1X1WA

Water-mediate interaction at aprotein-protein interface
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Water-mediated interaction at a protein-protein interface
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/protein binding
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1x1wA00
1I2EA 1JBTA 1X1WA 1TRPA 7RNTA 1BNRA 2BIRA 1HZ1A 4GHOA 1RGAA 1BSDA 1RCLA 4J5KA 3WR2A 1T2IA 1B2SA 1GMRA 3AGNA 1FW7A 1RHLA 1RGGA 1IYYA 2RNTA 1B2XA 1RDSA 3Q3FA 4HAAA 3AGOA 1LOVA 1I3IA 1MGWA 1LRAA 1BRIA 2KAAA 3D5IA 1I0XA 3D5GA 8RNTA 1BNEA 1YVSA 2GSPA 1BRJA 3SYUA 1B2MA 2AADA 1BNSA 1FUSA 2F4YA 1BSEA 2KF4A 1B27A 2F5WA 1Q9EA 4J5GA 1GSPA 2C4BA 1I2GA 1BAOA 1B2UA 1BSBA 1RCKA 6RNTA 1BRGA 1SARA 1TTOA 1AQZA 1RGEA 2ZA4A 1MGRA 4RNTA 1RNTA 1BOXA 1B2ZA 3HOHA 1TRQA 3URPA 7GSPA 2KF5A 3RNTA 1BRKA 3KCHA 1G02A 1BRSA 5RNTA 1BNIA 1YGWA 1I2FA 1I0VA 1UCKA 9RNTA 5HOHA 1BVIA 1RN4A 1BU4A 1GOYA 1HYFA 4BU4A 3GSPA 1I8VA 1B20A 1BNFA 5BIRA 1BRNL 1RN1A 1GOVA 1BNJA 4GSPA 2KF3A 1CH0A 1BSAA 1RGFA 1BIRA 1UCJA 1A2PA 3WHOA 1AY7A 2F5MA 1JBSA 1JBRA 1BNGA 2AAEA 1FUTA 6GSPA 1T2HA 1GMQA 1RNBA 1UCIA 1BANA 1LOYA 1X1UA 2KF6A 1LNIA 3A5EA 3BU4A 2BU4A 1LOWA 3AHSA 1BGSA 1RSNA 1BUJA 1RLSA 1RGCA 5GSPA 1X1XA 1DE3A 4BIRA 1UCLA 1X1YA 1C54A 1BSCA 1RTUA 1PY3A 1RGKA 4HOHA 1RMSA 1GOUA 1GMPA 1I3FA 1R4YA 1RGLA 2SARA 1PYLA 1YNVX 3DGYA 2RBIA 1DETA 3AHWA 1FZUA 3DH2A 1I70A 1BRHA 3D4AA 3BIRA 1RGHA 5BU4A 1FYSA 1ZGXA 1B21A 2HOHA 2F56A 1B3SA
chains in the Genus database with same CATH superfamily
2CX0A 5ELJA 4MMZB 1JBTA 5LC6A 3CCE3 2QGUA 2IA7A 3IMAB 1KD14 3LT8A 1HZ1A 2KRTA 1UUGB 1JZOA 2OOVA 3GAXA 4J5KA 4WFOA 3VGNA 2LYXA 2OQEC 3H3HA 1CYUA 1JNQA 2K0MA 1VQP3 3WR2A 1UI8A 1EA2A 1ZS7A 2O3OA 1EKMA 1IT8A 4EXRA 2QEX3 1Q40B 2ZHXB 3KSPA 1RDSA 1Q814 2KCDA 3AGOA 3FGYA 3LYGA 3VF1A 4X2HA 3CXC2 2CX1A 1I3IA 2O9UX 4MMYB 1LRAA 1O7NB 2IMJA 1WNHA 3PCRA 3S28A 4MEIA 3S29A 3PXMA 4L8PA 3EX9A 1AV4A 1GY6A 2HMOB 2OCTA 3CC43 2F5WA 4HM7B 3MYTA 3S67A 3NHXA 1AR0A 1N5PA 2ML5A 4I4KA 1VQM3 3FG1A 3J7Yd 1QVG2 1E97A 3CNXA 1ZO2A 6RNTA 1N8R4 5TGNA 4ORLA 1QAFA 1RGEA 3HX8A 3G8ZA 3K63A 1V57A 1RNTA 3S5CA 1BOXA 5JPPA 5FGOA 3RGAA 2R4IA 3N9HA 1JV2B 5KP4A 1HU9A 3GWRA 2WGOA 1FA3A 3EE1A 4LGQA 3CMA3 2LQVA 1BRSA 5RNTA 3X3ZA 7STDA 2BT3A 1VQ83 1I0VA 1UCKA 3KSED 9RNTA 3X40A 1FGQA 3FG4A 1TU5A 1BU4A 1FGTA 3UL6A 2STDA 2OQEA 3GSPA 1BNFA 4N6OB 4OVMA 1IQYA 2XGLA 1WMPA 4GSPA 2W9QA 3CU3A 1RGFA 1RRHA 5IENA 1G96A 3EBYA 1BIRA 2CH9A 2CFGA 5AIFA 3WA3A 4N6NB 3ZG5A 4TX4A 5AIIA 1OPYA 1BNGA 1IVWA 3HK4A 3KFQC 3NM7A 1RKYA 2XEPA 1GMQA 3MPHA 1RNBA 2FGTA 1RJOA 2BNGA 1IVUA 3WA2X 4NHFA 2XH9A 2YX9A 5G2GA 2KF6A 1LNIA 5KP1A 1GD3A 3A5EA 2BU4A 1RSNA 3D9RA 3JUOA 3BB9A 3M8CA 2Y73A 4O3VA 4XM4A 1DVDA 2L1SA 4G1MB 4AKYA 5D83A 1OGXA 3LTCA 2IUJA 1VQK3 1DE3A 1QVF2 4FMBA 1UCLA 4PEJA 1A2VA 5IG0A 1RTUA 2BMOB 3LTAA 3CNMA 4XBXA 1DMQA 4K1UA 1GOUA 1TUHA 3Q90A 5BXQA 2HMNB 2I9WA 1GMPA 2M7OA 4I5QA 1R4YA 2RBIA 3A76A 3AHWA 1VZZA 4ZM8A 1N9EA 1BRHA 4HZ9B 1L5GB 2XR8B 3BIRA 3O8YA 4AEQA 4BL3A 3PYJA 1KSIA 2PNCA 2GXFA 2XF3A 1PFPA 4MJDA 1GD4A 1TP6A 2BHMA 3MWZA 4GHOA 1RGAA 2Z77A 1UDII 1BSDA 1RCLA 2KXGA 2SBLA 3CCU3 1W6YA 4BTYA 3OXAA 2H0GA 2P05A 1T2IA 1PU4A 2D1WA 1UW1A 2INXA 2W0QA 1CEWI 1K28A 1B2SA 2ML6A 2WO0A 3KKGA 1RHLA 1RGGA 3DUKA 4HM4B 1IYYA 4MMXB 3K7CA 1B2XA 3I553 1U8CB 3Q3FA 2CIUA 1SIIA 3LMLA 3V99A 1LOVA 3UB1A 3V98A 1LXEA 4NPBA 1IDPA 2CG1A 5FW5A 3X3XA 1QJGA 4WHAA 1BRIA 4R1KA 1F8NA 2XSOB 8RNTA 1YVSA 3X41A 3EJVA 1MNLA 3EB8A 4XBTA 2P0MA 2GSPA 3DM8A 4O2HA 2CKFB 2C10A 1B2MA 2AADA 1BNSA 2YFLB 1JZDA 3G0KA 5CF2A 1NJI4 1KWIA 3NQZA 4OUQA 2K54A 5CF1A 1GSPA 1STDA 4U13A 4RZMA 4CCVA 5KP3A 3QK9A 1O7MB 1SIHA 1TTOA 3FF2A 4CDLA 1N8QA 2ZA4A 1VQ73 3OWUA 2OTL3 5G1KA 5AIHA 3U97A 2XRXB 7GSPA 3WOFB 1JN5A 1O7HB 1VQQA 2XGNA 3STDA 3RNTA 1KC84 3B4OA 1IVVA 2W6JH 4OK0A 4RNYA 5M18A 1BNIA 1GY7A 1YGWA 2Z76A 5AEWB 1I2FA 4EC6A 4L8OA 5A0OB 2Z7AA 1Q824 1BVIA 1RN4A 3CD63 4HKVB 3NV0A 2GBXB 1Q7HA 1TIJA 2CFWA 4N6UA 5BIRA 1YIJ3 4LZIA 1JJ22 1BRNL 3LT9A 1WMNA 1RN1A 2RCDA 1OF5A 2W2CA 1D6UA 1V74A 1D6ZA 8CHOA 4STDA 3ZFZA 3IPTA 1CH0A 1NWWA 1JKGA 1W6GA 1JRQA 4GB5A 3JUMA 5AYSC 5I97A 2F86B 2CFLA 1IQXA 2F5MA 4R9KA 3WHOA 4RBNA 3MG1A 1MWUA 1WQLB 2AAEA 3X42A 6GSPA 3N54B 2F99A 3NBBA 4L7KA 1UCIA 1BANA 4BTWA 2BO9B 4JF8A 2JQ5A 1GYBA 3CCQ3 2CWTA 3MG2A 1BGSA 3HIGA 1RLSA 2E2VA 3F7SA 1RGCA 5GSPA 2P09A 3JVCA 3NQYA 5IF6A 3NBRA 1X1YA 1WMOA 3ZG0A 1IVXA 1JN5B 3F8HA 4FCMA 2CFDA 1VQO3 1RMSA 1QALA 4FMCA 3CPW2 1T5YA 1IV9A 3KN4A 1RGLA 1PYLA 2Z6BA 1Y4KA 3V92A 4BL2A 4K61A 1UGHI 3D4AA 3NV0B 1OUNA 1W4NA 3G713 1RGHA 4WYKA 4KVHA 1E3RA 5AIGA 5BU4A 4BTXA 3DY5A 1IK3A 2MF7A 1OF5B 2GBWB 1O7PB 4HZBB 2HOHA 2F56A 4FCZA 1K9M4 1NB5I 1JKGB 3D79A 3K5TA 3FH1A 1FGOA 1M9GA 5EQLA 1NO3A 4XB5A 3N8BA 4EW5A 3E99A 5DRVA 1X1WA 4O8SA 1YI23 1UUWB 2BIRA 3DMCA 4KFEA 3EC9A 3SOYA 3NM2A 2F98A 3WODG 3LXUX 4HVNA 4N6MA 3NX0A 2RFRA 1OHSA 2CFKA 3EBTA 4KFFA 3GZBA 2YFJB 1NU3A 1TFOA 1GMRA 1UI7A 3EF8A 1YGEA 2ZDJA 4WP5A 5D82A 4HAAA 3BNEA 2XFSA 3DXOA 1LNHA 1W00A 1EQKA 4DKIA 1MGWA 3HZPA 2CG0A 3Q2PA 1VQ43 1K41A 1VQ53 1VQL3 4N6TA 2KAAA 3D5IA 1I0XA 3D5GA 1BNEA 3SEDA 1NB3I 1D6YA 1LQGC 1OHPA 2WOHA 1BRJA 3K0ZA 5AEUB 2BMQB 1FUSA 2F4YA 1BSEA 2H0IA 4R4KA 2KF4A 1DMNA 2K3DA 3B8LA 3F7XA 3NBJA 4CJNA 3TDGA 2C4BA 1I2GA 1BAOA 1B2UA 2P0XA 4HM8B 4IIAA 3UNLA 3SXXA 4KT3B 1W5ZA 1RCKA 3Q1CA 1BRGA 1SARA 1AQZA 5EVHA 4FR9A 5AYRB 1W7CA 1MWRA 3F8XA 3G6E3 1TJDA 2Y74A 3JUQA 1B2ZA 3HOHA 4HBRA 4N3VA 1OHOA 1YJN3 4IT7A 5BVBA 2KF5A 3I0YA 1VQN3 1BRKA 3KCHA 1G02A 4LYLB 1LOXA 3CCL3 3VSYA 2UUGC 5CXOA 2ZL8A 3QRDA 4IPBA 4HYZA 3ALAA 1ROVA 4LEHA 1STFI 3CC73 1GOYA 1IU7A 5IERA 3MKIA 3SOAA 4FMDA 3CCS3 1A67A 1AVLA 1GOVA 1BNJA 2BMRB 1YJW3 3FCSB 1BSAA 3HIIA 4HM3B 4HM6B 1MWSA 4XDVA 3MHEA 1BUQA 2UX0A 5M19A 1W6CA 3OV4A 2W03A 1G0TA 3BNCA 1A2PA 3S27A 3G16A 1OACA 3JUPA 1ULJB 1T2HA 2D42A 4Q53A 4WWUC 4GL6A 1M904 1YVBI 2FNQA 1J2BA 1OGZA 1U5OA 1X1UA 1T3BA 3SX1A 4KZ1A 1LVNA 3LZAA 5M1AA 1LQMB 3BU4A 2YFIB 1LOWA 3CCR3 3EN1B 5LC7A 1EEJA 2CC3A 3CCJ3 2QA43 1EG9B 3GZRA 1X1XA 4HM1B 5JBSA 3H51A 4BIRA 3SVAA 1C54A 1A2KA 4KFDA 3OWYA 1PY3A 1RGKA 2R41A 3T8UA 2XFTA 6STDA 1ZX2A 3WMDA 1US1A 2GEYA 2PZVA 3F40A 4H3UA 1MWTA 1MOLA 1YNVX 3DGNA 2FXTA 1DETA 2Q07A 1I70A 1E3VA 3FKAA 3PS8A 4CPKA 2QIYA 1OH0A 3LTBA 1TFKA 2W04A 2GU1A 4N6LA 1FYSA 1V58A 4H61A 5STDA 3IJEB 3RGRA 4LSOA 1ISKA 3KZTA 5IG4A 1B21A 2CWUA 3AMOA 3BNDA 5IG3A 1I2EA 2XSHB 2GU3A 3KIIA 3JUNA 3G4S3 4XDWA 4XBYA 1ULIB 1TRPA 2RGQA 5G1LA 4HM2B 7RNTA 1BNRA 1A90A 5DREA 1CYVA 1DVCA 3ROBA 1SQWA 1YJ93 4ILFA 4X2OA 1W2ZA 1IV7A 2HMLB 1SJWA 3EN8A 5IEPA 5D81A 1IT7A 1CQSA 1HKXA 3KE7A 4LMIA 1DYUA 2A15A 3WDGB 1WTHA 2CW9A 3OX9A 3U1WA 3AGNA 2IYJA 5ELUA 1FW7A 4O02B 3NUVA 2RNTA 2L4VA 4QWTA 2WOFA 4RNZA 1UGIA 2IUKA 1YHQ3 2JDIH 3UJMA 3DGOA 4HM0B 3PZWA 1NNVA 4K1VA 3SYUA 3OW22 5EEOA 3WOEB 3HI7A 3K9MC 2W9PA 1B27A 3L0RA 1Q9EA 3RDEA 3CPOA 1W2B2 4J5GA 1JB5A 1RRLA 2B1XB 1YIT3 1BSBA 1ROAA 3NXJA 3T8NA 3EHCA 2OWPA 1W01A 1QMAA 3I563 3AMOB 1FGRA 4HJLB 3CC23 1MGRA 4NREA 4RNTA 1NDOB 3EQQB 1K734 2MC8A 1TRQA 3DGLA 3URPA 1DMMA 1GS3A 5IEOA 3GRDA 4EV2A 4AKZA 1N9JA 4R80A 1OCVA 2WGQA 1Q42A 2IY2A 2H0HA 1UUVB 2CK3H 2OTJ3 3B7CA 1S5AA 5HOHA 3GZXB 3DGMA 4J9AA 4FMAA 4EBGA 4EYCA 1KQS2 3LTDA 5AI1A 1W02A 1HYFA 3FSDA 3FF0A 1SPUA 1IQ8A 1B20A 1I8VA 3MG3A 3PCSA 4N6V0 3SLUA 4BU4A 5JPUA 2W56A 4FCJA 3F14A 1VQ93 1O7WB 3B4PA 4WYKB 2OOVC 2KF3A 3F9SA 1JB2A 5IG5A 2E2TA 4JRFA 1UCJA 3PGBA 4R9LA 5CK6A 1AVKA 1AY7A 1JBSA 1JBRA 1RN7A 1EUIC 1FUTA 3CME3 1M1K4 3ECFA 1Z1SA 2V1LA 1LOYA 1FGMA 3FLJA 3FG3A 3T0UA 5IW9A 2C11A 1N5HA 2HMKB 4K90B 3CCM3 1O7GB 3AHSA 3BLZA 2UGIA 1BUJA 1Q40A 3ER7A 3GZYB 3MSOA 3CCV3 5HGRA 1C7HA 2CWVA 3UL5A 2HMMB 3LH4A 1Q7Y4 1R4CA 3OWSA 1BSCA 1Q864 1FUWA 3D3LA 1M1XB 3BNBA 2RSXA 1VQ63 1K8A4 4J8TA 2B24B 3X3YA 1I3FA 3DGYA 2SARA 2HMJB 4HM5B 5CLKA 4EV5A 1QAKA 1S723 1FZUA 3DH2A 2CHCA 1GY5A 3FZWA 3LOYA 2J8XB 1JB4A 1ZGXA 2E2UA 2W56B 2P38A 2GEXA 3DZLA 4HOHA 1B3SA 1ASKA
chains in the Genus database with same CATH topology
1I2EA 1JBTA 1X1WA 1TRPA 7RNTA 1BNRA 2BIRA 1HZ1A 4GHOA 1RGAA 1BSDA 1RCLA 4J5KA 3WR2A 1T2IA 1B2SA 1GMRA 3AGNA 1FW7A 1RHLA 1RGGA 1IYYA 2RNTA 1B2XA 1RDSA 3Q3FA 4HAAA 3AGOA 1LOVA 1I3IA 1MGWA 1LRAA 1BRIA 2KAAA 3D5IA 1I0XA 3D5GA 8RNTA 1BNEA 1YVSA 2GSPA 1BRJA 3SYUA 1B2MA 2AADA 1BNSA 1FUSA 2F4YA 1BSEA 2KF4A 1B27A 2F5WA 1Q9EA 4J5GA 1GSPA 2C4BA 1I2GA 1BAOA 1B2UA 1BSBA 1RCKA 6RNTA 1BRGA 1SARA 1TTOA 1AQZA 1RGEA 2ZA4A 1MGRA 4RNTA 1RNTA 1BOXA 1B2ZA 3HOHA 1TRQA 3URPA 7GSPA 2KF5A 3RNTA 1BRKA 3KCHA 1G02A 1BRSA 5RNTA 1BNIA 1YGWA 1I2FA 1I0VA 1UCKA 9RNTA 5HOHA 1BVIA 1RN4A 1BU4A 1GOYA 1HYFA 4BU4A 3GSPA 1I8VA 1B20A 1BNFA 5BIRA 1BRNL 1RN1A 1GOVA 1BNJA 4GSPA 2KF3A 1CH0A 1BSAA 1RGFA 1BIRA 1UCJA 1A2PA 3WHOA 1AY7A 2F5MA 1JBSA 1JBRA 1BNGA 2AAEA 1FUTA 6GSPA 1T2HA 1GMQA 1RNBA 1UCIA 1BANA 1LOYA 1X1UA 2KF6A 1LNIA 3A5EA 3BU4A 2BU4A 1LOWA 3AHSA 1BGSA 1RSNA 1BUJA 1RLSA 1RGCA 5GSPA 1X1XA 1DE3A 4BIRA 1UCLA 1X1YA 1C54A 1BSCA 1RTUA 1PY3A 1RGKA 4HOHA 1RMSA 1GOUA 1GMPA 1I3FA 1R4YA 1RGLA 2SARA 1PYLA 1YNVX 3DGYA 2RBIA 1DETA 3AHWA 1FZUA 3DH2A 1I70A 1BRHA 3D4AA 3BIRA 1RGHA 5BU4A 1FYSA 1ZGXA 1B21A 2HOHA 2F56A 1B3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2E A;  1JBT A;  1X1W A;  1TRP A;  7RNT A;  1BNR A;  2BIR A;  1HZ1 A;  4GHO A;  1RGA A;  1BSD A;  1RCL A;  4J5K A;  3WR2 A;  1T2I A;  1B2S A;  1GMR A;  3AGN A;  1FW7 A;  1RHL A;  1RGG A;  1IYY A;  2RNT A;  1B2X A;  1RDS A;  3Q3F A;  4HAA A;  3AGO A;  1LOV A;  1I3I A;  1MGW A;  1LRA A;  1BRI A;  2KAA A;  3D5I A;  1I0X A;  3D5G A;  8RNT A;  1BNE A;  1YVS A;  2GSP A;  1BRJ A;  3SYU A;  1B2M A;  2AAD A;  1BNS A;  1FUS A;  2F4Y A;  1BSE A;  2KF4 A;  1B27 A;  2F5W A;  1Q9E A;  4J5G A;  1GSP A;  2C4B A;  1I2G A;  1BAO A;  1B2U A;  1BSB A;  1RCK A;  6RNT A;  1BRG A;  1SAR A;  1TTO A;  1AQZ A;  1RGE A;  2ZA4 A;  1MGR A;  4RNT A;  1RNT A;  1BOX A;  1B2Z A;  3HOH A;  1TRQ A;  3URP A;  7GSP A;  2KF5 A;  3RNT A;  1BRK A;  3KCH A;  1G02 A;  1BRS A;  5RNT A;  1BNI A;  1YGW A;  1I2F A;  1I0V A;  1UCK A;  9RNT A;  5HOH A;  1BVI A;  1RN4 A;  1BU4 A;  1GOY A;  1HYF A;  4BU4 A;  3GSP A;  1I8V A;  1B20 A;  1BNF A;  5BIR A;  1BRN L;  1RN1 A;  1GOV A;  1BNJ A;  4GSP A;  2KF3 A;  1CH0 A;  1BSA A;  1RGF A;  1BIR A;  1UCJ A;  1A2P A;  3WHO A;  1AY7 A;  2F5M A;  1JBS A;  1JBR A;  1BNG A;  2AAE A;  1FUT A;  6GSP A;  1T2H A;  1GMQ A;  1RNB A;  1UCI A;  1BAN A;  1LOY A;  1X1U A;  2KF6 A;  1LNI A;  3A5E A;  3BU4 A;  2BU4 A;  1LOW A;  3AHS A;  1BGS A;  1RSN A;  1BUJ A;  1RLS A;  1RGC A;  5GSP A;  1X1X A;  1DE3 A;  4BIR A;  1UCL A;  1X1Y A;  1C54 A;  1BSC A;  1RTU A;  1PY3 A;  1RGK A;  4HOH A;  1RMS A;  1GOU A;  1GMP A;  1I3F A;  1R4Y A;  1RGL A;  2SAR A;  1PYL A;  1YNV X;  3DGY A;  2RBI A;  1DET A;  3AHW A;  1FZU A;  3DH2 A;  1I70 A;  1BRH A;  3D4A A;  3BIR A;  1RGH A;  5BU4 A;  1FYS A;  1ZGX A;  1B21 A;  2HOH A;  2F56 A;  1B3S A; 
#chains in the Genus database with same CATH topology
 2CX0 A;  5ELJ A;  4MMZ B;  1JBT A;  5LC6 A;  3CCE 3;  2QGU A;  2IA7 A;  3IMA B;  1KD1 4;  3LT8 A;  1HZ1 A;  2KRT A;  1UUG B;  1JZO A;  2OOV A;  3GAX A;  4J5K A;  4WFO A;  3VGN A;  2LYX A;  2OQE C;  3H3H A;  1CYU A;  1JNQ A;  2K0M A;  1VQP 3;  3WR2 A;  1UI8 A;  1EA2 A;  1ZS7 A;  2O3O A;  1EKM A;  1IT8 A;  4EXR A;  2QEX 3;  1Q40 B;  2ZHX B;  3KSP A;  1RDS A;  1Q81 4;  2KCD A;  3AGO A;  3FGY A;  3LYG A;  3VF1 A;  4X2H A;  3CXC 2;  2CX1 A;  1I3I A;  2O9U X;  4MMY B;  1LRA A;  1O7N B;  2IMJ A;  1WNH A;  3PCR A;  3S28 A;  4MEI A;  3S29 A;  3PXM A;  4L8P A;  3EX9 A;  1AV4 A;  1GY6 A;  2HMO B;  2OCT A;  3CC4 3;  2F5W A;  4HM7 B;  3MYT A;  3S67 A;  3NHX A;  1AR0 A;  1N5P A;  2ML5 A;  4I4K A;  1VQM 3;  3FG1 A;  3J7Y d;  1QVG 2;  1E97 A;  3CNX A;  1ZO2 A;  6RNT A;  1N8R 4;  5TGN A;  4ORL A;  1QAF A;  1RGE A;  3HX8 A;  3G8Z A;  3K63 A;  1V57 A;  1RNT A;  3S5C A;  1BOX A;  5JPP A;  5FGO A;  3RGA A;  2R4I A;  3N9H A;  1JV2 B;  5KP4 A;  1HU9 A;  3GWR A;  2WGO A;  1FA3 A;  3EE1 A;  4LGQ A;  3CMA 3;  2LQV A;  1BRS A;  5RNT A;  3X3Z A;  7STD A;  2BT3 A;  1VQ8 3;  1I0V A;  1UCK A;  3KSE D;  9RNT A;  3X40 A;  1FGQ A;  3FG4 A;  1TU5 A;  1BU4 A;  1FGT A;  3UL6 A;  2STD A;  2OQE A;  3GSP A;  1BNF A;  4N6O B;  4OVM A;  1IQY A;  2XGL A;  1WMP A;  4GSP A;  2W9Q A;  3CU3 A;  1RGF A;  1RRH A;  5IEN A;  1G96 A;  3EBY A;  1BIR A;  2CH9 A;  2CFG A;  5AIF A;  3WA3 A;  4N6N B;  3ZG5 A;  4TX4 A;  5AII A;  1OPY A;  1BNG A;  1IVW A;  3HK4 A;  3KFQ C;  3NM7 A;  1RKY A;  2XEP A;  1GMQ A;  3MPH A;  1RNB A;  2FGT A;  1RJO A;  2BNG A;  1IVU A;  3WA2 X;  4NHF A;  2XH9 A;  2YX9 A;  5G2G A;  2KF6 A;  1LNI A;  5KP1 A;  1GD3 A;  3A5E A;  2BU4 A;  1RSN A;  3D9R A;  3JUO A;  3BB9 A;  3M8C A;  2Y73 A;  4O3V A;  4XM4 A;  1DVD A;  2L1S A;  4G1M B;  4AKY A;  5D83 A;  1OGX A;  3LTC A;  2IUJ A;  1VQK 3;  1DE3 A;  1QVF 2;  4FMB A;  1UCL A;  4PEJ A;  1A2V A;  5IG0 A;  1RTU A;  2BMO B;  3LTA A;  3CNM A;  4XBX A;  1DMQ A;  4K1U A;  1GOU A;  1TUH A;  3Q90 A;  5BXQ A;  2HMN B;  2I9W A;  1GMP A;  2M7O A;  4I5Q A;  1R4Y A;  2RBI A;  3A76 A;  3AHW A;  1VZZ A;  4ZM8 A;  1N9E A;  1BRH A;  4HZ9 B;  1L5G B;  2XR8 B;  3BIR A;  3O8Y A;  4AEQ A;  4BL3 A;  3PYJ A;  1KSI A;  2PNC A;  2GXF A;  2XF3 A;  1PFP A;  4MJD A;  1GD4 A;  1TP6 A;  2BHM A;  3MWZ A;  4GHO A;  1RGA A;  2Z77 A;  1UDI I;  1BSD A;  1RCL A;  2KXG A;  2SBL A;  3CCU 3;  1W6Y A;  4BTY A;  3OXA A;  2H0G A;  2P05 A;  1T2I A;  1PU4 A;  2D1W A;  1UW1 A;  2INX A;  2W0Q A;  1CEW I;  1K28 A;  1B2S A;  2ML6 A;  2WO0 A;  3KKG A;  1RHL A;  1RGG A;  3DUK A;  4HM4 B;  1IYY A;  4MMX B;  3K7C A;  1B2X A;  3I55 3;  1U8C B;  3Q3F A;  2CIU A;  1SII A;  3LML A;  3V99 A;  1LOV A;  3UB1 A;  3V98 A;  1LXE A;  4NPB A;  1IDP A;  2CG1 A;  5FW5 A;  3X3X A;  1QJG A;  4WHA A;  1BRI A;  4R1K A;  1F8N A;  2XSO B;  8RNT A;  1YVS A;  3X41 A;  3EJV A;  1MNL A;  3EB8 A;  4XBT A;  2P0M A;  2GSP A;  3DM8 A;  4O2H A;  2CKF B;  2C10 A;  1B2M A;  2AAD A;  1BNS A;  2YFL B;  1JZD A;  3G0K A;  5CF2 A;  1NJI 4;  1KWI A;  3NQZ A;  4OUQ A;  2K54 A;  5CF1 A;  1GSP A;  1STD A;  4U13 A;  4RZM A;  4CCV A;  5KP3 A;  3QK9 A;  1O7M B;  1SIH A;  1TTO A;  3FF2 A;  4CDL A;  1N8Q A;  2ZA4 A;  1VQ7 3;  3OWU A;  2OTL 3;  5G1K A;  5AIH A;  3U97 A;  2XRX B;  7GSP A;  3WOF B;  1JN5 A;  1O7H B;  1VQQ A;  2XGN A;  3STD A;  3RNT A;  1KC8 4;  3B4O A;  1IVV A;  2W6J H;  4OK0 A;  4RNY A;  5M18 A;  1BNI A;  1GY7 A;  1YGW A;  2Z76 A;  5AEW B;  1I2F A;  4EC6 A;  4L8O A;  5A0O B;  2Z7A A;  1Q82 4;  1BVI A;  1RN4 A;  3CD6 3;  4HKV B;  3NV0 A;  2GBX B;  1Q7H A;  1TIJ A;  2CFW A;  4N6U A;  5BIR A;  1YIJ 3;  4LZI A;  1JJ2 2;  1BRN L;  3LT9 A;  1WMN A;  1RN1 A;  2RCD A;  1OF5 A;  2W2C A;  1D6U A;  1V74 A;  1D6Z A;  8CHO A;  4STD A;  3ZFZ A;  3IPT A;  1CH0 A;  1NWW A;  1JKG A;  1W6G A;  1JRQ A;  4GB5 A;  3JUM A;  5AYS C;  5I97 A;  2F86 B;  2CFL A;  1IQX A;  2F5M A;  4R9K A;  3WHO A;  4RBN A;  3MG1 A;  1MWU A;  1WQL B;  2AAE A;  3X42 A;  6GSP A;  3N54 B;  2F99 A;  3NBB A;  4L7K A;  1UCI A;  1BAN A;  4BTW A;  2BO9 B;  4JF8 A;  2JQ5 A;  1GYB A;  3CCQ 3;  2CWT A;  3MG2 A;  1BGS A;  3HIG A;  1RLS A;  2E2V A;  3F7S A;  1RGC A;  5GSP A;  2P09 A;  3JVC A;  3NQY A;  5IF6 A;  3NBR A;  1X1Y A;  1WMO A;  3ZG0 A;  1IVX A;  1JN5 B;  3F8H A;  4FCM A;  2CFD A;  1VQO 3;  1RMS A;  1QAL A;  4FMC A;  3CPW 2;  1T5Y A;  1IV9 A;  3KN4 A;  1RGL A;  1PYL A;  2Z6B A;  1Y4K A;  3V92 A;  4BL2 A;  4K61 A;  1UGH I;  3D4A A;  3NV0 B;  1OUN A;  1W4N A;  3G71 3;  1RGH A;  4WYK A;  4KVH A;  1E3R A;  5AIG A;  5BU4 A;  4BTX A;  3DY5 A;  1IK3 A;  2MF7 A;  1OF5 B;  2GBW B;  1O7P B;  4HZB B;  2HOH A;  2F56 A;  4FCZ A;  1K9M 4;  1NB5 I;  1JKG B;  3D79 A;  3K5T A;  3FH1 A;  1FGO A;  1M9G A;  5EQL A;  1NO3 A;  4XB5 A;  3N8B A;  4EW5 A;  3E99 A;  5DRV A;  1X1W A;  4O8S A;  1YI2 3;  1UUW B;  2BIR A;  3DMC A;  4KFE A;  3EC9 A;  3SOY A;  3NM2 A;  2F98 A;  3WOD G;  3LXU X;  4HVN A;  4N6M A;  3NX0 A;  2RFR A;  1OHS A;  2CFK A;  3EBT A;  4KFF A;  3GZB A;  2YFJ B;  1NU3 A;  1TFO A;  1GMR A;  1UI7 A;  3EF8 A;  1YGE A;  2ZDJ A;  4WP5 A;  5D82 A;  4HAA A;  3BNE A;  2XFS A;  3DXO A;  1LNH A;  1W00 A;  1EQK A;  4DKI A;  1MGW A;  3HZP A;  2CG0 A;  3Q2P A;  1VQ4 3;  1K41 A;  1VQ5 3;  1VQL 3;  4N6T A;  2KAA A;  3D5I A;  1I0X A;  3D5G A;  1BNE A;  3SED A;  1NB3 I;  1D6Y A;  1LQG C;  1OHP A;  2WOH A;  1BRJ A;  3K0Z A;  5AEU B;  2BMQ B;  1FUS A;  2F4Y A;  1BSE A;  2H0I A;  4R4K A;  2KF4 A;  1DMN A;  2K3D A;  3B8L A;  3F7X A;  3NBJ A;  4CJN A;  3TDG A;  2C4B A;  1I2G A;  1BAO A;  1B2U A;  2P0X A;  4HM8 B;  4IIA A;  3UNL A;  3SXX A;  4KT3 B;  1W5Z A;  1RCK A;  3Q1C A;  1BRG A;  1SAR A;  1AQZ A;  5EVH A;  4FR9 A;  5AYR B;  1W7C A;  1MWR A;  3F8X A;  3G6E 3;  1TJD A;  2Y74 A;  3JUQ A;  1B2Z A;  3HOH A;  4HBR A;  4N3V A;  1OHO A;  1YJN 3;  4IT7 A;  5BVB A;  2KF5 A;  3I0Y A;  1VQN 3;  1BRK A;  3KCH A;  1G02 A;  4LYL B;  1LOX A;  3CCL 3;  3VSY A;  2UUG C;  5CXO A;  2ZL8 A;  3QRD A;  4IPB A;  4HYZ A;  3ALA A;  1ROV A;  4LEH A;  1STF I;  3CC7 3;  1GOY A;  1IU7 A;  5IER A;  3MKI A;  3SOA A;  4FMD A;  3CCS 3;  1A67 A;  1AVL A;  1GOV A;  1BNJ A;  2BMR B;  1YJW 3;  3FCS B;  1BSA A;  3HII A;  4HM3 B;  4HM6 B;  1MWS A;  4XDV A;  3MHE A;  1BUQ A;  2UX0 A;  5M19 A;  1W6C A;  3OV4 A;  2W03 A;  1G0T A;  3BNC A;  1A2P A;  3S27 A;  3G16 A;  1OAC A;  3JUP A;  1ULJ B;  1T2H A;  2D42 A;  4Q53 A;  4WWU C;  4GL6 A;  1M90 4;  1YVB I;  2FNQ A;  1J2B A;  1OGZ A;  1U5O A;  1X1U A;  1T3B A;  3SX1 A;  4KZ1 A;  1LVN A;  3LZA A;  5M1A A;  1LQM B;  3BU4 A;  2YFI B;  1LOW A;  3CCR 3;  3EN1 B;  5LC7 A;  1EEJ A;  2CC3 A;  3CCJ 3;  2QA4 3;  1EG9 B;  3GZR A;  1X1X A;  4HM1 B;  5JBS A;  3H51 A;  4BIR A;  3SVA A;  1C54 A;  1A2K A;  4KFD A;  3OWY A;  1PY3 A;  1RGK A;  2R41 A;  3T8U A;  2XFT A;  6STD A;  1ZX2 A;  3WMD A;  1US1 A;  2GEY A;  2PZV A;  3F40 A;  4H3U A;  1MWT A;  1MOL A;  1YNV X;  3DGN A;  2FXT A;  1DET A;  2Q07 A;  1I70 A;  1E3V A;  3FKA A;  3PS8 A;  4CPK A;  2QIY A;  1OH0 A;  3LTB A;  1TFK A;  2W04 A;  2GU1 A;  4N6L A;  1FYS A;  1V58 A;  4H61 A;  5STD A;  3IJE B;  3RGR A;  4LSO A;  1ISK A;  3KZT A;  5IG4 A;  1B21 A;  2CWU A;  3AMO A;  3BND A;  5IG3 A;  1I2E A;  2XSH B;  2GU3 A;  3KII A;  3JUN A;  3G4S 3;  4XDW A;  4XBY A;  1ULI B;  1TRP A;  2RGQ A;  5G1L A;  4HM2 B;  7RNT A;  1BNR A;  1A90 A;  5DRE A;  1CYV A;  1DVC A;  3ROB A;  1SQW A;  1YJ9 3;  4ILF A;  4X2O A;  1W2Z A;  1IV7 A;  2HML B;  1SJW A;  3EN8 A;  5IEP A;  5D81 A;  1IT7 A;  1CQS A;  1HKX A;  3KE7 A;  4LMI A;  1DYU A;  2A15 A;  3WDG B;  1WTH A;  2CW9 A;  3OX9 A;  3U1W A;  3AGN A;  2IYJ A;  5ELU A;  1FW7 A;  4O02 B;  3NUV A;  2RNT A;  2L4V A;  4QWT A;  2WOF A;  4RNZ A;  1UGI A;  2IUK A;  1YHQ 3;  2JDI H;  3UJM A;  3DGO A;  4HM0 B;  3PZW A;  1NNV A;  4K1V A;  3SYU A;  3OW2 2;  5EEO A;  3WOE B;  3HI7 A;  3K9M C;  2W9P A;  1B27 A;  3L0R A;  1Q9E A;  3RDE A;  3CPO A;  1W2B 2;  4J5G A;  1JB5 A;  1RRL A;  2B1X B;  1YIT 3;  1BSB A;  1ROA A;  3NXJ A;  3T8N A;  3EHC A;  2OWP A;  1W01 A;  1QMA A;  3I56 3;  3AMO B;  1FGR A;  4HJL B;  3CC2 3;  1MGR A;  4NRE A;  4RNT A;  1NDO B;  3EQQ B;  1K73 4;  2MC8 A;  1TRQ A;  3DGL A;  3URP A;  1DMM A;  1GS3 A;  5IEO A;  3GRD A;  4EV2 A;  4AKZ A;  1N9J A;  4R80 A;  1OCV A;  2WGQ A;  1Q42 A;  2IY2 A;  2H0H A;  1UUV B;  2CK3 H;  2OTJ 3;  3B7C A;  1S5A A;  5HOH A;  3GZX B;  3DGM A;  4J9A A;  4FMA A;  4EBG A;  4EYC A;  1KQS 2;  3LTD A;  5AI1 A;  1W02 A;  1HYF A;  3FSD A;  3FF0 A;  1SPU A;  1IQ8 A;  1B20 A;  1I8V A;  3MG3 A;  3PCS A;  4N6V 0;  3SLU A;  4BU4 A;  5JPU A;  2W56 A;  4FCJ A;  3F14 A;  1VQ9 3;  1O7W B;  3B4P A;  4WYK B;  2OOV C;  2KF3 A;  3F9S A;  1JB2 A;  5IG5 A;  2E2T A;  4JRF A;  1UCJ A;  3PGB A;  4R9L A;  5CK6 A;  1AVK A;  1AY7 A;  1JBS A;  1JBR A;  1RN7 A;  1EUI C;  1FUT A;  3CME 3;  1M1K 4;  3ECF A;  1Z1S A;  2V1L A;  1LOY A;  1FGM A;  3FLJ A;  3FG3 A;  3T0U A;  5IW9 A;  2C11 A;  1N5H A;  2HMK B;  4K90 B;  3CCM 3;  1O7G B;  3AHS A;  3BLZ A;  2UGI A;  1BUJ A;  1Q40 A;  3ER7 A;  3GZY B;  3MSO A;  3CCV 3;  5HGR A;  1C7H A;  2CWV A;  3UL5 A;  2HMM B;  3LH4 A;  1Q7Y 4;  1R4C A;  3OWS A;  1BSC A;  1Q86 4;  1FUW A;  3D3L A;  1M1X B;  3BNB A;  2RSX A;  1VQ6 3;  1K8A 4;  4J8T A;  2B24 B;  3X3Y A;  1I3F A;  3DGY A;  2SAR A;  2HMJ B;  4HM5 B;  5CLK A;  4EV5 A;  1QAK A;  1S72 3;  1FZU A;  3DH2 A;  2CHC A;  1GY5 A;  3FZW A;  3LOY A;  2J8X B;  1JB4 A;  1ZGX A;  2E2U A;  2W56 B;  2P38 A;  2GEX A;  3DZL A;  4HOH A;  1B3S A;  1ASK A; 
#chains in the Genus database with same CATH homology
 1I2E A;  1JBT A;  1X1W A;  1TRP A;  7RNT A;  1BNR A;  2BIR A;  1HZ1 A;  4GHO A;  1RGA A;  1BSD A;  1RCL A;  4J5K A;  3WR2 A;  1T2I A;  1B2S A;  1GMR A;  3AGN A;  1FW7 A;  1RHL A;  1RGG A;  1IYY A;  2RNT A;  1B2X A;  1RDS A;  3Q3F A;  4HAA A;  3AGO A;  1LOV A;  1I3I A;  1MGW A;  1LRA A;  1BRI A;  2KAA A;  3D5I A;  1I0X A;  3D5G A;  8RNT A;  1BNE A;  1YVS A;  2GSP A;  1BRJ A;  3SYU A;  1B2M A;  2AAD A;  1BNS A;  1FUS A;  2F4Y A;  1BSE A;  2KF4 A;  1B27 A;  2F5W A;  1Q9E A;  4J5G A;  1GSP A;  2C4B A;  1I2G A;  1BAO A;  1B2U A;  1BSB A;  1RCK A;  6RNT A;  1BRG A;  1SAR A;  1TTO A;  1AQZ A;  1RGE A;  2ZA4 A;  1MGR A;  4RNT A;  1RNT A;  1BOX A;  1B2Z A;  3HOH A;  1TRQ A;  3URP A;  7GSP A;  2KF5 A;  3RNT A;  1BRK A;  3KCH A;  1G02 A;  1BRS A;  5RNT A;  1BNI A;  1YGW A;  1I2F A;  1I0V A;  1UCK A;  9RNT A;  5HOH A;  1BVI A;  1RN4 A;  1BU4 A;  1GOY A;  1HYF A;  4BU4 A;  3GSP A;  1I8V A;  1B20 A;  1BNF A;  5BIR A;  1BRN L;  1RN1 A;  1GOV A;  1BNJ A;  4GSP A;  2KF3 A;  1CH0 A;  1BSA A;  1RGF A;  1BIR A;  1UCJ A;  1A2P A;  3WHO A;  1AY7 A;  2F5M A;  1JBS A;  1JBR A;  1BNG A;  2AAE A;  1FUT A;  6GSP A;  1T2H A;  1GMQ A;  1RNB A;  1UCI A;  1BAN A;  1LOY A;  1X1U A;  2KF6 A;  1LNI A;  3A5E A;  3BU4 A;  2BU4 A;  1LOW A;  3AHS A;  1BGS A;  1RSN A;  1BUJ A;  1RLS A;  1RGC A;  5GSP A;  1X1X A;  1DE3 A;  4BIR A;  1UCL A;  1X1Y A;  1C54 A;  1BSC A;  1RTU A;  1PY3 A;  1RGK A;  4HOH A;  1RMS A;  1GOU A;  1GMP A;  1I3F A;  1R4Y A;  1RGL A;  2SAR A;  1PYL A;  1YNV X;  3DGY A;  2RBI A;  1DET A;  3AHW A;  1FZU A;  3DH2 A;  1I70 A;  1BRH A;  3D4A A;  3BIR A;  1RGH A;  5BU4 A;  1FYS A;  1ZGX A;  1B21 A;  2HOH A;  2F56 A;  1B3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...