1X1WA

Water-mediate interaction at aprotein-protein interface
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Water-mediated interaction at a protein-protein interface
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/protein binding
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1x1wA00
3HOHA 1R4YA 1HYFA 6RNTA 5GSPA 2GSPA 3AGOA 1BRJA 2KF4A 1X1WA 4J5KA 1RHLA 1LNIA 2KAAA 1BRKA 3DH2A 5BU4A 2BU4A 1JBRA 1BNIA 1BSDA 1LOYA 1PYLA 1B3SA 1FYSA 1Q9EA 2C4BA 1TRQA 7RNTA 1BUJA 2F56A 2AADA 1RGCA 2AAEA 3URPA 1BSAA 1JBSA 1X1UA 1RNTA 1BU4A 1GMPA 1RDSA 1T2IA 1MGRA 3RNTA 1IYYA 1YNVX 1DE3A 1RGKA 1BNEA 1JBTA 1AQZA 1BSBA 1GMQA 4RNTA 1RN4A 3D5IA 2F5WA 1B2XA 1TRPA 1B20A 1RLSA 1RSNA 2RBIA 9RNTA 1I70A 1BOXA 1SARA 1B2ZA 3Q3FA 4BU4A 4HAAA 1DETA 1LOVA 1BSCA 2SARA 7GSPA 1B2SA 1T2HA 2KF5A 1BNFA 2HOHA 1C54A 1GSPA 1UCLA 1UCKA 1UCIA 4HOHA 1FUSA 1BRNL 1X1XA 1RNBA 3BIRA 1RGHA 1BVIA 3A5EA 1FZUA 1AY7A 1I0XA 1LRAA 1I8VA 1BRIA 1MGWA 3AGNA 4GSPA 3WHOA 1G02A 5BIRA 1GOUA 1I3FA 3GSPA 5HOHA 1A2PA 1GOVA 1B27A 1I2FA 1RCLA 3AHWA 1HZ1A 1B2MA 1BSEA 1FUTA 3KCHA 1BIRA 1UCJA 1PY3A 2BIRA 1CH0A 4BIRA 3BU4A 5RNTA 1BNSA 1RGAA 1RCKA 1ZGXA 2ZA4A 1RGLA 1GMRA 1BGSA 1I2EA 1I0VA 1LOWA 3D5GA 3DGYA 8RNTA 1BNGA 1BRHA 1RGEA 2F5MA 4GHOA 1RN1A 2RNTA 3AHSA 1FW7A 2KF3A 1RGGA 2KF6A 1I3IA 3SYUA 1RMSA 1BNRA 1BNJA 1YVSA 2F4YA 1GOYA 3D4AA 1BAOA 1BRSA 1RGFA 1X1YA 1B2UA 1YGWA 1TTOA 1RTUA 1BANA 4J5GA 1I2GA 1B21A 1BRGA 3WR2A 6GSPA
chains in the Genus database with same CATH superfamily
3F7SA 1MWRA 1MWTA 3FSDA 5JBSA 2GSPA 1O7NB 2O3OA 1TFKA 2XH9A 5G1LA 4EV5A 5ELJA 4NREA 2K3DA 3FH1A 2JDIH 3I563 2BU4A 4R1KA 1NJI4 1BNIA 1U5OA 3F8HA 1WMOA 1HU9A 1TRQA 7RNTA 1A2VA 2AAEA 1RGCA 1UI8A 3NBJA 1IV7A 4TX4A 4CDLA 3OW22 1VQK3 1G96A 1IU7A 1MOLA 1F8NA 2XEPA 1GS3A 1NDOB 3MYTA 1YNVX 3F8XA 3K5TA 1SIHA 4HM5B 1BNEA 1JBTA 1AQZA 3GWRA 1JZDA 1IV9A 3GZYB 1QAKA 1RN7A 2GBXB 1TJDA 4HM7B 5AIFA 5JPUA 1ZS7A 2W03A 1NB5I 1CYUA 4WHAA 3CCV3 1TRPA 1B20A 1RSNA 3I0YA 1DVDA 2HMJB 1DMNA 1JN5A 3BNEA 3J7Yd 3EE1A 1YJ93 4H61A 4MMYB 1VQ53 3UJMA 4LMIA 1B2ZA 1JKGA 4HAAA 7GSPA 2FXTA 2WOHA 3DMCA 4K61A 4FMBA 4Q53A 1BNFA 4WYKB 3SVAA 3CU3A 3MKIA 3FCSB 2QA43 1GSPA 2FNQA 3F14A 1D6ZA 2OQEA 4HOHA 1US1A 1S5AA 2MF7A 4HVNA 4LGQA 1FUSA 4FR9A 4ORLA 2ML6A 3FKAA 3UL6A 5CXOA 1FGMA 2B1XB 2D1WA 1UGHI 4RZMA 1V74A 2HMKB 1N9JA 3A5EA 2CIUA 3PXMA 2F99A 2OTL3 4MMXB 3CMA3 4J8TA 1LRAA 3PYJA 4XM4A 3PCRA 1Q7Y4 1MWUA 3NXJA 4WWUC 5BIRA 1DYUA 1AV4A 2CWVA 1C7HA 3GZXB 1B27A 1I2FA 1RCLA 3NBRA 2QIYA 1HKXA 5HGRA 4OUQA 3LYGA 4STDA 3U1WA 2O9UX 3N8BA 4HM8B 4RNZA 5IENA 1RKYA 1WNHA 5M1AA 5IW9A 3T0UA 1ULIB 2INXA 3HIIA 4OVMA 1OGXA 2XFSA 1Q864 1M1K4 4AKYA 4N6NB 1OPYA 1O7MB 2Z6BA 1SJWA 3F7XA 1EQKA 1RGAA 2I9WA 2UUGC 1ZGXA 3HX8A 3ZFZA 3NM2A 1K9M4 1QVF2 1G0TA 2STDA 4O8SA 1Q42A 5DREA 3SLUA 1QVG2 1KQS2 4KFEA 1J2BA 1BRHA 4K1VA 4HZBB 3AHSA 1S723 1IVVA 2KF3A 3MPHA 4LSOA 2D42A 3BB9A 1KC84 3FZWA 1BNRA 4HM0B 3LTBA 5KP4A 3DUKA 4LEHA 4HM4B 1DMMA 3WDGB 3CCQ3 3A76A 2WGQA 1Q40B 3EX9A 1RGFA 3EC9A 4R9LA 3CC73 2RCDA 3OX9A 3X3YA 2E2UA 2J8XB 1M9GA 3MSOA 3WR2A 6GSPA 3M8CA 1QJGA 1R4YA 3KZTA 6RNTA 3IPTA 3EB8A 3S5CA 2KF4A 1X1WA 2IY2A 4G1MB 4BL2A 3V98A 3LMLA 2HMLB 2F98A 2GU1A 2IUKA 2ZHXB 4MJDA 3CCM3 4BTYA 1ISKA 5CK6A 2OOVC 1LVNA 3JUMA 3X3ZA 1BSDA 1N9EA 2HMNB 4HBRA 2YFIB 1FYSA 3FG4A 5CLKA 2C4BA 1BUQA 3MG3A 5BXQA 2AADA 2FGTA 2KXGA 3Q1CA 3PZWA 1A2KA 2C10A 1MGRA 3RNTA 3D9RA 1IYYA 3RGRA 5LC6A 2IMJA 4R80A 2WO0A 3WODG 4IT7A 3HIGA 2QGUA 4WFOA 1WMNA 1YIJ3 3V92A 1BSBA 2GBWB 1SIIA 4N6LA 1FGRA 4QWTA 5AYSC 4RNTA 1OF5B 5IG5A 1IVWA 2RBIA 4HM3B 1W02A 2PZVA 1PU4A 1O7WB 3SXXA 4IIAA 1Q40A 3ZG5A 3ALAA 3NV0B 1MWSA 1VQL3 2CHCA 2XRXB 3ER7A 1A67A 1CQSA 2W2CA 2YX9A 1DVCA 2MC8A 3S28A 3X3XA 3EJVA 3KKGA 2W9QA 3HK4A 2HOHA 3H3HA 1W4NA 3WOFB 2CG1A 1C54A 3GZRA 2W9PA 2E2VA 1M904 5EEOA 2H0IA 1BRNL 2K54A 1X1XA 3CCE3 2CFLA 2GEYA 2V1LA 3WA3A 4RBNA 3TDGA 1BVIA 3WMDA 3JVCA 1NNVA 1OUNA 4K1UA 3UL5A 1FZUA 1UUWB 1VQ93 1B21A 1I0XA 3K9MC 5FW5A 1CYVA 1TIJA 4GB5A 3AGNA 4GSPA 3WHOA 5BVBA 3SOAA 1VQ63 1GOUA 1A2PA 5M18A 2CC3A 3D3LA 3BNCA 1GOVA 2IYJA 4HKVB 4EV2A 4CCVA 5LC7A 3LH4A 5AEUB 3AHWA 1QMAA 1GD3A 1JB2A 1BSEA 1VQQA 1OF5A 3DZLA 2CFWA 4LZIA 7STDA 1WMPA 3AMOB 1O7HB 2XF3A 1RRLA 5KP3A 3STDA 4AKZA 5I97A 1YGEA 3KN4A 2BMOB 2BO9B 1BGSA 1I0VA 1LOWA 3D5GA 3DGYA 3NV0A 1VQO3 1RGEA 1RN1A 4NHFA 4NPBA 2W56B 3L0RA 3G16A 1N5PA 2Z76A 3T8UA 1ULJB 4N6V0 1QALA 2Z77A 2CWTA 3B8LA 4HJLB 3KSPA 2PNCA 1VZZA 3OWYA 1BRSA 2ZL8A 3PCSA 4L8PA 8CHOA 3LOYA 2HMMB 2BNGA 4JRFA 1B2UA 4CPKA 1TP6A 3NM7A 1TTOA 2RSXA 1RTUA 1EA2A 1UDII 4J5GA 2W04A 1I2GA 2P0XA 2Z7AA 3U97A 1BUJA 3S29A 3ECFA 3HOHA 1UUVB 1YHQ3 5AIHA 5GSPA 3AGOA 1YJW3 1BRJA 3DGNA 2R41A 1RHLA 2OQEC 2UX0A 3O8YA 2B24B 3DH2A 3MWZA 4XBYA 5M19A 1PYLA 4WYKA 3CCJ3 1Q9EA 3BNBA 3N9HA 4XDVA 3AMOA 2F56A 1VQM3 3PGBA 3G0KA 6STDA 1X1UA 3CPOA 1IT7A 1BU4A 1PFPA 3MG1A 1RDSA 3SOYA 1T2IA 2Y73A 3F40A 3FF0A 1WQLB 2C11A 3H51A 3S67A 3IMAB 4WP5A 4BTWA 3RGAA 1FGTA 1T3BA 3NX0A 1RGKA 2IA7A 1E3VA 1ROVA 3NQZA 3VGNA 1W00A 1GMQA 2W56A 3B4OA 2JQ5A 3LXUX 1L5GB 5AEWB 1RN4A 1NO3A 3D5IA 2F5WA 3QK9A 3WA2X 2R4IA 1YIT3 1OHSA 1RLSA 2XFTA 2CW9A 1LQGC 2BMQB 2P05A 2CK3H 4K90B 4N6MA 9RNTA 4FMDA 4JF8A 4HM6B 4L7KA 5IG0A 3RDEA 2KRTA 1SARA 4HM1B 3KIIA 4BU4A 1DETA 4HZ9B 5DRVA 1O7PB 3DGOA 2H0HA 1T2HA 1JNQA 1YJN3 2GU3A 3WOEB 1UUGB 1UCKA 2YFJB 5IEPA 1JB4A 2HMOB 1RJOA 2M7OA 1ROAA 3GAXA 3BIRA 3G4S3 3EBYA 1RNBA 1RGHA 3E99A 3NBBA 1W2ZA 4L8OA 1W7CA 5CF1A 2LYXA 1N8QA 3CNMA 2BMRB 1AVKA 1I8VA 3CME3 1VQ83 1BRIA 2RFRA 1NB3I 5HOHA 3GSPA 2W0QA 1STFI 2BT3A 3LTDA 3DGMA 3SEDA 1V57A 1EKMA 3GZBA 4LYLB 1GD4A 1HZ1A 4O2HA 5CF2A 2W6JH 4X2OA 2UGIA 1Q814 3DXOA 3KFQC 4ILFA 3KCHA 4N3VA 3DY5A 1PY3A 1JKGB 2BHMA 3BU4A 1IQXA 1GY6A 3EQQB 5RNTA 1CEWI 1BNSA 5G1KA 3EF8A 1RRHA 2E2TA 2K0MA 1JB5A 1RGLA 1GMRA 2GXFA 1VQN3 8RNTA 4XB5A 3Q2PA 1V58A 4H3UA 3G713 4GHOA 1IT8A 2WOFA 1LXEA 1W6YA 5AIGA 3K7CA 3CXC2 5AI1A 3F9SA 1W01A 1EEJA 2KF6A 2XSHB 1KSIA 1IQYA 1T5YA 3K63A 2XR8B 3SYUA 1RMSA 1K8A4 2GEXA 4EW5A 1E97A 1SPUA 2F4YA 2OCTA 3D4AA 1NWWA 3EN8A 1JZOA 1NU3A 1R4CA 1X1YA 1OACA 3CNXA 1YGWA 1AVLA 1FGQA 1QAFA 1BANA 3N54B 4N6TA 4N6UA 3FG3A 1Q7HA 4KZ1A 5D81A 1LNHA 1YI23 3CPW2 5G2GA 3CD63 1A90A 1HYFA 1W6CA 2OWPA 4RNYA 3X40A 1YVBI 2XGLA 4J5KA 1KWIA 1ASKA 1UGIA 1LNIA 3S27A 3IJEB 2CH9A 5TGNA 2KAAA 4J9AA 1BRKA 1TUHA 2CFDA 5BU4A 1JBRA 1U8CB 3B7CA 4R4KA 3T8NA 1LOYA 5KP1A 1B3SA 3I553 4MEIA 5IF6A 3JUPA 2H0GA 4XBTA 3FLJA 1OCVA 2ZDJA 1BSAA 3URPA 1JBSA 3FGYA 1RNTA 3D79A 3LTAA 1M1XB 3QRDA 1VQ43 3NUVA 1GY7A 4FCZA 4R9KA 2XSOB 5JPPA 5EVHA 4EBGA 4EC6A 1DE3A 2OTJ3 2CWUA 4FMAA 3JUNA 5IERA 2RGQA 3OV4A 2A15A 3LZAA 1Y4KA 3GRDA 1STDA 3EN1B 3MHEA 5IG3A 2CKFB 4KFDA 1B2XA 3EBTA 4EYCA 3CC23 1W5ZA 3DM8A 3NHXA 1LOXA 1I70A 2CFKA 1Q824 1BOXA 4KFFA 1TU5A 2L4VA 3G6E3 1JV2B 2KCDA 1W2B2 1N8R4 1OGZA 3Q90A 3Q3FA 4FCJA 1LOVA 1UI7A 1BSCA 1FGOA 3SX1A 2SARA 1B2SA 2KF5A 1IVUA 3BLZA 3MG2A 1GY5A 1Z1SA 2WGOA 1FA3A 1UCLA 1UCIA 4N6OB 3FF2A 3HI7A 4PEJA 3JUOA 3LT8A 5FGOA 3CCS3 1VQ73 2OOVA 3PS8A 3CCL3 2IUJA 3HZPA 4AEQA 4I4KA 1IK3A 1EUIC 1WTHA 2SBLA 1K41A 4KT3B 3LTCA 3UNLA 2QEX3 1AY7A 1OHPA 4XBXA 1FUWA 3ZG0A 4IPBA 3FG1A 3KE7A 2CX0A 1MGWA 5D82A 4BTXA 1G02A 4DKIA 1I3FA 3OWSA 1OHOA 4O02B 5AYRB 3VSYA 1EG9B 3UB1A 1JRQA 3ROBA 4HYZA 1TFOA 4KVHA 5D83A 1O7GB 3NQYA 4I5QA 4EXRA 4X2HA 3V99A 4ZM8A 1B2MA 1MNLA 1FUTA 2Q07A 1E3RA 1BIRA 2LQVA 1UCJA 5A0OB 3G8ZA 2BIRA 2XGNA 4MMZB 1D6UA 5EQLA 1CH0A 2P09A 2YFLB 1D6YA 3JUQA 4XDWA 1OH0A 4BIRA 1K734 4CJNA 2ML5A 5AIIA 2P0MA 2L1SA 1RCKA 1K28A 1W6GA 2ZA4A 1VQP3 1I2EA 2F86B 1IDPA 3DGLA 1BNGA 3OWUA 4HM2B 4BL3A 3KSED 1GYBA 2F5MA 1LQMB 1IVXA 5ELUA 2RNTA 1IQ8A 1FW7A 3X42A 1RGGA 4FCMA 1I3IA 4U13A 3OXAA 1AR0A 3BNDA 2CFGA 4O3VA 4OK0A 3CCU3 1KD14 3CC43 1BNJA 1YVSA 5IG4A 1GOYA 4FMCA 1ZX2A 3B4PA 2CG0A 5IEOA 1BAOA 1JN5B 3EHCA 5STDA 2CX1A 1ZO2A 1JJ22 2Y74A 3X41A 1N5HA 1DMQA 3LT9A 3VF1A 1UW1A 1SQWA 3CCR3 1GMPA 1BRGA 2P38A 3K0ZA 4GL6A
chains in the Genus database with same CATH topology
3HOHA 1R4YA 1HYFA 6RNTA 5GSPA 2GSPA 3AGOA 1BRJA 2KF4A 1X1WA 4J5KA 1RHLA 1LNIA 2KAAA 1BRKA 3DH2A 5BU4A 2BU4A 1JBRA 1BNIA 1BSDA 1LOYA 1PYLA 1B3SA 1FYSA 1Q9EA 2C4BA 1TRQA 7RNTA 1BUJA 2F56A 2AADA 1RGCA 2AAEA 3URPA 1BSAA 1JBSA 1X1UA 1RNTA 1BU4A 1GMPA 1RDSA 1T2IA 1MGRA 3RNTA 1IYYA 1YNVX 1DE3A 1RGKA 1BNEA 1JBTA 1AQZA 1BSBA 1GMQA 4RNTA 1RN4A 3D5IA 2F5WA 1B2XA 1TRPA 1B20A 1RLSA 1RSNA 2RBIA 9RNTA 1I70A 1BOXA 1SARA 1B2ZA 3Q3FA 4BU4A 4HAAA 1DETA 1LOVA 1BSCA 2SARA 7GSPA 1B2SA 1T2HA 2KF5A 1BNFA 2HOHA 1C54A 1GSPA 1UCLA 1UCKA 1UCIA 4HOHA 1FUSA 1BRNL 1X1XA 1RNBA 3BIRA 1RGHA 1BVIA 3A5EA 1FZUA 1AY7A 1I0XA 1LRAA 1I8VA 1BRIA 1MGWA 3AGNA 4GSPA 3WHOA 1G02A 5BIRA 1GOUA 1I3FA 3GSPA 5HOHA 1A2PA 1GOVA 1B27A 1I2FA 1RCLA 3AHWA 1HZ1A 1B2MA 1BSEA 1FUTA 3KCHA 1BIRA 1UCJA 1PY3A 2BIRA 1CH0A 4BIRA 3BU4A 5RNTA 1BNSA 1RGAA 1RCKA 1ZGXA 2ZA4A 1RGLA 1GMRA 1BGSA 1I2EA 1I0VA 1LOWA 3D5GA 3DGYA 8RNTA 1BNGA 1BRHA 1RGEA 2F5MA 4GHOA 1RN1A 2RNTA 3AHSA 1FW7A 2KF3A 1RGGA 2KF6A 1I3IA 3SYUA 1RMSA 1BNRA 1BNJA 1YVSA 2F4YA 1GOYA 3D4AA 1BAOA 1BRSA 1RGFA 1X1YA 1B2UA 1YGWA 1TTOA 1RTUA 1BANA 4J5GA 1I2GA 1B21A 1BRGA 3WR2A 6GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOH A;  1R4Y A;  1HYF A;  6RNT A;  5GSP A;  2GSP A;  3AGO A;  1BRJ A;  2KF4 A;  1X1W A;  4J5K A;  1RHL A;  1LNI A;  2KAA A;  1BRK A;  3DH2 A;  5BU4 A;  2BU4 A;  1JBR A;  1BNI A;  1BSD A;  1LOY A;  1PYL A;  1B3S A;  1FYS A;  1Q9E A;  2C4B A;  1TRQ A;  7RNT A;  1BUJ A;  2F56 A;  2AAD A;  1RGC A;  2AAE A;  3URP A;  1BSA A;  1JBS A;  1X1U A;  1RNT A;  1BU4 A;  1GMP A;  1RDS A;  1T2I A;  1MGR A;  3RNT A;  1IYY A;  1YNV X;  1DE3 A;  1RGK A;  1BNE A;  1JBT A;  1AQZ A;  1BSB A;  1GMQ A;  4RNT A;  1RN4 A;  3D5I A;  2F5W A;  1B2X A;  1TRP A;  1B20 A;  1RLS A;  1RSN A;  2RBI A;  9RNT A;  1I70 A;  1BOX A;  1SAR A;  1B2Z A;  3Q3F A;  4BU4 A;  4HAA A;  1DET A;  1LOV A;  1BSC A;  2SAR A;  7GSP A;  1B2S A;  1T2H A;  2KF5 A;  1BNF A;  2HOH A;  1C54 A;  1GSP A;  1UCL A;  1UCK A;  1UCI A;  4HOH A;  1FUS A;  1BRN L;  1X1X A;  1RNB A;  3BIR A;  1RGH A;  1BVI A;  3A5E A;  1FZU A;  1AY7 A;  1I0X A;  1LRA A;  1I8V A;  1BRI A;  1MGW A;  3AGN A;  4GSP A;  3WHO A;  1G02 A;  5BIR A;  1GOU A;  1I3F A;  3GSP A;  5HOH A;  1A2P A;  1GOV A;  1B27 A;  1I2F A;  1RCL A;  3AHW A;  1HZ1 A;  1B2M A;  1BSE A;  1FUT A;  3KCH A;  1BIR A;  1UCJ A;  1PY3 A;  2BIR A;  1CH0 A;  4BIR A;  3BU4 A;  5RNT A;  1BNS A;  1RGA A;  1RCK A;  1ZGX A;  2ZA4 A;  1RGL A;  1GMR A;  1BGS A;  1I2E A;  1I0V A;  1LOW A;  3D5G A;  3DGY A;  8RNT A;  1BNG A;  1BRH A;  1RGE A;  2F5M A;  4GHO A;  1RN1 A;  2RNT A;  3AHS A;  1FW7 A;  2KF3 A;  1RGG A;  2KF6 A;  1I3I A;  3SYU A;  1RMS A;  1BNR A;  1BNJ A;  1YVS A;  2F4Y A;  1GOY A;  3D4A A;  1BAO A;  1BRS A;  1RGF A;  1X1Y A;  1B2U A;  1YGW A;  1TTO A;  1RTU A;  1BAN A;  4J5G A;  1I2G A;  1B21 A;  1BRG A;  3WR2 A;  6GSP A; 
#chains in the Genus database with same CATH topology
 3F7S A;  1MWR A;  1MWT A;  3FSD A;  5JBS A;  2GSP A;  1O7N B;  2O3O A;  1TFK A;  2XH9 A;  5G1L A;  4EV5 A;  5ELJ A;  4NRE A;  2K3D A;  3FH1 A;  2JDI H;  3I56 3;  2BU4 A;  4R1K A;  1NJI 4;  1BNI A;  1U5O A;  3F8H A;  1WMO A;  1HU9 A;  1TRQ A;  7RNT A;  1A2V A;  2AAE A;  1RGC A;  1UI8 A;  3NBJ A;  1IV7 A;  4TX4 A;  4CDL A;  3OW2 2;  1VQK 3;  1G96 A;  1IU7 A;  1MOL A;  1F8N A;  2XEP A;  1GS3 A;  1NDO B;  3MYT A;  1YNV X;  3F8X A;  3K5T A;  1SIH A;  4HM5 B;  1BNE A;  1JBT A;  1AQZ A;  3GWR A;  1JZD A;  1IV9 A;  3GZY B;  1QAK A;  1RN7 A;  2GBX B;  1TJD A;  4HM7 B;  5AIF A;  5JPU A;  1ZS7 A;  2W03 A;  1NB5 I;  1CYU A;  4WHA A;  3CCV 3;  1TRP A;  1B20 A;  1RSN A;  3I0Y A;  1DVD A;  2HMJ B;  1DMN A;  1JN5 A;  3BNE A;  3J7Y d;  3EE1 A;  1YJ9 3;  4H61 A;  4MMY B;  1VQ5 3;  3UJM A;  4LMI A;  1B2Z A;  1JKG A;  4HAA A;  7GSP A;  2FXT A;  2WOH A;  3DMC A;  4K61 A;  4FMB A;  4Q53 A;  1BNF A;  4WYK B;  3SVA A;  3CU3 A;  3MKI A;  3FCS B;  2QA4 3;  1GSP A;  2FNQ A;  3F14 A;  1D6Z A;  2OQE A;  4HOH A;  1US1 A;  1S5A A;  2MF7 A;  4HVN A;  4LGQ A;  1FUS A;  4FR9 A;  4ORL A;  2ML6 A;  3FKA A;  3UL6 A;  5CXO A;  1FGM A;  2B1X B;  2D1W A;  1UGH I;  4RZM A;  1V74 A;  2HMK B;  1N9J A;  3A5E A;  2CIU A;  3PXM A;  2F99 A;  2OTL 3;  4MMX B;  3CMA 3;  4J8T A;  1LRA A;  3PYJ A;  4XM4 A;  3PCR A;  1Q7Y 4;  1MWU A;  3NXJ A;  4WWU C;  5BIR A;  1DYU A;  1AV4 A;  2CWV A;  1C7H A;  3GZX B;  1B27 A;  1I2F A;  1RCL A;  3NBR A;  2QIY A;  1HKX A;  5HGR A;  4OUQ A;  3LYG A;  4STD A;  3U1W A;  2O9U X;  3N8B A;  4HM8 B;  4RNZ A;  5IEN A;  1RKY A;  1WNH A;  5M1A A;  5IW9 A;  3T0U A;  1ULI B;  2INX A;  3HII A;  4OVM A;  1OGX A;  2XFS A;  1Q86 4;  1M1K 4;  4AKY A;  4N6N B;  1OPY A;  1O7M B;  2Z6B A;  1SJW A;  3F7X A;  1EQK A;  1RGA A;  2I9W A;  2UUG C;  1ZGX A;  3HX8 A;  3ZFZ A;  3NM2 A;  1K9M 4;  1QVF 2;  1G0T A;  2STD A;  4O8S A;  1Q42 A;  5DRE A;  3SLU A;  1QVG 2;  1KQS 2;  4KFE A;  1J2B A;  1BRH A;  4K1V A;  4HZB B;  3AHS A;  1S72 3;  1IVV A;  2KF3 A;  3MPH A;  4LSO A;  2D42 A;  3BB9 A;  1KC8 4;  3FZW A;  1BNR A;  4HM0 B;  3LTB A;  5KP4 A;  3DUK A;  4LEH A;  4HM4 B;  1DMM A;  3WDG B;  3CCQ 3;  3A76 A;  2WGQ A;  1Q40 B;  3EX9 A;  1RGF A;  3EC9 A;  4R9L A;  3CC7 3;  2RCD A;  3OX9 A;  3X3Y A;  2E2U A;  2J8X B;  1M9G A;  3MSO A;  3WR2 A;  6GSP A;  3M8C A;  1QJG A;  1R4Y A;  3KZT A;  6RNT A;  3IPT A;  3EB8 A;  3S5C A;  2KF4 A;  1X1W A;  2IY2 A;  4G1M B;  4BL2 A;  3V98 A;  3LML A;  2HML B;  2F98 A;  2GU1 A;  2IUK A;  2ZHX B;  4MJD A;  3CCM 3;  4BTY A;  1ISK A;  5CK6 A;  2OOV C;  1LVN A;  3JUM A;  3X3Z A;  1BSD A;  1N9E A;  2HMN B;  4HBR A;  2YFI B;  1FYS A;  3FG4 A;  5CLK A;  2C4B A;  1BUQ A;  3MG3 A;  5BXQ A;  2AAD A;  2FGT A;  2KXG A;  3Q1C A;  3PZW A;  1A2K A;  2C10 A;  1MGR A;  3RNT A;  3D9R A;  1IYY A;  3RGR A;  5LC6 A;  2IMJ A;  4R80 A;  2WO0 A;  3WOD G;  4IT7 A;  3HIG A;  2QGU A;  4WFO A;  1WMN A;  1YIJ 3;  3V92 A;  1BSB A;  2GBW B;  1SII A;  4N6L A;  1FGR A;  4QWT A;  5AYS C;  4RNT A;  1OF5 B;  5IG5 A;  1IVW A;  2RBI A;  4HM3 B;  1W02 A;  2PZV A;  1PU4 A;  1O7W B;  3SXX A;  4IIA A;  1Q40 A;  3ZG5 A;  3ALA A;  3NV0 B;  1MWS A;  1VQL 3;  2CHC A;  2XRX B;  3ER7 A;  1A67 A;  1CQS A;  2W2C A;  2YX9 A;  1DVC A;  2MC8 A;  3S28 A;  3X3X A;  3EJV A;  3KKG A;  2W9Q A;  3HK4 A;  2HOH A;  3H3H A;  1W4N A;  3WOF B;  2CG1 A;  1C54 A;  3GZR A;  2W9P A;  2E2V A;  1M90 4;  5EEO A;  2H0I A;  1BRN L;  2K54 A;  1X1X A;  3CCE 3;  2CFL A;  2GEY A;  2V1L A;  3WA3 A;  4RBN A;  3TDG A;  1BVI A;  3WMD A;  3JVC A;  1NNV A;  1OUN A;  4K1U A;  3UL5 A;  1FZU A;  1UUW B;  1VQ9 3;  1B21 A;  1I0X A;  3K9M C;  5FW5 A;  1CYV A;  1TIJ A;  4GB5 A;  3AGN A;  4GSP A;  3WHO A;  5BVB A;  3SOA A;  1VQ6 3;  1GOU A;  1A2P A;  5M18 A;  2CC3 A;  3D3L A;  3BNC A;  1GOV A;  2IYJ A;  4HKV B;  4EV2 A;  4CCV A;  5LC7 A;  3LH4 A;  5AEU B;  3AHW A;  1QMA A;  1GD3 A;  1JB2 A;  1BSE A;  1VQQ A;  1OF5 A;  3DZL A;  2CFW A;  4LZI A;  7STD A;  1WMP A;  3AMO B;  1O7H B;  2XF3 A;  1RRL A;  5KP3 A;  3STD A;  4AKZ A;  5I97 A;  1YGE A;  3KN4 A;  2BMO B;  2BO9 B;  1BGS A;  1I0V A;  1LOW A;  3D5G A;  3DGY A;  3NV0 A;  1VQO 3;  1RGE A;  1RN1 A;  4NHF A;  4NPB A;  2W56 B;  3L0R A;  3G16 A;  1N5P A;  2Z76 A;  3T8U A;  1ULJ B;  4N6V 0;  1QAL A;  2Z77 A;  2CWT A;  3B8L A;  4HJL B;  3KSP A;  2PNC A;  1VZZ A;  3OWY A;  1BRS A;  2ZL8 A;  3PCS A;  4L8P A;  8CHO A;  3LOY A;  2HMM B;  2BNG A;  4JRF A;  1B2U A;  4CPK A;  1TP6 A;  3NM7 A;  1TTO A;  2RSX A;  1RTU A;  1EA2 A;  1UDI I;  4J5G A;  2W04 A;  1I2G A;  2P0X A;  2Z7A A;  3U97 A;  1BUJ A;  3S29 A;  3ECF A;  3HOH A;  1UUV B;  1YHQ 3;  5AIH A;  5GSP A;  3AGO A;  1YJW 3;  1BRJ A;  3DGN A;  2R41 A;  1RHL A;  2OQE C;  2UX0 A;  3O8Y A;  2B24 B;  3DH2 A;  3MWZ A;  4XBY A;  5M19 A;  1PYL A;  4WYK A;  3CCJ 3;  1Q9E A;  3BNB A;  3N9H A;  4XDV A;  3AMO A;  2F56 A;  1VQM 3;  3PGB A;  3G0K A;  6STD A;  1X1U A;  3CPO A;  1IT7 A;  1BU4 A;  1PFP A;  3MG1 A;  1RDS A;  3SOY A;  1T2I A;  2Y73 A;  3F40 A;  3FF0 A;  1WQL B;  2C11 A;  3H51 A;  3S67 A;  3IMA B;  4WP5 A;  4BTW A;  3RGA A;  1FGT A;  1T3B A;  3NX0 A;  1RGK A;  2IA7 A;  1E3V A;  1ROV A;  3NQZ A;  3VGN A;  1W00 A;  1GMQ A;  2W56 A;  3B4O A;  2JQ5 A;  3LXU X;  1L5G B;  5AEW B;  1RN4 A;  1NO3 A;  3D5I A;  2F5W A;  3QK9 A;  3WA2 X;  2R4I A;  1YIT 3;  1OHS A;  1RLS A;  2XFT A;  2CW9 A;  1LQG C;  2BMQ B;  2P05 A;  2CK3 H;  4K90 B;  4N6M A;  9RNT A;  4FMD A;  4JF8 A;  4HM6 B;  4L7K A;  5IG0 A;  3RDE A;  2KRT A;  1SAR A;  4HM1 B;  3KII A;  4BU4 A;  1DET A;  4HZ9 B;  5DRV A;  1O7P B;  3DGO A;  2H0H A;  1T2H A;  1JNQ A;  1YJN 3;  2GU3 A;  3WOE B;  1UUG B;  1UCK A;  2YFJ B;  5IEP A;  1JB4 A;  2HMO B;  1RJO A;  2M7O A;  1ROA A;  3GAX A;  3BIR A;  3G4S 3;  3EBY A;  1RNB A;  1RGH A;  3E99 A;  3NBB A;  1W2Z A;  4L8O A;  1W7C A;  5CF1 A;  2LYX A;  1N8Q A;  3CNM A;  2BMR B;  1AVK A;  1I8V A;  3CME 3;  1VQ8 3;  1BRI A;  2RFR A;  1NB3 I;  5HOH A;  3GSP A;  2W0Q A;  1STF I;  2BT3 A;  3LTD A;  3DGM A;  3SED A;  1V57 A;  1EKM A;  3GZB A;  4LYL B;  1GD4 A;  1HZ1 A;  4O2H A;  5CF2 A;  2W6J H;  4X2O A;  2UGI A;  1Q81 4;  3DXO A;  3KFQ C;  4ILF A;  3KCH A;  4N3V A;  3DY5 A;  1PY3 A;  1JKG B;  2BHM A;  3BU4 A;  1IQX A;  1GY6 A;  3EQQ B;  5RNT A;  1CEW I;  1BNS A;  5G1K A;  3EF8 A;  1RRH A;  2E2T A;  2K0M A;  1JB5 A;  1RGL A;  1GMR A;  2GXF A;  1VQN 3;  8RNT A;  4XB5 A;  3Q2P A;  1V58 A;  4H3U A;  3G71 3;  4GHO A;  1IT8 A;  2WOF A;  1LXE A;  1W6Y A;  5AIG A;  3K7C A;  3CXC 2;  5AI1 A;  3F9S A;  1W01 A;  1EEJ A;  2KF6 A;  2XSH B;  1KSI A;  1IQY A;  1T5Y A;  3K63 A;  2XR8 B;  3SYU A;  1RMS A;  1K8A 4;  2GEX A;  4EW5 A;  1E97 A;  1SPU A;  2F4Y A;  2OCT A;  3D4A A;  1NWW A;  3EN8 A;  1JZO A;  1NU3 A;  1R4C A;  1X1Y A;  1OAC A;  3CNX A;  1YGW A;  1AVL A;  1FGQ A;  1QAF A;  1BAN A;  3N54 B;  4N6T A;  4N6U A;  3FG3 A;  1Q7H A;  4KZ1 A;  5D81 A;  1LNH A;  1YI2 3;  3CPW 2;  5G2G A;  3CD6 3;  1A90 A;  1HYF A;  1W6C A;  2OWP A;  4RNY A;  3X40 A;  1YVB I;  2XGL A;  4J5K A;  1KWI A;  1ASK A;  1UGI A;  1LNI A;  3S27 A;  3IJE B;  2CH9 A;  5TGN A;  2KAA A;  4J9A A;  1BRK A;  1TUH A;  2CFD A;  5BU4 A;  1JBR A;  1U8C B;  3B7C A;  4R4K A;  3T8N A;  1LOY A;  5KP1 A;  1B3S A;  3I55 3;  4MEI A;  5IF6 A;  3JUP A;  2H0G A;  4XBT A;  3FLJ A;  1OCV A;  2ZDJ A;  1BSA A;  3URP A;  1JBS A;  3FGY A;  1RNT A;  3D79 A;  3LTA A;  1M1X B;  3QRD A;  1VQ4 3;  3NUV A;  1GY7 A;  4FCZ A;  4R9K A;  2XSO B;  5JPP A;  5EVH A;  4EBG A;  4EC6 A;  1DE3 A;  2OTJ 3;  2CWU A;  4FMA A;  3JUN A;  5IER A;  2RGQ A;  3OV4 A;  2A15 A;  3LZA A;  1Y4K A;  3GRD A;  1STD A;  3EN1 B;  3MHE A;  5IG3 A;  2CKF B;  4KFD A;  1B2X A;  3EBT A;  4EYC A;  3CC2 3;  1W5Z A;  3DM8 A;  3NHX A;  1LOX A;  1I70 A;  2CFK A;  1Q82 4;  1BOX A;  4KFF A;  1TU5 A;  2L4V A;  3G6E 3;  1JV2 B;  2KCD A;  1W2B 2;  1N8R 4;  1OGZ A;  3Q90 A;  3Q3F A;  4FCJ A;  1LOV A;  1UI7 A;  1BSC A;  1FGO A;  3SX1 A;  2SAR A;  1B2S A;  2KF5 A;  1IVU A;  3BLZ A;  3MG2 A;  1GY5 A;  1Z1S A;  2WGO A;  1FA3 A;  1UCL A;  1UCI A;  4N6O B;  3FF2 A;  3HI7 A;  4PEJ A;  3JUO A;  3LT8 A;  5FGO A;  3CCS 3;  1VQ7 3;  2OOV A;  3PS8 A;  3CCL 3;  2IUJ A;  3HZP A;  4AEQ A;  4I4K A;  1IK3 A;  1EUI C;  1WTH A;  2SBL A;  1K41 A;  4KT3 B;  3LTC A;  3UNL A;  2QEX 3;  1AY7 A;  1OHP A;  4XBX A;  1FUW A;  3ZG0 A;  4IPB A;  3FG1 A;  3KE7 A;  2CX0 A;  1MGW A;  5D82 A;  4BTX A;  1G02 A;  4DKI A;  1I3F A;  3OWS A;  1OHO A;  4O02 B;  5AYR B;  3VSY A;  1EG9 B;  3UB1 A;  1JRQ A;  3ROB A;  4HYZ A;  1TFO A;  4KVH A;  5D83 A;  1O7G B;  3NQY A;  4I5Q A;  4EXR A;  4X2H A;  3V99 A;  4ZM8 A;  1B2M A;  1MNL A;  1FUT A;  2Q07 A;  1E3R A;  1BIR A;  2LQV A;  1UCJ A;  5A0O B;  3G8Z A;  2BIR A;  2XGN A;  4MMZ B;  1D6U A;  5EQL A;  1CH0 A;  2P09 A;  2YFL B;  1D6Y A;  3JUQ A;  4XDW A;  1OH0 A;  4BIR A;  1K73 4;  4CJN A;  2ML5 A;  5AII A;  2P0M A;  2L1S A;  1RCK A;  1K28 A;  1W6G A;  2ZA4 A;  1VQP 3;  1I2E A;  2F86 B;  1IDP A;  3DGL A;  1BNG A;  3OWU A;  4HM2 B;  4BL3 A;  3KSE D;  1GYB A;  2F5M A;  1LQM B;  1IVX A;  5ELU A;  2RNT A;  1IQ8 A;  1FW7 A;  3X42 A;  1RGG A;  4FCM A;  1I3I A;  4U13 A;  3OXA A;  1AR0 A;  3BND A;  2CFG A;  4O3V A;  4OK0 A;  3CCU 3;  1KD1 4;  3CC4 3;  1BNJ A;  1YVS A;  5IG4 A;  1GOY A;  4FMC A;  1ZX2 A;  3B4P A;  2CG0 A;  5IEO A;  1BAO A;  1JN5 B;  3EHC A;  5STD A;  2CX1 A;  1ZO2 A;  1JJ2 2;  2Y74 A;  3X41 A;  1N5H A;  1DMQ A;  3LT9 A;  3VF1 A;  1UW1 A;  1SQW A;  3CCR 3;  1GMP A;  1BRG A;  2P38 A;  3K0Z A;  4GL6 A; 
#chains in the Genus database with same CATH homology
 3HOH A;  1R4Y A;  1HYF A;  6RNT A;  5GSP A;  2GSP A;  3AGO A;  1BRJ A;  2KF4 A;  1X1W A;  4J5K A;  1RHL A;  1LNI A;  2KAA A;  1BRK A;  3DH2 A;  5BU4 A;  2BU4 A;  1JBR A;  1BNI A;  1BSD A;  1LOY A;  1PYL A;  1B3S A;  1FYS A;  1Q9E A;  2C4B A;  1TRQ A;  7RNT A;  1BUJ A;  2F56 A;  2AAD A;  1RGC A;  2AAE A;  3URP A;  1BSA A;  1JBS A;  1X1U A;  1RNT A;  1BU4 A;  1GMP A;  1RDS A;  1T2I A;  1MGR A;  3RNT A;  1IYY A;  1YNV X;  1DE3 A;  1RGK A;  1BNE A;  1JBT A;  1AQZ A;  1BSB A;  1GMQ A;  4RNT A;  1RN4 A;  3D5I A;  2F5W A;  1B2X A;  1TRP A;  1B20 A;  1RLS A;  1RSN A;  2RBI A;  9RNT A;  1I70 A;  1BOX A;  1SAR A;  1B2Z A;  3Q3F A;  4BU4 A;  4HAA A;  1DET A;  1LOV A;  1BSC A;  2SAR A;  7GSP A;  1B2S A;  1T2H A;  2KF5 A;  1BNF A;  2HOH A;  1C54 A;  1GSP A;  1UCL A;  1UCK A;  1UCI A;  4HOH A;  1FUS A;  1BRN L;  1X1X A;  1RNB A;  3BIR A;  1RGH A;  1BVI A;  3A5E A;  1FZU A;  1AY7 A;  1I0X A;  1LRA A;  1I8V A;  1BRI A;  1MGW A;  3AGN A;  4GSP A;  3WHO A;  1G02 A;  5BIR A;  1GOU A;  1I3F A;  3GSP A;  5HOH A;  1A2P A;  1GOV A;  1B27 A;  1I2F A;  1RCL A;  3AHW A;  1HZ1 A;  1B2M A;  1BSE A;  1FUT A;  3KCH A;  1BIR A;  1UCJ A;  1PY3 A;  2BIR A;  1CH0 A;  4BIR A;  3BU4 A;  5RNT A;  1BNS A;  1RGA A;  1RCK A;  1ZGX A;  2ZA4 A;  1RGL A;  1GMR A;  1BGS A;  1I2E A;  1I0V A;  1LOW A;  3D5G A;  3DGY A;  8RNT A;  1BNG A;  1BRH A;  1RGE A;  2F5M A;  4GHO A;  1RN1 A;  2RNT A;  3AHS A;  1FW7 A;  2KF3 A;  1RGG A;  2KF6 A;  1I3I A;  3SYU A;  1RMS A;  1BNR A;  1BNJ A;  1YVS A;  2F4Y A;  1GOY A;  3D4A A;  1BAO A;  1BRS A;  1RGF A;  1X1Y A;  1B2U A;  1YGW A;  1TTO A;  1RTU A;  1BAN A;  4J5G A;  1I2G A;  1B21 A;  1BRG A;  3WR2 A;  6GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...