2QEX3

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qex300
1VQK3 1YIJ3 1K9M4 1VQ83 1KD14 2OTJ3 1Q814 1QVF2 3I563 3CCV3 1Q864 3CC73 3CPW2 1QVG2 3CMA3 2OTL3 2QEX3 1M1K4 3CCR3 1YJN3 3CME3 3CXC2 1VQ53 3CC23 1Q7Y4 1YJ93 3CCJ3 1K8A4 1YI23 2QA43 1YIT3 1W2B2 1N8R4 1KQS2 3CC43 1VQ63 1YHQ3 1VQL3 1VQ73 1VQN3 3CCU3 1K734 1JJ22 3CCL3 1VQM3 1VQ43 3G4S3 3OW22 1VQP3 3CCS3 3G6E3 3CCM3 1VQO3 1KC84 3G713 1NJI4 1VQ93 3CD63 3I553 3CCE3 3CCQ3 1M904 1YJW3 1Q824 1S723
chains in the Genus database with same CATH superfamily
5AEUB 4IPBA 4GB5A 3JUQA 4I5QA 1VQ83 3FLJA 4JRFA 3I563 1UCIA 2CWVA 1W6GA 4J5KA 3CPW2 2K3DA 3AHWA 4H3UA 5IERA 2XGNA 4AKZA 1MWTA 1D6UA 5CK6A 1YJN3 1SIIA 5D83A 1IQ8A 1CEWI 3LTAA 4N3VA 5LC6A 3WR2A 1KSIA 1WMOA 1PYLA 1N8R4 1VZZA 1MOLA 4N6LA 1TU5A 2XSOB 1Q9EA 1K734 3ROBA 1SIHA 4LGQA 1OF5B 3G16A 4G1MB 4L8OA 4RNTA 4HZBB 2Z77A 1BSAA 2R41A 4J5GA 3S27A 2OOVC 4K90B 4EXRA 3IPTA 1RMSA 1B2MA 2O3OA 1N5HA 3UNLA 1G96A 3EBTA 1QVF2 1IYYA 1TFOA 1RN4A 3FG3A 1ROVA 1YNVX 1Q864 3CC73 2FXTA 1BANA 5EEOA 7RNTA 1BNFA 2P38A 3X41A 2F4YA 2F98A 2HMOB 2SARA 3NUVA 4LMIA 2W56B 5BIRA 3PGBA 4OUQA 1BRKA 1N5PA 1ULIB 2HMLB 1YJ93 1U5OA 2WGQA 4XBXA 1VQ63 2HMKB 1CQSA 5IEOA 1VQ73 1D6YA 1LOXA 1BSDA 1O7NB 2GEXA 3GZRA 4BIRA 3D79A 2Z6BA 3HX8A 2WGOA 3DUKA 1GOUA 3I0YA 5IF6A 1NJI4 3I553 2YFLB 5HOHA 1LXEA 1QAKA 1BRJA 1B2ZA 3EHCA 5AIHA 1OPYA 4HAAA 6RNTA 1L5GB 2LYXA 1SJWA 2UX0A 1NB5I 2CG0A 1GY6A 4EV5A 2WOFA 1FGOA 2IY2A 1BNGA 3CPOA 3CCV3 2XFSA 4HYZA 2ML6A 3J7Yd 2H0IA 2UGIA 4OVMA 2C11A 4GL6A 2OOVA 1EUIC 1UCKA 2OQEC 1WMNA 4XDWA 4XDVA 3SEDA 2CIUA 1O7HB 1RSNA 3HK4A 4HBRA 3X40A 3N8BA 1JN5A 1AVKA 2F5MA 1JBTA 5CLKA 1HZ1A 3U97A 5IENA 3OX9A 3LOYA 3DH2A 4EW5A 2RNTA 1GOVA 1GMQA 1SARA 1I0VA 2RBIA 3F7SA 3TDGA 3FH1A 3UL5A 3F8XA 4BL2A 1BNEA 1Q7HA 3KE7A 3AHSA 1TRPA 3SOAA 3D5GA 3Q90A 5GSPA 3ALAA 1LOWA 5TGNA 1JKGA 1OGXA 3CNMA 1OHSA 1RJOA 1X1XA 2IMJA 4BTXA 6STDA 2KF4A 3BNCA 2KF3A 4IIAA 1N9JA 1M9GA 2ZHXB 4N6MA 4ILFA 3SLUA 4HM4B 1KQS2 2W9QA 3LH4A 2QA43 3RGAA 3MPHA 3S5CA 5FGOA 3IJEB 5FW5A 1PY3A 1RTUA 4MMZB 4O02B 5IEPA 4I4KA 3T8UA 3KFQC 5JPUA 5M19A 3OW22 1JJ22 2PNCA 3CCS3 1RCLA 1SPUA 3STDA 2E2VA 3T8NA 1YVBI 4AEQA 4XB5A 3MG1A 3LT8A 1EQKA 2IUJA 1LOVA 1FW7A 4FR9A 1UUVB 2GU1A 3Q2PA 4RZMA 3GWRA 1B3SA 1S5AA 4LZIA 5DRVA 1LRAA 3RNTA 2XRXB 1OF5A 3N54B 4FCZA 2C4BA 3FF2A 2W0QA 1OHOA 4FCJA 2O9UX 3CCR3 4BTYA 4QWTA 1CYVA 1KWIA 2XGLA 1UI7A 1RNTA 2FGTA 4EYCA 3GSPA 1IVWA 1X1YA 2IUKA 3HI7A 1RGHA 2BNGA 2A15A 1DMQA 1OUNA 4R9LA 3B7CA 3LXUX 1EG9B 1GY5A 1IVUA 3CC43 1VQM3 1V57A 1STFI 4BU4A 3CCM3 1BIRA 4X2OA 4BTWA 5AEWB 1VQ93 3KSPA 2XR8B 1ASKA 3KCHA 3L0RA 3ZG0A 1NNVA 2K0MA 1UI8A 3K63A 4ZM8A 2W9PA 5IW9A 3EE1A 1BNJA 3G0KA 1X1WA 3AMOB 1QAFA 4N6TA 3CMA3 4HM8B 2E2TA 1I2GA 3N9HA 3PS8A 4LSOA 1M1K4 5G1LA 1QALA 3KN4A 3CXC2 1FUWA 1SQWA 3KIIA 2P05A 4RBNA 1PFPA 2HOHA 2MC8A 1K8A4 3OXAA 1G02A 1UCJA 1G0TA 2SBLA 4X2HA 1OCVA 1T5YA 3K9MC 1VQ43 4KFDA 3RGRA 4NHFA 5G1KA 3JUMA 2YFJB 5I97A 1PU4A 2BT3A 4LEHA 4STDA 3EN1B 3GZYB 4R1KA 1E3RA 2XH9A 3BLZA 3BNBA 1J2BA 1AV4A 1YJW3 1Q824 1BRSA 3PYJA 1S723 1IU7A 2KF6A 3SYUA 2OWPA 3U1WA 3D3LA 1I3FA 4FMCA 3UB1A 1DVDA 3GAXA 5AIGA 1K28A 2ZL8A 4K1VA 1STDA 2Y73A 3MHEA 4MJDA 3PXMA 6GSPA 5IG0A 1RGLA 2CHCA 3MG3A 5BXQA 3EQQB 2W03A 3NV0A 4R9KA 3FF0A 4MEIA 5AYSC 2P09A 1M1XB 1R4YA 3F40A 2BMOB 2CKFB 2Z7AA 1VQN3 1MWSA 3G4S3 1JZOA 2BHMA 2I9WA 3DXOA 2BO9B 5ELJA 4N6NB 3A5EA 1FA3A 1IQXA 1US1A 1BGSA 4HM2B 4OK0A 3H3HA 4PEJA 1Q7Y4 5CXOA 7STDA 3FKAA 1YIJ3 1X1UA 1UUWB 3JUNA 3FG4A 4HOHA 3DY5A 4KFFA 2F56A 1TP6A 4EC6A 4HM0B 1FGTA 2BIRA 1I8VA 2W04A 4Q53A 3NBJA 1GSPA 3K7CA 5G2GA 3MG2A 2YFIB 2RGQA 2CFDA 4HM5B 4K1UA 2CFKA 5IG3A 3EB8A 1Z1SA 3FGYA 1RGFA 2J8XB 3JUOA 1YI23 3GZXB 1VQL3 1W02A 4O8SA 2H0HA 2BU4A 4IT7A 3EN8A 1RDSA 2CG1A 1TUHA 3CCQ3 1IDPA 4GSPA 2CX0A 2CWUA 1M904 1MWUA 3NV0B 2CC3A 2GSPA 3DMCA 1YGEA 4XM4A 3X3XA 2OTJ3 2C10A 2K54A 1EA2A 5D81A 3E99A 3CU3A 5KP1A 1UDII 1UUGB 3AGNA 1HKXA 1T3BA 3T0UA 1Q42A 3CME3 3SVAA 1VQ53 2KRTA 1ZO2A 4CJNA 2CW9A 4N6UA 1WMPA 1I2EA 1FZUA 1LNIA 1N9EA 4L7KA 3FZWA 1W2ZA 1BRNL 1T2HA 2B1XB 3AMOA 3CD63 3G6E3 3O8YA 1DETA 3KZTA 2JDIH 2CX1A 4FMAA 4HZ9B 1BRIA 1OH0A 2L4VA 3X3YA 3BNEA 2B24B 2GXFA 1RKYA 1K9M4 1JNQA 3M8CA 1W4NA 4KT3B 3B4PA 1I70A 2F86B 1LQMB 1DVCA 1RGAA 1FUTA 1NO3A 1JV2B 2GBWB 3DGYA 1I0XA 4HVNA 3B8LA 1DMMA 1BVIA 3FSDA 1IK3A 2GBXB 3D4AA 5IG5A 1EEJA 1RNBA 3EJVA 1K41A 2ML5A 2IYJA 2D42A 4O2HA 5DREA 5M18A 1W01A 1UW1A 1IT8A 1ZGXA 1A90A 5AYRB 2P0XA 1Y4KA 2BMRB 1LVNA 3D9RA 4CDLA 4CPKA 3WA3A 1JB4A 3X3ZA 1LOYA 3OWUA 2WO0A 2QGUA 3NQZA 1WNHA 5EVHA 5M1AA 1Q814 1ZX2A 3WODG 5AIIA 4AKYA 1A2PA 3ZG5A 3LTCA 2QEX3 1GY7A 2XEPA 3SXXA 1GOYA 3PZWA 1BU4A 5AI1A 1NWWA 1B20A 3DGOA 5AIFA 1UGIA 1BSEA 1NB3I 1R4CA 1YGWA 1YVSA 1BUQA 2P0MA 1UGHI 1BRHA 1UCLA 3LYGA 3S28A 1KC84 3DGMA 1QJGA 3VGNA 3HOHA 3BU4A 3LMLA 4N6V0 3S67A 3ER7A 4HM6B 3HIGA 3NM2A 1RHLA 2AAEA 5CF2A 1RRLA 4XBTA 4HM3B 4RNZA 5EQLA 1JBSA 1D6ZA 3EX9A 3F9SA 4KVHA 1NU3A 1MGWA 2QIYA 3F8HA 1FGRA 3VSYA 3LTBA 3GRDA 1O7PB 2JQ5A 3WMDA 2YX9A 3CC23 1C7HA 2V1LA 4GHOA 5BVBA 3JUPA 1B2XA 2M7OA 1W2B2 2INXA 3BB9A 2XSHB 1CH0A 1GYBA 3NBRA 3NX0A 1BNIA 1VQP3 2RSXA 2E2UA 5RNTA 3CNXA 4NPBA 2CWTA 2WOHA 1JB2A 3B4OA 3CCE3 4R80A 1GS3A 1OGZA 1VQQA 3BNDA 2Q07A 3NHXA 2ZDJA 3DGNA 4RNYA 4WP5A 5STDA 2H0GA 3K5TA 1ISKA 1IVXA 3QK9A 1U8CB 3DM8A 3EF8A 3H51A 1T2IA 3DGLA 1KD14 3LZAA 4WWUC 1Q40A 1BSBA 1DYUA 1RGCA 2RFRA 1TTOA 2FNQA 2KF5A 3BIRA 3KKGA 3F14A 1DE3A 1JBRA 2CFGA 2GEYA 4WYKA 3NQYA 4O3VA 1BNSA 1OACA 1N8QA 1W5ZA 5KP4A 4KZ1A 3A76A 1GMRA 8RNTA 3KSED 1GD4A 2ZA4A 3HZPA 3ECFA 1AY7A 1V58A 1TRQA 1W00A 1EKMA 2HMJB 3EBYA 3URPA 3K0ZA 1GD3A 2KXGA 1OHPA 1MWRA 1JZDA 4EBGA 1VQO3 1TJDA 3WA2X 3NXJA 1CYUA 1IT7A 1A2VA 5CF1A 8CHOA 2KCDA 1FGQA 1IVVA 5JBSA 3MSOA 1IQYA 3SOYA 1RGGA 4CCVA 1MGRA 1W6YA 3Q3FA 1RRHA 2OCTA 4H61A 2L1SA 1AQZA 4HKVB 1RCKA 3V92A 3ZFZA 1QVG2 2OTL3 1JB5A 1RN7A 3D5IA 1BRGA 3X42A 1TFKA 5IG4A 1BNRA 4J8TA 4LYLB 2XF3A 4BL3A 1WTHA 3PCRA 5ELUA 2R4IA 3CCJ3 1AR0A 1B2UA 1RN1A 2HMMB 2W2CA 5BU4A 1HU9A 1FGMA 1YHQ3 1ROAA 4J9AA 4L8PA 1Q40B 1C54A 2LQVA 1ZS7A 2F5WA 3RDEA 3SX1A 4NREA 2CK3H 1MNLA 2Y74A 2GU3A 1BOXA 2BMQB 4WYKB 3Q1CA 4MMYB 4HM1B 4JF8A 3MKIA 1HYFA 3WDGB 3IMAB 1A2KA 3S29A 1O7MB 3NBBA 1GMPA 2CFLA 2HMNB 1B27A 7GSPA 2CFWA 1IV7A 1LQGC 1E97A 2MF7A 2CH9A 3FG1A 3G8ZA 1I3IA 9RNTA 1WQLB 3GZBA 4WFOA 3LT9A 2KAAA 4MMXB 3AGOA 1LNHA 3OWYA 1YIT3 1TIJA 5HGRA 4ORLA 3MYTA 3WHOA 2Z76A 3CCL3 1I2FA 3FCSB 2F99A 4FMBA 2OQEA 2RCDA 4R4KA 1NDOB 5KP3A 1E3VA 5D82A 4WHAA 1O7WB 2XFTA 4FCMA 4HM7B 3OWSA 1RGKA 4XBYA 1VQK3 1F8NA 3V99A 3F7XA 4FMDA 1RLSA 4K61A 1FYSA 3LTDA 3UL6A 1IV9A 1JN5B 5A0OB 3NM7A 1BAOA 3VF1A 5JPPA 2W6JH 2PZVA 1DMNA 4DKIA 3V98A 3OV4A 4U13A 2D1WA 1B2SA 1BSCA 2IA7A 1FUSA 1B21A 2UUGC 2AADA 1O7GB 1RGEA 1ULJB 4N6OB 4HJLB 3PCSA 4TX4A 3HIIA 4EV2A 2STDA 1W7CA 5LC7A 3CCU3 3JVCA 4KFEA 1V74A 1BUJA 3WOFB 1W6CA 3WOEB 1A67A 3G713 1JKGB 3MWZA 2W56A 1AVLA 3EC9A 3UJMA 3QRDA 1JRQA 1QMAA 3DZLA
chains in the Genus database with same CATH topology
5AEUB 4IPBA 4GB5A 3JUQA 1VQ83 3FLJA 4JRFA 3I563 2CWVA 1W6GA 3CPW2 4H3UA 5IERA 2XGNA 4AKZA 1D6UA 5CK6A 1YJN3 1SIIA 5D83A 1IQ8A 1CEWI 3LTAA 4N3VA 5LC6A 1KSIA 1WMOA 1N8R4 1VZZA 1MOLA 4N6LA 1TU5A 2XSOB 1K734 3ROBA 1SIHA 4LGQA 1OF5B 3G16A 4G1MB 4L8OA 4HZBB 2Z77A 3S27A 4EXRA 2OOVC 4K90B 3IPTA 2O3OA 1N5HA 3UNLA 1G96A 3EBTA 1QVF2 1TFOA 3FG3A 1ROVA 1Q864 3CC73 2FXTA 5EEOA 2P38A 3X41A 2F98A 2HMOB 3NUVA 4LMIA 2W56B 3PGBA 4OUQA 1ULIB 1N5PA 2HMLB 1YJ93 1U5OA 2WGQA 4XBXA 1VQ63 2HMKB 1CQSA 5IEOA 1VQ73 1D6YA 1LOXA 1O7NB 2GEXA 3GZRA 3HX8A 2Z6BA 5IF6A 2WGOA 3DUKA 3I0YA 1NJI4 3I553 2YFLB 1LXEA 1QAKA 3EHCA 5AIHA 1OPYA 1L5GB 2LYXA 1SJWA 2UX0A 1NB5I 2CG0A 1GY6A 4EV5A 2WOFA 1FGOA 3CPOA 3CCV3 2XFSA 4HYZA 2ML6A 3J7Yd 4OVMA 2C11A 4GL6A 2OOVA 2OQEC 1WMNA 4XDWA 4XDVA 3SEDA 2CIUA 1O7HB 3HK4A 4HBRA 3X40A 3N8BA 1JN5A 1AVKA 5CLKA 3U97A 5IENA 3OX9A 3LOYA 3F7SA 3TDGA 3FH1A 3F8XA 3KE7A 3SOAA 3Q90A 3ALAA 5TGNA 1JKGA 1OGXA 3CNMA 1OHSA 1RJOA 4BTXA 2IMJA 6STDA 3BNCA 4IIAA 1N9JA 1M9GA 4N6MA 3SLUA 4HM4B 1KQS2 2W9QA 3LH4A 2QA43 3RGAA 3MPHA 3S5CA 5FGOA 3IJEB 5FW5A 5IEPA 4MMZB 4O02B 5JPUA 4I4KA 3T8UA 3KFQC 1JJ22 3OW22 2PNCA 3CCS3 1SPUA 3STDA 2E2VA 3T8NA 1YVBI 4AEQA 4XB5A 3MG1A 3LT8A 1EQKA 2IUJA 4FR9A 1UUVB 2GU1A 3Q2PA 4RZMA 3GWRA 1S5AA 4LZIA 5DRVA 2XRXB 1OF5A 3N54B 4FCZA 3FF2A 2W0QA 1OHOA 4FCJA 2O9UX 3CCR3 4BTYA 4QWTA 1CYVA 1KWIA 2XGLA 1UI7A 4EYCA 2FGTA 1IVWA 2IUKA 3HI7A 2BNGA 2A15A 1DMQA 1OUNA 4R9LA 3B7CA 3LXUX 1EG9B 1GY5A 1IVUA 3CC43 1VQM3 1STFI 3CCM3 4X2OA 4BTWA 5AEWB 1VQ93 3KSPA 2XR8B 1ASKA 3L0RA 2K0MA 1UI8A 3K63A 4ZM8A 2W9PA 5IW9A 3EE1A 3G0KA 3AMOB 1QAFA 4N6TA 3CMA3 4HM8B 2E2TA 3N9HA 3PS8A 4LSOA 1M1K4 1QALA 3KN4A 3CXC2 1FUWA 1SQWA 3KIIA 2P05A 4RBNA 1PFPA 2MC8A 1K8A4 3OXAA 2SBLA 4X2HA 1OCVA 1T5YA 3K9MC 1VQ43 4KFDA 3RGRA 4NHFA 3JUMA 2YFJB 5I97A 1PU4A 2BT3A 4LEHA 4STDA 3EN1B 3GZYB 4R1KA 1E3RA 2XH9A 3BLZA 3BNBA 1J2BA 1AV4A 1YJW3 1Q824 3PYJA 1S723 1IU7A 2OWPA 3U1WA 3D3LA 4FMCA 3UB1A 1DVDA 3GAXA 5AIGA 1K28A 2ZL8A 4K1VA 1STDA 2Y73A 3MHEA 4MJDA 3PXMA 5IG0A 2CHCA 3MG3A 5BXQA 3EQQB 2W03A 3NV0A 4R9KA 3FF0A 4MEIA 5AYSC 2P09A 1M1XB 3F40A 2BMOB 2CKFB 2Z7AA 1VQN3 3G4S3 2BHMA 2I9WA 3DXOA 2BO9B 5ELJA 4N6NB 1FA3A 1IQXA 1US1A 4OK0A 4HM2B 3H3HA 4PEJA 1Q7Y4 5CXOA 7STDA 3FKAA 1YIJ3 1UUWB 3JUNA 3FG4A 3DY5A 4KFFA 1TP6A 4EC6A 4HM0B 1FGTA 2W04A 4Q53A 3NBJA 3K7CA 5G2GA 3MG2A 2YFIB 2RGQA 2CFDA 4HM5B 4K1UA 2CFKA 5IG3A 3EB8A 1Z1SA 3FGYA 1YI23 3JUOA 3GZXB 1VQL3 1W02A 4O8SA 4IT7A 3EN8A 2CG1A 1TUHA 3CCQ3 1IDPA 2CWUA 1M904 3NV0B 2CC3A 3DMCA 1YGEA 4XM4A 3X3XA 2OTJ3 2C10A 2K54A 1EA2A 5D81A 3E99A 3CU3A 5KP1A 1HKXA 3T0UA 1Q42A 3CME3 3SVAA 1VQ53 2KRTA 1ZO2A 2CW9A 4N6UA 1WMPA 1N9EA 4L7KA 3FZWA 1W2ZA 2B1XB 3AMOA 3CD63 3G6E3 3O8YA 3KZTA 2JDIH 4FMAA 4HZ9B 2L4VA 1OH0A 3X3YA 3BNEA 2B24B 2GXFA 1RKYA 1K9M4 1JNQA 3M8CA 1W4NA 3B4PA 2F86B 1DVCA 1NO3A 1JV2B 2GBWB 4HVNA 3B8LA 1DMMA 3FSDA 1IK3A 2GBXB 5IG5A 3EJVA 1K41A 2ML5A 2D42A 4O2HA 5DREA 1W01A 1UW1A 1IT8A 1A90A 5AYRB 2P0XA 1Y4KA 2BMRB 1LVNA 3D9RA 4CDLA 3WA3A 1JB4A 3X3ZA 3OWUA 2WO0A 2QGUA 3NQZA 1WNHA 5EVHA 1Q814 1ZX2A 3WODG 5AIIA 4AKYA 3LTCA 2QEX3 1GY7A 2XEPA 3SXXA 3PZWA 5AI1A 1NWWA 3DGOA 5AIFA 1NB3I 1R4CA 1BUQA 2P0MA 1KC84 3LYGA 3S28A 3DGMA 1QJGA 3VGNA 4N6V0 3LMLA 3S67A 3ER7A 4HM6B 3HIGA 3NM2A 5CF2A 1RRLA 4XBTA 4HM3B 4RNZA 5EQLA 1D6ZA 3EX9A 3F9SA 4KVHA 1NU3A 2QIYA 3F8HA 1FGRA 3VSYA 3LTBA 3GRDA 1O7PB 2JQ5A 3WMDA 2YX9A 3CC23 1C7HA 2V1LA 5BVBA 3JUPA 2M7OA 1W2B2 2INXA 3BB9A 2XSHB 1GYBA 3NBRA 3NX0A 1VQP3 2RSXA 2E2UA 3CNXA 2CWTA 2WOHA 1JB2A 3B4OA 3CCE3 4R80A 1GS3A 1OGZA 3BNDA 2Q07A 3NHXA 2ZDJA 3DGNA 4RNYA 4WP5A 5STDA 3K5TA 1ISKA 1IVXA 3QK9A 1U8CB 3DM8A 3EF8A 3H51A 3DGLA 1KD14 3LZAA 4WWUC 1Q40A 1DYUA 2RFRA 2FNQA 3KKGA 3F14A 2CFGA 2GEYA 4WYKA 3NQYA 4O3VA 1OACA 1N8QA 1W5ZA 5KP4A 4KZ1A 3A76A 3KSED 1GD4A 3HZPA 3ECFA 1W00A 2HMJB 1EKMA 3EBYA 3K0ZA 1GD3A 2KXGA 1OHPA 4EBGA 1VQO3 3WA2X 3NXJA 1CYUA 1IT7A 1A2VA 5CF1A 8CHOA 2KCDA 1FGQA 1IVVA 5JBSA 3MSOA 1IQYA 3SOYA 4CCVA 1W6YA 1RRHA 2OCTA 4H61A 4HKVB 1QVG2 3V92A 2OTL3 1JB5A 1RN7A 3X42A 5IG4A 1TFKA 4J8TA 2XF3A 1WTHA 3PCRA 5ELUA 2R4IA 3CCJ3 1AR0A 2HMMB 2W2CA 1HU9A 1FGMA 1YHQ3 1ROAA 4J9AA 4L8PA 1Q40B 2LQVA 3SX1A 3RDEA 4NREA 2CK3H 1MNLA 2Y74A 2GU3A 4WYKB 2BMQB 3Q1CA 4MMYB 4HM1B 4JF8A 3MKIA 3WDGB 3IMAB 1A2KA 3S29A 1O7MB 3NBBA 2CFLA 2HMNB 2CFWA 1IV7A 1E97A 2MF7A 2CH9A 3FG1A 3G8ZA 1WQLB 3GZBA 4WFOA 3LT9A 4MMXB 3OWYA 1LNHA 1YIT3 1TIJA 5HGRA 4ORLA 3MYTA 2Z76A 3CCL3 3FCSB 2F99A 4FMBA 2OQEA 2RCDA 4R4KA 1NDOB 5KP3A 1E3VA 5D82A 4WHAA 1O7WB 2XFTA 4FCMA 4HM7B 3OWSA 4XBYA 1VQK3 1F8NA 3V99A 3F7XA 4FMDA 4K61A 3LTDA 3UL6A 1IV9A 1JN5B 5A0OB 3NM7A 3VF1A 5JPPA 2W6JH 2PZVA 1DMNA 3V98A 3OV4A 4U13A 2D1WA 2IA7A 3UL5A 4TX4A 1O7GB 1ULJB 4N6OB 4HJLB 3PCSA 3HIIA 4EV2A 2STDA 1W7CA 5LC7A 3CCU3 3JVCA 4KFEA 1V74A 3WOFB 1W6CA 3WOEB 1A67A 3G713 1JKGB 3MWZA 2W56A 1AVLA 3EC9A 3UJMA 3QRDA 1JRQA 1QMAA 3DZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK 3;  1YIJ 3;  1K9M 4;  1VQ8 3;  1KD1 4;  2OTJ 3;  1Q81 4;  1QVF 2;  3I56 3;  3CCV 3;  1Q86 4;  3CC7 3;  3CPW 2;  1QVG 2;  3CMA 3;  2OTL 3;  2QEX 3;  1M1K 4;  3CCR 3;  1YJN 3;  3CME 3;  3CXC 2;  1VQ5 3;  3CC2 3;  1Q7Y 4;  1YJ9 3;  3CCJ 3;  1K8A 4;  1YI2 3;  2QA4 3;  1YIT 3;  1W2B 2;  1N8R 4;  1KQS 2;  3CC4 3;  1VQ6 3;  1YHQ 3;  1VQL 3;  1VQ7 3;  1VQN 3;  3CCU 3;  1K73 4;  1JJ2 2;  3CCL 3;  1VQM 3;  1VQ4 3;  3G4S 3;  3OW2 2;  1VQP 3;  3CCS 3;  3G6E 3;  3CCM 3;  1VQO 3;  1KC8 4;  3G71 3;  1NJI 4;  1VQ9 3;  3CD6 3;  3I55 3;  3CCE 3;  3CCQ 3;  1M90 4;  1YJW 3;  1Q82 4;  1S72 3; 
#chains in the Genus database with same CATH topology
 5AEU B;  4IPB A;  4GB5 A;  3JUQ A;  4I5Q A;  1VQ8 3;  3FLJ A;  4JRF A;  3I56 3;  1UCI A;  2CWV A;  1W6G A;  4J5K A;  3CPW 2;  2K3D A;  3AHW A;  4H3U A;  5IER A;  2XGN A;  4AKZ A;  1MWT A;  1D6U A;  5CK6 A;  1YJN 3;  1SII A;  5D83 A;  1IQ8 A;  1CEW I;  3LTA A;  4N3V A;  5LC6 A;  3WR2 A;  1KSI A;  1WMO A;  1PYL A;  1N8R 4;  1VZZ A;  1MOL A;  4N6L A;  1TU5 A;  2XSO B;  1Q9E A;  1K73 4;  3ROB A;  1SIH A;  4LGQ A;  1OF5 B;  3G16 A;  4G1M B;  4L8O A;  4RNT A;  4HZB B;  2Z77 A;  1BSA A;  2R41 A;  4J5G A;  3S27 A;  2OOV C;  4K90 B;  4EXR A;  3IPT A;  1RMS A;  1B2M A;  2O3O A;  1N5H A;  3UNL A;  1G96 A;  3EBT A;  1QVF 2;  1IYY A;  1TFO A;  1RN4 A;  3FG3 A;  1ROV A;  1YNV X;  1Q86 4;  3CC7 3;  2FXT A;  1BAN A;  5EEO A;  7RNT A;  1BNF A;  2P38 A;  3X41 A;  2F4Y A;  2F98 A;  2HMO B;  2SAR A;  3NUV A;  4LMI A;  2W56 B;  5BIR A;  3PGB A;  4OUQ A;  1BRK A;  1N5P A;  1ULI B;  2HML B;  1YJ9 3;  1U5O A;  2WGQ A;  4XBX A;  1VQ6 3;  2HMK B;  1CQS A;  5IEO A;  1VQ7 3;  1D6Y A;  1LOX A;  1BSD A;  1O7N B;  2GEX A;  3GZR A;  4BIR A;  3D79 A;  2Z6B A;  3HX8 A;  2WGO A;  3DUK A;  1GOU A;  3I0Y A;  5IF6 A;  1NJI 4;  3I55 3;  2YFL B;  5HOH A;  1LXE A;  1QAK A;  1BRJ A;  1B2Z A;  3EHC A;  5AIH A;  1OPY A;  4HAA A;  6RNT A;  1L5G B;  2LYX A;  1SJW A;  2UX0 A;  1NB5 I;  2CG0 A;  1GY6 A;  4EV5 A;  2WOF A;  1FGO A;  2IY2 A;  1BNG A;  3CPO A;  3CCV 3;  2XFS A;  4HYZ A;  2ML6 A;  3J7Y d;  2H0I A;  2UGI A;  4OVM A;  2C11 A;  4GL6 A;  2OOV A;  1EUI C;  1UCK A;  2OQE C;  1WMN A;  4XDW A;  4XDV A;  3SED A;  2CIU A;  1O7H B;  1RSN A;  3HK4 A;  4HBR A;  3X40 A;  3N8B A;  1JN5 A;  1AVK A;  2F5M A;  1JBT A;  5CLK A;  1HZ1 A;  3U97 A;  5IEN A;  3OX9 A;  3LOY A;  3DH2 A;  4EW5 A;  2RNT A;  1GOV A;  1GMQ A;  1SAR A;  1I0V A;  2RBI A;  3F7S A;  3TDG A;  3FH1 A;  3UL5 A;  3F8X A;  4BL2 A;  1BNE A;  1Q7H A;  3KE7 A;  3AHS A;  1TRP A;  3SOA A;  3D5G A;  3Q90 A;  5GSP A;  3ALA A;  1LOW A;  5TGN A;  1JKG A;  1OGX A;  3CNM A;  1OHS A;  1RJO A;  1X1X A;  2IMJ A;  4BTX A;  6STD A;  2KF4 A;  3BNC A;  2KF3 A;  4IIA A;  1N9J A;  1M9G A;  2ZHX B;  4N6M A;  4ILF A;  3SLU A;  4HM4 B;  1KQS 2;  2W9Q A;  3LH4 A;  2QA4 3;  3RGA A;  3MPH A;  3S5C A;  5FGO A;  3IJE B;  5FW5 A;  1PY3 A;  1RTU A;  4MMZ B;  4O02 B;  5IEP A;  4I4K A;  3T8U A;  3KFQ C;  5JPU A;  5M19 A;  3OW2 2;  1JJ2 2;  2PNC A;  3CCS 3;  1RCL A;  1SPU A;  3STD A;  2E2V A;  3T8N A;  1YVB I;  4AEQ A;  4XB5 A;  3MG1 A;  3LT8 A;  1EQK A;  2IUJ A;  1LOV A;  1FW7 A;  4FR9 A;  1UUV B;  2GU1 A;  3Q2P A;  4RZM A;  3GWR A;  1B3S A;  1S5A A;  4LZI A;  5DRV A;  1LRA A;  3RNT A;  2XRX B;  1OF5 A;  3N54 B;  4FCZ A;  2C4B A;  3FF2 A;  2W0Q A;  1OHO A;  4FCJ A;  2O9U X;  3CCR 3;  4BTY A;  4QWT A;  1CYV A;  1KWI A;  2XGL A;  1UI7 A;  1RNT A;  2FGT A;  4EYC A;  3GSP A;  1IVW A;  1X1Y A;  2IUK A;  3HI7 A;  1RGH A;  2BNG A;  2A15 A;  1DMQ A;  1OUN A;  4R9L A;  3B7C A;  3LXU X;  1EG9 B;  1GY5 A;  1IVU A;  3CC4 3;  1VQM 3;  1V57 A;  1STF I;  4BU4 A;  3CCM 3;  1BIR A;  4X2O A;  4BTW A;  5AEW B;  1VQ9 3;  3KSP A;  2XR8 B;  1ASK A;  3KCH A;  3L0R A;  3ZG0 A;  1NNV A;  2K0M A;  1UI8 A;  3K63 A;  4ZM8 A;  2W9P A;  5IW9 A;  3EE1 A;  1BNJ A;  3G0K A;  1X1W A;  3AMO B;  1QAF A;  4N6T A;  3CMA 3;  4HM8 B;  2E2T A;  1I2G A;  3N9H A;  3PS8 A;  4LSO A;  1M1K 4;  5G1L A;  1QAL A;  3KN4 A;  3CXC 2;  1FUW A;  1SQW A;  3KII A;  2P05 A;  4RBN A;  1PFP A;  2HOH A;  2MC8 A;  1K8A 4;  3OXA A;  1G02 A;  1UCJ A;  1G0T A;  2SBL A;  4X2H A;  1OCV A;  1T5Y A;  3K9M C;  1VQ4 3;  4KFD A;  3RGR A;  4NHF A;  5G1K A;  3JUM A;  2YFJ B;  5I97 A;  1PU4 A;  2BT3 A;  4LEH A;  4STD A;  3EN1 B;  3GZY B;  4R1K A;  1E3R A;  2XH9 A;  3BLZ A;  3BNB A;  1J2B A;  1AV4 A;  1YJW 3;  1Q82 4;  1BRS A;  3PYJ A;  1S72 3;  1IU7 A;  2KF6 A;  3SYU A;  2OWP A;  3U1W A;  3D3L A;  1I3F A;  4FMC A;  3UB1 A;  1DVD A;  3GAX A;  5AIG A;  1K28 A;  2ZL8 A;  4K1V A;  1STD A;  2Y73 A;  3MHE A;  4MJD A;  3PXM A;  6GSP A;  5IG0 A;  1RGL A;  2CHC A;  3MG3 A;  5BXQ A;  3EQQ B;  2W03 A;  3NV0 A;  4R9K A;  3FF0 A;  4MEI A;  5AYS C;  2P09 A;  1M1X B;  1R4Y A;  3F40 A;  2BMO B;  2CKF B;  2Z7A A;  1VQN 3;  1MWS A;  3G4S 3;  1JZO A;  2BHM A;  2I9W A;  3DXO A;  2BO9 B;  5ELJ A;  4N6N B;  3A5E A;  1FA3 A;  1IQX A;  1US1 A;  1BGS A;  4HM2 B;  4OK0 A;  3H3H A;  4PEJ A;  1Q7Y 4;  5CXO A;  7STD A;  3FKA A;  1YIJ 3;  1X1U A;  1UUW B;  3JUN A;  3FG4 A;  4HOH A;  3DY5 A;  4KFF A;  2F56 A;  1TP6 A;  4EC6 A;  4HM0 B;  1FGT A;  2BIR A;  1I8V A;  2W04 A;  4Q53 A;  3NBJ A;  1GSP A;  3K7C A;  5G2G A;  3MG2 A;  2YFI B;  2RGQ A;  2CFD A;  4HM5 B;  4K1U A;  2CFK A;  5IG3 A;  3EB8 A;  1Z1S A;  3FGY A;  1RGF A;  2J8X B;  3JUO A;  1YI2 3;  3GZX B;  1VQL 3;  1W02 A;  4O8S A;  2H0H A;  2BU4 A;  4IT7 A;  3EN8 A;  1RDS A;  2CG1 A;  1TUH A;  3CCQ 3;  1IDP A;  4GSP A;  2CX0 A;  2CWU A;  1M90 4;  1MWU A;  3NV0 B;  2CC3 A;  2GSP A;  3DMC A;  1YGE A;  4XM4 A;  3X3X A;  2OTJ 3;  2C10 A;  2K54 A;  1EA2 A;  5D81 A;  3E99 A;  3CU3 A;  5KP1 A;  1UDI I;  1UUG B;  3AGN A;  1HKX A;  1T3B A;  3T0U A;  1Q42 A;  3CME 3;  3SVA A;  1VQ5 3;  2KRT A;  1ZO2 A;  4CJN A;  2CW9 A;  4N6U A;  1WMP A;  1I2E A;  1FZU A;  1LNI A;  1N9E A;  4L7K A;  3FZW A;  1W2Z A;  1BRN L;  1T2H A;  2B1X B;  3AMO A;  3CD6 3;  3G6E 3;  3O8Y A;  1DET A;  3KZT A;  2JDI H;  2CX1 A;  4FMA A;  4HZ9 B;  1BRI A;  1OH0 A;  2L4V A;  3X3Y A;  3BNE A;  2B24 B;  2GXF A;  1RKY A;  1K9M 4;  1JNQ A;  3M8C A;  1W4N A;  4KT3 B;  3B4P A;  1I70 A;  2F86 B;  1LQM B;  1DVC A;  1RGA A;  1FUT A;  1NO3 A;  1JV2 B;  2GBW B;  3DGY A;  1I0X A;  4HVN A;  3B8L A;  1DMM A;  1BVI A;  3FSD A;  1IK3 A;  2GBX B;  3D4A A;  5IG5 A;  1EEJ A;  1RNB A;  3EJV A;  1K41 A;  2ML5 A;  2IYJ A;  2D42 A;  4O2H A;  5DRE A;  5M18 A;  1W01 A;  1UW1 A;  1IT8 A;  1ZGX A;  1A90 A;  5AYR B;  2P0X A;  1Y4K A;  2BMR B;  1LVN A;  3D9R A;  4CDL A;  4CPK A;  3WA3 A;  1JB4 A;  3X3Z A;  1LOY A;  3OWU A;  2WO0 A;  2QGU A;  3NQZ A;  1WNH A;  5EVH A;  5M1A A;  1Q81 4;  1ZX2 A;  3WOD G;  5AII A;  4AKY A;  1A2P A;  3ZG5 A;  3LTC A;  2QEX 3;  1GY7 A;  2XEP A;  3SXX A;  1GOY A;  3PZW A;  1BU4 A;  5AI1 A;  1NWW A;  1B20 A;  3DGO A;  5AIF A;  1UGI A;  1BSE A;  1NB3 I;  1R4C A;  1YGW A;  1YVS A;  1BUQ A;  2P0M A;  1UGH I;  1BRH A;  1UCL A;  3LYG A;  3S28 A;  1KC8 4;  3DGM A;  1QJG A;  3VGN A;  3HOH A;  3BU4 A;  3LML A;  4N6V 0;  3S67 A;  3ER7 A;  4HM6 B;  3HIG A;  3NM2 A;  1RHL A;  2AAE A;  5CF2 A;  1RRL A;  4XBT A;  4HM3 B;  4RNZ A;  5EQL A;  1JBS A;  1D6Z A;  3EX9 A;  3F9S A;  4KVH A;  1NU3 A;  1MGW A;  2QIY A;  3F8H A;  1FGR A;  3VSY A;  3LTB A;  3GRD A;  1O7P B;  2JQ5 A;  3WMD A;  2YX9 A;  3CC2 3;  1C7H A;  2V1L A;  4GHO A;  5BVB A;  3JUP A;  1B2X A;  2M7O A;  1W2B 2;  2INX A;  3BB9 A;  2XSH B;  1CH0 A;  1GYB A;  3NBR A;  3NX0 A;  1BNI A;  1VQP 3;  2RSX A;  2E2U A;  5RNT A;  3CNX A;  4NPB A;  2CWT A;  2WOH A;  1JB2 A;  3B4O A;  3CCE 3;  4R80 A;  1GS3 A;  1OGZ A;  1VQQ A;  3BND A;  2Q07 A;  3NHX A;  2ZDJ A;  3DGN A;  4RNY A;  4WP5 A;  5STD A;  2H0G A;  3K5T A;  1ISK A;  1IVX A;  3QK9 A;  1U8C B;  3DM8 A;  3EF8 A;  3H51 A;  1T2I A;  3DGL A;  1KD1 4;  3LZA A;  4WWU C;  1Q40 A;  1BSB A;  1DYU A;  1RGC A;  2RFR A;  1TTO A;  2FNQ A;  2KF5 A;  3BIR A;  3KKG A;  3F14 A;  1DE3 A;  1JBR A;  2CFG A;  2GEY A;  4WYK A;  3NQY A;  4O3V A;  1BNS A;  1OAC A;  1N8Q A;  1W5Z A;  5KP4 A;  4KZ1 A;  3A76 A;  1GMR A;  8RNT A;  3KSE D;  1GD4 A;  2ZA4 A;  3HZP A;  3ECF A;  1AY7 A;  1V58 A;  1TRQ A;  1W00 A;  1EKM A;  2HMJ B;  3EBY A;  3URP A;  3K0Z A;  1GD3 A;  2KXG A;  1OHP A;  1MWR A;  1JZD A;  4EBG A;  1VQO 3;  1TJD A;  3WA2 X;  3NXJ A;  1CYU A;  1IT7 A;  1A2V A;  5CF1 A;  8CHO A;  2KCD A;  1FGQ A;  1IVV A;  5JBS A;  3MSO A;  1IQY A;  3SOY A;  1RGG A;  4CCV A;  1MGR A;  1W6Y A;  3Q3F A;  1RRH A;  2OCT A;  4H61 A;  2L1S A;  1AQZ A;  4HKV B;  1RCK A;  3V92 A;  3ZFZ A;  1QVG 2;  2OTL 3;  1JB5 A;  1RN7 A;  3D5I A;  1BRG A;  3X42 A;  1TFK A;  5IG4 A;  1BNR A;  4J8T A;  4LYL B;  2XF3 A;  4BL3 A;  1WTH A;  3PCR A;  5ELU A;  2R4I A;  3CCJ 3;  1AR0 A;  1B2U A;  1RN1 A;  2HMM B;  2W2C A;  5BU4 A;  1HU9 A;  1FGM A;  1YHQ 3;  1ROA A;  4J9A A;  4L8P A;  1Q40 B;  1C54 A;  2LQV A;  1ZS7 A;  2F5W A;  3RDE A;  3SX1 A;  4NRE A;  2CK3 H;  1MNL A;  2Y74 A;  2GU3 A;  1BOX A;  2BMQ B;  4WYK B;  3Q1C A;  4MMY B;  4HM1 B;  4JF8 A;  3MKI A;  1HYF A;  3WDG B;  3IMA B;  1A2K A;  3S29 A;  1O7M B;  3NBB A;  1GMP A;  2CFL A;  2HMN B;  1B27 A;  7GSP A;  2CFW A;  1IV7 A;  1LQG C;  1E97 A;  2MF7 A;  2CH9 A;  3FG1 A;  3G8Z A;  1I3I A;  9RNT A;  1WQL B;  3GZB A;  4WFO A;  3LT9 A;  2KAA A;  4MMX B;  3AGO A;  1LNH A;  3OWY A;  1YIT 3;  1TIJ A;  5HGR A;  4ORL A;  3MYT A;  3WHO A;  2Z76 A;  3CCL 3;  1I2F A;  3FCS B;  2F99 A;  4FMB A;  2OQE A;  2RCD A;  4R4K A;  1NDO B;  5KP3 A;  1E3V A;  5D82 A;  4WHA A;  1O7W B;  2XFT A;  4FCM A;  4HM7 B;  3OWS A;  1RGK A;  4XBY A;  1VQK 3;  1F8N A;  3V99 A;  3F7X A;  4FMD A;  1RLS A;  4K61 A;  1FYS A;  3LTD A;  3UL6 A;  1IV9 A;  1JN5 B;  5A0O B;  3NM7 A;  1BAO A;  3VF1 A;  5JPP A;  2W6J H;  2PZV A;  1DMN A;  4DKI A;  3V98 A;  3OV4 A;  4U13 A;  2D1W A;  1B2S A;  1BSC A;  2IA7 A;  1FUS A;  1B21 A;  2UUG C;  2AAD A;  1O7G B;  1RGE A;  1ULJ B;  4N6O B;  4HJL B;  3PCS A;  4TX4 A;  3HII A;  4EV2 A;  2STD A;  1W7C A;  5LC7 A;  3CCU 3;  3JVC A;  4KFE A;  1V74 A;  1BUJ A;  3WOF B;  1W6C A;  3WOE B;  1A67 A;  3G71 3;  1JKG B;  3MWZ A;  2W56 A;  1AVL A;  3EC9 A;  3UJM A;  3QRD A;  1JRQ A;  1QMA A;  3DZL A; 
#chains in the Genus database with same CATH homology
 5AEU B;  4IPB A;  4GB5 A;  3JUQ A;  1VQ8 3;  3FLJ A;  4JRF A;  3I56 3;  2CWV A;  1W6G A;  3CPW 2;  4H3U A;  5IER A;  2XGN A;  4AKZ A;  1D6U A;  5CK6 A;  1YJN 3;  1SII A;  5D83 A;  1IQ8 A;  1CEW I;  3LTA A;  4N3V A;  5LC6 A;  1KSI A;  1WMO A;  1N8R 4;  1VZZ A;  1MOL A;  4N6L A;  1TU5 A;  2XSO B;  1K73 4;  3ROB A;  1SIH A;  4LGQ A;  1OF5 B;  3G16 A;  4G1M B;  4L8O A;  4HZB B;  2Z77 A;  3S27 A;  4EXR A;  2OOV C;  4K90 B;  3IPT A;  2O3O A;  1N5H A;  3UNL A;  1G96 A;  3EBT A;  1QVF 2;  1TFO A;  3FG3 A;  1ROV A;  1Q86 4;  3CC7 3;  2FXT A;  5EEO A;  2P38 A;  3X41 A;  2F98 A;  2HMO B;  3NUV A;  4LMI A;  2W56 B;  3PGB A;  4OUQ A;  1ULI B;  1N5P A;  2HML B;  1YJ9 3;  1U5O A;  2WGQ A;  4XBX A;  1VQ6 3;  2HMK B;  1CQS A;  5IEO A;  1VQ7 3;  1D6Y A;  1LOX A;  1O7N B;  2GEX A;  3GZR A;  3HX8 A;  2Z6B A;  5IF6 A;  2WGO A;  3DUK A;  3I0Y A;  1NJI 4;  3I55 3;  2YFL B;  1LXE A;  1QAK A;  3EHC A;  5AIH A;  1OPY A;  1L5G B;  2LYX A;  1SJW A;  2UX0 A;  1NB5 I;  2CG0 A;  1GY6 A;  4EV5 A;  2WOF A;  1FGO A;  3CPO A;  3CCV 3;  2XFS A;  4HYZ A;  2ML6 A;  3J7Y d;  4OVM A;  2C11 A;  4GL6 A;  2OOV A;  2OQE C;  1WMN A;  4XDW A;  4XDV A;  3SED A;  2CIU A;  1O7H B;  3HK4 A;  4HBR A;  3X40 A;  3N8B A;  1JN5 A;  1AVK A;  5CLK A;  3U97 A;  5IEN A;  3OX9 A;  3LOY A;  3F7S A;  3TDG A;  3FH1 A;  3F8X A;  3KE7 A;  3SOA A;  3Q90 A;  3ALA A;  5TGN A;  1JKG A;  1OGX A;  3CNM A;  1OHS A;  1RJO A;  4BTX A;  2IMJ A;  6STD A;  3BNC A;  4IIA A;  1N9J A;  1M9G A;  4N6M A;  3SLU A;  4HM4 B;  1KQS 2;  2W9Q A;  3LH4 A;  2QA4 3;  3RGA A;  3MPH A;  3S5C A;  5FGO A;  3IJE B;  5FW5 A;  5IEP A;  4MMZ B;  4O02 B;  5JPU A;  4I4K A;  3T8U A;  3KFQ C;  1JJ2 2;  3OW2 2;  2PNC A;  3CCS 3;  1SPU A;  3STD A;  2E2V A;  3T8N A;  1YVB I;  4AEQ A;  4XB5 A;  3MG1 A;  3LT8 A;  1EQK A;  2IUJ A;  4FR9 A;  1UUV B;  2GU1 A;  3Q2P A;  4RZM A;  3GWR A;  1S5A A;  4LZI A;  5DRV A;  2XRX B;  1OF5 A;  3N54 B;  4FCZ A;  3FF2 A;  2W0Q A;  1OHO A;  4FCJ A;  2O9U X;  3CCR 3;  4BTY A;  4QWT A;  1CYV A;  1KWI A;  2XGL A;  1UI7 A;  4EYC A;  2FGT A;  1IVW A;  2IUK A;  3HI7 A;  2BNG A;  2A15 A;  1DMQ A;  1OUN A;  4R9L A;  3B7C A;  3LXU X;  1EG9 B;  1GY5 A;  1IVU A;  3CC4 3;  1VQM 3;  1STF I;  3CCM 3;  4X2O A;  4BTW A;  5AEW B;  1VQ9 3;  3KSP A;  2XR8 B;  1ASK A;  3L0R A;  2K0M A;  1UI8 A;  3K63 A;  4ZM8 A;  2W9P A;  5IW9 A;  3EE1 A;  3G0K A;  3AMO B;  1QAF A;  4N6T A;  3CMA 3;  4HM8 B;  2E2T A;  3N9H A;  3PS8 A;  4LSO A;  1M1K 4;  1QAL A;  3KN4 A;  3CXC 2;  1FUW A;  1SQW A;  3KII A;  2P05 A;  4RBN A;  1PFP A;  2MC8 A;  1K8A 4;  3OXA A;  2SBL A;  4X2H A;  1OCV A;  1T5Y A;  3K9M C;  1VQ4 3;  4KFD A;  3RGR A;  4NHF A;  3JUM A;  2YFJ B;  5I97 A;  1PU4 A;  2BT3 A;  4LEH A;  4STD A;  3EN1 B;  3GZY B;  4R1K A;  1E3R A;  2XH9 A;  3BLZ A;  3BNB A;  1J2B A;  1AV4 A;  1YJW 3;  1Q82 4;  3PYJ A;  1S72 3;  1IU7 A;  2OWP A;  3U1W A;  3D3L A;  4FMC A;  3UB1 A;  1DVD A;  3GAX A;  5AIG A;  1K28 A;  2ZL8 A;  4K1V A;  1STD A;  2Y73 A;  3MHE A;  4MJD A;  3PXM A;  5IG0 A;  2CHC A;  3MG3 A;  5BXQ A;  3EQQ B;  2W03 A;  3NV0 A;  4R9K A;  3FF0 A;  4MEI A;  5AYS C;  2P09 A;  1M1X B;  3F40 A;  2BMO B;  2CKF B;  2Z7A A;  1VQN 3;  3G4S 3;  2BHM A;  2I9W A;  3DXO A;  2BO9 B;  5ELJ A;  4N6N B;  1FA3 A;  1IQX A;  1US1 A;  4OK0 A;  4HM2 B;  3H3H A;  4PEJ A;  1Q7Y 4;  5CXO A;  7STD A;  3FKA A;  1YIJ 3;  1UUW B;  3JUN A;  3FG4 A;  3DY5 A;  4KFF A;  1TP6 A;  4EC6 A;  4HM0 B;  1FGT A;  2W04 A;  4Q53 A;  3NBJ A;  3K7C A;  5G2G A;  3MG2 A;  2YFI B;  2RGQ A;  2CFD A;  4HM5 B;  4K1U A;  2CFK A;  5IG3 A;  3EB8 A;  1Z1S A;  3FGY A;  1YI2 3;  3JUO A;  3GZX B;  1VQL 3;  1W02 A;  4O8S A;  4IT7 A;  3EN8 A;  2CG1 A;  1TUH A;  3CCQ 3;  1IDP A;  2CWU A;  1M90 4;  3NV0 B;  2CC3 A;  3DMC A;  1YGE A;  4XM4 A;  3X3X A;  2OTJ 3;  2C10 A;  2K54 A;  1EA2 A;  5D81 A;  3E99 A;  3CU3 A;  5KP1 A;  1HKX A;  3T0U A;  1Q42 A;  3CME 3;  3SVA A;  1VQ5 3;  2KRT A;  1ZO2 A;  2CW9 A;  4N6U A;  1WMP A;  1N9E A;  4L7K A;  3FZW A;  1W2Z A;  2B1X B;  3AMO A;  3CD6 3;  3G6E 3;  3O8Y A;  3KZT A;  2JDI H;  4FMA A;  4HZ9 B;  2L4V A;  1OH0 A;  3X3Y A;  3BNE A;  2B24 B;  2GXF A;  1RKY A;  1K9M 4;  1JNQ A;  3M8C A;  1W4N A;  3B4P A;  2F86 B;  1DVC A;  1NO3 A;  1JV2 B;  2GBW B;  4HVN A;  3B8L A;  1DMM A;  3FSD A;  1IK3 A;  2GBX B;  5IG5 A;  3EJV A;  1K41 A;  2ML5 A;  2D42 A;  4O2H A;  5DRE A;  1W01 A;  1UW1 A;  1IT8 A;  1A90 A;  5AYR B;  2P0X A;  1Y4K A;  2BMR B;  1LVN A;  3D9R A;  4CDL A;  3WA3 A;  1JB4 A;  3X3Z A;  3OWU A;  2WO0 A;  2QGU A;  3NQZ A;  1WNH A;  5EVH A;  1Q81 4;  1ZX2 A;  3WOD G;  5AII A;  4AKY A;  3LTC A;  2QEX 3;  1GY7 A;  2XEP A;  3SXX A;  3PZW A;  5AI1 A;  1NWW A;  3DGO A;  5AIF A;  1NB3 I;  1R4C A;  1BUQ A;  2P0M A;  1KC8 4;  3LYG A;  3S28 A;  3DGM A;  1QJG A;  3VGN A;  4N6V 0;  3LML A;  3S67 A;  3ER7 A;  4HM6 B;  3HIG A;  3NM2 A;  5CF2 A;  1RRL A;  4XBT A;  4HM3 B;  4RNZ A;  5EQL A;  1D6Z A;  3EX9 A;  3F9S A;  4KVH A;  1NU3 A;  2QIY A;  3F8H A;  1FGR A;  3VSY A;  3LTB A;  3GRD A;  1O7P B;  2JQ5 A;  3WMD A;  2YX9 A;  3CC2 3;  1C7H A;  2V1L A;  5BVB A;  3JUP A;  2M7O A;  1W2B 2;  2INX A;  3BB9 A;  2XSH B;  1GYB A;  3NBR A;  3NX0 A;  1VQP 3;  2RSX A;  2E2U A;  3CNX A;  2CWT A;  2WOH A;  1JB2 A;  3B4O A;  3CCE 3;  4R80 A;  1GS3 A;  1OGZ A;  3BND A;  2Q07 A;  3NHX A;  2ZDJ A;  3DGN A;  4RNY A;  4WP5 A;  5STD A;  3K5T A;  1ISK A;  1IVX A;  3QK9 A;  1U8C B;  3DM8 A;  3EF8 A;  3H51 A;  3DGL A;  1KD1 4;  3LZA A;  4WWU C;  1Q40 A;  1DYU A;  2RFR A;  2FNQ A;  3KKG A;  3F14 A;  2CFG A;  2GEY A;  4WYK A;  3NQY A;  4O3V A;  1OAC A;  1N8Q A;  1W5Z A;  5KP4 A;  4KZ1 A;  3A76 A;  3KSE D;  1GD4 A;  3HZP A;  3ECF A;  1W00 A;  2HMJ B;  1EKM A;  3EBY A;  3K0Z A;  1GD3 A;  2KXG A;  1OHP A;  4EBG A;  1VQO 3;  3WA2 X;  3NXJ A;  1CYU A;  1IT7 A;  1A2V A;  5CF1 A;  8CHO A;  2KCD A;  1FGQ A;  1IVV A;  5JBS A;  3MSO A;  1IQY A;  3SOY A;  4CCV A;  1W6Y A;  1RRH A;  2OCT A;  4H61 A;  4HKV B;  1QVG 2;  3V92 A;  2OTL 3;  1JB5 A;  1RN7 A;  3X42 A;  5IG4 A;  1TFK A;  4J8T A;  2XF3 A;  1WTH A;  3PCR A;  5ELU A;  2R4I A;  3CCJ 3;  1AR0 A;  2HMM B;  2W2C A;  1HU9 A;  1FGM A;  1YHQ 3;  1ROA A;  4J9A A;  4L8P A;  1Q40 B;  2LQV A;  3SX1 A;  3RDE A;  4NRE A;  2CK3 H;  1MNL A;  2Y74 A;  2GU3 A;  4WYK B;  2BMQ B;  3Q1C A;  4MMY B;  4HM1 B;  4JF8 A;  3MKI A;  3WDG B;  3IMA B;  1A2K A;  3S29 A;  1O7M B;  3NBB A;  2CFL A;  2HMN B;  2CFW A;  1IV7 A;  1E97 A;  2MF7 A;  2CH9 A;  3FG1 A;  3G8Z A;  1WQL B;  3GZB A;  4WFO A;  3LT9 A;  4MMX B;  3OWY A;  1LNH A;  1YIT 3;  1TIJ A;  5HGR A;  4ORL A;  3MYT A;  2Z76 A;  3CCL 3;  3FCS B;  2F99 A;  4FMB A;  2OQE A;  2RCD A;  4R4K A;  1NDO B;  5KP3 A;  1E3V A;  5D82 A;  4WHA A;  1O7W B;  2XFT A;  4FCM A;  4HM7 B;  3OWS A;  4XBY A;  1VQK 3;  1F8N A;  3V99 A;  3F7X A;  4FMD A;  4K61 A;  3LTD A;  3UL6 A;  1IV9 A;  1JN5 B;  5A0O B;  3NM7 A;  3VF1 A;  5JPP A;  2W6J H;  2PZV A;  1DMN A;  3V98 A;  3OV4 A;  4U13 A;  2D1W A;  2IA7 A;  3UL5 A;  4TX4 A;  1O7G B;  1ULJ B;  4N6O B;  4HJL B;  3PCS A;  3HII A;  4EV2 A;  2STD A;  1W7C A;  5LC7 A;  3CCU 3;  3JVC A;  4KFE A;  1V74 A;  3WOF B;  1W6C A;  3WOE B;  1A67 A;  3G71 3;  1JKG B;  3MWZ A;  2W56 A;  1AVL A;  3EC9 A;  3UJM A;  3QRD A;  1JRQ A;  1QMA A;  3DZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...