1X1WA

Water-mediate interaction at aprotein-protein interface
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Water-mediated interaction at a protein-protein interface
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/protein binding
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1x1wA00
1RGGA 2F5WA 1BRHA 3BIRA 3KCHA 2KF4A 2RNTA 1B2ZA 3D5GA 1LNIA 1LOYA 1YVSA 2KAAA 1LOVA 3HOHA 1BVIA 1RGAA 9RNTA 1BSAA 1UCKA 1B3SA 1FW7A 1RMSA 1RNBA 1B2UA 1BGSA 1BRGA 2F4YA 1LOWA 2C4BA 4GSPA 1ZGXA 3AHSA 3DH2A 1I70A 1GMPA 1A2PA 4RNTA 5GSPA 4HAAA 1I0VA 1UCLA 1BIRA 1BNJA 2SARA 1X1XA 1BUJA 1UCIA 3RNTA 1RCLA 1X1WA 3WR2A 1I3IA 1B27A 3A5EA 8RNTA 2HOHA 1RGEA 3D4AA 1BAOA 1Q9EA 1BSCA 3D5IA 4BIRA 1I2EA 1T2IA 1IYYA 1TTOA 1R4YA 2GSPA 1RGLA 1I3FA 1SARA 1BRSA 1I2GA 3AGOA 4BU4A 1PY3A 1AY7A 1BRIA 1X1UA 1UCJA 3DGYA 7GSPA 1BNRA 1RN1A 1I8VA 1JBRA 1DE3A 1BRJA 1BRNL 2F5MA 3SYUA 1B20A 1TRPA 2ZA4A 1B2SA 1GMQA 6GSPA 1FUSA 2BU4A 1X1YA 1I0XA 1BRKA 1YNVX 1GOVA 1BU4A 1MGRA 1RDSA 1FUTA 2BIRA 2KF6A 5HOHA 1B2MA 4J5KA 3GSPA 2KF5A 3URPA 1RCKA 1MGWA 1RTUA 1FZUA 4J5GA 4HOHA 5BU4A 1BSBA 5RNTA 1T2HA 1HZ1A 1RSNA 1RN4A 1GOYA 1BNIA 1GSPA 1BANA 1RLSA 4GHOA 1TRQA 1HYFA 5BIRA 1RGFA 1B2XA 1BNGA 1GMRA 1C54A 1RNTA 3WHOA 3AGNA 1CH0A 1GOUA 1BOXA 2AAEA 1RGCA 1FYSA 1AQZA 2RBIA 7RNTA 1BSDA 1B21A 2F56A 1BSEA 1RGHA 3Q3FA 1BNFA 2KF3A 1LRAA 3AHWA 1G02A 1JBSA 1I2FA 1YGWA 1DETA 3BU4A 1PYLA 1BNSA 1RHLA 1RGKA 2AADA 6RNTA 1JBTA 1BNEA
chains in the Genus database with same CATH superfamily
3NBRA 3S5CA 4LGQA 3UL5A 2GEYA 4KVHA 1TU5A 2RNTA 1OHSA 3RDEA 1UUWB 1LOYA 2BMRB 4R80A 1WMOA 3E99A 3SOYA 3RGAA 1KC84 1MWUA 3SX1A 4WFOA 3X3ZA 4MMYB 3LTBA 2KRTA 1B3SA 2KXGA 3FG1A 5IG5A 1RNBA 1JNQA 1FGRA 2CWTA 1IV9A 2CKFB 5IEPA 1ROAA 1JB2A 4I4KA 1ZGXA 3DH2A 1A2PA 2Z76A 4RNTA 1NO3A 4HAAA 3KSPA 5GSPA 1OPYA 1UCLA 1DYUA 3LMLA 5BVBA 2SARA 2ZDJA 2ML5A 1JKGA 2MF7A 1UCIA 3PCRA 1JN5B 2JQ5A 1S723 3PS8A 2YX9A 1RCLA 3WR2A 4AKYA 4N6TA 2WOFA 1UUVB 3AMOB 3PYJA 3EC9A 3FKAA 3FH1A 5JBSA 3KKGA 1PFPA 2P0MA 4I5QA 1KSIA 4BIRA 1FA3A 4EC6A 4HZ9B 3LYGA 4X2OA 1PU4A 1RGLA 1I3FA 1RRLA 4BU4A 5LC7A 1CEWI 5AEUB 1FUWA 4HJLB 1AY7A 4XDWA 1OF5B 4NREA 1UCJA 3VSYA 4MMXB 1G0TA 2R41A 1ULIB 4Q53A 2WOHA 1GY7A 3QRDA 2M7OA 2R4IA 3FZWA 1BRNL 3HK4A 1N9JA 1UGIA 1FGQA 3KZTA 3CCM3 1GMQA 4FCZA 1VQ53 1X1YA 3CNMA 3G8ZA 4RNZA 5IG4A 1C7HA 1MGRA 1OHOA 1RDSA 1OGXA 1FUTA 1UDII 2CC3A 3BNEA 3S29A 4N6MA 3PGBA 1K8A4 1G96A 5IERA 2CX0A 1S5AA 4FMAA 4RBNA 3URPA 1RCKA 2LYXA 3A76A 3FF2A 1OUNA 4WYKA 3CD63 2H0HA 4HM7B 1W2ZA 3LTDA 1BANA 1K734 1M1XB 4HM3B 5G2GA 4O02B 3AGNA 1CH0A 3LXUX 1SIHA 1OH0A 3G713 3CC43 5M1AA 2ZL8A 1QVF2 1BSDA 4LSOA 3JUQA 3BNDA 4H61A 1B21A 3EE1A 4NPBA 1IVUA 4BTWA 1JZDA 3WOEB 3MKIA 1IT7A 3F14A 1KWIA 3BNCA 1V58A 3HIIA 1L5GB 2XEPA 2CH9A 2W56B 4R9KA 3UB1A 3WA2X 1JBSA 1I2FA 2W9QA 3HIGA 3PCSA 4U13A 5CK6A 1WQLB 4KT3B 1Q864 1YGEA 2W9PA 5AIIA 5DRVA 2ML6A 2GBWB 3Q2PA 2E2UA 5A0OB 4FCJA 1RHLA 2P38A 1RGKA 3JUOA 3OV4A 3CCU3 4EV2A 2Y73A 3K9MC 4O3VA 1STFI 5IF6A 3I563 3D3LA 2KF4A 1RKYA 1LOXA 1SQWA 1WNHA 1EG9B 5AIHA 1SIIA 2F98A 3CMA3 3NM7A 2W6JH 1Y4KA 1LNIA 1YVSA 4L7KA 2OCTA 2KAAA 3K0ZA 2CFWA 1LNHA 3HOHA 2WGOA 4HZBB 1RGAA 9RNTA 1BSAA 3CPOA 4FMBA 4HM6B 1V74A 4RZMA 2F4YA 1BGSA 4AKZA 1Q7Y4 3EHCA 3FG4A 3CCV3 2IY2A 3LTCA 2JDIH 3AHSA 2P09A 3DZLA 3U97A 2IMJA 2K3DA 4K1VA 4EV5A 1QALA 1I0VA 1HU9A 2GU1A 1BIRA 1YHQ3 2QA43 1EUIC 3G6E3 2W04A 3G0KA 4HM8B 5AYRB 4J9AA 4HM5B 2B24B 4R4KA 1RJOA 3MHEA 3N9HA 4ILFA 1W4NA 3T8NA 2FNQA 3KFQC 3A5EA 4OVMA 3G16A 3D79A 3K7CA 3LT9A 5CF1A 3RGRA 1NWWA 1Q9EA 1BSCA 4KFEA 3EN8A 3CC23 3GAXA 1YJ93 1FGTA 5BXQA 2BT3A 3PXMA 3EX9A 4FCMA 1I2GA 1K9M4 2ZHXB 1VQ63 3UL6A 1GD4A 2CFGA 2FGTA 4X2HA 4CJNA 2GXFA 5JPPA 3WOFB 6STDA 1AV4A 5ELJA 3MYTA 3DGYA 2YFLB 4LMIA 5FW5A 1BNRA 1F8NA 2CHCA 1BRJA 2YFJB 1OGZA 2Q07A 3SYUA 2LQVA 4K61A 3CCL3 3DY5A 2XRXB 1B2SA 1RN7A 1TJDA 3UNLA 1TUHA 3Q1CA 3SOAA 6GSPA 2OOVA 1N8R4 3MPHA 3OX9A 2Z7AA 4LZIA 2RGQA 1GOVA 2QGUA 2KF6A 3U1WA 2CK3H 3BB9A 8CHOA 1YI23 3GSPA 3MG3A 2E2TA 4K1UA 3IMAB 5KP3A 1LQMB 2GEXA 1IVVA 4KFDA 1UW1A 2UUGC 3EBTA 1ZX2A 4BTXA 3H51A 1W5ZA 1FZUA 4HOHA 1TFOA 4MMZB 5RNTA 2BHMA 1LQGC 3SXXA 3NV0A 2HMMB 4GHOA 1GOYA 1RLSA 2INXA 2I9WA 1BNGA 3NUVA 1GMRA 1NB3I 1D6UA 4XM4A 5AYSC 5CXOA 5DREA 3OW22 1MWTA 4AEQA 1MOLA 2UX0A 2WO0A 3F7SA 3VGNA 3PZWA 3VF1A 1A2VA 4ZM8A 2XF3A 3CCR3 4XB5A 2XFSA 1IV7A 3OWYA 1ISKA 3MWZA 3LT8A 1V57A 4TX4A 1AQZA 7RNTA 1VQ43 1BSEA 3V99A 2OOVC 3KE7A 1W6YA 1A67A 3Q90A 1OACA 1BNFA 1HKXA 4HM4B 1VQN3 1G02A 2WGQA 5EEOA 3MG2A 1DETA 3F8XA 4O2HA 1IK3A 5D83A 5HGRA 1QAKA 1PYLA 2C10A 1DMMA 1IQYA 1KQS2 1O7GB 1VZZA 2AADA 2P05A 3CNXA 4HVNA 5LC6A 6RNTA 3CC73 1N5HA 2F5WA 3LTAA 4L8PA 2CW9A 3ALAA 3FG3A 3NBBA 1VQ93 1B2ZA 3D5GA 4NHFA 3FF0A 4RNYA 3S27A 1LOVA 3ZFZA 1BVIA 1D6ZA 1Z1SA 2XSOB 1W6CA 1FW7A 1RMSA 2W2CA 4HYZA 5G1KA 3ROBA 2CFDA 3DMCA 3CCQ3 3NQYA 4OK0A 4WYKB 1M904 1N5PA 5IG3A 4JRFA 5FGOA 1W2B2 1A2KA 1JV2B 1CYVA 1O7NB 1O7PB 3LOYA 3FLJA 4ORLA 5AEWB 4FR9A 2K54A 5CF2A 2XGLA 1BNJA 4K90B 1BUJA 5EQLA 1GY5A 2IA7A 3EBYA 2HMOB 1I3IA 1TP6A 3SLUA 1EEJA 8RNTA 2W03A 1UGHI 2CX1A 4N3VA 3DUKA 1AVKA 1C54A 1Q40B 4EW5A 1FGMA 1N9EA 4N6OB 3D5IA 1I2EA 3WDGB 3STDA 1IYYA 4FMCA 5IENA 1SARA 3JUMA 1BRSA 2OQEA 2IYJA 1PY3A 5IG0A 4XDVA 1IU7A 1VQK3 1BRIA 1JB5A 3D9RA 3EQQB 2CG1A 3G4S3 1QVG2 4GL6A 1IVXA 1LXEA 1TFKA 2F86B 1JB4A 3HI7A 1O7HB 1I8VA 1O7WB 2BMQB 1JBRA 2HMKB 2HMNB 1MWSA 4CDLA 1FGOA 1TRPA 2ZA4A 3EF8A 3JUPA 1YVBI 2J8XB 1T5YA 4XBYA 2BU4A 3DGMA 4EXRA 3I553 1I0XA 1EQKA 3O8YA 3X3XA 2XH9A 2STDA 1QMAA 2BIRA 2CIUA 1IVWA 1W02A 3DGNA 3EJVA 2YFIB 3ER7A 4PEJA 2C11A 2W0QA 3NBJA 2Z6BA 2D42A 2KF5A 3MG1A 5AIFA 1JZOA 2OTJ3 1EA2A 2IUJA 1VQP3 3F7XA 1MGWA 4CCVA 3T8UA 4J5GA 3WA3A 3V92A 1YJN3 3DM8A 1BSBA 3UJMA 3H3HA 4MEIA 1HZ1A 2OQEC 3WMDA 1RSNA 3L0RA 2UGIA 2FXTA 1RN4A 2V1LA 1BNIA 1GSPA 1W01A 3NX0A 4WP5A 1TRQA 1HYFA 1E3VA 1RGFA 3OWSA 1Q42A 4XBTA 1UI7A 1JN5A 3B4PA 2QEX3 2KCDA 1RNTA 3FSDA 4R1KA 5AI1A 2HMLB 1NB5I 1BOXA 5JPUA 3B8LA 3AMOA 1T3BA 2AAEA 3B4OA 4KZ1A 1RGCA 4N6LA 4BL2A 1GS3A 1FYSA 1IQ8A 2RBIA 2RCDA 3CME3 1ROVA 2F56A 1RGHA 3EB8A 5EVHA 3Q3FA 1OCVA 3BLZA 2CFKA 1O7MB 1LRAA 3AHWA 4IIAA 2CG0A 2IUKA 1DMQA 1M9GA 2L4VA 3KN4A 5I97A 1D6YA 3BU4A 1OF5A 1UI8A 1E97A 3SEDA 3KIIA 2D1WA 5D82A 1BNEA 4BTYA 1JKGB 3ZG0A 1IQXA 1QAFA 1RGGA 3V98A 3M8CA 1WTHA 4FMDA 1BRHA 1ZO2A 1VQ73 3BIRA 4EYCA 3OXAA 3KCHA 4J8TA 4BL3A 1VQL3 4HBRA 3CCJ3 1W7CA 1RRHA 4N6V0 2Z77A 3FCSB 2XR8B 1W00A 3MSOA 1SPUA 2B1XB 2CWVA 1UCKA 3GZYB 4WWUC 1B2UA 1BRGA 3NHXA 4KFFA 3S28A 1LOWA 3CCS3 2BO9B 3LH4A 2C4BA 2H0GA 1WMNA 3GZBA 4GSPA 1I70A 1GMPA 4DKIA 1BUQA 5KP1A 3GRDA 1GYBA 1US1A 1Q814 3NV0B 4WHAA 3QK9A 3HX8A 1X1XA 4GB5A 3K5TA 3F9SA 1NU3A 4MJDA 3RNTA 1NJI4 2GBXB 1CYUA 3GZXB 1X1WA 1K41A 1TIJA 1B27A 1ZS7A 4LYLB 4OUQA 1GD3A 4N6NB 1CQSA 2HOHA 3X41A 1RGEA 2MC8A 1N8QA 4HM2B 1VQQA 3JVCA 3D4AA 1BAOA 4HM0B 4LEHA 3X42A 4QWTA 3CXC2 1WMPA 4CPKA 1NNVA 3CU3A 1T2IA 1YIJ3 1TTOA 1MWRA 2A15A 2H0IA 1R4YA 2GSPA 3X40A 3K63A 3BNBA 3AGOA 1YIT3 3B7CA 4JF8A 2BNGA 1NDOB 2Y74A 1JRQA 2BMOB 1X1UA 1OHPA 2W56A 2XSHB 3IJEB 4STDA 1U5OA 3GZRA 1IDPA 3N54B 7GSPA 3F8HA 1UUGB 5IW9A 5M18A 2GU3A 1RN1A 4O8SA 2OWPA 1DE3A 1DVDA 5ELUA 1W6GA 2F5MA 3NQZA 1B20A 4IT7A 2F99A 1U8CB 1R4CA 3CPW2 3GWRA 1Q7HA 1FUSA 2CWUA 3EN1B 4EBGA 5M19A 3N8BA 4N6UA 3J7Yd 2P0XA 3TDGA 1BRKA 1YNVX 1Q40A 1BU4A 5G1LA 1LVNA 1B2MA 5HOHA 2PZVA 3ECFA 2RSXA 4HKVB 4J5KA 2K0MA 1ASKA 4G1MB 1KD14 1VQ83 5IEOA 2OTL3 1YJW3 2E2VA 2L1SA 4XBXA 4L8OA 4H3UA 5STDA 1RTUA 3FGYA 5AIGA 3SVAA 1EKMA 2SBLA 3DXOA 1SJWA 1IT8A 3LZAA 5BU4A 1MNLA 1VQO3 1T2HA 5D81A 1Q824 5BIRA 1JJ22 1B2XA 3NM2A 3S67A 5KP4A 1GY6A 1A90A 3WHOA 3I0YA 1DVCA 1ULJB 3F40A 1GOUA 2RFRA 1E3RA 4HM1B 3WODG 2CFLA 2O3OA 1QJGA 2QIYA 3JUNA 1DMNA 3NXJA 1AVLA 3X3YA 1AR0A 3HZPA 2KF3A 3CCE3 3ZG5A 1VQM3 1M1K4 1J2BA 1YGWA 2XFTA 1K28A 3IPTA 4IPBA 3DGOA 1STDA 2XGNA 1BNSA 5TGNA 5CLKA 3KSED 4R9LA 3T0UA 2HMJB 3OWUA 1JBTA 2O9UX 2PNCA 7STDA 3DGLA
chains in the Genus database with same CATH topology
1RGGA 2F5WA 1BRHA 3BIRA 3KCHA 2KF4A 2RNTA 1B2ZA 3D5GA 1LNIA 1LOYA 1YVSA 2KAAA 1LOVA 3HOHA 1BVIA 1RGAA 9RNTA 1BSAA 1UCKA 1B3SA 1FW7A 1RMSA 1RNBA 1B2UA 1BGSA 1BRGA 2F4YA 1LOWA 2C4BA 4GSPA 1ZGXA 3AHSA 3DH2A 1I70A 1GMPA 1A2PA 4RNTA 5GSPA 4HAAA 1I0VA 1UCLA 1BIRA 1BNJA 2SARA 1X1XA 1BUJA 1UCIA 3RNTA 1RCLA 1X1WA 3WR2A 1I3IA 1B27A 3A5EA 8RNTA 2HOHA 1RGEA 3D4AA 1BAOA 1Q9EA 1BSCA 3D5IA 4BIRA 1I2EA 1T2IA 1IYYA 1TTOA 1R4YA 2GSPA 1RGLA 1I3FA 1SARA 1BRSA 1I2GA 3AGOA 4BU4A 1PY3A 1AY7A 1BRIA 1X1UA 1UCJA 3DGYA 7GSPA 1BNRA 1RN1A 1I8VA 1JBRA 1DE3A 1BRJA 1BRNL 2F5MA 3SYUA 1B20A 1TRPA 2ZA4A 1B2SA 1GMQA 6GSPA 1FUSA 2BU4A 1X1YA 1I0XA 1BRKA 1YNVX 1GOVA 1BU4A 1MGRA 1RDSA 1FUTA 2BIRA 2KF6A 5HOHA 1B2MA 4J5KA 3GSPA 2KF5A 3URPA 1RCKA 1MGWA 1RTUA 1FZUA 4J5GA 4HOHA 5BU4A 1BSBA 5RNTA 1T2HA 1HZ1A 1RSNA 1RN4A 1GOYA 1BNIA 1GSPA 1BANA 1RLSA 4GHOA 1TRQA 1HYFA 5BIRA 1RGFA 1B2XA 1BNGA 1GMRA 1C54A 1RNTA 3WHOA 3AGNA 1CH0A 1GOUA 1BOXA 2AAEA 1RGCA 1FYSA 1AQZA 2RBIA 7RNTA 1BSDA 1B21A 2F56A 1BSEA 1RGHA 3Q3FA 1BNFA 2KF3A 1LRAA 3AHWA 1G02A 1JBSA 1I2FA 1YGWA 1DETA 3BU4A 1PYLA 1BNSA 1RHLA 1RGKA 2AADA 6RNTA 1JBTA 1BNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGG A;  2F5W A;  1BRH A;  3BIR A;  3KCH A;  2KF4 A;  2RNT A;  1B2Z A;  3D5G A;  1LNI A;  1LOY A;  1YVS A;  2KAA A;  1LOV A;  3HOH A;  1BVI A;  1RGA A;  9RNT A;  1BSA A;  1UCK A;  1B3S A;  1FW7 A;  1RMS A;  1RNB A;  1B2U A;  1BGS A;  1BRG A;  2F4Y A;  1LOW A;  2C4B A;  4GSP A;  1ZGX A;  3AHS A;  3DH2 A;  1I70 A;  1GMP A;  1A2P A;  4RNT A;  5GSP A;  4HAA A;  1I0V A;  1UCL A;  1BIR A;  1BNJ A;  2SAR A;  1X1X A;  1BUJ A;  1UCI A;  3RNT A;  1RCL A;  1X1W A;  3WR2 A;  1I3I A;  1B27 A;  3A5E A;  8RNT A;  2HOH A;  1RGE A;  3D4A A;  1BAO A;  1Q9E A;  1BSC A;  3D5I A;  4BIR A;  1I2E A;  1T2I A;  1IYY A;  1TTO A;  1R4Y A;  2GSP A;  1RGL A;  1I3F A;  1SAR A;  1BRS A;  1I2G A;  3AGO A;  4BU4 A;  1PY3 A;  1AY7 A;  1BRI A;  1X1U A;  1UCJ A;  3DGY A;  7GSP A;  1BNR A;  1RN1 A;  1I8V A;  1JBR A;  1DE3 A;  1BRJ A;  1BRN L;  2F5M A;  3SYU A;  1B20 A;  1TRP A;  2ZA4 A;  1B2S A;  1GMQ A;  6GSP A;  1FUS A;  2BU4 A;  1X1Y A;  1I0X A;  1BRK A;  1YNV X;  1GOV A;  1BU4 A;  1MGR A;  1RDS A;  1FUT A;  2BIR A;  2KF6 A;  5HOH A;  1B2M A;  4J5K A;  3GSP A;  2KF5 A;  3URP A;  1RCK A;  1MGW A;  1RTU A;  1FZU A;  4J5G A;  4HOH A;  5BU4 A;  1BSB A;  5RNT A;  1T2H A;  1HZ1 A;  1RSN A;  1RN4 A;  1GOY A;  1BNI A;  1GSP A;  1BAN A;  1RLS A;  4GHO A;  1TRQ A;  1HYF A;  5BIR A;  1RGF A;  1B2X A;  1BNG A;  1GMR A;  1C54 A;  1RNT A;  3WHO A;  3AGN A;  1CH0 A;  1GOU A;  1BOX A;  2AAE A;  1RGC A;  1FYS A;  1AQZ A;  2RBI A;  7RNT A;  1BSD A;  1B21 A;  2F56 A;  1BSE A;  1RGH A;  3Q3F A;  1BNF A;  2KF3 A;  1LRA A;  3AHW A;  1G02 A;  1JBS A;  1I2F A;  1YGW A;  1DET A;  3BU4 A;  1PYL A;  1BNS A;  1RHL A;  1RGK A;  2AAD A;  6RNT A;  1JBT A;  1BNE A; 
#chains in the Genus database with same CATH topology
 3NBR A;  3S5C A;  4LGQ A;  3UL5 A;  2GEY A;  4KVH A;  1TU5 A;  2RNT A;  1OHS A;  3RDE A;  1UUW B;  1LOY A;  2BMR B;  4R80 A;  1WMO A;  3E99 A;  3SOY A;  3RGA A;  1KC8 4;  1MWU A;  3SX1 A;  4WFO A;  3X3Z A;  4MMY B;  3LTB A;  2KRT A;  1B3S A;  2KXG A;  3FG1 A;  5IG5 A;  1RNB A;  1JNQ A;  1FGR A;  2CWT A;  1IV9 A;  2CKF B;  5IEP A;  1ROA A;  1JB2 A;  4I4K A;  1ZGX A;  3DH2 A;  1A2P A;  2Z76 A;  4RNT A;  1NO3 A;  4HAA A;  3KSP A;  5GSP A;  1OPY A;  1UCL A;  1DYU A;  3LML A;  5BVB A;  2SAR A;  2ZDJ A;  2ML5 A;  1JKG A;  2MF7 A;  1UCI A;  3PCR A;  1JN5 B;  2JQ5 A;  1S72 3;  3PS8 A;  2YX9 A;  1RCL A;  3WR2 A;  4AKY A;  4N6T A;  2WOF A;  1UUV B;  3AMO B;  3PYJ A;  3EC9 A;  3FKA A;  3FH1 A;  5JBS A;  3KKG A;  1PFP A;  2P0M A;  4I5Q A;  1KSI A;  4BIR A;  1FA3 A;  4EC6 A;  4HZ9 B;  3LYG A;  4X2O A;  1PU4 A;  1RGL A;  1I3F A;  1RRL A;  4BU4 A;  5LC7 A;  1CEW I;  5AEU B;  1FUW A;  4HJL B;  1AY7 A;  4XDW A;  1OF5 B;  4NRE A;  1UCJ A;  3VSY A;  4MMX B;  1G0T A;  2R41 A;  1ULI B;  4Q53 A;  2WOH A;  1GY7 A;  3QRD A;  2M7O A;  2R4I A;  3FZW A;  1BRN L;  3HK4 A;  1N9J A;  1UGI A;  1FGQ A;  3KZT A;  3CCM 3;  1GMQ A;  4FCZ A;  1VQ5 3;  1X1Y A;  3CNM A;  3G8Z A;  4RNZ A;  5IG4 A;  1C7H A;  1MGR A;  1OHO A;  1RDS A;  1OGX A;  1FUT A;  1UDI I;  2CC3 A;  3BNE A;  3S29 A;  4N6M A;  3PGB A;  1K8A 4;  1G96 A;  5IER A;  2CX0 A;  1S5A A;  4FMA A;  4RBN A;  3URP A;  1RCK A;  2LYX A;  3A76 A;  3FF2 A;  1OUN A;  4WYK A;  3CD6 3;  2H0H A;  4HM7 B;  1W2Z A;  3LTD A;  1BAN A;  1K73 4;  1M1X B;  4HM3 B;  5G2G A;  4O02 B;  3AGN A;  1CH0 A;  3LXU X;  1SIH A;  1OH0 A;  3G71 3;  3CC4 3;  5M1A A;  2ZL8 A;  1QVF 2;  1BSD A;  4LSO A;  3JUQ A;  3BND A;  4H61 A;  1B21 A;  3EE1 A;  4NPB A;  1IVU A;  4BTW A;  1JZD A;  3WOE B;  3MKI A;  1IT7 A;  3F14 A;  1KWI A;  3BNC A;  1V58 A;  3HII A;  1L5G B;  2XEP A;  2CH9 A;  2W56 B;  4R9K A;  3UB1 A;  3WA2 X;  1JBS A;  1I2F A;  2W9Q A;  3HIG A;  3PCS A;  4U13 A;  5CK6 A;  1WQL B;  4KT3 B;  1Q86 4;  1YGE A;  2W9P A;  5AII A;  5DRV A;  2ML6 A;  2GBW B;  3Q2P A;  2E2U A;  5A0O B;  4FCJ A;  1RHL A;  2P38 A;  1RGK A;  3JUO A;  3OV4 A;  3CCU 3;  4EV2 A;  2Y73 A;  3K9M C;  4O3V A;  1STF I;  5IF6 A;  3I56 3;  3D3L A;  2KF4 A;  1RKY A;  1LOX A;  1SQW A;  1WNH A;  1EG9 B;  5AIH A;  1SII A;  2F98 A;  3CMA 3;  3NM7 A;  2W6J H;  1Y4K A;  1LNI A;  1YVS A;  4L7K A;  2OCT A;  2KAA A;  3K0Z A;  2CFW A;  1LNH A;  3HOH A;  2WGO A;  4HZB B;  1RGA A;  9RNT A;  1BSA A;  3CPO A;  4FMB A;  4HM6 B;  1V74 A;  4RZM A;  2F4Y A;  1BGS A;  4AKZ A;  1Q7Y 4;  3EHC A;  3FG4 A;  3CCV 3;  2IY2 A;  3LTC A;  2JDI H;  3AHS A;  2P09 A;  3DZL A;  3U97 A;  2IMJ A;  2K3D A;  4K1V A;  4EV5 A;  1QAL A;  1I0V A;  1HU9 A;  2GU1 A;  1BIR A;  1YHQ 3;  2QA4 3;  1EUI C;  3G6E 3;  2W04 A;  3G0K A;  4HM8 B;  5AYR B;  4J9A A;  4HM5 B;  2B24 B;  4R4K A;  1RJO A;  3MHE A;  3N9H A;  4ILF A;  1W4N A;  3T8N A;  2FNQ A;  3KFQ C;  3A5E A;  4OVM A;  3G16 A;  3D79 A;  3K7C A;  3LT9 A;  5CF1 A;  3RGR A;  1NWW A;  1Q9E A;  1BSC A;  4KFE A;  3EN8 A;  3CC2 3;  3GAX A;  1YJ9 3;  1FGT A;  5BXQ A;  2BT3 A;  3PXM A;  3EX9 A;  4FCM A;  1I2G A;  1K9M 4;  2ZHX B;  1VQ6 3;  3UL6 A;  1GD4 A;  2CFG A;  2FGT A;  4X2H A;  4CJN A;  2GXF A;  5JPP A;  3WOF B;  6STD A;  1AV4 A;  5ELJ A;  3MYT A;  3DGY A;  2YFL B;  4LMI A;  5FW5 A;  1BNR A;  1F8N A;  2CHC A;  1BRJ A;  2YFJ B;  1OGZ A;  2Q07 A;  3SYU A;  2LQV A;  4K61 A;  3CCL 3;  3DY5 A;  2XRX B;  1B2S A;  1RN7 A;  1TJD A;  3UNL A;  1TUH A;  3Q1C A;  3SOA A;  6GSP A;  2OOV A;  1N8R 4;  3MPH A;  3OX9 A;  2Z7A A;  4LZI A;  2RGQ A;  1GOV A;  2QGU A;  2KF6 A;  3U1W A;  2CK3 H;  3BB9 A;  8CHO A;  1YI2 3;  3GSP A;  3MG3 A;  2E2T A;  4K1U A;  3IMA B;  5KP3 A;  1LQM B;  2GEX A;  1IVV A;  4KFD A;  1UW1 A;  2UUG C;  3EBT A;  1ZX2 A;  4BTX A;  3H51 A;  1W5Z A;  1FZU A;  4HOH A;  1TFO A;  4MMZ B;  5RNT A;  2BHM A;  1LQG C;  3SXX A;  3NV0 A;  2HMM B;  4GHO A;  1GOY A;  1RLS A;  2INX A;  2I9W A;  1BNG A;  3NUV A;  1GMR A;  1NB3 I;  1D6U A;  4XM4 A;  5AYS C;  5CXO A;  5DRE A;  3OW2 2;  1MWT A;  4AEQ A;  1MOL A;  2UX0 A;  2WO0 A;  3F7S A;  3VGN A;  3PZW A;  3VF1 A;  1A2V A;  4ZM8 A;  2XF3 A;  3CCR 3;  4XB5 A;  2XFS A;  1IV7 A;  3OWY A;  1ISK A;  3MWZ A;  3LT8 A;  1V57 A;  4TX4 A;  1AQZ A;  7RNT A;  1VQ4 3;  1BSE A;  3V99 A;  2OOV C;  3KE7 A;  1W6Y A;  1A67 A;  3Q90 A;  1OAC A;  1BNF A;  1HKX A;  4HM4 B;  1VQN 3;  1G02 A;  2WGQ A;  5EEO A;  3MG2 A;  1DET A;  3F8X A;  4O2H A;  1IK3 A;  5D83 A;  5HGR A;  1QAK A;  1PYL A;  2C10 A;  1DMM A;  1IQY A;  1KQS 2;  1O7G B;  1VZZ A;  2AAD A;  2P05 A;  3CNX A;  4HVN A;  5LC6 A;  6RNT A;  3CC7 3;  1N5H A;  2F5W A;  3LTA A;  4L8P A;  2CW9 A;  3ALA A;  3FG3 A;  3NBB A;  1VQ9 3;  1B2Z A;  3D5G A;  4NHF A;  3FF0 A;  4RNY A;  3S27 A;  1LOV A;  3ZFZ A;  1BVI A;  1D6Z A;  1Z1S A;  2XSO B;  1W6C A;  1FW7 A;  1RMS A;  2W2C A;  4HYZ A;  5G1K A;  3ROB A;  2CFD A;  3DMC A;  3CCQ 3;  3NQY A;  4OK0 A;  4WYK B;  1M90 4;  1N5P A;  5IG3 A;  4JRF A;  5FGO A;  1W2B 2;  1A2K A;  1JV2 B;  1CYV A;  1O7N B;  1O7P B;  3LOY A;  3FLJ A;  4ORL A;  5AEW B;  4FR9 A;  2K54 A;  5CF2 A;  2XGL A;  1BNJ A;  4K90 B;  1BUJ A;  5EQL A;  1GY5 A;  2IA7 A;  3EBY A;  2HMO B;  1I3I A;  1TP6 A;  3SLU A;  1EEJ A;  8RNT A;  2W03 A;  1UGH I;  2CX1 A;  4N3V A;  3DUK A;  1AVK A;  1C54 A;  1Q40 B;  4EW5 A;  1FGM A;  1N9E A;  4N6O B;  3D5I A;  1I2E A;  3WDG B;  3STD A;  1IYY A;  4FMC A;  5IEN A;  1SAR A;  3JUM A;  1BRS A;  2OQE A;  2IYJ A;  1PY3 A;  5IG0 A;  4XDV A;  1IU7 A;  1VQK 3;  1BRI A;  1JB5 A;  3D9R A;  3EQQ B;  2CG1 A;  3G4S 3;  1QVG 2;  4GL6 A;  1IVX A;  1LXE A;  1TFK A;  2F86 B;  1JB4 A;  3HI7 A;  1O7H B;  1I8V A;  1O7W B;  2BMQ B;  1JBR A;  2HMK B;  2HMN B;  1MWS A;  4CDL A;  1FGO A;  1TRP A;  2ZA4 A;  3EF8 A;  3JUP A;  1YVB I;  2J8X B;  1T5Y A;  4XBY A;  2BU4 A;  3DGM A;  4EXR A;  3I55 3;  1I0X A;  1EQK A;  3O8Y A;  3X3X A;  2XH9 A;  2STD A;  1QMA A;  2BIR A;  2CIU A;  1IVW A;  1W02 A;  3DGN A;  3EJV A;  2YFI B;  3ER7 A;  4PEJ A;  2C11 A;  2W0Q A;  3NBJ A;  2Z6B A;  2D42 A;  2KF5 A;  3MG1 A;  5AIF A;  1JZO A;  2OTJ 3;  1EA2 A;  2IUJ A;  1VQP 3;  3F7X A;  1MGW A;  4CCV A;  3T8U A;  4J5G A;  3WA3 A;  3V92 A;  1YJN 3;  3DM8 A;  1BSB A;  3UJM A;  3H3H A;  4MEI A;  1HZ1 A;  2OQE C;  3WMD A;  1RSN A;  3L0R A;  2UGI A;  2FXT A;  1RN4 A;  2V1L A;  1BNI A;  1GSP A;  1W01 A;  3NX0 A;  4WP5 A;  1TRQ A;  1HYF A;  1E3V A;  1RGF A;  3OWS A;  1Q42 A;  4XBT A;  1UI7 A;  1JN5 A;  3B4P A;  2QEX 3;  2KCD A;  1RNT A;  3FSD A;  4R1K A;  5AI1 A;  2HML B;  1NB5 I;  1BOX A;  5JPU A;  3B8L A;  3AMO A;  1T3B A;  2AAE A;  3B4O A;  4KZ1 A;  1RGC A;  4N6L A;  4BL2 A;  1GS3 A;  1FYS A;  1IQ8 A;  2RBI A;  2RCD A;  3CME 3;  1ROV A;  2F56 A;  1RGH A;  3EB8 A;  5EVH A;  3Q3F A;  1OCV A;  3BLZ A;  2CFK A;  1O7M B;  1LRA A;  3AHW A;  4IIA A;  2CG0 A;  2IUK A;  1DMQ A;  1M9G A;  2L4V A;  3KN4 A;  5I97 A;  1D6Y A;  3BU4 A;  1OF5 A;  1UI8 A;  1E97 A;  3SED A;  3KII A;  2D1W A;  5D82 A;  1BNE A;  4BTY A;  1JKG B;  3ZG0 A;  1IQX A;  1QAF A;  1RGG A;  3V98 A;  3M8C A;  1WTH A;  4FMD A;  1BRH A;  1ZO2 A;  1VQ7 3;  3BIR A;  4EYC A;  3OXA A;  3KCH A;  4J8T A;  4BL3 A;  1VQL 3;  4HBR A;  3CCJ 3;  1W7C A;  1RRH A;  4N6V 0;  2Z77 A;  3FCS B;  2XR8 B;  1W00 A;  3MSO A;  1SPU A;  2B1X B;  2CWV A;  1UCK A;  3GZY B;  4WWU C;  1B2U A;  1BRG A;  3NHX A;  4KFF A;  3S28 A;  1LOW A;  3CCS 3;  2BO9 B;  3LH4 A;  2C4B A;  2H0G A;  1WMN A;  3GZB A;  4GSP A;  1I70 A;  1GMP A;  4DKI A;  1BUQ A;  5KP1 A;  3GRD A;  1GYB A;  1US1 A;  1Q81 4;  3NV0 B;  4WHA A;  3QK9 A;  3HX8 A;  1X1X A;  4GB5 A;  3K5T A;  3F9S A;  1NU3 A;  4MJD A;  3RNT A;  1NJI 4;  2GBX B;  1CYU A;  3GZX B;  1X1W A;  1K41 A;  1TIJ A;  1B27 A;  1ZS7 A;  4LYL B;  4OUQ A;  1GD3 A;  4N6N B;  1CQS A;  2HOH A;  3X41 A;  1RGE A;  2MC8 A;  1N8Q A;  4HM2 B;  1VQQ A;  3JVC A;  3D4A A;  1BAO A;  4HM0 B;  4LEH A;  3X42 A;  4QWT A;  3CXC 2;  1WMP A;  4CPK A;  1NNV A;  3CU3 A;  1T2I A;  1YIJ 3;  1TTO A;  1MWR A;  2A15 A;  2H0I A;  1R4Y A;  2GSP A;  3X40 A;  3K63 A;  3BNB A;  3AGO A;  1YIT 3;  3B7C A;  4JF8 A;  2BNG A;  1NDO B;  2Y74 A;  1JRQ A;  2BMO B;  1X1U A;  1OHP A;  2W56 A;  2XSH B;  3IJE B;  4STD A;  1U5O A;  3GZR A;  1IDP A;  3N54 B;  7GSP A;  3F8H A;  1UUG B;  5IW9 A;  5M18 A;  2GU3 A;  1RN1 A;  4O8S A;  2OWP A;  1DE3 A;  1DVD A;  5ELU A;  1W6G A;  2F5M A;  3NQZ A;  1B20 A;  4IT7 A;  2F99 A;  1U8C B;  1R4C A;  3CPW 2;  3GWR A;  1Q7H A;  1FUS A;  2CWU A;  3EN1 B;  4EBG A;  5M19 A;  3N8B A;  4N6U A;  3J7Y d;  2P0X A;  3TDG A;  1BRK A;  1YNV X;  1Q40 A;  1BU4 A;  5G1L A;  1LVN A;  1B2M A;  5HOH A;  2PZV A;  3ECF A;  2RSX A;  4HKV B;  4J5K A;  2K0M A;  1ASK A;  4G1M B;  1KD1 4;  1VQ8 3;  5IEO A;  2OTL 3;  1YJW 3;  2E2V A;  2L1S A;  4XBX A;  4L8O A;  4H3U A;  5STD A;  1RTU A;  3FGY A;  5AIG A;  3SVA A;  1EKM A;  2SBL A;  3DXO A;  1SJW A;  1IT8 A;  3LZA A;  5BU4 A;  1MNL A;  1VQO 3;  1T2H A;  5D81 A;  1Q82 4;  5BIR A;  1JJ2 2;  1B2X A;  3NM2 A;  3S67 A;  5KP4 A;  1GY6 A;  1A90 A;  3WHO A;  3I0Y A;  1DVC A;  1ULJ B;  3F40 A;  1GOU A;  2RFR A;  1E3R A;  4HM1 B;  3WOD G;  2CFL A;  2O3O A;  1QJG A;  2QIY A;  3JUN A;  1DMN A;  3NXJ A;  1AVL A;  3X3Y A;  1AR0 A;  3HZP A;  2KF3 A;  3CCE 3;  3ZG5 A;  1VQM 3;  1M1K 4;  1J2B A;  1YGW A;  2XFT A;  1K28 A;  3IPT A;  4IPB A;  3DGO A;  1STD A;  2XGN A;  1BNS A;  5TGN A;  5CLK A;  3KSE D;  4R9L A;  3T0U A;  2HMJ B;  3OWU A;  1JBT A;  2O9U X;  2PNC A;  7STD A;  3DGL A; 
#chains in the Genus database with same CATH homology
 1RGG A;  2F5W A;  1BRH A;  3BIR A;  3KCH A;  2KF4 A;  2RNT A;  1B2Z A;  3D5G A;  1LNI A;  1LOY A;  1YVS A;  2KAA A;  1LOV A;  3HOH A;  1BVI A;  1RGA A;  9RNT A;  1BSA A;  1UCK A;  1B3S A;  1FW7 A;  1RMS A;  1RNB A;  1B2U A;  1BGS A;  1BRG A;  2F4Y A;  1LOW A;  2C4B A;  4GSP A;  1ZGX A;  3AHS A;  3DH2 A;  1I70 A;  1GMP A;  1A2P A;  4RNT A;  5GSP A;  4HAA A;  1I0V A;  1UCL A;  1BIR A;  1BNJ A;  2SAR A;  1X1X A;  1BUJ A;  1UCI A;  3RNT A;  1RCL A;  1X1W A;  3WR2 A;  1I3I A;  1B27 A;  3A5E A;  8RNT A;  2HOH A;  1RGE A;  3D4A A;  1BAO A;  1Q9E A;  1BSC A;  3D5I A;  4BIR A;  1I2E A;  1T2I A;  1IYY A;  1TTO A;  1R4Y A;  2GSP A;  1RGL A;  1I3F A;  1SAR A;  1BRS A;  1I2G A;  3AGO A;  4BU4 A;  1PY3 A;  1AY7 A;  1BRI A;  1X1U A;  1UCJ A;  3DGY A;  7GSP A;  1BNR A;  1RN1 A;  1I8V A;  1JBR A;  1DE3 A;  1BRJ A;  1BRN L;  2F5M A;  3SYU A;  1B20 A;  1TRP A;  2ZA4 A;  1B2S A;  1GMQ A;  6GSP A;  1FUS A;  2BU4 A;  1X1Y A;  1I0X A;  1BRK A;  1YNV X;  1GOV A;  1BU4 A;  1MGR A;  1RDS A;  1FUT A;  2BIR A;  2KF6 A;  5HOH A;  1B2M A;  4J5K A;  3GSP A;  2KF5 A;  3URP A;  1RCK A;  1MGW A;  1RTU A;  1FZU A;  4J5G A;  4HOH A;  5BU4 A;  1BSB A;  5RNT A;  1T2H A;  1HZ1 A;  1RSN A;  1RN4 A;  1GOY A;  1BNI A;  1GSP A;  1BAN A;  1RLS A;  4GHO A;  1TRQ A;  1HYF A;  5BIR A;  1RGF A;  1B2X A;  1BNG A;  1GMR A;  1C54 A;  1RNT A;  3WHO A;  3AGN A;  1CH0 A;  1GOU A;  1BOX A;  2AAE A;  1RGC A;  1FYS A;  1AQZ A;  2RBI A;  7RNT A;  1BSD A;  1B21 A;  2F56 A;  1BSE A;  1RGH A;  3Q3F A;  1BNF A;  2KF3 A;  1LRA A;  3AHW A;  1G02 A;  1JBS A;  1I2F A;  1YGW A;  1DET A;  3BU4 A;  1PYL A;  1BNS A;  1RHL A;  1RGK A;  2AAD A;  6RNT A;  1JBT A;  1BNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...