3SYUA

Re-refined coordinates for pdb entry 1det - ribonuclease t1 carboxymethylated at glu 58 in complex with 2'gmp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
102
Chain Sequence
b'CDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease T1
publication title Exploiting structure similarity in refinement: automated NCS and target-structure restraints in BUSTER.
pubmed doi rcsb
molecule tags Hydrolase
total genus 22
structure length 102
sequence length 103
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3syuA00
1HYFA 1BUJA 7RNTA 1I8VA 1RCLA 4GHOA 3BU4A 3WR2A 1C54A 1PY3A 2KF5A 1UCKA 1GOUA 5GSPA 1RNTA 4BIRA 1FW7A 9RNTA 1RGEA 3RNTA 2GSPA 1BNFA 1X1WA 2ZA4A 3KCHA 1RGAA 1BAOA 4J5GA 1TRQA 1B2ZA 8RNTA 4BU4A 1B20A 1BU4A 1BOXA 1MGRA 1GSPA 3DH2A 1RGGA 1BGSA 2KAAA 1LOYA 4HOHA 1RCKA 1X1UA 1B27A 1B3SA 1BSCA 1BSBA 1UCIA 3SYUA 2AADA 6GSPA 1B21A 3AGOA 1T2IA 1I2EA 1RNBA 1JBSA 1B2UA 1BRIA 2RNTA 1X1XA 1RN4A 1Q9EA 1DE3A 5BU4A 1AQZA 1RTUA 1I2FA 2KF3A 2SARA 2AAEA 1BSDA 2F5MA 1RGFA 1X1YA 1BVIA 1HZ1A 1I70A 1RDSA 1I0XA 1I0VA 1LRAA 1BIRA 1I2GA 2F5WA 1BSAA 2HOHA 3URPA 5RNTA 4HAAA 1BNGA 1FUSA 1BNJA 3AHSA 1RGHA 3D5IA 1B2SA 4GSPA 1IYYA 1A2PA 1BNEA 3WHOA 1TTOA 1GOVA 1RGCA 1I3IA 3GSPA 1YVSA 3HOHA 1YGWA 1GOYA 1BNRA 1BRSA 1BNIA 2BIRA 1BRKA 1RHLA 3Q3FA 7GSPA 5HOHA 1B2XA 1UCJA 1JBTA 1TRPA 1BRGA 1PYLA 1I3FA 2KF4A 3AHWA 1GMRA 4J5KA 1BRHA 2RBIA 3DGYA 1BSEA 2BU4A 3AGNA 1G02A 1GMQA 1BNSA 1BRJA 1YNVX 1FUTA 3A5EA 1B2MA 1BANA 1FYSA 1CH0A 1BRNL 2KF6A 1RGLA 5BIRA 1LOVA 1SARA 1LOWA 2F4YA 3BIRA 1FZUA 1RLSA 6RNTA 1RN1A 1R4YA 1T2HA 2F56A 1ZGXA 1RMSA 1UCLA 1AY7A 1GMPA 1MGWA 1LNIA 2C4BA 4RNTA 1JBRA 3D4AA 1RGKA 3D5GA 1RSNA 1DETA
chains in the Genus database with same CATH superfamily
4WYKB 2V1LA 4G1MB 1BUJA 2K0MA 7RNTA 3CCJ3 3SXXA 2W56B 2P0MA 2L1SA 1OGZA 1IT7A 1M1K4 5JBSA 1HKXA 1GOUA 2BNGA 5FW5A 3G0KA 5GSPA 2CFKA 3EJVA 1OHOA 1WQLB 2E2VA 3TDGA 2OWPA 1Y4KA 2GSPA 1JNQA 3EB8A 4J5GA 4JF8A 4EV5A 1TRQA 2JDIH 1VQN3 3AMOB 5TGNA 1N5PA 1BU4A 4XM4A 4TX4A 4AKYA 2YFLB 1MGRA 1GSPA 5FGOA 2KAAA 5IG0A 1BUQA 2CK3H 1SPUA 3UL6A 3MG2A 2HMKB 2YFIB 4MEIA 3NBBA 1UUWB 3X3ZA 2JQ5A 2CX1A 1OF5A 2FNQA 5CK6A 3WA2X 1B3SA 1BSCA 1BSBA 1M1XB 1W6CA 2R41A 3FSDA 3RDEA 3J7Yd 1RNBA 1LQMB 3FGYA 3X3YA 1JBSA 2Q07A 1KD14 1BRIA 2RNTA 2CG1A 3OXAA 2CX0A 4FCMA 5D81A 7STDA 3BNBA 1RN4A 1O7WB 1Q9EA 1RRHA 1DE3A 3MYTA 1SQWA 2CC3A 4ORLA 2KXGA 3DZLA 6STDA 4NREA 2WGQA 3NV0A 1W5ZA 2SARA 3S27A 4EYCA 1QALA 2F5MA 4CDLA 3B4PA 3LOYA 1I70A 1K28A 3LTAA 1JV2B 3GZXB 1I0XA 1SJWA 4HVNA 4KVHA 5I97A 1LRAA 1BIRA 1JJ22 1I2GA 1Z1SA 4KFFA 3ER7A 2OCTA 3X42A 1FGRA 3FZWA 1R4CA 4HAAA 3VGNA 3KN4A 1UI7A 2UUGC 4KT3B 1BNJA 1JN5B 1W2ZA 1B2SA 4GSPA 3HI7A 3OWUA 3X40A 2UX0A 1UW1A 1NDOB 1AVLA 1YHQ3 3K63A 3GSPA 4X2HA 3LTCA 5DREA 4CCVA 1YGWA 2Z7AA 1O7GB 1MWSA 1DMMA 2WGOA 3NM7A 4WP5A 3CCU3 3SVAA 3EN8A 5ELJA 2CWVA 3CCR3 1UCJA 2CFDA 3FCSB 2H0GA 3CNXA 2Y73A 4N6LA 2CWTA 1GY5A 1GMRA 1N5HA 3ZG0A 3DGYA 3FG4A 4OUQA 3F7SA 4XDVA 1BSEA 2HMJB 2XGLA 3FF2A 4STDA 3CCS3 1K734 3AGNA 3LYGA 2D1WA 1YNVX 4WWUC 4AEQA 1FUTA 3CPOA 4XDWA 3UNLA 3S29A 1ROAA 1RJOA 3BNCA 2QEX3 3CC73 1FGMA 3NUVA 3F8XA 1MWTA 4KFEA 2H0IA 3BIRA 1V58A 6RNTA 1STFI 3EF8A 1T2HA 1YIJ3 5AYRB 2BMRB 1EUIC 4QWTA 1RMSA 1UCLA 3Q2PA 1AY7A 2BHMA 2BMOB 5CLKA 1MGWA 4RNZA 5STDA 5EVHA 1LNIA 3STDA 2RSXA 4RNTA 3ECFA 3D4AA 3H51A 4HKVB 2WOFA 3MKIA 1TP6A 4FMAA 4L7KA 1VQL3 2IA7A 1OUNA 2M7OA 5IEPA 1O7HB 1D6YA 1E3RA 1DETA 5AIGA 2OOVA 1WMOA 3IPTA 4XBYA 2Z6BA 2BMQB 3T0UA 1W01A 2KF5A 1WNHA 3SX1A 1M9GA 2CHCA 4R9KA 3U1WA 2ML5A 4BTWA 1JB4A 1U5OA 4J9AA 3CU3A 3FKAA 3N8BA 4IPBA 3HIIA 2P05A 4BIRA 2YFJB 2C11A 3HX8A 9RNTA 1N8R4 1ZX2A 1VQK3 3I553 1X1WA 2ZA4A 3KCHA 1OCVA 5IG3A 3U97A 1WTHA 1A2VA 5LC7A 2GEYA 2KRTA 3MPHA 4WYKA 1S5AA 5CF2A 1B20A 2OQEA 1TU5A 3OWYA 2CIUA 3F40A 2W56A 2XGNA 3CCE3 2XR8B 2W6JH 3K9MC 3DH2A 1NO3A 3CCQ3 2RCDA 4ZM8A 3X41A 1RCKA 3G8ZA 1X1UA 5IENA 5BXQA 1AR0A 1VQ83 3SYUA 2AADA 2CKFB 3BNEA 4NPBA 3RGAA 2ML6A 3HIGA 2K54A 1B2UA 3AMOA 4BL3A 5IG4A 1YI23 1DMQA 4HM4B 1X1XA 1G96A 3CCM3 2XF3A 2Y74A 4MMXB 1RKYA 5BU4A 2QIYA 3S28A 5AIIA 1JKGB 3KKGA 1PU4A 5G1LA 4KZ1A 5IF6A 3DGLA 3G713 3LXUX 1X1YA 1E97A 1HZ1A 1OGXA 5KP4A 4HZBB 1TUHA 4WFOA 1AVKA 1I0VA 1EQKA 2O9UX 3KFQC 1BSAA 2L4VA 3URPA 4WHAA 1BNGA 1GD3A 3MHEA 3NXJA 3VF1A 3D5IA 3H3HA 5HGRA 1BNEA 1NB3I 1VQ93 4OVMA 3T8NA 1RGCA 3UL5A 1VQ53 1Q7Y4 3CMA3 2MF7A 2GXFA 2R4IA 1K41A 2SBLA 3GAXA 3HOHA 3LTDA 5ELUA 1GOYA 3FG3A 4LGQA 4R9LA 1F8NA 4HM8B 4K1UA 4BL2A 2BIRA 1BRKA 1ULJB 1MWRA 3KIIA 3Q3FA 1B2XA 1VQQA 1TRPA 1FUWA 1JN5A 2CFWA 1IV9A 2KF4A 3AHWA 2XFTA 3HZPA 3UJMA 3JUMA 1QAKA 3OWSA 4LYLB 4HM5B 1PFPA 3PCRA 2P09A 3Q1CA 1C7HA 3D9RA 2W04A 4HZ9B 1GD4A 4HJLB 1ISKA 4L8OA 2UGIA 1LQGC 1B2MA 3MG3A 1BRNL 4FMCA 2KF6A 5BIRA 3G16A 3CME3 5G2GA 2F4YA 3GZBA 1RN1A 1R4YA 1NWWA 3K5TA 3LMLA 3F7XA 3L0RA 1IK3A 2IUKA 2WO0A 1G0TA 1JZDA 1IV7A 3T8UA 1EG9B 1IQYA 2D42A 4AKZA 1OH0A 2B1XB 4I5QA 2RGQA 1JBRA 1Q7HA 1Q42A 1LXEA 3SLUA 3D5GA 4EW5A 1RRLA 4EV2A 3CPW2 1HYFA 1ZO2A 3NBRA 4N6NB 1I8VA 1Q40B 4GHOA 3D3LA 3DY5A 3WR2A 2OTL3 2XH9A 1C54A 4L8PA 1WMPA 1LOXA 3SEDA 3OV4A 4J8TA 1RNTA 1FW7A 1RGEA 1IVVA 4FMDA 2ZHXB 3EQQB 3WMDA 1BNFA 4K1VA 1RGAA 1BAOA 1W6GA 2FXTA 3IJEB 3QRDA 2W9PA 1D6ZA 1DVDA 3EHCA 1B2ZA 8RNTA 1W02A 4BU4A 1IQ8A 2HMNB 3WOFB 3JUQA 4U13A 3IMAB 3VSYA 1RGGA 1U8CB 4BTXA 2QA43 3GZRA 2XSHB 1STDA 1TFOA 5JPPA 2HMMB 1B27A 5DRVA 1VQ43 2XRXB 3DXOA 6GSPA 4FMBA 1Q824 4LMIA 3B8LA 2PZVA 1I2EA 1S723 4I4KA 3OW22 3SOAA 3PXMA 4LZIA 1Q864 3KSPA 1W6YA 3F9SA 4GB5A 2P0XA 4LEHA 1M904 1AQZA 4KFDA 3GWRA 1KQS2 1RTUA 1VQ63 2KF3A 2AAEA 1BSDA 1GYBA 2FGTA 2O3OA 2Z77A 5AI1A 1RGFA 3PZWA 1RDSA 1NB5I 1LVNA 2GU3A 1DMNA 1CEWI 1MNLA 2LYXA 2BO9B 2HOHA 4R80A 3SOYA 3X3XA 3N54B 1FUSA 3LH4A 1LNHA 1YJW3 5AEUB 1IVWA 1VQ73 4R1KA 1JKGA 3EE1A 4HM6B 3ZG5A 1QAFA 3CXC2 5AIFA 1VQP3 2KCDA 1TTOA 2OOVC 3FLJA 5IERA 1YVBI 1UGIA 1YVSA 2CW9A 3V99A 1QVF2 3BNDA 1V74A 5IG5A 3DGOA 2RFRA 8CHOA 7GSPA 1RHLA 4RZMA 1JBTA 4HM1B 1BRGA 1Q814 2W03A 4N6V0 5D83A 1I3FA 1FA3A 4N3VA 3FG1A 4N6MA 1UI8A 1N9EA 4K90B 4MMYB 4EC6A 4K61A 1GY7A 1KWIA 2OQEC 2BU4A 3MSOA 3OX9A 3CCL3 1QVG2 1W7CA 3EBTA 3S67A 1GMQA 1BNSA 1IT8A 3D79A 3A5EA 3FF0A 3JVCA 2Z76A 1GY6A 3Q90A 1BANA 3PCSA 1LOVA 1MOLA 2PNCA 2CFGA 1T5YA 1NJI4 3WODG 2F99A 3LT8A 1FZUA 1RLSA 2IMJA 4XB5A 5A0OB 2QGUA 3WA3A 1ASKA 1J2BA 2OTJ3 3CNMA 4EBGA 4ILFA 2GBXB 4IT7A 2W9QA 1V57A 3JUNA 4NHFA 4GL6A 5AYSC 3CD63 1GMPA 1W00A 2W2CA 1A67A 1RGKA 2HMOB 2IYJA 2YX9A 1VQO3 4O8SA 3B4OA 1N9JA 5BVBA 1QJGA 1JB2A 3PYJA 4RNYA 3DMCA 5IEOA 2INXA 1RSNA 3NX0A 4HM2B 1WMNA 4DKIA 2B24B 3UB1A 1KC84 1FGOA 1O7MB 3DGNA 1IQXA 2ZL8A 4CPKA 1RCLA 2J8XB 3S5CA 5CF1A 3BU4A 1EEJA 1PY3A 3RGRA 5KP1A 2XEPA 1JRQA 1IVUA 1TIJA 3QK9A 1UCKA 3CC43 1UUGB 1YJN3 4IIAA 4OK0A 3LZAA 4N6UA 1D6UA 1IDPA 1OF5B 3DM8A 2XFSA 2H0HA 3RNTA 3NQYA 3WOEB 3JUPA 3G4S3 4H61A 3BLZA 1TFKA 1GS3A 4HBRA 1OHSA 1DVCA 2GEXA 3HK4A 4MJDA 2P38A 3N9HA 3KSED 1CYUA 5M1AA 1HU9A 3EX9A 3NM2A 5EQLA 1BOXA 1Q40A 2LQVA 2E2TA 4FCJA 1BGSA 1LOYA 3MG1A 1N8QA 3NV0B 4HOHA 3EN1B 2IUJA 2CH9A 3DGMA 1QMAA 2WOHA 1JZOA 4MMZB 1FGQA 1CYVA 5CXOA 1UCIA 3PGBA 1B21A 3AGOA 4XBTA 5IW9A 1T2IA 4X2OA 4N6OB 1YIT3 4HM7B 1O7PB 1UGHI 4PEJA 5AEWB 4O2HA 1OACA 3B7CA 3KZTA 5EEOA 1L5GB 1NU3A 1JB5A 2STDA 2W0QA 3LT9A 2MC8A 1I2FA 4LSOA 3EBYA 4N6TA 3K7CA 2XSOB 1A2KA 3G6E3 3JUOA 2CG0A 1BVIA 1W4NA 2GBWB 3E99A 1O7NB 1W2B2 3V98A 3NBJA 2F5WA 1SIIA 1A90A 3ZFZA 1AV4A 5RNTA 4XBXA 1OHPA 1FGTA 1EA2A 3EC9A 1EKMA 3AHSA 1RGHA 1US1A 2C10A 1MWUA 1ULIB 1IYYA 1A2PA 1K9M4 3WHOA 3CCV3 2IY2A 1GOVA 1VZZA 1I3IA 1E3VA 3M8CA 3F8HA 1IU7A 3I563 4Q53A 1IVXA 4HYZA 4H3UA 2CWUA 1BRSA 1NNVA 3NHXA 1ZS7A 1UUVB 3V92A 1BNRA 1T3BA 1BNIA 3ROBA 5HOHA 5G1KA 2ZDJA 4EXRA 3K0ZA 1PYLA 1RN7A 3DUKA 2F86B 2K3DA 1YJ93 2HMLB 5KP3A 4J5KA 3A76A 4R4KA 1BRHA 2RBIA 5AIHA 1OPYA 1KSIA 3GZYB 1TJDA 3I0YA 4HM0B 4HM3B 1K8A4 1G02A 1YGEA 1BRJA 1SIHA 3BB9A 4O02B 2E2UA 1FYSA 1VQM3 1CH0A 1DYUA 3CC23 1RGLA 5LC6A 4CJNA 3LTBA 1SARA 3F14A 2A15A 1LOWA 4BTYA 1UDII 3WDGB 1ROVA 4JRFA 5D82A 2F56A 1ZGXA 2F98A 3KE7A 3PS8A 4FR9A 3ALAA 3O8YA 3MWZA 3FH1A 2I9WA 2CFLA 2BT3A 2C4BA 3GRDA 2GU1A 5JPUA 5M18A 4FCZA 5M19A 3NQZA 4O3VA 4RBNA 1CQSA
chains in the Genus database with same CATH topology
1HYFA 1BUJA 7RNTA 1I8VA 1RCLA 4GHOA 3BU4A 3WR2A 1C54A 1PY3A 2KF5A 1UCKA 1GOUA 5GSPA 1RNTA 4BIRA 1FW7A 9RNTA 1RGEA 3RNTA 2GSPA 1BNFA 1X1WA 2ZA4A 3KCHA 1RGAA 1BAOA 4J5GA 1TRQA 1B2ZA 8RNTA 4BU4A 1B20A 1BU4A 1BOXA 1MGRA 1GSPA 3DH2A 1RGGA 1BGSA 2KAAA 1LOYA 4HOHA 1RCKA 1X1UA 1B27A 1B3SA 1BSCA 1BSBA 1UCIA 3SYUA 2AADA 6GSPA 1B21A 3AGOA 1T2IA 1I2EA 1RNBA 1JBSA 1B2UA 1BRIA 2RNTA 1X1XA 1RN4A 1Q9EA 1DE3A 5BU4A 1AQZA 1RTUA 1I2FA 2KF3A 2SARA 2AAEA 1BSDA 2F5MA 1RGFA 1X1YA 1BVIA 1HZ1A 1I70A 1RDSA 1I0XA 1I0VA 1LRAA 1BIRA 1I2GA 2F5WA 1BSAA 2HOHA 3URPA 5RNTA 4HAAA 1BNGA 1FUSA 1BNJA 3AHSA 1RGHA 3D5IA 1B2SA 4GSPA 1IYYA 1A2PA 1BNEA 3WHOA 1TTOA 1GOVA 1RGCA 1I3IA 3GSPA 1YVSA 3HOHA 1YGWA 1GOYA 1BNRA 1BRSA 1BNIA 2BIRA 1BRKA 1RHLA 3Q3FA 7GSPA 5HOHA 1B2XA 1UCJA 1JBTA 1TRPA 1BRGA 1PYLA 1I3FA 2KF4A 3AHWA 1GMRA 4J5KA 1BRHA 2RBIA 3DGYA 1BSEA 2BU4A 3AGNA 1G02A 1GMQA 1BNSA 1BRJA 1YNVX 1FUTA 3A5EA 1B2MA 1BANA 1FYSA 1CH0A 1BRNL 2KF6A 1RGLA 5BIRA 1LOVA 1SARA 1LOWA 2F4YA 3BIRA 1FZUA 1RLSA 6RNTA 1RN1A 1R4YA 1T2HA 2F56A 1ZGXA 1RMSA 1UCLA 1AY7A 1GMPA 1MGWA 1LNIA 2C4BA 4RNTA 1JBRA 3D4AA 1RGKA 3D5GA 1RSNA 1DETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYF A;  1BUJ A;  7RNT A;  1I8V A;  1RCL A;  4GHO A;  3BU4 A;  3WR2 A;  1C54 A;  1PY3 A;  2KF5 A;  1UCK A;  1GOU A;  5GSP A;  1RNT A;  4BIR A;  1FW7 A;  9RNT A;  1RGE A;  3RNT A;  2GSP A;  1BNF A;  1X1W A;  2ZA4 A;  3KCH A;  1RGA A;  1BAO A;  4J5G A;  1TRQ A;  1B2Z A;  8RNT A;  4BU4 A;  1B20 A;  1BU4 A;  1BOX A;  1MGR A;  1GSP A;  3DH2 A;  1RGG A;  1BGS A;  2KAA A;  1LOY A;  4HOH A;  1RCK A;  1X1U A;  1B27 A;  1B3S A;  1BSC A;  1BSB A;  1UCI A;  3SYU A;  2AAD A;  6GSP A;  1B21 A;  3AGO A;  1T2I A;  1I2E A;  1RNB A;  1JBS A;  1B2U A;  1BRI A;  2RNT A;  1X1X A;  1RN4 A;  1Q9E A;  1DE3 A;  5BU4 A;  1AQZ A;  1RTU A;  1I2F A;  2KF3 A;  2SAR A;  2AAE A;  1BSD A;  2F5M A;  1RGF A;  1X1Y A;  1BVI A;  1HZ1 A;  1I70 A;  1RDS A;  1I0X A;  1I0V A;  1LRA A;  1BIR A;  1I2G A;  2F5W A;  1BSA A;  2HOH A;  3URP A;  5RNT A;  4HAA A;  1BNG A;  1FUS A;  1BNJ A;  3AHS A;  1RGH A;  3D5I A;  1B2S A;  4GSP A;  1IYY A;  1A2P A;  1BNE A;  3WHO A;  1TTO A;  1GOV A;  1RGC A;  1I3I A;  3GSP A;  1YVS A;  3HOH A;  1YGW A;  1GOY A;  1BNR A;  1BRS A;  1BNI A;  2BIR A;  1BRK A;  1RHL A;  3Q3F A;  7GSP A;  5HOH A;  1B2X A;  1UCJ A;  1JBT A;  1TRP A;  1BRG A;  1PYL A;  1I3F A;  2KF4 A;  3AHW A;  1GMR A;  4J5K A;  1BRH A;  2RBI A;  3DGY A;  1BSE A;  2BU4 A;  3AGN A;  1G02 A;  1GMQ A;  1BNS A;  1BRJ A;  1YNV X;  1FUT A;  3A5E A;  1B2M A;  1BAN A;  1FYS A;  1CH0 A;  1BRN L;  2KF6 A;  1RGL A;  5BIR A;  1LOV A;  1SAR A;  1LOW A;  2F4Y A;  3BIR A;  1FZU A;  1RLS A;  6RNT A;  1RN1 A;  1R4Y A;  1T2H A;  2F56 A;  1ZGX A;  1RMS A;  1UCL A;  1AY7 A;  1GMP A;  1MGW A;  1LNI A;  2C4B A;  4RNT A;  1JBR A;  3D4A A;  1RGK A;  3D5G A;  1RSN A;  1DET A; 
#chains in the Genus database with same CATH topology
 4WYK B;  2V1L A;  4G1M B;  1BUJ A;  2K0M A;  7RNT A;  3CCJ 3;  3SXX A;  2W56 B;  2P0M A;  2L1S A;  1OGZ A;  1IT7 A;  1M1K 4;  5JBS A;  1HKX A;  1GOU A;  2BNG A;  5FW5 A;  3G0K A;  5GSP A;  2CFK A;  3EJV A;  1OHO A;  1WQL B;  2E2V A;  3TDG A;  2OWP A;  1Y4K A;  2GSP A;  1JNQ A;  3EB8 A;  4J5G A;  4JF8 A;  4EV5 A;  1TRQ A;  2JDI H;  1VQN 3;  3AMO B;  5TGN A;  1N5P A;  1BU4 A;  4XM4 A;  4TX4 A;  4AKY A;  2YFL B;  1MGR A;  1GSP A;  5FGO A;  2KAA A;  5IG0 A;  1BUQ A;  2CK3 H;  1SPU A;  3UL6 A;  3MG2 A;  2HMK B;  2YFI B;  4MEI A;  3NBB A;  1UUW B;  3X3Z A;  2JQ5 A;  2CX1 A;  1OF5 A;  2FNQ A;  5CK6 A;  3WA2 X;  1B3S A;  1BSC A;  1BSB A;  1M1X B;  1W6C A;  2R41 A;  3FSD A;  3RDE A;  3J7Y d;  1RNB A;  1LQM B;  3FGY A;  3X3Y A;  1JBS A;  2Q07 A;  1KD1 4;  1BRI A;  2RNT A;  2CG1 A;  3OXA A;  2CX0 A;  4FCM A;  5D81 A;  7STD A;  3BNB A;  1RN4 A;  1O7W B;  1Q9E A;  1RRH A;  1DE3 A;  3MYT A;  1SQW A;  2CC3 A;  4ORL A;  2KXG A;  3DZL A;  6STD A;  4NRE A;  2WGQ A;  3NV0 A;  1W5Z A;  2SAR A;  3S27 A;  4EYC A;  1QAL A;  2F5M A;  4CDL A;  3B4P A;  3LOY A;  1I70 A;  1K28 A;  3LTA A;  1JV2 B;  3GZX B;  1I0X A;  1SJW A;  4HVN A;  4KVH A;  5I97 A;  1LRA A;  1BIR A;  1JJ2 2;  1I2G A;  1Z1S A;  4KFF A;  3ER7 A;  2OCT A;  3X42 A;  1FGR A;  3FZW A;  1R4C A;  4HAA A;  3VGN A;  3KN4 A;  1UI7 A;  2UUG C;  4KT3 B;  1BNJ A;  1JN5 B;  1W2Z A;  1B2S A;  4GSP A;  3HI7 A;  3OWU A;  3X40 A;  2UX0 A;  1UW1 A;  1NDO B;  1AVL A;  1YHQ 3;  3K63 A;  3GSP A;  4X2H A;  3LTC A;  5DRE A;  4CCV A;  1YGW A;  2Z7A A;  1O7G B;  1MWS A;  1DMM A;  2WGO A;  3NM7 A;  4WP5 A;  3CCU 3;  3SVA A;  3EN8 A;  5ELJ A;  2CWV A;  3CCR 3;  1UCJ A;  2CFD A;  3FCS B;  2H0G A;  3CNX A;  2Y73 A;  4N6L A;  2CWT A;  1GY5 A;  1GMR A;  1N5H A;  3ZG0 A;  3DGY A;  3FG4 A;  4OUQ A;  3F7S A;  4XDV A;  1BSE A;  2HMJ B;  2XGL A;  3FF2 A;  4STD A;  3CCS 3;  1K73 4;  3AGN A;  3LYG A;  2D1W A;  1YNV X;  4WWU C;  4AEQ A;  1FUT A;  3CPO A;  4XDW A;  3UNL A;  3S29 A;  1ROA A;  1RJO A;  3BNC A;  2QEX 3;  3CC7 3;  1FGM A;  3NUV A;  3F8X A;  1MWT A;  4KFE A;  2H0I A;  3BIR A;  1V58 A;  6RNT A;  1STF I;  3EF8 A;  1T2H A;  1YIJ 3;  5AYR B;  2BMR B;  1EUI C;  4QWT A;  1RMS A;  1UCL A;  3Q2P A;  1AY7 A;  2BHM A;  2BMO B;  5CLK A;  1MGW A;  4RNZ A;  5STD A;  5EVH A;  1LNI A;  3STD A;  2RSX A;  4RNT A;  3ECF A;  3D4A A;  3H51 A;  4HKV B;  2WOF A;  3MKI A;  1TP6 A;  4FMA A;  4L7K A;  1VQL 3;  2IA7 A;  1OUN A;  2M7O A;  5IEP A;  1O7H B;  1D6Y A;  1E3R A;  1DET A;  5AIG A;  2OOV A;  1WMO A;  3IPT A;  4XBY A;  2Z6B A;  2BMQ B;  3T0U A;  1W01 A;  2KF5 A;  1WNH A;  3SX1 A;  1M9G A;  2CHC A;  4R9K A;  3U1W A;  2ML5 A;  4BTW A;  1JB4 A;  1U5O A;  4J9A A;  3CU3 A;  3FKA A;  3N8B A;  4IPB A;  3HII A;  2P05 A;  4BIR A;  2YFJ B;  2C11 A;  3HX8 A;  9RNT A;  1N8R 4;  1ZX2 A;  1VQK 3;  3I55 3;  1X1W A;  2ZA4 A;  3KCH A;  1OCV A;  5IG3 A;  3U97 A;  1WTH A;  1A2V A;  5LC7 A;  2GEY A;  2KRT A;  3MPH A;  4WYK A;  1S5A A;  5CF2 A;  1B20 A;  2OQE A;  1TU5 A;  3OWY A;  2CIU A;  3F40 A;  2W56 A;  2XGN A;  3CCE 3;  2XR8 B;  2W6J H;  3K9M C;  3DH2 A;  1NO3 A;  3CCQ 3;  2RCD A;  4ZM8 A;  3X41 A;  1RCK A;  3G8Z A;  1X1U A;  5IEN A;  5BXQ A;  1AR0 A;  1VQ8 3;  3SYU A;  2AAD A;  2CKF B;  3BNE A;  4NPB A;  3RGA A;  2ML6 A;  3HIG A;  2K54 A;  1B2U A;  3AMO A;  4BL3 A;  5IG4 A;  1YI2 3;  1DMQ A;  4HM4 B;  1X1X A;  1G96 A;  3CCM 3;  2XF3 A;  2Y74 A;  4MMX B;  1RKY A;  5BU4 A;  2QIY A;  3S28 A;  5AII A;  1JKG B;  3KKG A;  1PU4 A;  5G1L A;  4KZ1 A;  5IF6 A;  3DGL A;  3G71 3;  3LXU X;  1X1Y A;  1E97 A;  1HZ1 A;  1OGX A;  5KP4 A;  4HZB B;  1TUH A;  4WFO A;  1AVK A;  1I0V A;  1EQK A;  2O9U X;  3KFQ C;  1BSA A;  2L4V A;  3URP A;  4WHA A;  1BNG A;  1GD3 A;  3MHE A;  3NXJ A;  3VF1 A;  3D5I A;  3H3H A;  5HGR A;  1BNE A;  1NB3 I;  1VQ9 3;  4OVM A;  3T8N A;  1RGC A;  3UL5 A;  1VQ5 3;  1Q7Y 4;  3CMA 3;  2MF7 A;  2GXF A;  2R4I A;  1K41 A;  2SBL A;  3GAX A;  3HOH A;  3LTD A;  5ELU A;  1GOY A;  3FG3 A;  4LGQ A;  4R9L A;  1F8N A;  4HM8 B;  4K1U A;  4BL2 A;  2BIR A;  1BRK A;  1ULJ B;  1MWR A;  3KII A;  3Q3F A;  1B2X A;  1VQQ A;  1TRP A;  1FUW A;  1JN5 A;  2CFW A;  1IV9 A;  2KF4 A;  3AHW A;  2XFT A;  3HZP A;  3UJM A;  3JUM A;  1QAK A;  3OWS A;  4LYL B;  4HM5 B;  1PFP A;  3PCR A;  2P09 A;  3Q1C A;  1C7H A;  3D9R A;  2W04 A;  4HZ9 B;  1GD4 A;  4HJL B;  1ISK A;  4L8O A;  2UGI A;  1LQG C;  1B2M A;  3MG3 A;  1BRN L;  4FMC A;  2KF6 A;  5BIR A;  3G16 A;  3CME 3;  5G2G A;  2F4Y A;  3GZB A;  1RN1 A;  1R4Y A;  1NWW A;  3K5T A;  3LML A;  3F7X A;  3L0R A;  1IK3 A;  2IUK A;  2WO0 A;  1G0T A;  1JZD A;  1IV7 A;  3T8U A;  1EG9 B;  1IQY A;  2D42 A;  4AKZ A;  1OH0 A;  2B1X B;  4I5Q A;  2RGQ A;  1JBR A;  1Q7H A;  1Q42 A;  1LXE A;  3SLU A;  3D5G A;  4EW5 A;  1RRL A;  4EV2 A;  3CPW 2;  1HYF A;  1ZO2 A;  3NBR A;  4N6N B;  1I8V A;  1Q40 B;  4GHO A;  3D3L A;  3DY5 A;  3WR2 A;  2OTL 3;  2XH9 A;  1C54 A;  4L8P A;  1WMP A;  1LOX A;  3SED A;  3OV4 A;  4J8T A;  1RNT A;  1FW7 A;  1RGE A;  1IVV A;  4FMD A;  2ZHX B;  3EQQ B;  3WMD A;  1BNF A;  4K1V A;  1RGA A;  1BAO A;  1W6G A;  2FXT A;  3IJE B;  3QRD A;  2W9P A;  1D6Z A;  1DVD A;  3EHC A;  1B2Z A;  8RNT A;  1W02 A;  4BU4 A;  1IQ8 A;  2HMN B;  3WOF B;  3JUQ A;  4U13 A;  3IMA B;  3VSY A;  1RGG A;  1U8C B;  4BTX A;  2QA4 3;  3GZR A;  2XSH B;  1STD A;  1TFO A;  5JPP A;  2HMM B;  1B27 A;  5DRV A;  1VQ4 3;  2XRX B;  3DXO A;  6GSP A;  4FMB A;  1Q82 4;  4LMI A;  3B8L A;  2PZV A;  1I2E A;  1S72 3;  4I4K A;  3OW2 2;  3SOA A;  3PXM A;  4LZI A;  1Q86 4;  3KSP A;  1W6Y A;  3F9S A;  4GB5 A;  2P0X A;  4LEH A;  1M90 4;  1AQZ A;  4KFD A;  3GWR A;  1KQS 2;  1RTU A;  1VQ6 3;  2KF3 A;  2AAE A;  1BSD A;  1GYB A;  2FGT A;  2O3O A;  2Z77 A;  5AI1 A;  1RGF A;  3PZW A;  1RDS A;  1NB5 I;  1LVN A;  2GU3 A;  1DMN A;  1CEW I;  1MNL A;  2LYX A;  2BO9 B;  2HOH A;  4R80 A;  3SOY A;  3X3X A;  3N54 B;  1FUS A;  3LH4 A;  1LNH A;  1YJW 3;  5AEU B;  1IVW A;  1VQ7 3;  4R1K A;  1JKG A;  3EE1 A;  4HM6 B;  3ZG5 A;  1QAF A;  3CXC 2;  5AIF A;  1VQP 3;  2KCD A;  1TTO A;  2OOV C;  3FLJ A;  5IER A;  1YVB I;  1UGI A;  1YVS A;  2CW9 A;  3V99 A;  1QVF 2;  3BND A;  1V74 A;  5IG5 A;  3DGO A;  2RFR A;  8CHO A;  7GSP A;  1RHL A;  4RZM A;  1JBT A;  4HM1 B;  1BRG A;  1Q81 4;  2W03 A;  4N6V 0;  5D83 A;  1I3F A;  1FA3 A;  4N3V A;  3FG1 A;  4N6M A;  1UI8 A;  1N9E A;  4K90 B;  4MMY B;  4EC6 A;  4K61 A;  1GY7 A;  1KWI A;  2OQE C;  2BU4 A;  3MSO A;  3OX9 A;  3CCL 3;  1QVG 2;  1W7C A;  3EBT A;  3S67 A;  1GMQ A;  1BNS A;  1IT8 A;  3D79 A;  3A5E A;  3FF0 A;  3JVC A;  2Z76 A;  1GY6 A;  3Q90 A;  1BAN A;  3PCS A;  1LOV A;  1MOL A;  2PNC A;  2CFG A;  1T5Y A;  1NJI 4;  3WOD G;  2F99 A;  3LT8 A;  1FZU A;  1RLS A;  2IMJ A;  4XB5 A;  5A0O B;  2QGU A;  3WA3 A;  1ASK A;  1J2B A;  2OTJ 3;  3CNM A;  4EBG A;  4ILF A;  2GBX B;  4IT7 A;  2W9Q A;  1V57 A;  3JUN A;  4NHF A;  4GL6 A;  5AYS C;  3CD6 3;  1GMP A;  1W00 A;  2W2C A;  1A67 A;  1RGK A;  2HMO B;  2IYJ A;  2YX9 A;  1VQO 3;  4O8S A;  3B4O A;  1N9J A;  5BVB A;  1QJG A;  1JB2 A;  3PYJ A;  4RNY A;  3DMC A;  5IEO A;  2INX A;  1RSN A;  3NX0 A;  4HM2 B;  1WMN A;  4DKI A;  2B24 B;  3UB1 A;  1KC8 4;  1FGO A;  1O7M B;  3DGN A;  1IQX A;  2ZL8 A;  4CPK A;  1RCL A;  2J8X B;  3S5C A;  5CF1 A;  3BU4 A;  1EEJ A;  1PY3 A;  3RGR A;  5KP1 A;  2XEP A;  1JRQ A;  1IVU A;  1TIJ A;  3QK9 A;  1UCK A;  3CC4 3;  1UUG B;  1YJN 3;  4IIA A;  4OK0 A;  3LZA A;  4N6U A;  1D6U A;  1IDP A;  1OF5 B;  3DM8 A;  2XFS A;  2H0H A;  3RNT A;  3NQY A;  3WOE B;  3JUP A;  3G4S 3;  4H61 A;  3BLZ A;  1TFK A;  1GS3 A;  4HBR A;  1OHS A;  1DVC A;  2GEX A;  3HK4 A;  4MJD A;  2P38 A;  3N9H A;  3KSE D;  1CYU A;  5M1A A;  1HU9 A;  3EX9 A;  3NM2 A;  5EQL A;  1BOX A;  1Q40 A;  2LQV A;  2E2T A;  4FCJ A;  1BGS A;  1LOY A;  3MG1 A;  1N8Q A;  3NV0 B;  4HOH A;  3EN1 B;  2IUJ A;  2CH9 A;  3DGM A;  1QMA A;  2WOH A;  1JZO A;  4MMZ B;  1FGQ A;  1CYV A;  5CXO A;  1UCI A;  3PGB A;  1B21 A;  3AGO A;  4XBT A;  5IW9 A;  1T2I A;  4X2O A;  4N6O B;  1YIT 3;  4HM7 B;  1O7P B;  1UGH I;  4PEJ A;  5AEW B;  4O2H A;  1OAC A;  3B7C A;  3KZT A;  5EEO A;  1L5G B;  1NU3 A;  1JB5 A;  2STD A;  2W0Q A;  3LT9 A;  2MC8 A;  1I2F A;  4LSO A;  3EBY A;  4N6T A;  3K7C A;  2XSO B;  1A2K A;  3G6E 3;  3JUO A;  2CG0 A;  1BVI A;  1W4N A;  2GBW B;  3E99 A;  1O7N B;  1W2B 2;  3V98 A;  3NBJ A;  2F5W A;  1SII A;  1A90 A;  3ZFZ A;  1AV4 A;  5RNT A;  4XBX A;  1OHP A;  1FGT A;  1EA2 A;  3EC9 A;  1EKM A;  3AHS A;  1RGH A;  1US1 A;  2C10 A;  1MWU A;  1ULI B;  1IYY A;  1A2P A;  1K9M 4;  3WHO A;  3CCV 3;  2IY2 A;  1GOV A;  1VZZ A;  1I3I A;  1E3V A;  3M8C A;  3F8H A;  1IU7 A;  3I56 3;  4Q53 A;  1IVX A;  4HYZ A;  4H3U A;  2CWU A;  1BRS A;  1NNV A;  3NHX A;  1ZS7 A;  1UUV B;  3V92 A;  1BNR A;  1T3B A;  1BNI A;  3ROB A;  5HOH A;  5G1K A;  2ZDJ A;  4EXR A;  3K0Z A;  1PYL A;  1RN7 A;  3DUK A;  2F86 B;  2K3D A;  1YJ9 3;  2HML B;  5KP3 A;  4J5K A;  3A76 A;  4R4K A;  1BRH A;  2RBI A;  5AIH A;  1OPY A;  1KSI A;  3GZY B;  1TJD A;  3I0Y A;  4HM0 B;  4HM3 B;  1K8A 4;  1G02 A;  1YGE A;  1BRJ A;  1SIH A;  3BB9 A;  4O02 B;  2E2U A;  1FYS A;  1VQM 3;  1CH0 A;  1DYU A;  3CC2 3;  1RGL A;  5LC6 A;  4CJN A;  3LTB A;  1SAR A;  3F14 A;  2A15 A;  1LOW A;  4BTY A;  1UDI I;  3WDG B;  1ROV A;  4JRF A;  5D82 A;  2F56 A;  1ZGX A;  2F98 A;  3KE7 A;  3PS8 A;  4FR9 A;  3ALA A;  3O8Y A;  3MWZ A;  3FH1 A;  2I9W A;  2CFL A;  2BT3 A;  2C4B A;  3GRD A;  2GU1 A;  5JPU A;  5M18 A;  4FCZ A;  5M19 A;  3NQZ A;  4O3V A;  4RBN A;  1CQS A; 
#chains in the Genus database with same CATH homology
 1HYF A;  1BUJ A;  7RNT A;  1I8V A;  1RCL A;  4GHO A;  3BU4 A;  3WR2 A;  1C54 A;  1PY3 A;  2KF5 A;  1UCK A;  1GOU A;  5GSP A;  1RNT A;  4BIR A;  1FW7 A;  9RNT A;  1RGE A;  3RNT A;  2GSP A;  1BNF A;  1X1W A;  2ZA4 A;  3KCH A;  1RGA A;  1BAO A;  4J5G A;  1TRQ A;  1B2Z A;  8RNT A;  4BU4 A;  1B20 A;  1BU4 A;  1BOX A;  1MGR A;  1GSP A;  3DH2 A;  1RGG A;  1BGS A;  2KAA A;  1LOY A;  4HOH A;  1RCK A;  1X1U A;  1B27 A;  1B3S A;  1BSC A;  1BSB A;  1UCI A;  3SYU A;  2AAD A;  6GSP A;  1B21 A;  3AGO A;  1T2I A;  1I2E A;  1RNB A;  1JBS A;  1B2U A;  1BRI A;  2RNT A;  1X1X A;  1RN4 A;  1Q9E A;  1DE3 A;  5BU4 A;  1AQZ A;  1RTU A;  1I2F A;  2KF3 A;  2SAR A;  2AAE A;  1BSD A;  2F5M A;  1RGF A;  1X1Y A;  1BVI A;  1HZ1 A;  1I70 A;  1RDS A;  1I0X A;  1I0V A;  1LRA A;  1BIR A;  1I2G A;  2F5W A;  1BSA A;  2HOH A;  3URP A;  5RNT A;  4HAA A;  1BNG A;  1FUS A;  1BNJ A;  3AHS A;  1RGH A;  3D5I A;  1B2S A;  4GSP A;  1IYY A;  1A2P A;  1BNE A;  3WHO A;  1TTO A;  1GOV A;  1RGC A;  1I3I A;  3GSP A;  1YVS A;  3HOH A;  1YGW A;  1GOY A;  1BNR A;  1BRS A;  1BNI A;  2BIR A;  1BRK A;  1RHL A;  3Q3F A;  7GSP A;  5HOH A;  1B2X A;  1UCJ A;  1JBT A;  1TRP A;  1BRG A;  1PYL A;  1I3F A;  2KF4 A;  3AHW A;  1GMR A;  4J5K A;  1BRH A;  2RBI A;  3DGY A;  1BSE A;  2BU4 A;  3AGN A;  1G02 A;  1GMQ A;  1BNS A;  1BRJ A;  1YNV X;  1FUT A;  3A5E A;  1B2M A;  1BAN A;  1FYS A;  1CH0 A;  1BRN L;  2KF6 A;  1RGL A;  5BIR A;  1LOV A;  1SAR A;  1LOW A;  2F4Y A;  3BIR A;  1FZU A;  1RLS A;  6RNT A;  1RN1 A;  1R4Y A;  1T2H A;  2F56 A;  1ZGX A;  1RMS A;  1UCL A;  1AY7 A;  1GMP A;  1MGW A;  1LNI A;  2C4B A;  4RNT A;  1JBR A;  3D4A A;  1RGK A;  3D5G A;  1RSN A;  1DET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...