3SYUA

Re-refined coordinates for pdb entry 1det - ribonuclease t1 carboxymethylated at glu 58 in complex with 2'gmp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
102
Chain Sequence
CDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease T1
publication title Exploiting structure similarity in refinement: automated NCS and target-structure restraints in BUSTER.
pubmed doi rcsb
total genus 22
structure length 102
sequence length 103
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3syuA00
6RNTA 1RGLA 2BU4A 1BSAA 7RNTA 4J5GA 3DGYA 1RGGA 3URPA 2AADA 1BRSA 1RN1A 4HOHA 1GMQA 1GOVA 3AGNA 1BU4A 1FW7A 1RGFA 1T2IA 1I3IA 3AGOA 9RNTA 1LOYA 1X1UA 1IYYA 1BRJA 1I2GA 2ZA4A 1MGRA 1X1XA 2AAEA 1B2ZA 1BOXA 1Q9EA 1FZUA 1FYSA 1BRNL 1LRAA 1YGWA 3DH2A 1FUTA 3AHWA 1B2UA 1I2EA 1RLSA 3KCHA 5RNTA 4BIRA 5BU4A 1JBSA 3D5IA 1JBRA 2KF6A 1A2PA 1RCKA 1R4YA 1BSCA 2SARA 1BNSA 1BUJA 1LNIA 4J5KA 1RNTA 1BNJA 3HOHA 1BRKA 1BVIA 1GMPA 1BRIA 1I70A 2KF4A 1BAOA 5BIRA 1BNFA 1RMSA 1RN4A 2HOHA 2F5WA 1RNBA 8RNTA 5HOHA 1RCLA 6GSPA 1B2XA 1B3SA 2F56A 1DE3A 1I0VA 1RHLA 1RSNA 4GSPA 3AHSA 1AY7A 1MGWA 1UCJA 1I3FA 1UCKA 3Q3FA 1B27A 1B20A 1FUSA 1X1YA 3WR2A 1SARA 1DETA 3GSPA 1JBTA 1T2HA 1BSDA 1UCLA 2KF5A 1B2SA 1BRGA 1RGEA 3D4AA 4HAAA 1HYFA 1BNGA 1I2FA 1BNEA 1RGHA 4RNTA 1G02A 1BSEA 1TRPA 1BNRA 2BIRA 1PY3A 1BIRA 3D5GA 2GSPA 1RGCA 1GOUA 1BANA 1BSBA 1BNIA 1RTUA 2RNTA 1AQZA 2KAAA 3BIRA 1LOVA 1ZGXA 2F5MA 3RNTA 1X1WA 1RGAA 1BRHA 1GMRA 2KF3A 1PYLA 1GOYA 1TTOA 1RDSA 3BU4A 2RBIA 1I8VA 4GHOA 1RGKA 1UCIA 1HZ1A 1YNVX 1I0XA 5GSPA 1GSPA 1B2MA 1CH0A 1BGSA 3SYUA 1TRQA 4BU4A 1YVSA 1LOWA 2C4BA 1C54A 3WHOA 3A5EA 2F4YA 7GSPA 1B21A
chains in the Genus database with same CATH superfamily
2OQEA 1RGLA 3CCU3 1FGQA 2R41A 3D3LA 1JZOA 5A0OB 1R4CA 1BSAA 2XSHB 3ROBA 1VQ53 3SOAA 3S27A 5TGNA 3SOYA 1JB2A 3LT8A 1YJW3 3F7XA 1A90A 1OF5B 1UW1A 1AVLA 1NU3A 2D42A 1ULIB 1KSIA 1YGEA 2AADA 1YJN3 5CF1A 3CU3A 4OK0A 4DKIA 1YIJ3 1MNLA 5DRVA 3CCS3 1RN1A 1T3BA 1BU4A 2WOFA 1AV4A 2HMJB 4BL3A 2H0HA 1FW7A 3V92A 5ELJA 2H0IA 1LOYA 3CCJ3 1G0TA 4MMZB 2Z6BA 1TU5A 2ZA4A 3NV0A 5FGOA 3CNXA 3WOEB 1EQKA 2W56A 2WO0A 3JUQA 2BMOB 4O8SA 4KFDA 3CME3 2RFRA 3AMOA 5STDA 4CCVA 2GXFA 1IV7A 2CKFB 1PFPA 2YFLB 3D79A 1FYSA 2XH9A 2CHCA 1LRAA 2ML5A 1IV9A 3AHWA 1I2EA 4LSOA 4BIRA 5BU4A 4K1VA 3KKGA 1TJDA 5LC6A 1JBRA 1A2PA 2FNQA 1RCKA 2WGQA 4NPBA 2H0GA 5JPUA 2HMKB 1BNSA 2PNCA 2K54A 3UNLA 3CCR3 4J5KA 2QEX3 4RNZA 3EF8A 1JJ22 3T8UA 5IG4A 1N5PA 1NNVA 1Q814 3EBYA 1ROVA 4XDWA 3X41A 4HM5B 1BNFA 3GZBA 2F98A 1Z1SA 2W03A 3FF0A 3M8CA 3HIIA 2OTL3 3JUOA 3CCQ3 5IG3A 1B2XA 3V99A 3MKIA 1E3VA 1NWWA 1PU4A 4G1MB 2L1SA 4KVHA 4O3VA 2XFTA 5AEUB 4AKYA 7STDA 1KC84 1TP6A 3UB1A 3X3YA 1B20A 1FUSA 1NB3I 4N3VA 1D6YA 1SARA 2BT3A 3Q1CA 1JB4A 1JZDA 2W2CA 1UCLA 2C10A 3EC9A 2HMOB 4U13A 1B2SA 1N8QA 1BRGA 1RGEA 4RBNA 1DVCA 3D4AA 1WMOA 1W5ZA 2HMNB 4LMIA 3SLUA 4CPKA 1O7WB 4OUQA 1BSEA 1O7MB 1STDA 1TUHA 3O8YA 3K63A 1SPUA 2WGOA 1BIRA 1BNRA 2MC8A 1OPYA 2RGQA 4J9AA 1CQSA 2P38A 2P09A 1RGCA 2W9PA 2W9QA 1IT7A 2ML6A 2FXTA 2BHMA 4N6MA 3HIGA 2Z7AA 3GZRA 1GD4A 3BIRA 1DYUA 3PGBA 3U97A 2LYXA 3HX8A 1M9GA 3MYTA 1NB5I 1QVG2 1X1WA 3F9SA 4LYLB 2CH9A 3IPTA 5AI1A 3OWSA 5KP1A 1V58A 3CMA3 1RDSA 1Y4KA 3WOFB 3BU4A 1Q42A 4R4KA 1RGKA 1EA2A 1I0XA 1N9EA 1GSPA 5CLKA 1N5HA 1O7HB 1BGSA 5EEOA 1TRQA 3T8NA 3FKAA 3MG1A 4GL6A 1UGHI 1TIJA 2C4BA 3LTDA 2WOHA 4FMBA 4R80A 3A5EA 5CF2A 1MWRA 1C54A 1B21A 1QAKA 3S28A 4WP5A 3KSED 1YIT3 4H3UA 3OV4A 3EBTA 1U5OA 1KQS2 3FG1A 1DMMA 1W2ZA 2CC3A 5EQLA 1V57A 2M7OA 2D1WA 2LQVA 2QA43 5AYSC 4J5GA 3F8HA 4HM0B 1RRLA 3CXC2 1RGGA 5CXOA 2XGLA 2HMMB 3DGMA 4EXRA 2BMRB 1BRSA 1BUQA 1FUWA 3UL5A 3G4S3 1ISKA 3OW22 4L8PA 3NV0B 1GMQA 3JUMA 2GU3A 2HMLB 3X3ZA 2RSXA 1VQ63 1I3IA 2W56B 9RNTA 3ZG0A 1LVNA 1IYYA 2Y74A 1BRJA 2XR8B 3GAXA 1X1XA 3HI7A 4J8TA 4FR9A 1AVKA 1Q40A 3B7CA 5D82A 3BNDA 1IQYA 3NXJA 4MJDA 2CFGA 1BOXA 1S723 1F8NA 2MF7A 3F14A 3NM7A 3DH2A 1FUTA 3TDGA 3KCHA 1RLSA 3NBBA 5RNTA 1WMNA 1JBSA 1SIHA 1JB5A 2CIUA 4XDVA 2XEPA 3SXXA 1LNIA 4BTXA 1BNJA 3OWUA 3HOHA 1YHQ3 1T5YA 3DGNA 4HYZA 1C7HA 1OHPA 2CFLA 2CWUA 3G8ZA 4XBXA 1BAOA 4HM7B 3K7CA 4N6LA 3VF1A 3EN8A 1RMSA 1RJOA 4GB5A 3A76A 1KD14 3LH4A 1ULJB 4HM2B 8RNTA 1W7CA 3SEDA 3LTCA 3WODG 3D9RA 2CG1A 1I0VA 3NM2A 4EYCA 3CCE3 2Y73A 3EE1A 5IG5A 2PZVA 1OGXA 3AHSA 2KRTA 1MGWA 1IVXA 3L0RA 3FSDA 1UCJA 4L7KA 1IVVA 2OOVC 1UCKA 2UUGC 3Q3FA 1W6GA 1M904 1IDPA 1W00A 1DETA 2CWTA 3GSPA 1ZO2A 4KFFA 4HM1B 3VSYA 2KF5A 4H61A 3PCRA 1VZZA 2A15A 1OHOA 2J8XB 2IYJA 3LYGA 4WHAA 1G02A 4IT7A 3NHXA 2BIRA 5D81A 1PY3A 3G0KA 4MMXB 3K0ZA 2I9WA 2IY2A 5IG0A 2RNTA 2BO9B 1A2VA 1AQZA 2CK3H 1UI8A 5IENA 1EUIC 2F5MA 4KT3B 5IF6A 3EN1B 1VQ93 3BLZA 4XM4A 1Q864 1BRHA 1GMRA 2KF3A 2RCDA 1CYVA 1VQO3 6STDA 3NUVA 4EBGA 1GOYA 3MHEA 3F8XA 1DMNA 2RBIA 1I8VA 2K3DA 3QRDA 1IVWA 4FMAA 1UCIA 4GHOA 1YNVX 3B8LA 3NX0A 3H51A 1LOWA 3WHOA 5D83A 7GSPA 2CX0A 5AEWB 1VQ73 3NBJA 4STDA 3HZPA 6RNTA 3K9MC 4RZMA 4LZIA 3PZWA 1KWIA 1LQMB 3ECFA 3SX1A 1IK3A 1RN7A 7RNTA 1GD3A 1YI23 2STDA 2QIYA 2OTJ3 1FGTA 3K5TA 2IA7A 5KP3A 4N6V0 1Q7HA 2E2TA 2P0XA 5IW9A 1GS3A 1HKXA 3WA3A 4XBYA 3CPW2 3JUNA 1MOLA 1OHSA 2CX1A 1QAFA 1Q40B 4HM3B 3AGOA 1UGIA 1X1UA 2Q07A 3I0YA 1I2GA 4EV2A 1L5GB 1J2BA 1WTHA 1OCVA 1MGRA 3N9HA 1K734 4X2OA 3IJEB 4KZ1A 1B2ZA 2CFDA 4KFEA 1E3RA 1N9JA 1VQ83 1Q9EA 1FZUA 3UJMA 5AIHA 4EV5A 2GEXA 1YGWA 2UGIA 1MWUA 2R4IA 1B2UA 1K41A 1ZX2A 3PYJA 4HZ9B 2O3OA 3CC73 3KIIA 5IEOA 2KF6A 2JDIH 2Z76A 1RKYA 3WMDA 1R4YA 4HM4B 4R9LA 1BSCA 2OCTA 1RNTA 3S5CA 1LNHA 1TFKA 5JPPA 1LQGC 1BRKA 1GMPA 5EVHA 3BNEA 1JN5A 1D6ZA 1I70A 2XF3A 2K0MA 3DXOA 3ZG5A 2KF4A 1IU7A 3IMAB 3LT9A 1NJI4 2QGUA 5BIRA 4OVMA 2L4VA 3ALAA 3AMOB 5HGRA 2IUJA 2ZDJA 2OQEC 3DM8A 4EW5A 1CYUA 1SIIA 2F5WA 1RCLA 3OXAA 5IERA 4N6UA 6GSPA 1DMQA 5JBSA 1OUNA 2GU1A 2F56A 1DE3A 4WYKA 5M1AA 1RHLA 2XSOB 2E2UA 4O02B 1RSNA 4GSPA 3VGNA 1W2B2 1QMAA 4K90B 4HBRA 3MSOA 2KCDA 3JUPA 1I3FA 1QALA 4JRFA 4N6OB 3S67A 3T0UA 4RNYA 1B27A 1NO3A 3KSPA 1X1YA 3LMLA 3RGAA 5I97A 1JBTA 1T2HA 1W6YA 3STDA 3N54B 1DVDA 3KZTA 4XBTA 3CCL3 2IUKA 4HAAA 2OWPA 4FCMA 1HYFA 2JQ5A 3DMCA 1I2FA 1RGHA 4RNTA 3FG3A 1O7PB 3I553 1EG9B 5KP4A 4HKVB 2GSPA 1JV2B 2ZL8A 3ZFZA 5IEPA 1BANA 1BSBA 1BNIA 3LTBA 3CCV3 3B4OA 1G96A 2KAAA 2E2VA 1EKMA 1UDII 1YVBI 2CWVA 4BTYA 1K28A 4CDLA 2O9UX 3RNTA 1ASKA 1RGAA 1GY5A 4HVNA 5AIFA 1WMPA 3JVCA 2B1XB 3SVAA 3G713 1JKGA 1FGRA 3MG2A 1PYLA 1LXEA 3F7SA 1TTOA 1VQN3 4K61A 1UUGB 3J7Yd 1GY7A 4ZM8A 3FCSB 4HM6B 1AR0A 5GSPA 1JRQA 3F40A 1CH0A 3OX9A 3EB8A 3BNCA 1ROAA 3SYUA 5BXQA 4BU4A 4WWUC 5ELUA 4NHFA 3MWZA 3U1WA 1W4NA 2INXA 4Q53A 4WFOA 1VQK3 3GRDA 2BU4A 1M1XB 3GZYB 4L8OA 1Q7Y4 2W6JH 4ORLA 5G1KA 3EJVA 1IQ8A 1UUVB 4MMYB 1A67A 4I5QA 1FGOA 5AYRB 1QVF2 1OH0A 3X3XA 3S29A 1MWTA 3EHCA 3N8BA 3V98A 1W02A 3GWRA 2OOVA 4FMCA 3DGYA 4R9KA 3G16A 1VQQA 3URPA 3Q2PA 4FMDA 1M1K4 2ZHXB 3FZWA 4ILFA 1VQ43 3CCM3 3CC43 1OF5A 1OACA 4HZBB 2C11A 5CK6A 4HOHA 3KN4A 1EEJA 1GOVA 3AGNA 1WQLB 1O7GB 4O2HA 2P0MA 4QWTA 1RGFA 1T2IA 2P05A 3DGOA 3EX9A 3LXUX 1FA3A 1S5AA 3CPOA 4CJNA 1E97A 2UX0A 4EC6A 1RRHA 2IMJA 4N6NB 5FW5A 4MEIA 1CEWI 4I4KA 2AAEA 4LGQA 3I563 3MG3A 1W6CA 3GZXB 3Q90A 3WDGB 4AEQA 1US1A 3NBRA 2CFWA 1ZS7A 4LEHA 3X42A 5BVBA 1BRNL 3DZLA 4IPBA 2YX9A 1D6UA 1W01A 1GYBA 2XGNA 3DUKA 5G2GA 3NQYA 1SQWA 3D5IA 3ER7A 3KFQC 3RDEA 3QK9A 3BNBA 1JN5B 2XFSA 2SARA 4IIAA 3CD63 1N8R4 1BUJA 2Z77A 2KXGA 1UUWB 1Q824 1IQXA 3DY5A 2GEYA 4N6TA 1BVIA 1BRIA 3RGRA 2XRXB 3E99A 1A2KA 5AIIA 4WYKB 2CG0A 2W04A 1RN4A 5M19A 3KE7A 3HK4A 2HOHA 1RNBA 1JNQA 4K1UA 5HOHA 2F86B 1YJ93 3LTAA 1B3SA 3G6E3 2GBXB 4XB5A 4TX4A 1K9M4 3X40A 2CW9A 2YFJB 1AY7A 4R1KA 1U8CB 3PXMA 1TFOA 4NREA 1NDOB 3CNMA 2SBLA 2YFIB 3PCSA 3WR2A 1VQL3 2FGTA 1BSDA 1SJWA 2GBWB 5LC7A 4FCJA 1MWSA 2W0QA 1HU9A 1BNGA 8CHOA 1BNEA 1O7NB 5M18A 4BTWA 3H3HA 5DREA 3FG4A 2BNGA 3B4PA 1TRPA 4PEJA 3FH1A 3D5GA 4HM8B 1GOUA 3EQQB 3LZAA 3FGYA 1RTUA 1QJGA 3UL6A 2V1LA 1STFI 4AKZA 3OWYA 1ZGXA 1JKGB 1LOVA 1VQM3 3MPHA 3FLJA 4JF8A 1K8A4 1GY6A 1LOXA 2CFKA 1IT8A 2B24B 4FCZA 1V74A 1VQP3 3DGLA 3BB9A 3LOYA 3NQZA 4HJLB 1OGZA 1HZ1A 3WA2X 5AIGA 1FGMA 4BL2A 1WNHA 1B2MA 1YVSA 3CC23 2F99A 1IVUA 2F4YA 1UI7A 2BMQB 4X2HA 3PS8A 3FF2A 5G1LA
chains in the Genus database with same CATH topology
6RNTA 1RGLA 2BU4A 1BSAA 7RNTA 4J5GA 3DGYA 1RGGA 3URPA 2AADA 1BRSA 1RN1A 4HOHA 1GMQA 1GOVA 3AGNA 1BU4A 1FW7A 1RGFA 1T2IA 1I3IA 3AGOA 9RNTA 1LOYA 1X1UA 1IYYA 1BRJA 1I2GA 2ZA4A 1MGRA 1X1XA 2AAEA 1B2ZA 1BOXA 1Q9EA 1FZUA 1FYSA 1BRNL 1LRAA 1YGWA 3DH2A 1FUTA 3AHWA 1B2UA 1I2EA 1RLSA 3KCHA 5RNTA 4BIRA 5BU4A 1JBSA 3D5IA 1JBRA 2KF6A 1A2PA 1RCKA 1R4YA 1BSCA 2SARA 1BNSA 1BUJA 1LNIA 4J5KA 1RNTA 1BNJA 3HOHA 1BRKA 1BVIA 1GMPA 1BRIA 1I70A 2KF4A 1BAOA 5BIRA 1BNFA 1RMSA 1RN4A 2HOHA 2F5WA 1RNBA 8RNTA 5HOHA 1RCLA 6GSPA 1B2XA 1B3SA 2F56A 1DE3A 1I0VA 1RHLA 1RSNA 4GSPA 3AHSA 1AY7A 1MGWA 1UCJA 1I3FA 1UCKA 3Q3FA 1B27A 1B20A 1FUSA 1X1YA 3WR2A 1SARA 1DETA 3GSPA 1JBTA 1T2HA 1BSDA 1UCLA 2KF5A 1B2SA 1BRGA 1RGEA 3D4AA 4HAAA 1HYFA 1BNGA 1I2FA 1BNEA 1RGHA 4RNTA 1G02A 1BSEA 1TRPA 1BNRA 2BIRA 1PY3A 1BIRA 3D5GA 2GSPA 1RGCA 1GOUA 1BANA 1BSBA 1BNIA 1RTUA 2RNTA 1AQZA 2KAAA 3BIRA 1LOVA 1ZGXA 2F5MA 3RNTA 1X1WA 1RGAA 1BRHA 1GMRA 2KF3A 1PYLA 1GOYA 1TTOA 1RDSA 3BU4A 2RBIA 1I8VA 4GHOA 1RGKA 1UCIA 1HZ1A 1YNVX 1I0XA 5GSPA 1GSPA 1B2MA 1CH0A 1BGSA 3SYUA 1TRQA 4BU4A 1YVSA 1LOWA 2C4BA 1C54A 3WHOA 3A5EA 2F4YA 7GSPA 1B21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6RNT A;  1RGL A;  2BU4 A;  1BSA A;  7RNT A;  4J5G A;  3DGY A;  1RGG A;  3URP A;  2AAD A;  1BRS A;  1RN1 A;  4HOH A;  1GMQ A;  1GOV A;  3AGN A;  1BU4 A;  1FW7 A;  1RGF A;  1T2I A;  1I3I A;  3AGO A;  9RNT A;  1LOY A;  1X1U A;  1IYY A;  1BRJ A;  1I2G A;  2ZA4 A;  1MGR A;  1X1X A;  2AAE A;  1B2Z A;  1BOX A;  1Q9E A;  1FZU A;  1FYS A;  1BRN L;  1LRA A;  1YGW A;  3DH2 A;  1FUT A;  3AHW A;  1B2U A;  1I2E A;  1RLS A;  3KCH A;  5RNT A;  4BIR A;  5BU4 A;  1JBS A;  3D5I A;  1JBR A;  2KF6 A;  1A2P A;  1RCK A;  1R4Y A;  1BSC A;  2SAR A;  1BNS A;  1BUJ A;  1LNI A;  4J5K A;  1RNT A;  1BNJ A;  3HOH A;  1BRK A;  1BVI A;  1GMP A;  1BRI A;  1I70 A;  2KF4 A;  1BAO A;  5BIR A;  1BNF A;  1RMS A;  1RN4 A;  2HOH A;  2F5W A;  1RNB A;  8RNT A;  5HOH A;  1RCL A;  6GSP A;  1B2X A;  1B3S A;  2F56 A;  1DE3 A;  1I0V A;  1RHL A;  1RSN A;  4GSP A;  3AHS A;  1AY7 A;  1MGW A;  1UCJ A;  1I3F A;  1UCK A;  3Q3F A;  1B27 A;  1B20 A;  1FUS A;  1X1Y A;  3WR2 A;  1SAR A;  1DET A;  3GSP A;  1JBT A;  1T2H A;  1BSD A;  1UCL A;  2KF5 A;  1B2S A;  1BRG A;  1RGE A;  3D4A A;  4HAA A;  1HYF A;  1BNG A;  1I2F A;  1BNE A;  1RGH A;  4RNT A;  1G02 A;  1BSE A;  1TRP A;  1BNR A;  2BIR A;  1PY3 A;  1BIR A;  3D5G A;  2GSP A;  1RGC A;  1GOU A;  1BAN A;  1BSB A;  1BNI A;  1RTU A;  2RNT A;  1AQZ A;  2KAA A;  3BIR A;  1LOV A;  1ZGX A;  2F5M A;  3RNT A;  1X1W A;  1RGA A;  1BRH A;  1GMR A;  2KF3 A;  1PYL A;  1GOY A;  1TTO A;  1RDS A;  3BU4 A;  2RBI A;  1I8V A;  4GHO A;  1RGK A;  1UCI A;  1HZ1 A;  1YNV X;  1I0X A;  5GSP A;  1GSP A;  1B2M A;  1CH0 A;  1BGS A;  3SYU A;  1TRQ A;  4BU4 A;  1YVS A;  1LOW A;  2C4B A;  1C54 A;  3WHO A;  3A5E A;  2F4Y A;  7GSP A;  1B21 A; 
#chains in the Genus database with same CATH topology
 2OQE A;  1RGL A;  3CCU 3;  1FGQ A;  2R41 A;  3D3L A;  1JZO A;  5A0O B;  1R4C A;  1BSA A;  2XSH B;  3ROB A;  1VQ5 3;  3SOA A;  3S27 A;  5TGN A;  3SOY A;  1JB2 A;  3LT8 A;  1YJW 3;  3F7X A;  1A90 A;  1OF5 B;  1UW1 A;  1AVL A;  1NU3 A;  2D42 A;  1ULI B;  1KSI A;  1YGE A;  2AAD A;  1YJN 3;  5CF1 A;  3CU3 A;  4OK0 A;  4DKI A;  1YIJ 3;  1MNL A;  5DRV A;  3CCS 3;  1RN1 A;  1T3B A;  1BU4 A;  2WOF A;  1AV4 A;  2HMJ B;  4BL3 A;  2H0H A;  1FW7 A;  3V92 A;  5ELJ A;  2H0I A;  1LOY A;  3CCJ 3;  1G0T A;  4MMZ B;  2Z6B A;  1TU5 A;  2ZA4 A;  3NV0 A;  5FGO A;  3CNX A;  3WOE B;  1EQK A;  2W56 A;  2WO0 A;  3JUQ A;  2BMO B;  4O8S A;  4KFD A;  3CME 3;  2RFR A;  3AMO A;  5STD A;  4CCV A;  2GXF A;  1IV7 A;  2CKF B;  1PFP A;  2YFL B;  3D79 A;  1FYS A;  2XH9 A;  2CHC A;  1LRA A;  2ML5 A;  1IV9 A;  3AHW A;  1I2E A;  4LSO A;  4BIR A;  5BU4 A;  4K1V A;  3KKG A;  1TJD A;  5LC6 A;  1JBR A;  1A2P A;  2FNQ A;  1RCK A;  2WGQ A;  4NPB A;  2H0G A;  5JPU A;  2HMK B;  1BNS A;  2PNC A;  2K54 A;  3UNL A;  3CCR 3;  4J5K A;  2QEX 3;  4RNZ A;  3EF8 A;  1JJ2 2;  3T8U A;  5IG4 A;  1N5P A;  1NNV A;  1Q81 4;  3EBY A;  1ROV A;  4XDW A;  3X41 A;  4HM5 B;  1BNF A;  3GZB A;  2F98 A;  1Z1S A;  2W03 A;  3FF0 A;  3M8C A;  3HII A;  2OTL 3;  3JUO A;  3CCQ 3;  5IG3 A;  1B2X A;  3V99 A;  3MKI A;  1E3V A;  1NWW A;  1PU4 A;  4G1M B;  2L1S A;  4KVH A;  4O3V A;  2XFT A;  5AEU B;  4AKY A;  7STD A;  1KC8 4;  1TP6 A;  3UB1 A;  3X3Y A;  1B20 A;  1FUS A;  1NB3 I;  4N3V A;  1D6Y A;  1SAR A;  2BT3 A;  3Q1C A;  1JB4 A;  1JZD A;  2W2C A;  1UCL A;  2C10 A;  3EC9 A;  2HMO B;  4U13 A;  1B2S A;  1N8Q A;  1BRG A;  1RGE A;  4RBN A;  1DVC A;  3D4A A;  1WMO A;  1W5Z A;  2HMN B;  4LMI A;  3SLU A;  4CPK A;  1O7W B;  4OUQ A;  1BSE A;  1O7M B;  1STD A;  1TUH A;  3O8Y A;  3K63 A;  1SPU A;  2WGO A;  1BIR A;  1BNR A;  2MC8 A;  1OPY A;  2RGQ A;  4J9A A;  1CQS A;  2P38 A;  2P09 A;  1RGC A;  2W9P A;  2W9Q A;  1IT7 A;  2ML6 A;  2FXT A;  2BHM A;  4N6M A;  3HIG A;  2Z7A A;  3GZR A;  1GD4 A;  3BIR A;  1DYU A;  3PGB A;  3U97 A;  2LYX A;  3HX8 A;  1M9G A;  3MYT A;  1NB5 I;  1QVG 2;  1X1W A;  3F9S A;  4LYL B;  2CH9 A;  3IPT A;  5AI1 A;  3OWS A;  5KP1 A;  1V58 A;  3CMA 3;  1RDS A;  1Y4K A;  3WOF B;  3BU4 A;  1Q42 A;  4R4K A;  1RGK A;  1EA2 A;  1I0X A;  1N9E A;  1GSP A;  5CLK A;  1N5H A;  1O7H B;  1BGS A;  5EEO A;  1TRQ A;  3T8N A;  3FKA A;  3MG1 A;  4GL6 A;  1UGH I;  1TIJ A;  2C4B A;  3LTD A;  2WOH A;  4FMB A;  4R80 A;  3A5E A;  5CF2 A;  1MWR A;  1C54 A;  1B21 A;  1QAK A;  3S28 A;  4WP5 A;  3KSE D;  1YIT 3;  4H3U A;  3OV4 A;  3EBT A;  1U5O A;  1KQS 2;  3FG1 A;  1DMM A;  1W2Z A;  2CC3 A;  5EQL A;  1V57 A;  2M7O A;  2D1W A;  2LQV A;  2QA4 3;  5AYS C;  4J5G A;  3F8H A;  4HM0 B;  1RRL A;  3CXC 2;  1RGG A;  5CXO A;  2XGL A;  2HMM B;  3DGM A;  4EXR A;  2BMR B;  1BRS A;  1BUQ A;  1FUW A;  3UL5 A;  3G4S 3;  1ISK A;  3OW2 2;  4L8P A;  3NV0 B;  1GMQ A;  3JUM A;  2GU3 A;  2HML B;  3X3Z A;  2RSX A;  1VQ6 3;  1I3I A;  2W56 B;  9RNT A;  3ZG0 A;  1LVN A;  1IYY A;  2Y74 A;  1BRJ A;  2XR8 B;  3GAX A;  1X1X A;  3HI7 A;  4J8T A;  4FR9 A;  1AVK A;  1Q40 A;  3B7C A;  5D82 A;  3BND A;  1IQY A;  3NXJ A;  4MJD A;  2CFG A;  1BOX A;  1S72 3;  1F8N A;  2MF7 A;  3F14 A;  3NM7 A;  3DH2 A;  1FUT A;  3TDG A;  3KCH A;  1RLS A;  3NBB A;  5RNT A;  1WMN A;  1JBS A;  1SIH A;  1JB5 A;  2CIU A;  4XDV A;  2XEP A;  3SXX A;  1LNI A;  4BTX A;  1BNJ A;  3OWU A;  3HOH A;  1YHQ 3;  1T5Y A;  3DGN A;  4HYZ A;  1C7H A;  1OHP A;  2CFL A;  2CWU A;  3G8Z A;  4XBX A;  1BAO A;  4HM7 B;  3K7C A;  4N6L A;  3VF1 A;  3EN8 A;  1RMS A;  1RJO A;  4GB5 A;  3A76 A;  1KD1 4;  3LH4 A;  1ULJ B;  4HM2 B;  8RNT A;  1W7C A;  3SED A;  3LTC A;  3WOD G;  3D9R A;  2CG1 A;  1I0V A;  3NM2 A;  4EYC A;  3CCE 3;  2Y73 A;  3EE1 A;  5IG5 A;  2PZV A;  1OGX A;  3AHS A;  2KRT A;  1MGW A;  1IVX A;  3L0R A;  3FSD A;  1UCJ A;  4L7K A;  1IVV A;  2OOV C;  1UCK A;  2UUG C;  3Q3F A;  1W6G A;  1M90 4;  1IDP A;  1W00 A;  1DET A;  2CWT A;  3GSP A;  1ZO2 A;  4KFF A;  4HM1 B;  3VSY A;  2KF5 A;  4H61 A;  3PCR A;  1VZZ A;  2A15 A;  1OHO A;  2J8X B;  2IYJ A;  3LYG A;  4WHA A;  1G02 A;  4IT7 A;  3NHX A;  2BIR A;  5D81 A;  1PY3 A;  3G0K A;  4MMX B;  3K0Z A;  2I9W A;  2IY2 A;  5IG0 A;  2RNT A;  2BO9 B;  1A2V A;  1AQZ A;  2CK3 H;  1UI8 A;  5IEN A;  1EUI C;  2F5M A;  4KT3 B;  5IF6 A;  3EN1 B;  1VQ9 3;  3BLZ A;  4XM4 A;  1Q86 4;  1BRH A;  1GMR A;  2KF3 A;  2RCD A;  1CYV A;  1VQO 3;  6STD A;  3NUV A;  4EBG A;  1GOY A;  3MHE A;  3F8X A;  1DMN A;  2RBI A;  1I8V A;  2K3D A;  3QRD A;  1IVW A;  4FMA A;  1UCI A;  4GHO A;  1YNV X;  3B8L A;  3NX0 A;  3H51 A;  1LOW A;  3WHO A;  5D83 A;  7GSP A;  2CX0 A;  5AEW B;  1VQ7 3;  3NBJ A;  4STD A;  3HZP A;  6RNT A;  3K9M C;  4RZM A;  4LZI A;  3PZW A;  1KWI A;  1LQM B;  3ECF A;  3SX1 A;  1IK3 A;  1RN7 A;  7RNT A;  1GD3 A;  1YI2 3;  2STD A;  2QIY A;  2OTJ 3;  1FGT A;  3K5T A;  2IA7 A;  5KP3 A;  4N6V 0;  1Q7H A;  2E2T A;  2P0X A;  5IW9 A;  1GS3 A;  1HKX A;  3WA3 A;  4XBY A;  3CPW 2;  3JUN A;  1MOL A;  1OHS A;  2CX1 A;  1QAF A;  1Q40 B;  4HM3 B;  3AGO A;  1UGI A;  1X1U A;  2Q07 A;  3I0Y A;  1I2G A;  4EV2 A;  1L5G B;  1J2B A;  1WTH A;  1OCV A;  1MGR A;  3N9H A;  1K73 4;  4X2O A;  3IJE B;  4KZ1 A;  1B2Z A;  2CFD A;  4KFE A;  1E3R A;  1N9J A;  1VQ8 3;  1Q9E A;  1FZU A;  3UJM A;  5AIH A;  4EV5 A;  2GEX A;  1YGW A;  2UGI A;  1MWU A;  2R4I A;  1B2U A;  1K41 A;  1ZX2 A;  3PYJ A;  4HZ9 B;  2O3O A;  3CC7 3;  3KII A;  5IEO A;  2KF6 A;  2JDI H;  2Z76 A;  1RKY A;  3WMD A;  1R4Y A;  4HM4 B;  4R9L A;  1BSC A;  2OCT A;  1RNT A;  3S5C A;  1LNH A;  1TFK A;  5JPP A;  1LQG C;  1BRK A;  1GMP A;  5EVH A;  3BNE A;  1JN5 A;  1D6Z A;  1I70 A;  2XF3 A;  2K0M A;  3DXO A;  3ZG5 A;  2KF4 A;  1IU7 A;  3IMA B;  3LT9 A;  1NJI 4;  2QGU A;  5BIR A;  4OVM A;  2L4V A;  3ALA A;  3AMO B;  5HGR A;  2IUJ A;  2ZDJ A;  2OQE C;  3DM8 A;  4EW5 A;  1CYU A;  1SII A;  2F5W A;  1RCL A;  3OXA A;  5IER A;  4N6U A;  6GSP A;  1DMQ A;  5JBS A;  1OUN A;  2GU1 A;  2F56 A;  1DE3 A;  4WYK A;  5M1A A;  1RHL A;  2XSO B;  2E2U A;  4O02 B;  1RSN A;  4GSP A;  3VGN A;  1W2B 2;  1QMA A;  4K90 B;  4HBR A;  3MSO A;  2KCD A;  3JUP A;  1I3F A;  1QAL A;  4JRF A;  4N6O B;  3S67 A;  3T0U A;  4RNY A;  1B27 A;  1NO3 A;  3KSP A;  1X1Y A;  3LML A;  3RGA A;  5I97 A;  1JBT A;  1T2H A;  1W6Y A;  3STD A;  3N54 B;  1DVD A;  3KZT A;  4XBT A;  3CCL 3;  2IUK A;  4HAA A;  2OWP A;  4FCM A;  1HYF A;  2JQ5 A;  3DMC A;  1I2F A;  1RGH A;  4RNT A;  3FG3 A;  1O7P B;  3I55 3;  1EG9 B;  5KP4 A;  4HKV B;  2GSP A;  1JV2 B;  2ZL8 A;  3ZFZ A;  5IEP A;  1BAN A;  1BSB A;  1BNI A;  3LTB A;  3CCV 3;  3B4O A;  1G96 A;  2KAA A;  2E2V A;  1EKM A;  1UDI I;  1YVB I;  2CWV A;  4BTY A;  1K28 A;  4CDL A;  2O9U X;  3RNT A;  1ASK A;  1RGA A;  1GY5 A;  4HVN A;  5AIF A;  1WMP A;  3JVC A;  2B1X B;  3SVA A;  3G71 3;  1JKG A;  1FGR A;  3MG2 A;  1PYL A;  1LXE A;  3F7S A;  1TTO A;  1VQN 3;  4K61 A;  1UUG B;  3J7Y d;  1GY7 A;  4ZM8 A;  3FCS B;  4HM6 B;  1AR0 A;  5GSP A;  1JRQ A;  3F40 A;  1CH0 A;  3OX9 A;  3EB8 A;  3BNC A;  1ROA A;  3SYU A;  5BXQ A;  4BU4 A;  4WWU C;  5ELU A;  4NHF A;  3MWZ A;  3U1W A;  1W4N A;  2INX A;  4Q53 A;  4WFO A;  1VQK 3;  3GRD A;  2BU4 A;  1M1X B;  3GZY B;  4L8O A;  1Q7Y 4;  2W6J H;  4ORL A;  5G1K A;  3EJV A;  1IQ8 A;  1UUV B;  4MMY B;  1A67 A;  4I5Q A;  1FGO A;  5AYR B;  1QVF 2;  1OH0 A;  3X3X A;  3S29 A;  1MWT A;  3EHC A;  3N8B A;  3V98 A;  1W02 A;  3GWR A;  2OOV A;  4FMC A;  3DGY A;  4R9K A;  3G16 A;  1VQQ A;  3URP A;  3Q2P A;  4FMD A;  1M1K 4;  2ZHX B;  3FZW A;  4ILF A;  1VQ4 3;  3CCM 3;  3CC4 3;  1OF5 A;  1OAC A;  4HZB B;  2C11 A;  5CK6 A;  4HOH A;  3KN4 A;  1EEJ A;  1GOV A;  3AGN A;  1WQL B;  1O7G B;  4O2H A;  2P0M A;  4QWT A;  1RGF A;  1T2I A;  2P05 A;  3DGO A;  3EX9 A;  3LXU X;  1FA3 A;  1S5A A;  3CPO A;  4CJN A;  1E97 A;  2UX0 A;  4EC6 A;  1RRH A;  2IMJ A;  4N6N B;  5FW5 A;  4MEI A;  1CEW I;  4I4K A;  2AAE A;  4LGQ A;  3I56 3;  3MG3 A;  1W6C A;  3GZX B;  3Q90 A;  3WDG B;  4AEQ A;  1US1 A;  3NBR A;  2CFW A;  1ZS7 A;  4LEH A;  3X42 A;  5BVB A;  1BRN L;  3DZL A;  4IPB A;  2YX9 A;  1D6U A;  1W01 A;  1GYB A;  2XGN A;  3DUK A;  5G2G A;  3NQY A;  1SQW A;  3D5I A;  3ER7 A;  3KFQ C;  3RDE A;  3QK9 A;  3BNB A;  1JN5 B;  2XFS A;  2SAR A;  4IIA A;  3CD6 3;  1N8R 4;  1BUJ A;  2Z77 A;  2KXG A;  1UUW B;  1Q82 4;  1IQX A;  3DY5 A;  2GEY A;  4N6T A;  1BVI A;  1BRI A;  3RGR A;  2XRX B;  3E99 A;  1A2K A;  5AII A;  4WYK B;  2CG0 A;  2W04 A;  1RN4 A;  5M19 A;  3KE7 A;  3HK4 A;  2HOH A;  1RNB A;  1JNQ A;  4K1U A;  5HOH A;  2F86 B;  1YJ9 3;  3LTA A;  1B3S A;  3G6E 3;  2GBX B;  4XB5 A;  4TX4 A;  1K9M 4;  3X40 A;  2CW9 A;  2YFJ B;  1AY7 A;  4R1K A;  1U8C B;  3PXM A;  1TFO A;  4NRE A;  1NDO B;  3CNM A;  2SBL A;  2YFI B;  3PCS A;  3WR2 A;  1VQL 3;  2FGT A;  1BSD A;  1SJW A;  2GBW B;  5LC7 A;  4FCJ A;  1MWS A;  2W0Q A;  1HU9 A;  1BNG A;  8CHO A;  1BNE A;  1O7N B;  5M18 A;  4BTW A;  3H3H A;  5DRE A;  3FG4 A;  2BNG A;  3B4P A;  1TRP A;  4PEJ A;  3FH1 A;  3D5G A;  4HM8 B;  1GOU A;  3EQQ B;  3LZA A;  3FGY A;  1RTU A;  1QJG A;  3UL6 A;  2V1L A;  1STF I;  4AKZ A;  3OWY A;  1ZGX A;  1JKG B;  1LOV A;  1VQM 3;  3MPH A;  3FLJ A;  4JF8 A;  1K8A 4;  1GY6 A;  1LOX A;  2CFK A;  1IT8 A;  2B24 B;  4FCZ A;  1V74 A;  1VQP 3;  3DGL A;  3BB9 A;  3LOY A;  3NQZ A;  4HJL B;  1OGZ A;  1HZ1 A;  3WA2 X;  5AIG A;  1FGM A;  4BL2 A;  1WNH A;  1B2M A;  1YVS A;  3CC2 3;  2F99 A;  1IVU A;  2F4Y A;  1UI7 A;  2BMQ B;  4X2H A;  3PS8 A;  3FF2 A;  5G1L A; 
#chains in the Genus database with same CATH homology
 6RNT A;  1RGL A;  2BU4 A;  1BSA A;  7RNT A;  4J5G A;  3DGY A;  1RGG A;  3URP A;  2AAD A;  1BRS A;  1RN1 A;  4HOH A;  1GMQ A;  1GOV A;  3AGN A;  1BU4 A;  1FW7 A;  1RGF A;  1T2I A;  1I3I A;  3AGO A;  9RNT A;  1LOY A;  1X1U A;  1IYY A;  1BRJ A;  1I2G A;  2ZA4 A;  1MGR A;  1X1X A;  2AAE A;  1B2Z A;  1BOX A;  1Q9E A;  1FZU A;  1FYS A;  1BRN L;  1LRA A;  1YGW A;  3DH2 A;  1FUT A;  3AHW A;  1B2U A;  1I2E A;  1RLS A;  3KCH A;  5RNT A;  4BIR A;  5BU4 A;  1JBS A;  3D5I A;  1JBR A;  2KF6 A;  1A2P A;  1RCK A;  1R4Y A;  1BSC A;  2SAR A;  1BNS A;  1BUJ A;  1LNI A;  4J5K A;  1RNT A;  1BNJ A;  3HOH A;  1BRK A;  1BVI A;  1GMP A;  1BRI A;  1I70 A;  2KF4 A;  1BAO A;  5BIR A;  1BNF A;  1RMS A;  1RN4 A;  2HOH A;  2F5W A;  1RNB A;  8RNT A;  5HOH A;  1RCL A;  6GSP A;  1B2X A;  1B3S A;  2F56 A;  1DE3 A;  1I0V A;  1RHL A;  1RSN A;  4GSP A;  3AHS A;  1AY7 A;  1MGW A;  1UCJ A;  1I3F A;  1UCK A;  3Q3F A;  1B27 A;  1B20 A;  1FUS A;  1X1Y A;  3WR2 A;  1SAR A;  1DET A;  3GSP A;  1JBT A;  1T2H A;  1BSD A;  1UCL A;  2KF5 A;  1B2S A;  1BRG A;  1RGE A;  3D4A A;  4HAA A;  1HYF A;  1BNG A;  1I2F A;  1BNE A;  1RGH A;  4RNT A;  1G02 A;  1BSE A;  1TRP A;  1BNR A;  2BIR A;  1PY3 A;  1BIR A;  3D5G A;  2GSP A;  1RGC A;  1GOU A;  1BAN A;  1BSB A;  1BNI A;  1RTU A;  2RNT A;  1AQZ A;  2KAA A;  3BIR A;  1LOV A;  1ZGX A;  2F5M A;  3RNT A;  1X1W A;  1RGA A;  1BRH A;  1GMR A;  2KF3 A;  1PYL A;  1GOY A;  1TTO A;  1RDS A;  3BU4 A;  2RBI A;  1I8V A;  4GHO A;  1RGK A;  1UCI A;  1HZ1 A;  1YNV X;  1I0X A;  5GSP A;  1GSP A;  1B2M A;  1CH0 A;  1BGS A;  3SYU A;  1TRQ A;  4BU4 A;  1YVS A;  1LOW A;  2C4B A;  1C54 A;  3WHO A;  3A5E A;  2F4Y A;  7GSP A;  1B21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...