3SYUA

Re-refined coordinates for pdb entry 1det - ribonuclease t1 carboxymethylated at glu 58 in complex with 2'gmp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
102
Chain Sequence
CDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease T1
publication title Exploiting structure similarity in refinement: automated NCS and target-structure restraints in BUSTER.
pubmed doi rcsb
molecule tags Hydrolase
total genus 22
structure length 102
sequence length 103
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3syuA00
1RGGA 1LNIA 1RLSA 1X1WA 2F56A 2F4YA 5GSPA 3URPA 9RNTA 1HYFA 1GMPA 1R4YA 1RGFA 1LRAA 1RGHA 3AGNA 1MGWA 1RHLA 2KF4A 1I0VA 3WR2A 1BANA 1GMQA 1RMSA 1BVIA 1MGRA 1AY7A 5HOHA 1I3IA 3D5GA 1PY3A 1PYLA 2AADA 1IYYA 2BIRA 2C4BA 1GMRA 7GSPA 1FUTA 3AGOA 1TRQA 1BSAA 4HOHA 2F5MA 1YNVX 1BSEA 1GOVA 1Q9EA 2BU4A 1B27A 1A2PA 3SYUA 1I2FA 1RGLA 4BIRA 6GSPA 2AAEA 1FZUA 2RNTA 2GSPA 4J5KA 1I8VA 6RNTA 3BIRA 1BRGA 1BSDA 5BIRA 1B2ZA 4HAAA 1JBRA 1I70A 5BU4A 1HZ1A 1RDSA 1T2HA 1UCLA 1LOYA 4GSPA 7RNTA 1BNEA 4GHOA 1RNBA 1FW7A 1RGKA 1YVSA 1UCIA 3WHOA 5RNTA 1UCJA 2KF5A 8RNTA 1LOVA 1B21A 1BRKA 1BU4A 1FUSA 1B20A 1RGAA 3D4AA 1GSPA 1BNSA 1BNGA 1C54A 1BRHA 2F5WA 3DGYA 3Q3FA 2KAAA 1T2IA 1B2SA 1GOYA 1B2UA 1BRSA 1BSBA 1BGSA 1RGEA 1X1UA 1RCKA 1RN4A 2KF3A 1BIRA 1BOXA 1X1YA 1GOUA 4BU4A 1ZGXA 2ZA4A 3RNTA 1G02A 1B2XA 1BRNL 1TRPA 1RNTA 1LOWA 1YGWA 1DE3A 1RSNA 1I2EA 1I3FA 1TTOA 1FYSA 1X1XA 3GSPA 3DH2A 1BRIA 1CH0A 3AHWA 1BSCA 1BRJA 3A5EA 2SARA 3HOHA 1I2GA 1DETA 3AHSA 4J5GA 1B2MA 1BNRA 4RNTA 1UCKA 1SARA 1BNIA 3D5IA 1JBTA 1I0XA 1BNFA 2HOHA 1BAOA 1RN1A 3KCHA 1BUJA 3BU4A 1RTUA 1RGCA 1B3SA 2KF6A 1JBSA 2RBIA 1RCLA 1AQZA 1BNJA
chains in the Genus database with same CATH superfamily
3PCRA 2KCDA 2SBLA 1K8A4 5AYSC 5GSPA 1GMPA 1R4YA 2FXTA 3F14A 3GZBA 5AIFA 3AGNA 2XGLA 4AEQA 1MGWA 1RHLA 3LTAA 2GBWB 2Q07A 1E3VA 2GBXB 5BXQA 1GMQA 2XEPA 1RMSA 3T8UA 1N5HA 4HM1B 2OQEC 3KFQC 3X3ZA 3I563 3WOFB 3FH1A 2ML6A 4LYLB 3D5GA 4L8PA 5IEPA 3CXC2 4FCJA 1PYLA 2AADA 2XSHB 5CK6A 3JUQA 1SIHA 2BIRA 2WGQA 2XFTA 2K3DA 3EE1A 4CCVA 3NBRA 3NX0A 4KT3B 4R9KA 1W5ZA 1OCVA 2BMRB 2CWTA 5IG0A 1EQKA 4K1UA 5IEOA 3FG4A 2BO9B 4N3VA 1TRQA 4RBNA 1A90A 2O9UX 1YHQ3 2R41A 1OH0A 3LT9A 4HOHA 3IJEB 1NDOB 4HVNA 1EA2A 4EYCA 5IG4A 1Q9EA 1VQO3 1GY7A 1B27A 3IPTA 3EBYA 4OVMA 1TP6A 2AAEA 2WOHA 4WYKB 3K0ZA 1RJOA 5G1LA 4KFEA 3L0RA 2QA43 3X41A 3K9MC 4BTYA 1IV9A 2W04A 1I8VA 1CQSA 3X40A 1VQP3 3NM2A 4HM0B 4MMYB 5BIRA 4QWTA 1R4CA 2F98A 5M1AA 4HM6B 2C11A 1UGHI 3G6E3 4HZBB 1S723 1N5PA 3EB8A 4HZ9B 3HK4A 1NNVA 1JZDA 3SOYA 1AV4A 3BNDA 1DMMA 1IK3A 1MNLA 3F8XA 1UCIA 3HIIA 2F86B 2OTL3 4OK0A 1IQYA 3UB1A 1UCJA 3RDEA 5RNTA 1JZOA 3PZWA 1LOVA 1VQ73 3B7CA 1ZX2A 1UDII 1FUSA 3KSED 1B20A 1RGAA 3OX9A 3NXJA 3OWUA 4CPKA 5A0OB 1GSPA 1ZS7A 4FMAA 2L1SA 3K5TA 3LXUX 1UGIA 1Z1SA 3CNMA 3K7CA 3Q3FA 5JPUA 2CWVA 3T0UA 3ER7A 1TJDA 1W4NA 3SXXA 1RCKA 1WNHA 3KSPA 4O8SA 3Q90A 4MJDA 1QVF2 1X1YA 2XR8B 4FMBA 3SOAA 1RN7A 1STFI 4BU4A 3CC23 3F8HA 4J8TA 3MPHA 1U8CB 1RNTA 1C7HA 2H0HA 1O7WB 1JB5A 1NWWA 4ORLA 1YJW3 2D1WA 5AEUB 3DH2A 2IMJA 4AKYA 3AHWA 4ILFA 3ALAA 3U97A 3A5EA 2L4VA 3LTBA 4NHFA 1HU9A 1UUVB 1OHPA 2YX9A 3K63A 5CXOA 3F40A 1ISKA 1BNRA 3D79A 1QALA 4KFFA 4PEJA 1JRQA 4RNTA 2B1XB 4XDWA 1DVDA 3MWZA 3EN1B 4CJNA 3KE7A 2HOHA 1BNFA 1Q824 1T5YA 1RN1A 2M7OA 1IVUA 1LVNA 3GWRA 3G8ZA 1N9EA 3BU4A 1RTUA 2P0MA 1RGCA 2OOVA 3F9SA 5D83A 2W2CA 1D6YA 2KXGA 1JBSA 2CHCA 1Q40A 1MWTA 2OWPA 4I5QA 4I4KA 1FUWA 4KVHA 1E3RA 3WODG 2GU3A 1W00A 3ECFA 1VQN3 2P0XA 1UW1A 2KRTA 1X1WA 2F56A 1RGFA 1LRAA 2IY2A 3LH4A 4N6TA 3CCE3 3FCSB 5D82A 1A2VA 1GYBA 1ROVA 1YJN3 1OHSA 2MC8A 1CYVA 1AY7A 1WMNA 5CF1A 5EEOA 2XF3A 4MEIA 2CH9A 3B4OA 3CPW2 3Q2PA 1JKGA 3MKIA 5D81A 1Q7Y4 4FCMA 1YVBI 2UX0A 3VSYA 3T8NA 1GMRA 1IT7A 5IG3A 1YJ93 5I97A 2F99A 4LZIA 2W56A 3SEDA 2HMJB 3CU3A 1US1A 3Q1CA 1BSAA 2W9PA 1QAFA 5ELJA 1W6GA 2GXFA 3FKAA 2XSOB 1A2PA 1ASKA 1GY5A 1WMPA 2E2UA 4R1KA 2HMOB 3CD63 1FZUA 3NBJA 5JBSA 3DY5A 4O2HA 3NV0A 3B8LA 1U5OA 1GS3A 6RNTA 2XGNA 3NQYA 3CC73 3BIRA 2GU1A 1BRGA 1BSDA 3S29A 4DKIA 2CKFB 1AR0A 3CCS3 1M1K4 3JUOA 3OWYA 4MMZB 1M1XB 1I70A 2OOVC 2BT3A 1DMQA 3FF0A 1IV7A 1HZ1A 1RDSA 5AIIA 1T2HA 1UCLA 3GRDA 4KZ1A 1BNEA 3M8CA 1RNBA 1O7GB 1FW7A 1DYUA 1YVSA 3GAXA 4LEHA 4BTWA 1FGMA 4NPBA 3RGRA 1AVKA 3QRDA 4Q53A 4EW5A 2KF5A 1BRKA 1BU4A 3KN4A 3NM7A 2RSXA 3NQZA 2P09A 3V92A 3G4S3 1BNGA 1OUNA 1C54A 4N6NB 1L5GB 3PS8A 1YI23 1BRHA 1JB4A 4JRFA 3EHCA 1QVG2 1T2IA 1B2SA 5AIGA 1IT8A 2V1LA 1GOYA 1B2UA 1BRSA 1BSBA 1RGEA 4XDVA 1X1UA 2I9WA 3FSDA 4RZMA 3D3LA 1BIRA 3WA2X 1GOUA 2INXA 1JN5A 2ZA4A 5G1KA 1EKMA 1G02A 5AIHA 5DREA 3CCL3 1BRNL 3N8BA 5CF2A 1YGWA 1DE3A 3LOYA 2W0QA 1RSNA 1I2EA 5FW5A 3CMA3 1W2ZA 1Y4KA 3RGAA 1FYSA 1IVVA 2B24B 2FNQA 1K41A 3ZFZA 4J9AA 4BL2A 1PFPA 5CLKA 3HI7A 4N6V0 1I2GA 1JNQA 2WGOA 3AHSA 4J5GA 1CEWI 8CHOA 1B2MA 4HYZA 1MWRA 2E2VA 1UCKA 1BUQA 1V57A 4EV5A 3AMOB 3AMOA 1BNIA 2O3OA 1I0XA 1TIJA 2RFRA 1TFOA 4IPBA 5EVHA 1BUJA 5IG5A 1VQQA 1RRHA 2CFDA 4IT7A 3DGMA 3H51A 3NUVA 1LQGC 3ZG0A 4HM3B 2CWUA 1NB5I 1Q42A 2R4IA 1YIJ3 1AQZA 1CYUA 1K28A 2PNCA 1UI8A 1QMAA 3CCJ3 3STDA 1ULJB 1LNIA 1RLSA 3URPA 9RNTA 1HYFA 3LZAA 3D9RA 1QJGA 4OUQA 1IVWA 2KF4A 1E97A 1GD4A 3DZLA 2CFGA 3LTCA 4H61A 1LNHA 2ZHXB 3WR2A 3CCU3 1BANA 1S5AA 1IVXA 1W6YA 1N8QA 4GL6A 1DMNA 1VQ53 1O7MB 2JDIH 1I3IA 4LMIA 1IQ8A 4K90B 4L7KA 3DGLA 1VQ83 1NU3A 1F8NA 2E2TA 5TGNA 2OCTA 1A2KA 5LC7A 1O7PB 1Q814 1KD14 4FR9A 1Q40B 3WMDA 3O8YA 3NBBA 3SVAA 2YFIB 2FGTA 1WTHA 4BTXA 3AGOA 4XBYA 1IDPA 5LC6A 1LXEA 4WHAA 3OV4A 1BSEA 3BNEA 4RNZA 1PU4A 3BNCA 3FG3A 4HM5B 3SYUA 3J7Yd 1ZO2A 3EBTA 3SLUA 4BIRA 6GSPA 3JUNA 2H0IA 5AI1A 2HMNB 1Q7HA 4XBTA 3G713 2GSPA 4EBGA 1W2B2 1DVCA 4XM4A 2IUKA 1JKGB 3V99A 3S67A 2IUJA 5IENA 1B2ZA 2CC3A 2H0GA 2IA7A 3CCR3 2K0MA 1YIT3 3JUMA 5BU4A 1OPYA 4JF8A 5M19A 1MWSA 1N9JA 7RNTA 4GSPA 2STDA 3A76A 2W56B 2WOFA 1TUHA 3HIGA 4LSOA 1RGKA 2XRXB 4HKVB 4FMCA 1FGRA 3LT8A 3MG1A 1FGOA 3F7SA 8RNTA 5EQLA 1B21A 2J8XB 4N6UA 4K1VA 3WDGB 1OHOA 2ML5A 4LGQA 3D4AA 1STDA 2Y74A 4O02B 2QGUA 5JPPA 1BNSA 4EXRA 4K61A 2JQ5A 1KQS2 2CW9A 3DGYA 1M904 3JVCA 3NV0B 2KAAA 1SPUA 3MG3A 3BNBA 5G2GA 1QAKA 1VQK3 1BGSA 2CFWA 1RN4A 2RGQA 2Z7AA 3N9HA 3EC9A 1B2XA 2A15A 4TX4A 1LOWA 4R9LA 1SQWA 3F7XA 1VZZA 1X1XA 1T3BA 1VQ43 2HMMB 4WFOA 1O7NB 1VQ63 2IYJA 1BRJA 1OGZA 2XFSA 2Z76A 5DRVA 6STDA 2YFJB 3PYJA 3EQQB 3HOHA 1JV2B 1V58A 4RNYA 1MOLA 3I0YA 1N8R4 1A67A 1SJWA 2BHMA 1UI7A 5IF6A 2CG0A 1M9GA 3D5IA 1JB2A 2W9QA 3KZTA 4H3UA 3VGNA 1JBTA 3OWSA 3GZRA 5AYRB 3FG1A 1BAOA 2D42A 3KCHA 1D6UA 3X3XA 2KF6A 1B3SA 1ULIB 2UUGC 1AVLA 2P05A 1W02A 3FZWA 2RBIA 2W03A 1FGQA 1JN5B 3I553 5IW9A 1TFKA 3ROBA 2K54A 2HMKB 1IU7A 3JUPA 1KWIA 3WA3A 1RGGA 2ZDJA 3EJVA 4XB5A 5KP4A 1IQXA 2F4YA 1RGHA 3SX1A 2PZVA 4WYKA 3UJMA 3PCSA 1I0VA 2ZL8A 1Q864 3U1WA 3UL5A 3TDGA 2CFLA 1BVIA 1MGRA 2CFKA 5HOHA 4R4KA 3H3HA 2LYXA 1NO3A 1PY3A 2RCDA 1IYYA 2CIUA 2C4BA 2OTJ3 1FA3A 3PGBA 1K9M4 1O7HB 3CNXA 5STDA 3MG2A 1NB3I 3BB9A 3G16A 1K734 2CK3H 4HM8B 4XBXA 3EX9A 7GSPA 1FUTA 4N6LA 5ELUA 3N54B 1W7CA 4FCZA 2LQVA 3MSOA 4N6OB 1TU5A 1G96A 2F5MA 1YNVX 1OF5B 2CG1A 1GOVA 1OF5A 1EEJA 1OACA 2BU4A 2Z77A 4HM2B 4HM7B 4WP5A 1I2FA 1FGTA 1RGLA 5BVBA 3CME3 5M18A 1NJI4 4AKZA 2RNTA 1KSIA 1GD3A 3KIIA 4HM4B 2XH9A 3FLJA 1MWUA 1EUIC 4O3VA 3S27A 7STDA 4J5KA 3CCV3 2WO0A 3G0KA 3OW22 4G1MB 3PXMA 3MYTA 3OXAA 3S28A 1EG9B 1ROAA 4R80A 3B4PA 3S5CA 1J2BA 4HAAA 4KFDA 2C10A 1VQL3 1JBRA 2MF7A 4BL3A 1UUWB 3DGOA 2HMLB 1LOYA 4GHOA 3V98A 1V74A 3CC43 2BNGA 2BMOB 3LMLA 2YFLB 3WHOA 5FGOA 4HBRA 2QIYA 3LTDA 3VF1A 5KP1A 1YGEA 1SIIA 3DUKA 1OGXA 2OQEA 4U13A 4MMXB 4HJLB 1G0TA 2F5WA 3DXOA 2GEYA 1LOXA 3UNLA 2P38A 4STDA 3WOEB 1VQ93 3CCQ3 1KC84 3ZG5A 2KF3A 1BOXA 2CX1A 3DGNA 1ZGXA 2GEXA 3RNTA 2W6JH 3KKGA 3GZXB 4NREA 3HZPA 1I3FA 1TTOA 3FGYA 3LYGA 3EF8A 3GSPA 3BLZA 4X2OA 1D6ZA 3X3YA 1W6CA 1BRIA 5IERA 2Y73A 5HGRA 1CH0A 1VQM3 4L8OA 1BSCA 1UUGB 1WQLB 4IIAA 4WWUC 3X42A 2Z6BA 3GZYB 4FMDA 1HKXA 1W01A 4CDLA 2SARA 2QEX3 1JJ22 3DMCA 1DETA 1RKYA 3CPOA 3E99A 2UGIA 1SARA 1LQMB 3IMAB 3NHXA 3CCM3 3QK9A 5KP3A 5AEWB 4ZM8A 2BMQB 3EN8A 4X2HA 4EV2A 4GB5A 1GY6A 3MHEA 2CX0A 1WMOA 4EC6A 3UL6A 1BNJA 3FF2A 3HX8A 1RCLA 3DM8A 1RRLA 4N6MA 1TRPA
chains in the Genus database with same CATH topology
1RGGA 1LNIA 1RLSA 1X1WA 2F56A 2F4YA 5GSPA 3URPA 9RNTA 1HYFA 1GMPA 1R4YA 1RGFA 1LRAA 1RGHA 3AGNA 1MGWA 1RHLA 2KF4A 1I0VA 3WR2A 1BANA 1GMQA 1RMSA 1BVIA 1MGRA 1AY7A 5HOHA 1I3IA 3D5GA 1PY3A 1PYLA 2AADA 1IYYA 2BIRA 2C4BA 1GMRA 7GSPA 1FUTA 3AGOA 1TRQA 1BSAA 4HOHA 2F5MA 1YNVX 1BSEA 1GOVA 1Q9EA 2BU4A 1B27A 1A2PA 3SYUA 1I2FA 1RGLA 4BIRA 6GSPA 2AAEA 1FZUA 2RNTA 2GSPA 4J5KA 1I8VA 6RNTA 3BIRA 1BRGA 1BSDA 5BIRA 1B2ZA 4HAAA 1JBRA 1I70A 5BU4A 1HZ1A 1RDSA 1T2HA 1UCLA 1LOYA 4GSPA 7RNTA 1BNEA 4GHOA 1RNBA 1FW7A 1RGKA 1YVSA 1UCIA 3WHOA 5RNTA 1UCJA 2KF5A 8RNTA 1LOVA 1B21A 1BRKA 1BU4A 1FUSA 1B20A 1RGAA 3D4AA 1GSPA 1BNSA 1BNGA 1C54A 1BRHA 2F5WA 3DGYA 3Q3FA 2KAAA 1T2IA 1B2SA 1GOYA 1B2UA 1BRSA 1BSBA 1BGSA 1RGEA 1X1UA 1RCKA 1RN4A 2KF3A 1BIRA 1BOXA 1X1YA 1GOUA 4BU4A 1ZGXA 2ZA4A 3RNTA 1G02A 1B2XA 1BRNL 1TRPA 1RNTA 1LOWA 1YGWA 1DE3A 1RSNA 1I2EA 1I3FA 1TTOA 1FYSA 1X1XA 3GSPA 3DH2A 1BRIA 1CH0A 3AHWA 1BSCA 1BRJA 3A5EA 2SARA 3HOHA 1I2GA 1DETA 3AHSA 4J5GA 1B2MA 1BNRA 4RNTA 1UCKA 1SARA 1BNIA 3D5IA 1JBTA 1I0XA 1BNFA 2HOHA 1BAOA 1RN1A 3KCHA 1BUJA 3BU4A 1RTUA 1RGCA 1B3SA 2KF6A 1JBSA 2RBIA 1RCLA 1AQZA 1BNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGG A;  1LNI A;  1RLS A;  1X1W A;  2F56 A;  2F4Y A;  5GSP A;  3URP A;  9RNT A;  1HYF A;  1GMP A;  1R4Y A;  1RGF A;  1LRA A;  1RGH A;  3AGN A;  1MGW A;  1RHL A;  2KF4 A;  1I0V A;  3WR2 A;  1BAN A;  1GMQ A;  1RMS A;  1BVI A;  1MGR A;  1AY7 A;  5HOH A;  1I3I A;  3D5G A;  1PY3 A;  1PYL A;  2AAD A;  1IYY A;  2BIR A;  2C4B A;  1GMR A;  7GSP A;  1FUT A;  3AGO A;  1TRQ A;  1BSA A;  4HOH A;  2F5M A;  1YNV X;  1BSE A;  1GOV A;  1Q9E A;  2BU4 A;  1B27 A;  1A2P A;  3SYU A;  1I2F A;  1RGL A;  4BIR A;  6GSP A;  2AAE A;  1FZU A;  2RNT A;  2GSP A;  4J5K A;  1I8V A;  6RNT A;  3BIR A;  1BRG A;  1BSD A;  5BIR A;  1B2Z A;  4HAA A;  1JBR A;  1I70 A;  5BU4 A;  1HZ1 A;  1RDS A;  1T2H A;  1UCL A;  1LOY A;  4GSP A;  7RNT A;  1BNE A;  4GHO A;  1RNB A;  1FW7 A;  1RGK A;  1YVS A;  1UCI A;  3WHO A;  5RNT A;  1UCJ A;  2KF5 A;  8RNT A;  1LOV A;  1B21 A;  1BRK A;  1BU4 A;  1FUS A;  1B20 A;  1RGA A;  3D4A A;  1GSP A;  1BNS A;  1BNG A;  1C54 A;  1BRH A;  2F5W A;  3DGY A;  3Q3F A;  2KAA A;  1T2I A;  1B2S A;  1GOY A;  1B2U A;  1BRS A;  1BSB A;  1BGS A;  1RGE A;  1X1U A;  1RCK A;  1RN4 A;  2KF3 A;  1BIR A;  1BOX A;  1X1Y A;  1GOU A;  4BU4 A;  1ZGX A;  2ZA4 A;  3RNT A;  1G02 A;  1B2X A;  1BRN L;  1TRP A;  1RNT A;  1LOW A;  1YGW A;  1DE3 A;  1RSN A;  1I2E A;  1I3F A;  1TTO A;  1FYS A;  1X1X A;  3GSP A;  3DH2 A;  1BRI A;  1CH0 A;  3AHW A;  1BSC A;  1BRJ A;  3A5E A;  2SAR A;  3HOH A;  1I2G A;  1DET A;  3AHS A;  4J5G A;  1B2M A;  1BNR A;  4RNT A;  1UCK A;  1SAR A;  1BNI A;  3D5I A;  1JBT A;  1I0X A;  1BNF A;  2HOH A;  1BAO A;  1RN1 A;  3KCH A;  1BUJ A;  3BU4 A;  1RTU A;  1RGC A;  1B3S A;  2KF6 A;  1JBS A;  2RBI A;  1RCL A;  1AQZ A;  1BNJ A; 
#chains in the Genus database with same CATH topology
 3PCR A;  2KCD A;  2SBL A;  1K8A 4;  5AYS C;  5GSP A;  1GMP A;  1R4Y A;  2FXT A;  3F14 A;  3GZB A;  5AIF A;  3AGN A;  2XGL A;  4AEQ A;  1MGW A;  1RHL A;  3LTA A;  2GBW B;  2Q07 A;  1E3V A;  2GBX B;  5BXQ A;  1GMQ A;  2XEP A;  1RMS A;  3T8U A;  1N5H A;  4HM1 B;  2OQE C;  3KFQ C;  3X3Z A;  3I56 3;  3WOF B;  3FH1 A;  2ML6 A;  4LYL B;  3D5G A;  4L8P A;  5IEP A;  3CXC 2;  4FCJ A;  1PYL A;  2AAD A;  2XSH B;  5CK6 A;  3JUQ A;  1SIH A;  2BIR A;  2WGQ A;  2XFT A;  2K3D A;  3EE1 A;  4CCV A;  3NBR A;  3NX0 A;  4KT3 B;  4R9K A;  1W5Z A;  1OCV A;  2BMR B;  2CWT A;  5IG0 A;  1EQK A;  4K1U A;  5IEO A;  3FG4 A;  2BO9 B;  4N3V A;  1TRQ A;  4RBN A;  1A90 A;  2O9U X;  1YHQ 3;  2R41 A;  1OH0 A;  3LT9 A;  4HOH A;  3IJE B;  1NDO B;  4HVN A;  1EA2 A;  4EYC A;  5IG4 A;  1Q9E A;  1VQO 3;  1GY7 A;  1B27 A;  3IPT A;  3EBY A;  4OVM A;  1TP6 A;  2AAE A;  2WOH A;  4WYK B;  3K0Z A;  1RJO A;  5G1L A;  4KFE A;  3L0R A;  2QA4 3;  3X41 A;  3K9M C;  4BTY A;  1IV9 A;  2W04 A;  1I8V A;  1CQS A;  3X40 A;  1VQP 3;  3NM2 A;  4HM0 B;  4MMY B;  5BIR A;  4QWT A;  1R4C A;  2F98 A;  5M1A A;  4HM6 B;  2C11 A;  1UGH I;  3G6E 3;  4HZB B;  1S72 3;  1N5P A;  3EB8 A;  4HZ9 B;  3HK4 A;  1NNV A;  1JZD A;  3SOY A;  1AV4 A;  3BND A;  1DMM A;  1IK3 A;  1MNL A;  3F8X A;  1UCI A;  3HII A;  2F86 B;  2OTL 3;  4OK0 A;  1IQY A;  3UB1 A;  1UCJ A;  3RDE A;  5RNT A;  1JZO A;  3PZW A;  1LOV A;  1VQ7 3;  3B7C A;  1ZX2 A;  1UDI I;  1FUS A;  3KSE D;  1B20 A;  1RGA A;  3OX9 A;  3NXJ A;  3OWU A;  4CPK A;  5A0O B;  1GSP A;  1ZS7 A;  4FMA A;  2L1S A;  3K5T A;  3LXU X;  1UGI A;  1Z1S A;  3CNM A;  3K7C A;  3Q3F A;  5JPU A;  2CWV A;  3T0U A;  3ER7 A;  1TJD A;  1W4N A;  3SXX A;  1RCK A;  1WNH A;  3KSP A;  4O8S A;  3Q90 A;  4MJD A;  1QVF 2;  1X1Y A;  2XR8 B;  4FMB A;  3SOA A;  1RN7 A;  1STF I;  4BU4 A;  3CC2 3;  3F8H A;  4J8T A;  3MPH A;  1U8C B;  1RNT A;  1C7H A;  2H0H A;  1O7W B;  1JB5 A;  1NWW A;  4ORL A;  1YJW 3;  2D1W A;  5AEU B;  3DH2 A;  2IMJ A;  4AKY A;  3AHW A;  4ILF A;  3ALA A;  3U97 A;  3A5E A;  2L4V A;  3LTB A;  4NHF A;  1HU9 A;  1UUV B;  1OHP A;  2YX9 A;  3K63 A;  5CXO A;  3F40 A;  1ISK A;  1BNR A;  3D79 A;  1QAL A;  4KFF A;  4PEJ A;  1JRQ A;  4RNT A;  2B1X B;  4XDW A;  1DVD A;  3MWZ A;  3EN1 B;  4CJN A;  3KE7 A;  2HOH A;  1BNF A;  1Q82 4;  1T5Y A;  1RN1 A;  2M7O A;  1IVU A;  1LVN A;  3GWR A;  3G8Z A;  1N9E A;  3BU4 A;  1RTU A;  2P0M A;  1RGC A;  2OOV A;  3F9S A;  5D83 A;  2W2C A;  1D6Y A;  2KXG A;  1JBS A;  2CHC A;  1Q40 A;  1MWT A;  2OWP A;  4I5Q A;  4I4K A;  1FUW A;  4KVH A;  1E3R A;  3WOD G;  2GU3 A;  1W00 A;  3ECF A;  1VQN 3;  2P0X A;  1UW1 A;  2KRT A;  1X1W A;  2F56 A;  1RGF A;  1LRA A;  2IY2 A;  3LH4 A;  4N6T A;  3CCE 3;  3FCS B;  5D82 A;  1A2V A;  1GYB A;  1ROV A;  1YJN 3;  1OHS A;  2MC8 A;  1CYV A;  1AY7 A;  1WMN A;  5CF1 A;  5EEO A;  2XF3 A;  4MEI A;  2CH9 A;  3B4O A;  3CPW 2;  3Q2P A;  1JKG A;  3MKI A;  5D81 A;  1Q7Y 4;  4FCM A;  1YVB I;  2UX0 A;  3VSY A;  3T8N A;  1GMR A;  1IT7 A;  5IG3 A;  1YJ9 3;  5I97 A;  2F99 A;  4LZI A;  2W56 A;  3SED A;  2HMJ B;  3CU3 A;  1US1 A;  3Q1C A;  1BSA A;  2W9P A;  1QAF A;  5ELJ A;  1W6G A;  2GXF A;  3FKA A;  2XSO B;  1A2P A;  1ASK A;  1GY5 A;  1WMP A;  2E2U A;  4R1K A;  2HMO B;  3CD6 3;  1FZU A;  3NBJ A;  5JBS A;  3DY5 A;  4O2H A;  3NV0 A;  3B8L A;  1U5O A;  1GS3 A;  6RNT A;  2XGN A;  3NQY A;  3CC7 3;  3BIR A;  2GU1 A;  1BRG A;  1BSD A;  3S29 A;  4DKI A;  2CKF B;  1AR0 A;  3CCS 3;  1M1K 4;  3JUO A;  3OWY A;  4MMZ B;  1M1X B;  1I70 A;  2OOV C;  2BT3 A;  1DMQ A;  3FF0 A;  1IV7 A;  1HZ1 A;  1RDS A;  5AII A;  1T2H A;  1UCL A;  3GRD A;  4KZ1 A;  1BNE A;  3M8C A;  1RNB A;  1O7G B;  1FW7 A;  1DYU A;  1YVS A;  3GAX A;  4LEH A;  4BTW A;  1FGM A;  4NPB A;  3RGR A;  1AVK A;  3QRD A;  4Q53 A;  4EW5 A;  2KF5 A;  1BRK A;  1BU4 A;  3KN4 A;  3NM7 A;  2RSX A;  3NQZ A;  2P09 A;  3V92 A;  3G4S 3;  1BNG A;  1OUN A;  1C54 A;  4N6N B;  1L5G B;  3PS8 A;  1YI2 3;  1BRH A;  1JB4 A;  4JRF A;  3EHC A;  1QVG 2;  1T2I A;  1B2S A;  5AIG A;  1IT8 A;  2V1L A;  1GOY A;  1B2U A;  1BRS A;  1BSB A;  1RGE A;  4XDV A;  1X1U A;  2I9W A;  3FSD A;  4RZM A;  3D3L A;  1BIR A;  3WA2 X;  1GOU A;  2INX A;  1JN5 A;  2ZA4 A;  5G1K A;  1EKM A;  1G02 A;  5AIH A;  5DRE A;  3CCL 3;  1BRN L;  3N8B A;  5CF2 A;  1YGW A;  1DE3 A;  3LOY A;  2W0Q A;  1RSN A;  1I2E A;  5FW5 A;  3CMA 3;  1W2Z A;  1Y4K A;  3RGA A;  1FYS A;  1IVV A;  2B24 B;  2FNQ A;  1K41 A;  3ZFZ A;  4J9A A;  4BL2 A;  1PFP A;  5CLK A;  3HI7 A;  4N6V 0;  1I2G A;  1JNQ A;  2WGO A;  3AHS A;  4J5G A;  1CEW I;  8CHO A;  1B2M A;  4HYZ A;  1MWR A;  2E2V A;  1UCK A;  1BUQ A;  1V57 A;  4EV5 A;  3AMO B;  3AMO A;  1BNI A;  2O3O A;  1I0X A;  1TIJ A;  2RFR A;  1TFO A;  4IPB A;  5EVH A;  1BUJ A;  5IG5 A;  1VQQ A;  1RRH A;  2CFD A;  4IT7 A;  3DGM A;  3H51 A;  3NUV A;  1LQG C;  3ZG0 A;  4HM3 B;  2CWU A;  1NB5 I;  1Q42 A;  2R4I A;  1YIJ 3;  1AQZ A;  1CYU A;  1K28 A;  2PNC A;  1UI8 A;  1QMA A;  3CCJ 3;  3STD A;  1ULJ B;  1LNI A;  1RLS A;  3URP A;  9RNT A;  1HYF A;  3LZA A;  3D9R A;  1QJG A;  4OUQ A;  1IVW A;  2KF4 A;  1E97 A;  1GD4 A;  3DZL A;  2CFG A;  3LTC A;  4H61 A;  1LNH A;  2ZHX B;  3WR2 A;  3CCU 3;  1BAN A;  1S5A A;  1IVX A;  1W6Y A;  1N8Q A;  4GL6 A;  1DMN A;  1VQ5 3;  1O7M B;  2JDI H;  1I3I A;  4LMI A;  1IQ8 A;  4K90 B;  4L7K A;  3DGL A;  1VQ8 3;  1NU3 A;  1F8N A;  2E2T A;  5TGN A;  2OCT A;  1A2K A;  5LC7 A;  1O7P B;  1Q81 4;  1KD1 4;  4FR9 A;  1Q40 B;  3WMD A;  3O8Y A;  3NBB A;  3SVA A;  2YFI B;  2FGT A;  1WTH A;  4BTX A;  3AGO A;  4XBY A;  1IDP A;  5LC6 A;  1LXE A;  4WHA A;  3OV4 A;  1BSE A;  3BNE A;  4RNZ A;  1PU4 A;  3BNC A;  3FG3 A;  4HM5 B;  3SYU A;  3J7Y d;  1ZO2 A;  3EBT A;  3SLU A;  4BIR A;  6GSP A;  3JUN A;  2H0I A;  5AI1 A;  2HMN B;  1Q7H A;  4XBT A;  3G71 3;  2GSP A;  4EBG A;  1W2B 2;  1DVC A;  4XM4 A;  2IUK A;  1JKG B;  3V99 A;  3S67 A;  2IUJ A;  5IEN A;  1B2Z A;  2CC3 A;  2H0G A;  2IA7 A;  3CCR 3;  2K0M A;  1YIT 3;  3JUM A;  5BU4 A;  1OPY A;  4JF8 A;  5M19 A;  1MWS A;  1N9J A;  7RNT A;  4GSP A;  2STD A;  3A76 A;  2W56 B;  2WOF A;  1TUH A;  3HIG A;  4LSO A;  1RGK A;  2XRX B;  4HKV B;  4FMC A;  1FGR A;  3LT8 A;  3MG1 A;  1FGO A;  3F7S A;  8RNT A;  5EQL A;  1B21 A;  2J8X B;  4N6U A;  4K1V A;  3WDG B;  1OHO A;  2ML5 A;  4LGQ A;  3D4A A;  1STD A;  2Y74 A;  4O02 B;  2QGU A;  5JPP A;  1BNS A;  4EXR A;  4K61 A;  2JQ5 A;  1KQS 2;  2CW9 A;  3DGY A;  1M90 4;  3JVC A;  3NV0 B;  2KAA A;  1SPU A;  3MG3 A;  3BNB A;  5G2G A;  1QAK A;  1VQK 3;  1BGS A;  2CFW A;  1RN4 A;  2RGQ A;  2Z7A A;  3N9H A;  3EC9 A;  1B2X A;  2A15 A;  4TX4 A;  1LOW A;  4R9L A;  1SQW A;  3F7X A;  1VZZ A;  1X1X A;  1T3B A;  1VQ4 3;  2HMM B;  4WFO A;  1O7N B;  1VQ6 3;  2IYJ A;  1BRJ A;  1OGZ A;  2XFS A;  2Z76 A;  5DRV A;  6STD A;  2YFJ B;  3PYJ A;  3EQQ B;  3HOH A;  1JV2 B;  1V58 A;  4RNY A;  1MOL A;  3I0Y A;  1N8R 4;  1A67 A;  1SJW A;  2BHM A;  1UI7 A;  5IF6 A;  2CG0 A;  1M9G A;  3D5I A;  1JB2 A;  2W9Q A;  3KZT A;  4H3U A;  3VGN A;  1JBT A;  3OWS A;  3GZR A;  5AYR B;  3FG1 A;  1BAO A;  2D42 A;  3KCH A;  1D6U A;  3X3X A;  2KF6 A;  1B3S A;  1ULI B;  2UUG C;  1AVL A;  2P05 A;  1W02 A;  3FZW A;  2RBI A;  2W03 A;  1FGQ A;  1JN5 B;  3I55 3;  5IW9 A;  1TFK A;  3ROB A;  2K54 A;  2HMK B;  1IU7 A;  3JUP A;  1KWI A;  3WA3 A;  1RGG A;  2ZDJ A;  3EJV A;  4XB5 A;  5KP4 A;  1IQX A;  2F4Y A;  1RGH A;  3SX1 A;  2PZV A;  4WYK A;  3UJM A;  3PCS A;  1I0V A;  2ZL8 A;  1Q86 4;  3U1W A;  3UL5 A;  3TDG A;  2CFL A;  1BVI A;  1MGR A;  2CFK A;  5HOH A;  4R4K A;  3H3H A;  2LYX A;  1NO3 A;  1PY3 A;  2RCD A;  1IYY A;  2CIU A;  2C4B A;  2OTJ 3;  1FA3 A;  3PGB A;  1K9M 4;  1O7H B;  3CNX A;  5STD A;  3MG2 A;  1NB3 I;  3BB9 A;  3G16 A;  1K73 4;  2CK3 H;  4HM8 B;  4XBX A;  3EX9 A;  7GSP A;  1FUT A;  4N6L A;  5ELU A;  3N54 B;  1W7C A;  4FCZ A;  2LQV A;  3MSO A;  4N6O B;  1TU5 A;  1G96 A;  2F5M A;  1YNV X;  1OF5 B;  2CG1 A;  1GOV A;  1OF5 A;  1EEJ A;  1OAC A;  2BU4 A;  2Z77 A;  4HM2 B;  4HM7 B;  4WP5 A;  1I2F A;  1FGT A;  1RGL A;  5BVB A;  3CME 3;  5M18 A;  1NJI 4;  4AKZ A;  2RNT A;  1KSI A;  1GD3 A;  3KII A;  4HM4 B;  2XH9 A;  3FLJ A;  1MWU A;  1EUI C;  4O3V A;  3S27 A;  7STD A;  4J5K A;  3CCV 3;  2WO0 A;  3G0K A;  3OW2 2;  4G1M B;  3PXM A;  3MYT A;  3OXA A;  3S28 A;  1EG9 B;  1ROA A;  4R80 A;  3B4P A;  3S5C A;  1J2B A;  4HAA A;  4KFD A;  2C10 A;  1VQL 3;  1JBR A;  2MF7 A;  4BL3 A;  1UUW B;  3DGO A;  2HML B;  1LOY A;  4GHO A;  3V98 A;  1V74 A;  3CC4 3;  2BNG A;  2BMO B;  3LML A;  2YFL B;  3WHO A;  5FGO A;  4HBR A;  2QIY A;  3LTD A;  3VF1 A;  5KP1 A;  1YGE A;  1SII A;  3DUK A;  1OGX A;  2OQE A;  4U13 A;  4MMX B;  4HJL B;  1G0T A;  2F5W A;  3DXO A;  2GEY A;  1LOX A;  3UNL A;  2P38 A;  4STD A;  3WOE B;  1VQ9 3;  3CCQ 3;  1KC8 4;  3ZG5 A;  2KF3 A;  1BOX A;  2CX1 A;  3DGN A;  1ZGX A;  2GEX A;  3RNT A;  2W6J H;  3KKG A;  3GZX B;  4NRE A;  3HZP A;  1I3F A;  1TTO A;  3FGY A;  3LYG A;  3EF8 A;  3GSP A;  3BLZ A;  4X2O A;  1D6Z A;  3X3Y A;  1W6C A;  1BRI A;  5IER A;  2Y73 A;  5HGR A;  1CH0 A;  1VQM 3;  4L8O A;  1BSC A;  1UUG B;  1WQL B;  4IIA A;  4WWU C;  3X42 A;  2Z6B A;  3GZY B;  4FMD A;  1HKX A;  1W01 A;  4CDL A;  2SAR A;  2QEX 3;  1JJ2 2;  3DMC A;  1DET A;  1RKY A;  3CPO A;  3E99 A;  2UGI A;  1SAR A;  1LQM B;  3IMA B;  3NHX A;  3CCM 3;  3QK9 A;  5KP3 A;  5AEW B;  4ZM8 A;  2BMQ B;  3EN8 A;  4X2H A;  4EV2 A;  4GB5 A;  1GY6 A;  3MHE A;  2CX0 A;  1WMO A;  4EC6 A;  3UL6 A;  1BNJ A;  3FF2 A;  3HX8 A;  1RCL A;  3DM8 A;  1RRL A;  4N6M A;  1TRP A; 
#chains in the Genus database with same CATH homology
 1RGG A;  1LNI A;  1RLS A;  1X1W A;  2F56 A;  2F4Y A;  5GSP A;  3URP A;  9RNT A;  1HYF A;  1GMP A;  1R4Y A;  1RGF A;  1LRA A;  1RGH A;  3AGN A;  1MGW A;  1RHL A;  2KF4 A;  1I0V A;  3WR2 A;  1BAN A;  1GMQ A;  1RMS A;  1BVI A;  1MGR A;  1AY7 A;  5HOH A;  1I3I A;  3D5G A;  1PY3 A;  1PYL A;  2AAD A;  1IYY A;  2BIR A;  2C4B A;  1GMR A;  7GSP A;  1FUT A;  3AGO A;  1TRQ A;  1BSA A;  4HOH A;  2F5M A;  1YNV X;  1BSE A;  1GOV A;  1Q9E A;  2BU4 A;  1B27 A;  1A2P A;  3SYU A;  1I2F A;  1RGL A;  4BIR A;  6GSP A;  2AAE A;  1FZU A;  2RNT A;  2GSP A;  4J5K A;  1I8V A;  6RNT A;  3BIR A;  1BRG A;  1BSD A;  5BIR A;  1B2Z A;  4HAA A;  1JBR A;  1I70 A;  5BU4 A;  1HZ1 A;  1RDS A;  1T2H A;  1UCL A;  1LOY A;  4GSP A;  7RNT A;  1BNE A;  4GHO A;  1RNB A;  1FW7 A;  1RGK A;  1YVS A;  1UCI A;  3WHO A;  5RNT A;  1UCJ A;  2KF5 A;  8RNT A;  1LOV A;  1B21 A;  1BRK A;  1BU4 A;  1FUS A;  1B20 A;  1RGA A;  3D4A A;  1GSP A;  1BNS A;  1BNG A;  1C54 A;  1BRH A;  2F5W A;  3DGY A;  3Q3F A;  2KAA A;  1T2I A;  1B2S A;  1GOY A;  1B2U A;  1BRS A;  1BSB A;  1BGS A;  1RGE A;  1X1U A;  1RCK A;  1RN4 A;  2KF3 A;  1BIR A;  1BOX A;  1X1Y A;  1GOU A;  4BU4 A;  1ZGX A;  2ZA4 A;  3RNT A;  1G02 A;  1B2X A;  1BRN L;  1TRP A;  1RNT A;  1LOW A;  1YGW A;  1DE3 A;  1RSN A;  1I2E A;  1I3F A;  1TTO A;  1FYS A;  1X1X A;  3GSP A;  3DH2 A;  1BRI A;  1CH0 A;  3AHW A;  1BSC A;  1BRJ A;  3A5E A;  2SAR A;  3HOH A;  1I2G A;  1DET A;  3AHS A;  4J5G A;  1B2M A;  1BNR A;  4RNT A;  1UCK A;  1SAR A;  1BNI A;  3D5I A;  1JBT A;  1I0X A;  1BNF A;  2HOH A;  1BAO A;  1RN1 A;  3KCH A;  1BUJ A;  3BU4 A;  1RTU A;  1RGC A;  1B3S A;  2KF6 A;  1JBS A;  2RBI A;  1RCL A;  1AQZ A;  1BNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...