A 3B4OA 3RNTA 1QVF2 2IY2A 2XGNA 1QAKA 1K734 1RN7A 3V92A 3AGNA 3RDEA 1FUSA 3DM8A 1OHSA 1UGIA 1T5YA 5JPUA 1JNQA 3IJEB 1RSNA 2BIRA 3STDA 1DMMA 3X3YA 5M1AA 4L8OA 3CPOA 2HMJB 4BL3A 3N8BA 1X1YA 3BNDA 4HJLB 1YHQ3 1RGEA 3BNBA 1R4CA 2CK3H 4QWTA 1OUNA 1RGKA 3F7XA 2W9QA 3MG3A 3JUNA 1FGRA 1KC84 1NU3A 1RN4A 1K41A 1AQZA 1BSEA 1RGAA 1ROAA 2L4VA 1T2IA 1KQS2 1GD3A 3EN8A 4HM5B 8CHOA 2GU3A 1RLSA 2WO0A 3CC23 5AIFA 5AI1A 1DVDA 1BRGA 3LTAA 2PZVA 2GBXB 3VGNA 3SXXA 2IA7A 1ISKA 1AV4A 1MOLA 4KZ1A 3FLJA 1LRAA 3ZG0A 4ORLA 1SIIA 7STDA 3DUKA 4XBXA 2K54A 1YJN3 3CCJ3 4KFEA 2HMLB 2W0QA 1K9M4 1Q9EA 2F4YA 1TP6A 1TTOA 3LMLA 2F5WA 3NBJA 3UB1A 4FR9A 4I4KA 3CD63 4OUQA 2STDA 1U8CB 2IYJA 2BNGA 3PZWA 2C11A 3GZRA 3T0UA 1CH0A 5DRVA 1OF5B 3I563 1O7NB 1W6GA 3AMOA 5M19A 4GHOA 1U5OA 2Z77A 1C7HA 1IVWA 1GMRA 1UUWB 1WMNA 4JRFA 1K28A 3WODG 1TRQA 1Q40B 1CYUA 2OWPA 4KFFA 1BNSA 2OTJ3 2WOHA 3NV0B 3NBBA 1FA3A 1MGRA 1RGHA 1A67A 3FKAA 2K0MA 1B2ZA 2CFWA 4BTXA 1GMQA 1RNTA 3WHOA 3S5CA 4MMXB 4RBNA 2QIYA 3X3ZA 3PCRA 2SBLA 2C4BA 3EE1A 3X3XA 1Q7Y4 3OW22 3OV4A 4HM8B 5G2GA 1IYYA 1AY7A 3I0YA 5LC6A 3LH4A 2C10A 4LSOA 3CME3 2P38A 1NNVA 4O2HA 3CU3A 1RGFA 3URPA 1JB4A 2CFLA 4EW5A 4IIAA 1SIHA 1RNBA 1BIRA 3G16A 3EBTA 2OOVA 1IQXA 1N5HA 2GXFA 1RMSA 3Q1CA 2BMOB 3F7SA 2JDIH 1CQSA 1IQYA 2CHCA 3HI7A 2CX0A 2E2UA 3SOYA 3X42A 2GEXA 3G6E3 1M1XB 1YGEA 4LEHA 1KSIA 4MMZB 2D1WA 3IMAB 3BNEA 3ALAA 5IF6A 1VQL3 4BU4A 1O7PB 4RNZA 1TIJA 3CNXA 1JB5A 4TX4A 1RTUA 2FXTA 3L0RA 1GSPA 2QEX3 1LQGC 2HMOB 4KVHA 2BMQB 3FG1A 4Q53A 5IG3A 4EV2A 4XBYA 2XFSA 3NQZA 1V74A 1B2SA 1STDA 5EQLA 2W56A 1BUQA 1D6YA 3K63A 4EBGA 3PGBA 1Q42A 1GMPA 2WGQA 1VQK3 2XSOB 3DY5A 5G1LA 1MWTA 1BRIA 1WTHA 5CF1A 1UI8A 5KP4A 2E2TA 1JBTA 1B3SA 1RHLA 1VQM3 2KF3A 4PEJA 1W6CA 3K9MC 4NREA 4R80A 4HAAA 1LVNA 2B1XB 1LNHA 6GSPA 1YVBI 8RNTA 3CCQ3 4X2OA 1BNJA 5AIGA 1E3VA 1WMPA 3JUMA 3EBYA 3BU4A 4N3VA 2SARA 3WDGB 3D79A 1TUHA 1J2BA 2YFJB 2I9WA 1BSBA 2ZL8A 3AGOA 7GSPA 1N5PA 3D5GA 3G0KA 1LOVA 1UCKA 3NQYA 4KFDA 4DKIA 2AADA 3CPW2 4ILFA 1A2KA 3ZG5A 1OH0A 2KAAA 2Y74A 1ZX2A 4IPBA 3ER7A 1PYLA 3GZBA 5IW9A 9RNTA 2ML5A 3MYTA 1ZO2A 5KP3A 1ZS7A 5IEOA 5IG4A 5BIRA 1I2GA 4GSPA 6STDA 1UUGB 4CCVA 2HMNB 3A76A 5BVBA 1I3IA 4FMCA 1HU9A 1BRHA 1LNIA 1GS3A 1SJWA 2GU1A 3OWYA 4X2HA 5AEUB 1GY5A 3PYJA 4HM6B 1FUWA 1D6UA 1D6ZA 3KSPA 3LOYA 2WOFA 2XEPA 2J8XB 5JPPA 3EX9A 2OCTA 1SPUA 3F8HA 1MNLA 3KFQC 5KP1A 2OQEA 2R4IA 1HYFA 2QA43 1GYBA 1YIT3 1HZ1A 4N6NB 3FZWA 3DGNA 1YNVX 1IV7A 5HOHA 1IQ8A 2CFDA 1WMOA 3CXC2 1Q814 4O8SA 4K90B 3CCV3 3SX1A 3G713 4CJNA 2D42A 2IMJA 2H0GA 3UNLA 4FCMA 1B2XA 4HM7B 5FW5A 1NB3I 3VSYA 1O7GB 3LTCA 3I553 4OK0A 1B2UA 1FGTA 3EC9A 1E97A 1YGWA 2P0XA 4EV5A 1MWUA 3ECFA 2IUKA 1JJ22 1X1WA 1PU4A 1RKYA 1N8QA 3LT9A 1O7MB 3ZFZA 2M7OA 2RSXA 2O9UX 2CG0A 3K5TA 4CDLA 1TU5A 5EEOA 3JUOA 1ULJB 1OPYA 3GAXA 5DREA 2ZA4A 1YVSA 4MMYB 4R4KA 2GEYA 1FZUA 1GOVA 4HVNA 1VQN3 1EUIC 1ASKA 1BOXA 1JZOA 4FMAA 2IUJA 1JN5A 2BU4A 2W56B 3WOFB 2UUGC 6RNTA 1BVIA 1GY6A 1VQ73 1RGCA 5AEWB 3KKGA 3NHXA 3RGAA 4RZMA 1RJOA 1Q824 3SLUA 2KF5A 1B2MA 4XDVA 1BU4A
chains in the Genus database with same CATH topology
2V1LA 1VQ63 4K1VA 2CFKA 1N9JA 1UW1A 2XR8B 1W00A 2BHMA 5IERA 3NX0A 1VQ83 3KZTA 2BMRB 2O3OA 4JF8A 3MKIA 3NM2A 1NB5I 4HZBB 2CIUA 3LXUX 3T8NA 1O7WB 3MHEA 3G4S3 3LYGA 3KN4A 2Z7AA 2F99A 3CCR3 3NXJA 1W2B2 1TFKA 5CXOA 1IVXA 1QAFA 3S27A 3K0ZA 2F98A 5IG5A 2Q07A 2W6JH 3NUVA 1OCVA 3NBRA 1HKXA 5JBSA 1IK3A 4O02B 1EQKA 3U1WA 3JUQA 1DYUA 1ULIB 3E99A 3MG1A 3CCL3 4HM4B 3T8UA 3B7CA 5HGRA 1Q864 2FGTA 1UUVB 3HIIA 4N6OB 2RFRA 1DMQA 3UJMA 1OGZA 3U97A 1TFOA 1FGMA 2W04A 3X41A 3WA3A 4XB5A 2XH9A 4NHFA 1IVUA 5A0OB 3LT8A 1AR0A 3BB9A 2PNCA 2CH9A 2LYXA 1QVG2 1VQ53 4N6TA 3EN1B 2W2CA 4STDA 2YFLB 3NM7A 2P0MA 1AVLA 1NWWA 3MG2A 4N6V0 4IT7A 3DZLA 4N6UA 4XDWA 4AKZA 3CNMA 4WWUC 4WYKA 1Z1SA 5IG0A 2WGOA 1JKGA 4J9AA 1S5AA 2JQ5A 3K7CA 3EF8A 4GL6A 1F8NA 3F40A 3HX8A 3LTDA 2ZDJA 1O7HB 3G8ZA 5AIIA 2XRXB 4U13A 1VZZA 2MC8A 3WOEB 5D81A 3CC73 3OWSA 3AMOB 4EC6A 4FMBA 2HMKB 3OWUA 5ELJA 2KXGA 3MPHA 3KSED 1EG9B 4N6MA 5CLKA 3DMCA 1NJI4 3H51A 3FGYA 2Z76A 3D3LA 3F9SA 4HM0B 3J7Yd 3HIGA 1IV9A 2CG1A 4ZM8A 1W02A 5I97A 3DGOA 2LQVA 1JN5B 3CCE3 1DMNA 2W9PA 2OOVC 1N9EA 4OVMA 4XBTA 1QALA 1ROVA 5D83A 1K8A4 3CCS3 1KWIA 3GZYB 3X40A 2CKFB 4K61A 4LGQA 3Q2PA 2Z6BA 3B8LA 2MF7A 5IEPA 4LZIA 2INXA 2P09A 5FGOA 4FCJA 2Y73A 1PFPA 3MSOA 1QMAA 5CF2A 2BT3A 1FGQA 3FCSB 3D9RA 3S29A 1LOXA 4FMDA 5ELUA 3QK9A 4HM2B 4RNYA 3CCU3 4BTYA 2RGQA 2CWTA 1W5ZA 1M1K4 1CYVA 1YJ93 3TDGA 3S28A 4EXRA 3N9HA 4K1UA 3V98A 1VQP3 1W6YA 2UX0A 3ROBA 3H3HA 3FF2A 1YI23 1AVKA 2P05A 1QJGA 4H61A 4HZ9B 4XM4A 1YIJ3 4R9KA 5EVHA 5IENA 3GZXB 4HKVB 1N8R4 3B4PA 1JRQA 3M8CA 1S723 1CEWI 1E3RA 2CFGA 1STFI 4LMIA 4GB5A 2KCDA 1W7CA 1VQ43 5AYRB 3FSDA 3BNCA 2RCDA 2XGLA 1W01A 2A15A 4BTWA 1W4NA 3EB8A 3SEDA 5D82A 3V99A 3OXAA 3QRDA 1EKMA 4MEIA 4HM1B 3GRDA 4R1KA 3GWRA 3KE7A 3UL5A 2OTL3 3O8YA 5TGNA 1WQLB 3SOAA 4WYKB 3MWZA 3PS8A 3CC43 1JKGB 4WP5A 3PCSA 4J8TA 1LXEA 1M904 3Q90A 4MJDA 1YJW3 4HM3B 4L7KA 3PXMA 1IDPA 3F14A 1RRHA 3FH1A 3CMA3 1GY7A 1DVCA 1JV2B 2W03A 1IT8A 4WFOA 5LC7A 3DGLA 2CC3A 5CK6A 4O3VA 2BO9B 2CW9A 5BXQA 3WMDA 3LZAA 1US1A 3F8XA 2OQEC 3BLZA 1GD4A 2CWVA 2YX9A 3FF0A 4L8PA 1A2VA 2QGUA 2XSHB 1VQ93 1IU7A 1IT7A 1OF5A 3WA2X 1WNHA 4HBRA 4WHAA 3UL6A 1OGXA 4R9LA 3JVCA 1Q40A 4AKYA 1SQWA 3VF1A 1NDOB 3JUPA 2HMMB 3N54B 5STDA 3NV0A 4G1MB 1OACA 3S67A 4AEQA 1RRLA 2GBWB 3HZPA 2KRTA 1OHOA 1FGOA 1KD14 1EA2A 3EJVA 3FG4A 4H3UA 3SVAA 4FCZA 1NO3A 2FNQA 1M9GA 2XFTA 3EQQB 3OX9A 1Y4KA 1L5GB 3RGRA 3EHCA 2E2VA 3KIIA 1OHPA 1IVVA 3DXOA 2CWUA 1VQO3 1A90A 2XF3A 1UI7A 2YFIB 1W2ZA 5AIHA 5AYSC 3IPTA 2ML6A 4EYCA 2B24B 3HK4A 3LTBA 3CCM3 4HYZA 1JB2A 2F86B 1G96A 3DGMA 4N6LA 3FG3A 3B4OA 1QVF2 2XGNA 1QAKA 1K734 1RN7A 3V92A 3RDEA 3DM8A 1OHSA 1T5YA 5JPUA 1JNQA 3IJEB 3STDA 1DMMA 3X3YA 4L8OA 3CPOA 2HMJB 3N8BA 3BNDA 4HJLB 1YHQ3 3BNBA 1R4CA 2CK3H 4QWTA 1OUNA 3F7XA 2W9QA 3MG3A 3JUNA 1FGRA 1KC84 1NU3A 1K41A 1ROAA 2L4VA 1KQS2 1GD3A 3EN8A 4HM5B 8CHOA 2GU3A 2WO0A 3CC23 5AIFA 5AI1A 1DVDA 3LTAA 2PZVA 2GBXB 3VGNA 3SXXA 2IA7A 1ISKA 1AV4A 1MOLA 4KZ1A 3FLJA 4ORLA 1SIIA 7STDA 3DUKA 4XBXA 2K54A 1YJN3 3CCJ3 4KFEA 2HMLB 2W0QA 1K9M4 1TP6A 3LMLA 3NBJA 3UB1A 4FR9A 4I4KA 3CD63 4OUQA 2STDA 1U8CB 2BNGA 3PZWA 2C11A 3GZRA 3T0UA 5DRVA 1OF5B 3I563 1O7NB 1W6GA 3AMOA 1U5OA 2Z77A 1C7HA 1IVWA 1UUWB 1WMNA 4JRFA 1K28A 3WODG 1CYUA 1Q40B 2OWPA 4KFFA 2OTJ3 2WOHA 3NV0B 3NBBA 1FA3A 1A67A 3FKAA 2K0MA 2CFWA 4BTXA 3S5CA 4MMXB 4RBNA 2QIYA 3X3ZA 3PCRA 2SBLA 3EE1A 3X3XA 1Q7Y4 3OW22 3OV4A 4HM8B 5G2GA 3I0YA 5LC6A 3LH4A 2C10A 4LSOA 3CME3 2P38A 4O2HA 3CU3A 1JB4A 2CFLA 4IIAA 1SIHA 3G16A 3EBTA 2OOVA 1IQXA 1N5HA 2GXFA 3Q1CA 2BMOB 3F7SA 2JDIH 1CQSA 1IQYA 2CHCA 3HI7A 2E2UA 3SOYA 3X42A 2GEXA 3G6E3 1M1XB 1YGEA 4LEHA 1KSIA 4MMZB 2D1WA 3IMAB 3BNEA 3ALAA 5IF6A 1VQL3 1O7PB 4RNZA 1TIJA 3CNXA 1JB5A 4TX4A 2FXTA 3L0RA 2QEX3 4Q53A 2HMOB 4KVHA 2BMQB 3FG1A 5IG3A 4EV2A 4XBYA 2XFSA 3NQZA 1V74A 1STDA 5EQLA 1BUQA 2W56A 1D6YA 3K63A 4EBGA 3PGBA 1Q42A 2WGQA 1VQK3 2XSOB 3DY5A 1WTHA 5CF1A 1UI8A 5KP4A 2E2TA 1VQM3 4PEJA 1W6CA 3K9MC 4NREA 4R80A 1LVNA 1LNHA 2B1XB 1YVBI 3CCQ3 4X2OA 5AIGA 1E3VA 1WMPA 3JUMA 3EBYA 4N3VA 3WDGB 1TUHA 1J2BA 2YFJB 2I9WA 2ZL8A 1N5PA 3G0KA 3NQYA 4KFDA 3CPW2 1A2KA 1OH0A 2Y74A 1ZX2A 4IPBA 3ER7A 3GZBA 5IW9A 2ML5A 3MYTA 1ZO2A 5KP3A 5IG4A 5IEOA 6STDA 4CCVA 2HMNB 3A76A 5BVBA 4FMCA 1HU9A 1SJWA 2GU1A 1GS3A 3OWYA 4X2HA 5AEUB 1GY5A 3PYJA 4HM6B 1FUWA 1D6UA 1D6ZA 3KSPA 3LOYA 2WOFA 2XEPA 5JPPA 3EX9A 2OCTA 1SPUA 3F8HA 1MNLA 3KFQC 5KP1A 2OQEA 2R4IA 2QA43 1GYBA 1YIT3 4N6NB 3FZWA 3DGNA 1IV7A 1Q814 1IQ8A 2CFDA 1WMOA 3CXC2 4O8SA 4K90B 3CCV3 3SX1A 3G713 2D42A 2IMJA 3UNLA 4FCMA 4HM7B 5FW5A 1NB3I 3VSYA 1O7GB 3LTCA 3I553 4OK0A 1FGTA 3EC9A 1E97A 2P0XA 4EV5A 3ECFA 2IUKA 1JJ22 1PU4A 1RKYA 1N8QA 3LT9A 1O7MB 2M7OA 2RSXA 2O9UX 2CG0A 3K5TA 4CDLA 1TU5A 5EEOA 3JUOA 1ULJB 1OPYA 3GAXA 5DREA 4R4KA 4MMYB 2GEYA 4HVNA 1VQN3 1ASKA 4FMAA 2IUJA 1JN5A 2W56B 3WOFB 1GY6A 1VQ73 5AEWB 3KKGA 3NHXA 3RGAA 4RZMA 1RJOA 1Q824 3SLUA 4XDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 3;  3CCL 3;  1VQP 3;  1VQ6 3;  3CCE 3;  1KD1 4;  1Q86 4;  1YI2 3;  1K8A 4;  1VQK 3;  3CCS 3;  3CPW 2;  2QEX 3;  1VQ8 3;  2OTL 3;  2OTJ 3;  2QA4 3;  1YIJ 3;  1YIT 3;  3CC7 3;  1YHQ 3;  1YJN 3;  1N8R 4;  1VQ9 3;  1VQN 3;  3G4S 3;  1Q81 4;  3CCJ 3;  3CXC 2;  3CC4 3;  1VQO 3;  1VQM 3;  3CCR 3;  3CCV 3;  3G6E 3;  3G71 3;  1S72 3;  1W2B 2;  1K9M 4;  1QVG 2;  1VQ5 3;  3CCU 3;  1VQL 3;  3I56 3;  3CCM 3;  1VQ7 3;  1M90 4;  1NJI 4;  1YJW 3;  1KC8 4;  3CCQ 3;  3CD6 3;  1VQ4 3;  3I55 3;  1Q7Y 4;  3OW2 2;  1M1K 4;  1KQS 2;  3CMA 3;  1QVF 2;  1Q82 4;  1YJ9 3;  1K73 4;  3CME 3;  1JJ2 2; 
#chains in the Genus database with same CATH topology
 1RGG A;  2V1L A;  4K1V A;  1VQ6 3;  2CFK A;  1N9J A;  1UW1 A;  2XR8 B;  1W00 A;  2BHM A;  1BNI A;  5IER A;  3NX0 A;  1FUT A;  1VQ8 3;  3KZT A;  2BMR B;  2O3O A;  4JF8 A;  3MKI A;  2F56 A;  3NM2 A;  1JBS A;  1NB5 I;  4HZB B;  2L1S A;  1PY3 A;  2CIU A;  3LXU X;  3T8N A;  1O7W B;  3MHE A;  3G4S 3;  3LYG A;  3KN4 A;  1MWR A;  2F99 A;  2Z7A A;  3NXJ A;  3CCR 3;  1W2B 2;  1TFK A;  1BSD A;  5CXO A;  1IVX A;  1QAF A;  3S27 A;  3K0Z A;  2F98 A;  5IG5 A;  1I0V A;  2Q07 A;  2W6J H;  3NUV A;  1OCV A;  3NBR A;  1HKX A;  5JBS A;  1IK3 A;  4O02 B;  5BU4 A;  1EQK A;  3U1W A;  3JUQ A;  1DYU A;  1ULI B;  3E99 A;  3MG1 A;  3CCL 3;  4HM4 B;  3T8U A;  3B7C A;  5HGR A;  1G0T A;  1Q86 4;  2FGT A;  1UUV B;  3HII A;  4N6O B;  2RFR A;  1DMQ A;  3UJM A;  1BUJ A;  1OGZ A;  3U97 A;  1BNR A;  1FW7 A;  1TFO A;  1FGM A;  2W04 A;  5G1K A;  1T2H A;  3X41 A;  3WA3 A;  4XB5 A;  2XH9 A;  4NHF A;  3D4A A;  1IVU A;  5A0O B;  3BIR A;  3LT8 A;  1AR0 A;  3BB9 A;  2GSP A;  2PNC A;  2CH9 A;  2KF4 A;  2LYX A;  1QVG 2;  1VQ5 3;  3D5I A;  4N6T A;  3EN1 B;  2W2C A;  2F5M A;  4KT3 B;  4STD A;  2YFL B;  3NM7 A;  2P0M A;  1AVL A;  1NWW A;  3MG2 A;  2R41 A;  4IT7 A;  4N6V 0;  1JBR A;  3DZL A;  1GOU A;  4N6U A;  3AHW A;  4XDW A;  4AKZ A;  3CNM A;  4WWU C;  4WYK A;  1Z1S A;  1DE3 A;  5IG0 A;  1BRN L;  2WGO A;  1JKG A;  4J9A A;  1I2E A;  1S5A A;  2CX1 A;  2JQ5 A;  3K7C A;  3EF8 A;  4GL6 A;  1F8N A;  3F40 A;  3HX8 A;  1BNG A;  3LTD A;  2ZDJ A;  1O7H B;  3G8Z A;  1TRP A;  2XRX B;  5AII A;  4NPB A;  1VZZ A;  4U13 A;  2MC8 A;  3WOE B;  5D81 A;  3CC7 3;  3OWS A;  1I8V A;  3AMO B;  4EC6 A;  2RNT A;  2HMK B;  3OWU A;  4FMB A;  2KXG A;  3AHS A;  3KSE D;  3MPH A;  5ELJ A;  1EG9 B;  1VQQ A;  4N6M A;  5CLK A;  3DMC A;  5GSP A;  1NJI 4;  3H51 A;  3FGY A;  2Z76 A;  3D3L A;  3F9S A;  4HM0 B;  3J7Y d;  7RNT A;  3HIG A;  1IV9 A;  2CG1 A;  4ZM8 A;  1W02 A;  5I97 A;  3DGO A;  2LQV A;  1JN5 B;  3CCE 3;  1DMN A;  2W9P A;  2OOV C;  1N9E A;  4OVM A;  1MGW A;  2H0H A;  1I70 A;  1QAL A;  1ROV A;  4XBT A;  5D83 A;  3KCH A;  1K8A 4;  3CCS 3;  1KWI A;  3GZY B;  3X40 A;  2CKF B;  4K61 A;  4LGQ A;  3Q2P A;  2Z6B A;  3B8L A;  2MF7 A;  5IEP A;  4LZI A;  2INX A;  2P09 A;  5FGO A;  3HOH A;  4FCJ A;  2Y73 A;  4CPK A;  1PFP A;  3MSO A;  1QMA A;  4LYL B;  2BT3 A;  5CF2 A;  1FGQ A;  3FCS B;  3D9R A;  4J5K A;  3S29 A;  1A2P A;  1LOX A;  4BIR A;  4FMD A;  5ELU A;  3QK9 A;  4HM2 B;  4RNY A;  3CCU 3;  4BTY A;  1BGS A;  1ZGX A;  2CWT A;  2RGQ A;  1W5Z A;  1M1K 4;  1CYV A;  1X1X A;  2AAE A;  1YJ9 3;  3TDG A;  3S28 A;  1BRS A;  2UGI A;  4EXR A;  3N9H A;  4K1U A;  3V98 A;  1VQP 3;  1W6Y A;  1C54 A;  1BRK A;  2UX0 A;  1LOW A;  1B27 A;  1UCJ A;  3H3H A;  3ROB A;  3FF2 A;  1RGL A;  4HOH A;  1YI2 3;  1V58 A;  1RDS A;  1AVK A;  2P05 A;  1QJG A;  4H61 A;  4I5Q A;  4HZ9 B;  4XM4 A;  1YIJ 3;  4R9K A;  5EVH A;  5IEN A;  3GZX B;  4HKV B;  1N8R 4;  1Q7H A;  1V57 A;  1BAO A;  3B4P A;  4RNT A;  1GOY A;  1JRQ A;  3M8C A;  1S72 3;  1CEW I;  1E3R A;  2CFG A;  1SAR A;  1BAN A;  1STF I;  1UGH I;  4LMI A;  4GB5 A;  2KCD A;  1W7C A;  1VQ4 3;  5AYR B;  1LOY A;  3FSD A;  3BNC A;  2RCD A;  2XGL A;  1I3F A;  1W01 A;  2A15 A;  4BTW A;  1W4N A;  3EB8 A;  3SED A;  1I0X A;  5D82 A;  3V99 A;  3OXA A;  1FYS A;  2H0I A;  3QRD A;  1EKM A;  4MEI A;  4HM1 B;  3GRD A;  1MWS A;  4R1K A;  3GWR A;  3KE7 A;  3UL5 A;  2OTL 3;  3O8Y A;  4BL2 A;  5TGN A;  1WQL B;  3SOA A;  4WYK B;  3MWZ A;  3A5E A;  1UDI I;  3GSP A;  3PS8 A;  3CC4 3;  1JKG B;  1TJD A;  4WP5 A;  3PCS A;  1DET A;  4J8T A;  1BSA A;  1LXE A;  1M90 4;  3Q90 A;  4MJD A;  1YJW 3;  1RCL A;  4HM3 B;  4L7K A;  3PXM A;  1IDP A;  3F14 A;  1RRH A;  1BSC A;  3FH1 A;  3CMA 3;  1GY7 A;  1DVC A;  1JV2 B;  2W03 A;  1IT8 A;  2HOH A;  4WFO A;  5LC7 A;  3DGL A;  2CC3 A;  5CK6 A;  3WR2 A;  4O3V A;  2BO9 B;  2CW9 A;  5BXQ A;  1I2F A;  2ZHX B;  3LZA A;  3WMD A;  1US1 A;  3F8X A;  1B21 A;  1EEJ A;  2OQE C;  3BLZ A;  1GD4 A;  2CWV A;  2YX9 A;  2RBI A;  1G02 A;  3FF0 A;  4L8P A;  1A2V A;  2QGU A;  2XSH B;  1VQ9 3;  1IU7 A;  1IT7 A;  1OF5 A;  1R4Y A;  3WA2 X;  1WNH A;  4HBR A;  4WHA A;  3UL6 A;  1OGX A;  4R9L A;  1JZD A;  3JVC A;  1Q40 A;  4AKY A;  1SQW A;  1B20 A;  3VF1 A;  1BRJ A;  1LQM B;  1NDO B;  3JUP A;  2HMM B;  3N54 B;  5STD A;  1T3B A;  3NV0 A;  4G1M B;  1OAC A;  3S67 A;  1RCK A;  4AEQ A;  1RRL A;  2GBW B;  3HZP A;  1RN1 A;  2KRT A;  3Q3F A;  1OHO A;  1FGO A;  4J5G A;  1KD1 4;  1X1U A;  1EA2 A;  3EJV A;  3FG4 A;  4H3U A;  3SVA A;  4FCZ A;  5RNT A;  1NO3 A;  2FNQ A;  1M9G A;  3DH2 A;  2XFT A;  3EQQ B;  3OX9 A;  1Y4K A;  1L5G B;  3RGR A;  3EHC A;  2E2V A;  1UCL A;  3KII A;  1OHP A;  1IVV A;  3DXO A;  2CWU A;  1VQO 3;  1A90 A;  2XF3 A;  3SYU A;  1UI7 A;  2KF6 A;  1W2Z A;  2YFI B;  5AIH A;  3IPT A;  2ML6 A;  5AYS C;  4EYC A;  2B24 B;  3DGY A;  2K3D A;  3HK4 A;  1BNE A;  3LTB A;  4HYZ A;  3CCM 3;  1BNF A;  1JB2 A;  2F86 B;  1UCI A;  1G96 A;  3DGM A;  4N6L A;  5M18 A;  3FG3 A;  3B4O A;  3RNT A;  1QVF 2;  2IY2 A;  2XGN A;  1QAK A;  1K73 4;  1RN7 A;  3V92 A;  3AGN A;  3RDE A;  1FUS A;  3DM8 A;  1OHS A;  1UGI A;  1T5Y A;  5JPU A;  1JNQ A;  3IJE B;  1RSN A;  2BIR A;  3STD A;  1DMM A;  3X3Y A;  5M1A A;  4L8O A;  3CPO A;  2HMJ B;  4BL3 A;  3N8B A;  1X1Y A;  3BND A;  4HJL B;  1YHQ 3;  1RGE A;  3BNB A;  1R4C A;  2CK3 H;  4QWT A;  1OUN A;  1RGK A;  3F7X A;  2W9Q A;  3MG3 A;  3JUN A;  1FGR A;  1KC8 4;  1NU3 A;  1RN4 A;  1K41 A;  1AQZ A;  1BSE A;  1RGA A;  1ROA A;  2L4V A;  1T2I A;  1KQS 2;  1GD3 A;  3EN8 A;  4HM5 B;  8CHO A;  2GU3 A;  1RLS A;  2WO0 A;  3CC2 3;  5AIF A;  5AI1 A;  1DVD A;  1BRG A;  3LTA A;  2PZV A;  2GBX B;  3VGN A;  3SXX A;  2IA7 A;  1ISK A;  1AV4 A;  1MOL A;  4KZ1 A;  3FLJ A;  1LRA A;  3ZG0 A;  4ORL A;  1SII A;  7STD A;  3DUK A;  4XBX A;  2K54 A;  1YJN 3;  3CCJ 3;  4KFE A;  2HML B;  2W0Q A;  1K9M 4;  1Q9E A;  2F4Y A;  1TP6 A;  1TTO A;  3LML A;  2F5W A;  3NBJ A;  3UB1 A;  4FR9 A;  4I4K A;  3CD6 3;  4OUQ A;  2STD A;  1U8C B;  2IYJ A;  2BNG A;  3PZW A;  2C11 A;  3GZR A;  3T0U A;  1CH0 A;  5DRV A;  1OF5 B;  3I56 3;  1O7N B;  1W6G A;  3AMO A;  5M19 A;  4GHO A;  1U5O A;  2Z77 A;  1C7H A;  1IVW A;  1GMR A;  1UUW B;  1WMN A;  4JRF A;  1K28 A;  3WOD G;  1TRQ A;  1Q40 B;  1CYU A;  2OWP A;  4KFF A;  1BNS A;  2OTJ 3;  2WOH A;  3NV0 B;  3NBB A;  1FA3 A;  1MGR A;  1RGH A;  1A67 A;  3FKA A;  2K0M A;  1B2Z A;  2CFW A;  4BTX A;  1GMQ A;  1RNT A;  3WHO A;  3S5C A;  4MMX B;  4RBN A;  2QIY A;  3X3Z A;  3PCR A;  2SBL A;  2C4B A;  3EE1 A;  3X3X A;  1Q7Y 4;  3OW2 2;  3OV4 A;  4HM8 B;  5G2G A;  1IYY A;  1AY7 A;  3I0Y A;  5LC6 A;  3LH4 A;  2C10 A;  4LSO A;  3CME 3;  2P38 A;  1NNV A;  4O2H A;  3CU3 A;  1RGF A;  3URP A;  1JB4 A;  2CFL A;  4EW5 A;  4IIA A;  1SIH A;  1RNB A;  1BIR A;  3G16 A;  3EBT A;  2OOV A;  1IQX A;  1N5H A;  2GXF A;  1RMS A;  3Q1C A;  2BMO B;  3F7S A;  2JDI H;  1CQS A;  1IQY A;  2CHC A;  3HI7 A;  2CX0 A;  2E2U A;  3SOY A;  3X42 A;  2GEX A;  3G6E 3;  1M1X B;  1YGE A;  4LEH A;  1KSI A;  4MMZ B;  2D1W A;  3IMA B;  3BNE A;  3ALA A;  5IF6 A;  1VQL 3;  4BU4 A;  1O7P B;  4RNZ A;  1TIJ A;  3CNX A;  1JB5 A;  4TX4 A;  1RTU A;  2FXT A;  3L0R A;  1GSP A;  2QEX 3;  1LQG C;  2HMO B;  4KVH A;  2BMQ B;  3FG1 A;  4Q53 A;  5IG3 A;  4EV2 A;  4XBY A;  2XFS A;  3NQZ A;  1V74 A;  1B2S A;  1STD A;  5EQL A;  2W56 A;  1BUQ A;  1D6Y A;  3K63 A;  4EBG A;  3PGB A;  1Q42 A;  1GMP A;  2WGQ A;  1VQK 3;  2XSO B;  3DY5 A;  5G1L A;  1MWT A;  1BRI A;  1WTH A;  5CF1 A;  1UI8 A;  5KP4 A;  2E2T A;  1JBT A;  1B3S A;  1RHL A;  1VQM 3;  2KF3 A;  4PEJ A;  1W6C A;  3K9M C;  4NRE A;  4R80 A;  4HAA A;  1LVN A;  2B1X B;  1LNH A;  6GSP A;  1YVB I;  8RNT A;  3CCQ 3;  4X2O A;  1BNJ A;  5AIG A;  1E3V A;  1WMP A;  3JUM A;  3EBY A;  3BU4 A;  4N3V A;  2SAR A;  3WDG B;  3D79 A;  1TUH A;  1J2B A;  2YFJ B;  2I9W A;  1BSB A;  2ZL8 A;  3AGO A;  7GSP A;  1N5P A;  3D5G A;  3G0K A;  1LOV A;  1UCK A;  3NQY A;  4KFD A;  4DKI A;  2AAD A;  3CPW 2;  4ILF A;  1A2K A;  3ZG5 A;  1OH0 A;  2KAA A;  2Y74 A;  1ZX2 A;  4IPB A;  3ER7 A;  1PYL A;  3GZB A;  5IW9 A;  9RNT A;  2ML5 A;  3MYT A;  1ZO2 A;  5KP3 A;  1ZS7 A;  5IEO A;  5IG4 A;  5BIR A;  1I2G A;  4GSP A;  6STD A;  1UUG B;  4CCV A;  2HMN B;  3A76 A;  5BVB A;  1I3I A;  4FMC A;  1HU9 A;  1BRH A;  1LNI A;  1GS3 A;  1SJW A;  2GU1 A;  3OWY A;  4X2H A;  5AEU B;  1GY5 A;  3PYJ A;  4HM6 B;  1FUW A;  1D6U A;  1D6Z A;  3KSP A;  3LOY A;  2WOF A;  2XEP A;  2J8X B;  5JPP A;  3EX9 A;  2OCT A;  1SPU A;  3F8H A;  1MNL A;  3KFQ C;  5KP1 A;  2OQE A;  2R4I A;  1HYF A;  2QA4 3;  1GYB A;  1YIT 3;  1HZ1 A;  4N6N B;  3FZW A;  3DGN A;  1YNV X;  1IV7 A;  5HOH A;  1IQ8 A;  2CFD A;  1WMO A;  3CXC 2;  1Q81 4;  4O8S A;  4K90 B;  3CCV 3;  3SX1 A;  3G71 3;  4CJN A;  2D42 A;  2IMJ A;  2H0G A;  3UNL A;  4FCM A;  1B2X A;  4HM7 B;  5FW5 A;  1NB3 I;  3VSY A;  1O7G B;  3LTC A;  3I55 3;  4OK0 A;  1B2U A;  1FGT A;  3EC9 A;  1E97 A;  1YGW A;  2P0X A;  4EV5 A;  1MWU A;  3ECF A;  2IUK A;  1JJ2 2;  1X1W A;  1PU4 A;  1RKY A;  1N8Q A;  3LT9 A;  1O7M B;  3ZFZ A;  2M7O A;  2RSX A;  2O9U X;  2CG0 A;  3K5T A;  4CDL A;  1TU5 A;  5EEO A;  3JUO A;  1ULJ B;  1OPY A;  3GAX A;  5DRE A;  2ZA4 A;  1YVS A;  4MMY B;  4R4K A;  2GEY A;  1FZU A;  1GOV A;  4HVN A;  1VQN 3;  1EUI C;  1ASK A;  1BOX A;  1JZO A;  4FMA A;  2IUJ A;  1JN5 A;  2BU4 A;  2W56 B;  3WOF B;  2UUG C;  6RNT A;  1BVI A;  1GY6 A;  1VQ7 3;  1RGC A;  5AEW B;  3KKG A;  3NHX A;  3RGA A;  4RZM A;  1RJO A;  1Q82 4;  3SLU A;  2KF5 A;  1B2M A;  4XDV A;  1BU4 A; 
#chains in the Genus database with same CATH homology
 2V1L A;  1VQ6 3;  4K1V A;  2CFK A;  1N9J A;  1UW1 A;  2XR8 B;  1W00 A;  2BHM A;  5IER A;  3NX0 A;  1VQ8 3;  3KZT A;  2BMR B;  2O3O A;  4JF8 A;  3MKI A;  3NM2 A;  1NB5 I;  4HZB B;  2CIU A;  3LXU X;  3T8N A;  1O7W B;  3MHE A;  3G4S 3;  3LYG A;  3KN4 A;  2Z7A A;  2F99 A;  3CCR 3;  3NXJ A;  1W2B 2;  1TFK A;  5CXO A;  1IVX A;  1QAF A;  3S27 A;  3K0Z A;  2F98 A;  5IG5 A;  2Q07 A;  2W6J H;  3NUV A;  1OCV A;  3NBR A;  1HKX A;  5JBS A;  1IK3 A;  4O02 B;  1EQK A;  3U1W A;  3JUQ A;  1DYU A;  1ULI B;  3E99 A;  3MG1 A;  3CCL 3;  4HM4 B;  3T8U A;  3B7C A;  5HGR A;  1Q86 4;  2FGT A;  1UUV B;  3HII A;  4N6O B;  2RFR A;  1DMQ A;  3UJM A;  1OGZ A;  3U97 A;  1TFO A;  1FGM A;  2W04 A;  3X41 A;  3WA3 A;  4XB5 A;  2XH9 A;  4NHF A;  1IVU A;  5A0O B;  3LT8 A;  1AR0 A;  3BB9 A;  2PNC A;  2CH9 A;  2LYX A;  1QVG 2;  1VQ5 3;  4N6T A;  3EN1 B;  2W2C A;  4STD A;  2YFL B;  3NM7 A;  2P0M A;  1AVL A;  1NWW A;  3MG2 A;  4N6V 0;  4IT7 A;  3DZL A;  4N6U A;  4XDW A;  4AKZ A;  3CNM A;  4WWU C;  4WYK A;  1Z1S A;  5IG0 A;  2WGO A;  1JKG A;  4J9A A;  1S5A A;  2JQ5 A;  3K7C A;  3EF8 A;  4GL6 A;  1F8N A;  3F40 A;  3HX8 A;  3LTD A;  2ZDJ A;  1O7H B;  3G8Z A;  5AII A;  2XRX B;  4U13 A;  1VZZ A;  2MC8 A;  3WOE B;  5D81 A;  3CC7 3;  3OWS A;  3AMO B;  4EC6 A;  4FMB A;  2HMK B;  3OWU A;  5ELJ A;  2KXG A;  3MPH A;  3KSE D;  1EG9 B;  4N6M A;  5CLK A;  3DMC A;  1NJI 4;  3H51 A;  3FGY A;  2Z76 A;  3D3L A;  3F9S A;  4HM0 B;  3J7Y d;  3HIG A;  1IV9 A;  2CG1 A;  4ZM8 A;  1W02 A;  5I97 A;  3DGO A;  2LQV A;  1JN5 B;  3CCE 3;  1DMN A;  2W9P A;  2OOV C;  1N9E A;  4OVM A;  4XBT A;  1QAL A;  1ROV A;  5D83 A;  1K8A 4;  3CCS 3;  1KWI A;  3GZY B;  3X40 A;  2CKF B;  4K61 A;  4LGQ A;  3Q2P A;  2Z6B A;  3B8L A;  2MF7 A;  5IEP A;  4LZI A;  2INX A;  2P09 A;  5FGO A;  4FCJ A;  2Y73 A;  1PFP A;  3MSO A;  1QMA A;  5CF2 A;  2BT3 A;  1FGQ A;  3FCS B;  3D9R A;  3S29 A;  1LOX A;  4FMD A;  5ELU A;  3QK9 A;  4HM2 B;  4RNY A;  3CCU 3;  4BTY A;  2RGQ A;  2CWT A;  1W5Z A;  1M1K 4;  1CYV A;  1YJ9 3;  3TDG A;  3S28 A;  4EXR A;  3N9H A;  4K1U A;  3V98 A;  1VQP 3;  1W6Y A;  2UX0 A;  3ROB A;  3H3H A;  3FF2 A;  1YI2 3;  1AVK A;  2P05 A;  1QJG A;  4H61 A;  4HZ9 B;  4XM4 A;  1YIJ 3;  4R9K A;  5EVH A;  5IEN A;  3GZX B;  4HKV B;  1N8R 4;  3B4P A;  1JRQ A;  3M8C A;  1S72 3;  1CEW I;  1E3R A;  2CFG A;  1STF I;  4LMI A;  4GB5 A;  2KCD A;  1W7C A;  1VQ4 3;  5AYR B;  3FSD A;  3BNC A;  2RCD A;  2XGL A;  1W01 A;  2A15 A;  4BTW A;  1W4N A;  3EB8 A;  3SED A;  5D82 A;  3V99 A;  3OXA A;  3QRD A;  1EKM A;  4MEI A;  4HM1 B;  3GRD A;  4R1K A;  3GWR A;  3KE7 A;  3UL5 A;  2OTL 3;  3O8Y A;  5TGN A;  1WQL B;  3SOA A;  4WYK B;  3MWZ A;  3PS8 A;  3CC4 3;  1JKG B;  4WP5 A;  3PCS A;  4J8T A;  1LXE A;  1M90 4;  3Q90 A;  4MJD A;  1YJW 3;  4HM3 B;  4L7K A;  3PXM A;  1IDP A;  3F14 A;  1RRH A;  3FH1 A;  3CMA 3;  1GY7 A;  1DVC A;  1JV2 B;  2W03 A;  1IT8 A;  4WFO A;  5LC7 A;  3DGL A;  2CC3 A;  5CK6 A;  4O3V A;  2BO9 B;  2CW9 A;  5BXQ A;  3WMD A;  3LZA A;  1US1 A;  3F8X A;  2OQE C;  3BLZ A;  1GD4 A;  2CWV A;  2YX9 A;  3FF0 A;  4L8P A;  1A2V A;  2QGU A;  2XSH B;  1VQ9 3;  1IU7 A;  1IT7 A;  1OF5 A;  3WA2 X;  1WNH A;  4HBR A;  4WHA A;  3UL6 A;  1OGX A;  4R9L A;  3JVC A;  1Q40 A;  4AKY A;  1SQW A;  3VF1 A;  1NDO B;  3JUP A;  2HMM B;  3N54 B;  5STD A;  3NV0 A;  4G1M B;  1OAC A;  3S67 A;  4AEQ A;  1RRL A;  2GBW B;  3HZP A;  2KRT A;  1OHO A;  1FGO A;  1KD1 4;  1EA2 A;  3EJV A;  3FG4 A;  4H3U A;  3SVA A;  4FCZ A;  1NO3 A;  2FNQ A;  1M9G A;  2XFT A;  3EQQ B;  3OX9 A;  1Y4K A;  1L5G B;  3RGR A;  3EHC A;  2E2V A;  3KII A;  1OHP A;  1IVV A;  3DXO A;  2CWU A;  1VQO 3;  1A90 A;  2XF3 A;  1UI7 A;  2YFI B;  1W2Z A;  5AIH A;  5AYS C;  3IPT A;  2ML6 A;  4EYC A;  2B24 B;  3HK4 A;  3LTB A;  3CCM 3;  4HYZ A;  1JB2 A;  2F86 B;  1G96 A;  3DGM A;  4N6L A;  3FG3 A;  3B4O A;  1QVF 2;  2XGN A;  1QAK A;  1K73 4;  1RN7 A;  3V92 A;  3RDE A;  3DM8 A;  1OHS A;  1T5Y A;  5JPU A;  1JNQ A;  3IJE B;  3STD A;  1DMM A;  3X3Y A;  4L8O A;  3CPO A;  2HMJ B;  3N8B A;  3BND A;  4HJL B;  1YHQ 3;  3BNB A;  1R4C A;  2CK3 H;  4QWT A;  1OUN A;  3F7X A;  2W9Q A;  3MG3 A;  3JUN A;  1FGR A;  1KC8 4;  1NU3 A;  1K41 A;  1ROA A;  2L4V A;  1KQS 2;  1GD3 A;  3EN8 A;  4HM5 B;  8CHO A;  2GU3 A;  2WO0 A;  3CC2 3;  5AIF A;  5AI1 A;  1DVD A;  3LTA A;  2PZV A;  2GBX B;  3VGN A;  3SXX A;  2IA7 A;  1ISK A;  1AV4 A;  1MOL A;  4KZ1 A;  3FLJ A;  4ORL A;  1SII A;  7STD A;  3DUK A;  4XBX A;  2K54 A;  1YJN 3;  3CCJ 3;  4KFE A;  2HML B;  2W0Q A;  1K9M 4;  1TP6 A;  3LML A;  3NBJ A;  3UB1 A;  4FR9 A;  4I4K A;  3CD6 3;  4OUQ A;  2STD A;  1U8C B;  2BNG A;  3PZW A;  2C11 A;  3GZR A;  3T0U A;  5DRV A;  1OF5 B;  3I56 3;  1O7N B;  1W6G A;  3AMO A;  1U5O A;  2Z77 A;  1C7H A;  1IVW A;  1UUW B;  1WMN A;  4JRF A;  1K28 A;  3WOD G;  1CYU A;  1Q40 B;  2OWP A;  4KFF A;  2OTJ 3;  2WOH A;  3NV0 B;  3NBB A;  1FA3 A;  1A67 A;  3FKA A;  2K0M A;  2CFW A;  4BTX A;  3S5C A;  4MMX B;  4RBN A;  2QIY A;  3X3Z A;  3PCR A;  2SBL A;  3EE1 A;  3X3X A;  1Q7Y 4;  3OW2 2;  3OV4 A;  4HM8 B;  5G2G A;  3I0Y A;  5LC6 A;  3LH4 A;  2C10 A;  4LSO A;  3CME 3;  2P38 A;  4O2H A;  3CU3 A;  1JB4 A;  2CFL A;  4IIA A;  1SIH A;  3G16 A;  3EBT A;  2OOV A;  1IQX A;  1N5H A;  2GXF A;  3Q1C A;  2BMO B;  3F7S A;  2JDI H;  1CQS A;  1IQY A;  2CHC A;  3HI7 A;  2E2U A;  3SOY A;  3X42 A;  2GEX A;  3G6E 3;  1M1X B;  1YGE A;  4LEH A;  1KSI A;  4MMZ B;  2D1W A;  3IMA B;  3BNE A;  3ALA A;  5IF6 A;  1VQL 3;  1O7P B;  4RNZ A;  1TIJ A;  3CNX A;  1JB5 A;  4TX4 A;  2FXT A;  3L0R A;  2QEX 3;  4Q53 A;  2HMO B;  4KVH A;  2BMQ B;  3FG1 A;  5IG3 A;  4EV2 A;  4XBY A;  2XFS A;  3NQZ A;  1V74 A;  1STD A;  5EQL A;  1BUQ A;  2W56 A;  1D6Y A;  3K63 A;  4EBG A;  3PGB A;  1Q42 A;  2WGQ A;  1VQK 3;  2XSO B;  3DY5 A;  1WTH A;  5CF1 A;  1UI8 A;  5KP4 A;  2E2T A;  1VQM 3;  4PEJ A;  1W6C A;  3K9M C;  4NRE A;  4R80 A;  1LVN A;  1LNH A;  2B1X B;  1YVB I;  3CCQ 3;  4X2O A;  5AIG A;  1E3V A;  1WMP A;  3JUM A;  3EBY A;  4N3V A;  3WDG B;  1TUH A;  1J2B A;  2YFJ B;  2I9W A;  2ZL8 A;  1N5P A;  3G0K A;  3NQY A;  4KFD A;  3CPW 2;  1A2K A;  1OH0 A;  2Y74 A;  1ZX2 A;  4IPB A;  3ER7 A;  3GZB A;  5IW9 A;  2ML5 A;  3MYT A;  1ZO2 A;  5KP3 A;  5IG4 A;  5IEO A;  6STD A;  4CCV A;  2HMN B;  3A76 A;  5BVB A;  4FMC A;  1HU9 A;  1SJW A;  2GU1 A;  1GS3 A;  3OWY A;  4X2H A;  5AEU B;  1GY5 A;  3PYJ A;  4HM6 B;  1FUW A;  1D6U A;  1D6Z A;  3KSP A;  3LOY A;  2WOF A;  2XEP A;  5JPP A;  3EX9 A;  2OCT A;  1SPU A;  3F8H A;  1MNL A;  3KFQ C;  5KP1 A;  2OQE A;  2R4I A;  2QA4 3;  1GYB A;  1YIT 3;  4N6N B;  3FZW A;  3DGN A;  1IV7 A;  1Q81 4;  1IQ8 A;  2CFD A;  1WMO A;  3CXC 2;  4O8S A;  4K90 B;  3CCV 3;  3SX1 A;  3G71 3;  2D42 A;  2IMJ A;  3UNL A;  4FCM A;  4HM7 B;  5FW5 A;  1NB3 I;  3VSY A;  1O7G B;  3LTC A;  3I55 3;  4OK0 A;  1FGT A;  3EC9 A;  1E97 A;  2P0X A;  4EV5 A;  3ECF A;  2IUK A;  1JJ2 2;  1PU4 A;  1RKY A;  1N8Q A;  3LT9 A;  1O7M B;  2M7O A;  2RSX A;  2O9U X;  2CG0 A;  3K5T A;  4CDL A;  1TU5 A;  5EEO A;  3JUO A;  1ULJ B;  1OPY A;  3GAX A;  5DRE A;  4R4K A;  4MMY B;  2GEY A;  4HVN A;  1VQN 3;  1ASK A;  4FMA A;  2IUJ A;  1JN5 A;  2W56 B;  3WOF B;  1GY6 A;  1VQ7 3;  5AEW B;  3KKG A;  3NHX A;  3RGA A;  4RZM A;  1RJO A;  1Q82 4;  3SLU A;  4XDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...