1X1WA

Water-mediate interaction at aprotein-protein interface
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords Ribonuclease
publication title Water-mediated interaction at a protein-protein interface
pubmed rcsb
source organism Bacillus amyloliquefaciens
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1x1wA00
1FYSA 4HAAA 3HOHA 1BRNL 1B27A 1BSDA 5HOHA 1I2FA 1CH0A 1JBRA 1BAOA 1BNIA 1YVSA 1LNIA 1TRPA 1B2UA 3DGYA 3Q3FA 1MGWA 1RGKA 1JBTA 4HOHA 2C4BA 1FW7A 1I3FA 1B3SA 2BIRA 1GMPA 7RNTA 1B2XA 4GHOA 1BSCA 1BOXA 1RMSA 3GSPA 2GSPA 1B2ZA 2F5WA 1MGRA 3D5GA 1RGLA 1G02A 1RTUA 1FZUA 1GMQA 2AADA 6RNTA 1PY3A 2F4YA 1I2GA 2KAAA 5BIRA 1B20A 1UCKA 2F5MA 1RNBA 1AY7A 1BRIA 1RLSA 1HYFA 1T2HA 1BSEA 1B2MA 1I70A 1A2PA 3D5IA 1T2IA 2KF6A 1RHLA 1UCJA 1BRSA 4J5GA 1BNFA 1LOWA 1BUJA 1BRGA 1GSPA 3URPA 2SARA 1BRKA 2ZA4A 3SYUA 3WHOA 1BGSA 1FUSA 3AGNA 7GSPA 1GOYA 1RCKA 2RBIA 1RGCA 1I3IA 1X1WA 1BNSA 1BNJA 1BNEA 1LOVA 4BIRA 4J5KA 1B21A 1GMRA 1IYYA 3BU4A 3KCHA 1BRJA 3RNTA 3WR2A 2F56A 1RSNA 1JBSA 4RNTA 1BSBA 2RNTA 1RN4A 2KF5A 2KF4A 1RCLA 3D4AA 2AAEA 9RNTA 1FUTA 1YGWA 8RNTA 1X1UA 1RGEA 1RNTA 3AHWA 1SARA 1I2EA 5BU4A 3BIRA 1BU4A 1I0XA 1X1YA 3A5EA 1RN1A 1RDSA 1R4YA 3DH2A 1TTOA 1RGAA 1BVIA 1BIRA 1LOYA 5RNTA 1HZ1A 1RGHA 1ZGXA 1AQZA 1RGGA 1DE3A 1I8VA 1YNVX 1Q9EA 2KF3A 1LRAA 1DETA 1BRHA 1UCIA 4GSPA 1B2SA 1BANA 1UCLA 1PYLA 1C54A 3AHSA 2HOHA 1RGFA 1I0VA 1GOUA 5GSPA 1BNRA 3AGOA 1BSAA 1X1XA 4BU4A 1GOVA 1BNGA 6GSPA 2BU4A 1TRQA
chains in the Genus database with same CATH superfamily
4HAAA 3VF1A 3PXMA 2CIUA 3MG1A 1B27A 4J8TA 2KRTA 3T8NA 2PNCA 1MNLA 2ZDJA 3FLJA 1JBTA 4HM4B 2QIYA 3EB8A 2QEX3 1B3SA 2YX9A 1N9JA 5AI1A 4GHOA 2HMKB 1BSCA 4XDVA 1D6UA 3CPOA 1GY5A 1RMSA 4N6TA 2PZVA 2F5WA 3CCQ3 5IF6A 1NWWA 3FF0A 1G02A 3NV0A 4BL2A 4EV5A 4HM7B 3HIGA 1WMOA 3K9MC 1ZO2A 2C11A 1WNHA 2CW9A 5AYSC 2OWPA 1VQL3 1NNVA 2R41A 5CLKA 2ML6A 4XM4A 5M1AA 1OHSA 1AY7A 5KP4A 1RLSA 1FGTA 1E97A 3A76A 4WYKB 1B2MA 3MG3A 1E3VA 1I70A 4N6UA 2CWUA 3BNCA 1A2PA 3D5IA 1UUGB 2KF6A 1Q7Y4 3V99A 2XF3A 2ZL8A 1NU3A 4J5GA 3X3YA 1BNFA 4CPKA 3DMCA 1V57A 3GZRA 4RBNA 1PU4A 1RRHA 4HM6B 3MPHA 4FMAA 5AIHA 2SARA 3KIIA 4BTWA 2V1LA 1IDPA 1OPYA 4XB5A 2I9WA 1FA3A 1O7PB 2CKFB 2OTL3 1GOYA 2D1WA 2K3DA 1GYBA 1WMPA 5STDA 2MC8A 1W01A 1EEJA 1W7CA 4RNZA 1M1XB 5IG5A 2ZHXB 2E2UA 1QAKA 1X1WA 2KXGA 3MSOA 1NB5I 2B1XB 1JN5B 3KN4A 3HX8A 5M19A 1BNEA 1OGXA 1W2B2 4WWUC 1JKGB 1RRLA 4HKVB 3LYGA 3FF2A 2CFWA 2FXTA 1UUWB 3EQQB 2OQEC 4FMCA 3G4S3 4O3VA 3CCE3 1AVKA 1K28A 3BU4A 4MMYB 3KCHA 3LT8A 1QAFA 4L7KA 5IG3A 3OWYA 3F7XA 2R4IA 1JB2A 1JN5A 4KFEA 3CC23 1RCLA 4L8OA 2AAEA 4WHAA 3CCJ3 1MWTA 1VQ93 3CU3A 1RNTA 1W5ZA 2K54A 1I0XA 1X1YA 1JJ22 1CYVA 1IVXA 3LTDA 2K0MA 3G713 1JRQA 3G8ZA 1BIRA 3X40A 3EJVA 4Q53A 3JUOA 3MYTA 5G1KA 5JPPA 1DE3A 4HM3B 1AR0A 4LEHA 1I8VA 3SVAA 1EQKA 4MMXB 1M1K4 2OQEA 1SJWA 3CXC2 2GBXB 3J7Yd 3WOEB 3E99A 3HIIA 3PCSA 4XDWA 1PYLA 3AHSA 4O02B 4RNYA 1EKMA 3UNLA 4FMDA 3KSPA 1VQP3 3Q90A 3NXJA 2BMQB 3N9HA 3HOHA 4BL3A 1N8QA 1NDOB 1CH0A 4N3VA 1K41A 1BNIA 1DMMA 1IV9A 4K1VA 1B2UA 3DGYA 4NHFA 3Q3FA 1MGWA 1RGKA 4N6LA 4XBYA 5ELJA 1GY6A 2GXFA 3OW22 1GMPA 1N9EA 1MWSA 3K7CA 1W6CA 1STDA 3KE7A 1B2ZA 3DZLA 4KFFA 1AV4A 1NO3A 1IV7A 5IEPA 3O8YA 3JUQA 3D5GA 2RSXA 4FCJA 1RTUA 3EHCA 2AADA 6RNTA 1T3BA 3SX1A 1GD4A 1I2GA 2KAAA 5BIRA 1KD14 3L0RA 2JQ5A 4KT3B 4CDLA 3ALAA 1L5GB 4K1UA 1IK3A 2STDA 3NBJA 1OHOA 2GBWB 3BNDA 1RNBA 4R9KA 1YI23 4I5QA 2CG0A 3DY5A 1T5YA 1VQO3 4XBTA 1ZX2A 1G0TA 1Q824 1DMNA 3H51A 3UB1A 3FG4A 3G16A 1UCJA 3NV0B 1VQQA 3IJEB 2Z7AA 4HJLB 3RGRA 3WMDA 2RCDA 5IW9A 2ML5A 1LNHA 2JDIH 3ECFA 1MOLA 4R9LA 1FUSA 3MWZA 7GSPA 1EG9B 4WP5A 4N6NB 2GEYA 3KKGA 2RBIA 1CYUA 1UGIA 1VQK3 2UUGC 4HM8B 4ORLA 1BNSA 2KCDA 3H3HA 1LOVA 3CCR3 5EVHA 3G6E3 1B21A 1UDII 1A67A 2Y74A 2IYJA 4JF8A 1QALA 1LQGC 3X42A 2QGUA 3LZAA 2L4VA 3STDA 1N8R4 3B7CA 1JZDA 5KP3A 3BNEA 1JBSA 1JV2B 5BVBA 1E3RA 1RN4A 2CK3H 2C10A 2KF4A 1FUTA 2YFIB 3CCU3 3V92A 1VZZA 3AMOA 1W00A 1IVUA 1FGOA 3GAXA 4FR9A 4WFOA 3VSYA 3WA2X 1A2VA 1SIIA 1WMNA 3AHWA 2BHMA 4LYLB 4MEIA 3I0YA 4CJNA 2WO0A 3BIRA 5BU4A 1YJW3 4TX4A 1BU4A 8CHOA 1TJDA 3CNMA 4HBRA 1WTHA 4K90B 2L1SA 2P38A 1TU5A 4J9AA 1RN1A 2W2CA 1JB4A 1R4YA 3B4OA 1FGMA 4STDA 4H3UA 3CMA3 1BVIA 4EW5A 4FCZA 3OX9A 1LOYA 5AYRB 5RNTA 2BMRB 3DGMA 3F8HA 1ZGXA 3OV4A 4IT7A 5JPUA 2SBLA 1C7HA 2P0XA 1RGGA 5G2GA 3KFQC 2F98A 1IQYA 1Q9EA 2OTJ3 3NBBA 1Q40B 2Z6BA 5IERA 4GSPA 1B2SA 1ULJB 3CCS3 4N6MA 1STFI 1ROVA 1DYUA 3D3LA 3IMAB 1C54A 5CXOA 4NPBA 1SIHA 2M7OA 3JVCA 2WOHA 3MHEA 1N5HA 1OACA 1I0VA 1RGFA 1GOUA 5GSPA 4OK0A 1Q814 1Q40A 3I563 1BNRA 1EUIC 1BSAA 1JZOA 1X1XA 2FGTA 1OH0A 1Q864 3NHXA 4U13A 2W56A 4LGQA 2BU4A 4JRFA 3GWRA 1BRNL 5KP1A 1YJN3 4G1MB 1BSDA 1PFPA 2INXA 1I2FA 2XEPA 3F9SA 3HI7A 1CEWI 1BAOA 1YJ93 1JBRA 1YVSA 1QVF2 4ILFA 3EF8A 5D81A 5JBSA 2XFSA 5DRVA 4HOHA 1MWUA 2IUJA 3CME3 4QWTA 1VQ53 3EN8A 3WA3A 1ASKA 1BOXA 3V98A 3EBYA 3HK4A 2GSPA 3B8LA 3OWUA 1LXEA 1R4CA 2XRXB 3X41A 1GMQA 1AVLA 1VQN3 1IVWA 1PY3A 2W04A 5LC6A 3T8UA 2F4YA 3LTBA 3UJMA 2H0IA 4IIAA 4O8SA 3BB9A 2BO9B 3PZWA 1J2BA 4MMZB 1UCKA 1W02A 3LTCA 1WQLB 5CF1A 1JNQA 1BRIA 1S5AA 3BNBA 3QRDA 3CNXA 4HM1B 4CCVA 3FSDA 3EBTA 1YIJ3 2XH9A 5LC7A 1UUVB 3NUVA 2WOFA 4FCMA 4OVMA 3GZBA 3DGOA 5G1LA 1HKXA 3FKAA 1V74A 5AEUB 3LMLA 1BRSA 2XFTA 1QMAA 3LOYA 1BUJA 2CWVA 3X3XA 1GSPA 4X2OA 1IT7A 4EYCA 1BRKA 1TIJA 4H61A 5TGNA 2W6JH 2ZA4A 3SYUA 4K61A 3ROBA 1BGSA 3AGNA 1VQ63 2BMOB 5HGRA 1RCKA 5IEOA 2Y73A 1OUNA 2CFDA 1KQS2 3EE1A 4EBGA 3RDEA 3DM8A 3CCL3 2F86B 3PS8A 5AIFA 2XSOB 4BTYA 3DUKA 3K5TA 3S28A 3FZWA 3ZG5A 1BNJA 4LZIA 5BXQA 3CCV3 3FG3A 5CF2A 4BIRA 1YHQ3 1KSIA 1K8A4 2Z76A 4I4KA 2J8XB 1IYYA 3NM7A 1GS3A 2HMLB 2XSHB 4R1KA 4HM0B 1Z1SA 1BRJA 2IUKA 3RNTA 2HMMB 1TUHA 4XBXA 1NJI4 1SQWA 3NX0A 1JB5A 3WR2A 4HM2B 4RNTA 4HZBB 1BSBA 1RJOA 2RNTA 4KVHA 1VQM3 1ZS7A 9RNTA 3DGNA 4O2HA 2OOVA 2YFJB 3LXUX 4AEQA 1X1UA 2E2VA 1O7NB 1SARA 1I2EA 3Q2PA 1US1A 3SEDA 3I553 5FGOA 1NB3I 2O3OA 2RGQA 4KZ1A 4LMIA 3CD63 1RDSA 2HMOB 4LSOA 1TTOA 4N6V0 1RGAA 2H0GA 1FGQA 1LOXA 3NQZA 3Q1CA 4AKZA 4ZM8A 3ZG0A 2W9PA 1G96A 3BLZA 3EX9A 3D9RA 1HZ1A 3T0UA 3PYJA 1AQZA 2D42A 4DKIA 3AMOB 3GRDA 1Q42A 1W6YA 1M9GA 2KF3A 1FUWA 2CX1A 1DETA 3IPTA 5ELUA 1UCIA 3F7SA 1RKYA 1TFKA 1BANA 3NQYA 4R80A 3WDGB 3HZPA 1D6ZA 4BTXA 5I97A 3N8BA 1K734 5IG0A 2HOHA 3FG1A 1GD3A 2WGOA 3RGAA 1BNGA 1QVG2 2H0HA 2GEXA 2OCTA 3F40A 4HM5B 6GSPA 1VQ43 1YNVX 1FYSA 1TRQA 2Q07A 1TFOA 2CWTA 1UI8A 1UW1A 3GZYB 3PCRA 4N6OB 5AIIA 4EC6A 3FCSB 4FMBA 5HOHA 1OF5B 3SOYA 1LNIA 1TRPA 3EN1B 2UX0A 1EA2A 1S723 1FGRA 1O7HB 2GU3A 2C4BA 6STDA 1I3FA 1IQXA 2BIRA 2IA7A 4IPBA 3DXOA 3TDGA 7RNTA 1FW7A 1B2XA 5A0OB 4WYKA 3FGYA 2E2TA 1OF5A 2WGQA 2W56B 3GSPA 1OGZA 2P05A 3K0ZA 4L8PA 1MGRA 1RGLA 4GL6A 3U1WA 1FZUA 1W4NA 1ULIB 2IMJA 2O9UX 3B4PA 1DVDA 2F99A 1Q7HA 3MKIA 3JUNA 4HVNA 1U8CB 1B20A 1LVNA 4EV2A 2CH9A 1KC84 2GU1A 3N54B 3WOFB 1YVBI 1UGHI 2QA43 2F5MA 2Z77A 3S67A 1ISKA 3KSED 1ROAA 1HYFA 1T2HA 2CFKA 1BSEA 2CFLA 3D79A 5M18A 1OCVA 1RN7A 1T2IA 2XGLA 1RHLA 2YFLB 3DGLA 1UI7A 4GB5A 3S29A 1LQMB 2CFGA 4OUQA 5IG4A 3K63A 1K9M4 1LOWA 1JKGA 1HU9A 3GZXB 1BRGA 3PGBA 7STDA 4HZ9B 1M904 3URPA 1N5PA 2BT3A 3X3ZA 2B24B 2IY2A 3WHOA 1Y4KA 1A90A 3S27A 1IT8A 3EC9A 3ER7A 1V58A 4HYZA 3CCM3 2FNQA 3CC43 1GY7A 1RGCA 2BNGA 3CC73 1I3IA 2UGIA 2A15A 1D6YA 1O7GB 2LYXA 1SPUA 5EQLA 2CC3A 4NREA 3F8XA 4J5KA 5IENA 1MWRA 1GMRA 1OHPA 3FH1A 1YIT3 2HMNB 3UL5A 3SXXA 2HMJB 3JUMA 3S5CA 2F56A 1RSNA 4EXRA 1IQ8A 2OOVC 2KF5A 2W0QA 3KZTA 3D4AA 5AIGA 2CX0A 1YGWA 3CPW2 8RNTA 1KWIA 1W6GA 1RGEA 3LT9A 1DMQA 2RFRA 3ZFZA 3SLUA 5AEWB 3OWSA 3A5EA 2P09A 2CG1A 3NM2A 3DH2A 2W9QA 5EEOA 2CHCA 1IU7A 5D82A 1TP6A 3OXAA 1A2KA 1IVVA 1RGHA 4MJDA 1QJGA 3MG2A 3JUPA 1VQ83 1F8NA 3LH4A 1LRAA 3LTAA 5CK6A 1BRHA 3QK9A 2LQVA 2MF7A 4X2HA 1UCLA 4RZMA 3WODG 1VQ73 3M8CA 2XR8B 5FW5A 2XGNA 4PEJA 4AKYA 1BUQA 2W03A 1DVCA 4R4KA 3G0KA 1O7WB 1U5OA 3NBRA 3AGOA 3F14A 5DREA 3U97A 2P0MA 1YGEA 1GOVA 3SOAA 5D83A 3UL6A 4BU4A 4KFDA 1CQSA 1O7MB 1W2ZA 3VGNA
chains in the Genus database with same CATH topology
1FYSA 4HAAA 3HOHA 1BRNL 1B27A 1BSDA 5HOHA 1I2FA 1CH0A 1JBRA 1BAOA 1BNIA 1YVSA 1LNIA 1TRPA 1B2UA 3DGYA 3Q3FA 1MGWA 1RGKA 1JBTA 4HOHA 2C4BA 1FW7A 1I3FA 1B3SA 2BIRA 1GMPA 7RNTA 1B2XA 4GHOA 1BSCA 1BOXA 1RMSA 3GSPA 2GSPA 1B2ZA 2F5WA 1MGRA 3D5GA 1RGLA 1G02A 1RTUA 1FZUA 1GMQA 2AADA 6RNTA 1PY3A 2F4YA 1I2GA 2KAAA 5BIRA 1B20A 1UCKA 2F5MA 1RNBA 1AY7A 1BRIA 1RLSA 1HYFA 1T2HA 1BSEA 1B2MA 1I70A 1A2PA 3D5IA 1T2IA 2KF6A 1RHLA 1UCJA 1BRSA 4J5GA 1BNFA 1LOWA 1BUJA 1BRGA 1GSPA 3URPA 2SARA 1BRKA 2ZA4A 3SYUA 3WHOA 1BGSA 1FUSA 3AGNA 7GSPA 1GOYA 1RCKA 2RBIA 1RGCA 1I3IA 1X1WA 1BNSA 1BNJA 1BNEA 1LOVA 4BIRA 4J5KA 1B21A 1GMRA 1IYYA 3BU4A 3KCHA 1BRJA 3RNTA 3WR2A 2F56A 1RSNA 1JBSA 4RNTA 1BSBA 2RNTA 1RN4A 2KF5A 2KF4A 1RCLA 3D4AA 2AAEA 9RNTA 1FUTA 1YGWA 8RNTA 1X1UA 1RGEA 1RNTA 3AHWA 1SARA 1I2EA 5BU4A 3BIRA 1BU4A 1I0XA 1X1YA 3A5EA 1RN1A 1RDSA 1R4YA 3DH2A 1TTOA 1RGAA 1BVIA 1BIRA 1LOYA 5RNTA 1HZ1A 1RGHA 1ZGXA 1AQZA 1RGGA 1DE3A 1I8VA 1YNVX 1Q9EA 2KF3A 1LRAA 1DETA 1BRHA 1UCIA 4GSPA 1B2SA 1BANA 1UCLA 1PYLA 1C54A 3AHSA 2HOHA 1RGFA 1I0VA 1GOUA 5GSPA 1BNRA 3AGOA 1BSAA 1X1XA 4BU4A 1GOVA 1BNGA 6GSPA 2BU4A 1TRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYS A;  4HAA A;  3HOH A;  1BRN L;  1B27 A;  1BSD A;  5HOH A;  1I2F A;  1CH0 A;  1JBR A;  1BAO A;  1BNI A;  1YVS A;  1LNI A;  1TRP A;  1B2U A;  3DGY A;  3Q3F A;  1MGW A;  1RGK A;  1JBT A;  4HOH A;  2C4B A;  1FW7 A;  1I3F A;  1B3S A;  2BIR A;  1GMP A;  7RNT A;  1B2X A;  4GHO A;  1BSC A;  1BOX A;  1RMS A;  3GSP A;  2GSP A;  1B2Z A;  2F5W A;  1MGR A;  3D5G A;  1RGL A;  1G02 A;  1RTU A;  1FZU A;  1GMQ A;  2AAD A;  6RNT A;  1PY3 A;  2F4Y A;  1I2G A;  2KAA A;  5BIR A;  1B20 A;  1UCK A;  2F5M A;  1RNB A;  1AY7 A;  1BRI A;  1RLS A;  1HYF A;  1T2H A;  1BSE A;  1B2M A;  1I70 A;  1A2P A;  3D5I A;  1T2I A;  2KF6 A;  1RHL A;  1UCJ A;  1BRS A;  4J5G A;  1BNF A;  1LOW A;  1BUJ A;  1BRG A;  1GSP A;  3URP A;  2SAR A;  1BRK A;  2ZA4 A;  3SYU A;  3WHO A;  1BGS A;  1FUS A;  3AGN A;  7GSP A;  1GOY A;  1RCK A;  2RBI A;  1RGC A;  1I3I A;  1X1W A;  1BNS A;  1BNJ A;  1BNE A;  1LOV A;  4BIR A;  4J5K A;  1B21 A;  1GMR A;  1IYY A;  3BU4 A;  3KCH A;  1BRJ A;  3RNT A;  3WR2 A;  2F56 A;  1RSN A;  1JBS A;  4RNT A;  1BSB A;  2RNT A;  1RN4 A;  2KF5 A;  2KF4 A;  1RCL A;  3D4A A;  2AAE A;  9RNT A;  1FUT A;  1YGW A;  8RNT A;  1X1U A;  1RGE A;  1RNT A;  3AHW A;  1SAR A;  1I2E A;  5BU4 A;  3BIR A;  1BU4 A;  1I0X A;  1X1Y A;  3A5E A;  1RN1 A;  1RDS A;  1R4Y A;  3DH2 A;  1TTO A;  1RGA A;  1BVI A;  1BIR A;  1LOY A;  5RNT A;  1HZ1 A;  1RGH A;  1ZGX A;  1AQZ A;  1RGG A;  1DE3 A;  1I8V A;  1YNV X;  1Q9E A;  2KF3 A;  1LRA A;  1DET A;  1BRH A;  1UCI A;  4GSP A;  1B2S A;  1BAN A;  1UCL A;  1PYL A;  1C54 A;  3AHS A;  2HOH A;  1RGF A;  1I0V A;  1GOU A;  5GSP A;  1BNR A;  3AGO A;  1BSA A;  1X1X A;  4BU4 A;  1GOV A;  1BNG A;  6GSP A;  2BU4 A;  1TRQ A; 
#chains in the Genus database with same CATH topology
 4HAA A;  3VF1 A;  3PXM A;  2CIU A;  3MG1 A;  1B27 A;  4J8T A;  2KRT A;  3T8N A;  2PNC A;  1MNL A;  2ZDJ A;  3FLJ A;  1JBT A;  4HM4 B;  2QIY A;  3EB8 A;  2QEX 3;  1B3S A;  2YX9 A;  1N9J A;  5AI1 A;  4GHO A;  2HMK B;  1BSC A;  4XDV A;  1D6U A;  3CPO A;  1GY5 A;  1RMS A;  4N6T A;  2PZV A;  2F5W A;  3CCQ 3;  5IF6 A;  1NWW A;  3FF0 A;  1G02 A;  3NV0 A;  4BL2 A;  4EV5 A;  4HM7 B;  3HIG A;  1WMO A;  3K9M C;  1ZO2 A;  2C11 A;  1WNH A;  2CW9 A;  5AYS C;  2OWP A;  1VQL 3;  1NNV A;  2R41 A;  5CLK A;  2ML6 A;  4XM4 A;  5M1A A;  1OHS A;  1AY7 A;  5KP4 A;  1RLS A;  1FGT A;  1E97 A;  3A76 A;  4WYK B;  1B2M A;  3MG3 A;  1E3V A;  1I70 A;  4N6U A;  2CWU A;  3BNC A;  1A2P A;  3D5I A;  1UUG B;  2KF6 A;  1Q7Y 4;  3V99 A;  2XF3 A;  2ZL8 A;  1NU3 A;  4J5G A;  3X3Y A;  1BNF A;  4CPK A;  3DMC A;  1V57 A;  3GZR A;  4RBN A;  1PU4 A;  1RRH A;  4HM6 B;  3MPH A;  4FMA A;  5AIH A;  2SAR A;  3KII A;  4BTW A;  2V1L A;  1IDP A;  1OPY A;  4XB5 A;  2I9W A;  1FA3 A;  1O7P B;  2CKF B;  2OTL 3;  1GOY A;  2D1W A;  2K3D A;  1GYB A;  1WMP A;  5STD A;  2MC8 A;  1W01 A;  1EEJ A;  1W7C A;  4RNZ A;  1M1X B;  5IG5 A;  2ZHX B;  2E2U A;  1QAK A;  1X1W A;  2KXG A;  3MSO A;  1NB5 I;  2B1X B;  1JN5 B;  3KN4 A;  3HX8 A;  5M19 A;  1BNE A;  1OGX A;  1W2B 2;  4WWU C;  1JKG B;  1RRL A;  4HKV B;  3LYG A;  3FF2 A;  2CFW A;  2FXT A;  1UUW B;  3EQQ B;  2OQE C;  4FMC A;  3G4S 3;  4O3V A;  3CCE 3;  1AVK A;  1K28 A;  3BU4 A;  4MMY B;  3KCH A;  3LT8 A;  1QAF A;  4L7K A;  5IG3 A;  3OWY A;  3F7X A;  2R4I A;  1JB2 A;  1JN5 A;  4KFE A;  3CC2 3;  1RCL A;  4L8O A;  2AAE A;  4WHA A;  3CCJ 3;  1MWT A;  1VQ9 3;  3CU3 A;  1RNT A;  1W5Z A;  2K54 A;  1I0X A;  1X1Y A;  1JJ2 2;  1CYV A;  1IVX A;  3LTD A;  2K0M A;  3G71 3;  1JRQ A;  3G8Z A;  1BIR A;  3X40 A;  3EJV A;  4Q53 A;  3JUO A;  3MYT A;  5G1K A;  5JPP A;  1DE3 A;  4HM3 B;  1AR0 A;  4LEH A;  1I8V A;  3SVA A;  1EQK A;  4MMX B;  1M1K 4;  2OQE A;  1SJW A;  3CXC 2;  2GBX B;  3J7Y d;  3WOE B;  3E99 A;  3HII A;  3PCS A;  4XDW A;  1PYL A;  3AHS A;  4O02 B;  4RNY A;  1EKM A;  3UNL A;  4FMD A;  3KSP A;  1VQP 3;  3Q90 A;  3NXJ A;  2BMQ B;  3N9H A;  3HOH A;  4BL3 A;  1N8Q A;  1NDO B;  1CH0 A;  4N3V A;  1K41 A;  1BNI A;  1DMM A;  1IV9 A;  4K1V A;  1B2U A;  3DGY A;  4NHF A;  3Q3F A;  1MGW A;  1RGK A;  4N6L A;  4XBY A;  5ELJ A;  1GY6 A;  2GXF A;  3OW2 2;  1GMP A;  1N9E A;  1MWS A;  3K7C A;  1W6C A;  1STD A;  3KE7 A;  1B2Z A;  3DZL A;  4KFF A;  1AV4 A;  1NO3 A;  1IV7 A;  5IEP A;  3O8Y A;  3JUQ A;  3D5G A;  2RSX A;  4FCJ A;  1RTU A;  3EHC A;  2AAD A;  6RNT A;  1T3B A;  3SX1 A;  1GD4 A;  1I2G A;  2KAA A;  5BIR A;  1KD1 4;  3L0R A;  2JQ5 A;  4KT3 B;  4CDL A;  3ALA A;  1L5G B;  4K1U A;  1IK3 A;  2STD A;  3NBJ A;  1OHO A;  2GBW B;  3BND A;  1RNB A;  4R9K A;  1YI2 3;  4I5Q A;  2CG0 A;  3DY5 A;  1T5Y A;  1VQO 3;  4XBT A;  1ZX2 A;  1G0T A;  1Q82 4;  1DMN A;  3H51 A;  3UB1 A;  3FG4 A;  3G16 A;  1UCJ A;  3NV0 B;  1VQQ A;  3IJE B;  2Z7A A;  4HJL B;  3RGR A;  3WMD A;  2RCD A;  5IW9 A;  2ML5 A;  1LNH A;  2JDI H;  3ECF A;  1MOL A;  4R9L A;  1FUS A;  3MWZ A;  7GSP A;  1EG9 B;  4WP5 A;  4N6N B;  2GEY A;  3KKG A;  2RBI A;  1CYU A;  1UGI A;  1VQK 3;  2UUG C;  4HM8 B;  4ORL A;  1BNS A;  2KCD A;  3H3H A;  1LOV A;  3CCR 3;  5EVH A;  3G6E 3;  1B21 A;  1UDI I;  1A67 A;  2Y74 A;  2IYJ A;  4JF8 A;  1QAL A;  1LQG C;  3X42 A;  2QGU A;  3LZA A;  2L4V A;  3STD A;  1N8R 4;  3B7C A;  1JZD A;  5KP3 A;  3BNE A;  1JBS A;  1JV2 B;  5BVB A;  1E3R A;  1RN4 A;  2CK3 H;  2C10 A;  2KF4 A;  1FUT A;  2YFI B;  3CCU 3;  3V92 A;  1VZZ A;  3AMO A;  1W00 A;  1IVU A;  1FGO A;  3GAX A;  4FR9 A;  4WFO A;  3VSY A;  3WA2 X;  1A2V A;  1SII A;  1WMN A;  3AHW A;  2BHM A;  4LYL B;  4MEI A;  3I0Y A;  4CJN A;  2WO0 A;  3BIR A;  5BU4 A;  1YJW 3;  4TX4 A;  1BU4 A;  8CHO A;  1TJD A;  3CNM A;  4HBR A;  1WTH A;  4K90 B;  2L1S A;  2P38 A;  1TU5 A;  4J9A A;  1RN1 A;  2W2C A;  1JB4 A;  1R4Y A;  3B4O A;  1FGM A;  4STD A;  4H3U A;  3CMA 3;  1BVI A;  4EW5 A;  4FCZ A;  3OX9 A;  1LOY A;  5AYR B;  5RNT A;  2BMR B;  3DGM A;  3F8H A;  1ZGX A;  3OV4 A;  4IT7 A;  5JPU A;  2SBL A;  1C7H A;  2P0X A;  1RGG A;  5G2G A;  3KFQ C;  2F98 A;  1IQY A;  1Q9E A;  2OTJ 3;  3NBB A;  1Q40 B;  2Z6B A;  5IER A;  4GSP A;  1B2S A;  1ULJ B;  3CCS 3;  4N6M A;  1STF I;  1ROV A;  1DYU A;  3D3L A;  3IMA B;  1C54 A;  5CXO A;  4NPB A;  1SIH A;  2M7O A;  3JVC A;  2WOH A;  3MHE A;  1N5H A;  1OAC A;  1I0V A;  1RGF A;  1GOU A;  5GSP A;  4OK0 A;  1Q81 4;  1Q40 A;  3I56 3;  1BNR A;  1EUI C;  1BSA A;  1JZO A;  1X1X A;  2FGT A;  1OH0 A;  1Q86 4;  3NHX A;  4U13 A;  2W56 A;  4LGQ A;  2BU4 A;  4JRF A;  3GWR A;  1BRN L;  5KP1 A;  1YJN 3;  4G1M B;  1BSD A;  1PFP A;  2INX A;  1I2F A;  2XEP A;  3F9S A;  3HI7 A;  1CEW I;  1BAO A;  1YJ9 3;  1JBR A;  1YVS A;  1QVF 2;  4ILF A;  3EF8 A;  5D81 A;  5JBS A;  2XFS A;  5DRV A;  4HOH A;  1MWU A;  2IUJ A;  3CME 3;  4QWT A;  1VQ5 3;  3EN8 A;  3WA3 A;  1ASK A;  1BOX A;  3V98 A;  3EBY A;  3HK4 A;  2GSP A;  3B8L A;  3OWU A;  1LXE A;  1R4C A;  2XRX B;  3X41 A;  1GMQ A;  1AVL A;  1VQN 3;  1IVW A;  1PY3 A;  2W04 A;  5LC6 A;  3T8U A;  2F4Y A;  3LTB A;  3UJM A;  2H0I A;  4IIA A;  4O8S A;  3BB9 A;  2BO9 B;  3PZW A;  1J2B A;  4MMZ B;  1UCK A;  1W02 A;  3LTC A;  1WQL B;  5CF1 A;  1JNQ A;  1BRI A;  1S5A A;  3BNB A;  3QRD A;  3CNX A;  4HM1 B;  4CCV A;  3FSD A;  3EBT A;  1YIJ 3;  2XH9 A;  5LC7 A;  1UUV B;  3NUV A;  2WOF A;  4FCM A;  4OVM A;  3GZB A;  3DGO A;  5G1L A;  1HKX A;  3FKA A;  1V74 A;  5AEU B;  3LML A;  1BRS A;  2XFT A;  1QMA A;  3LOY A;  1BUJ A;  2CWV A;  3X3X A;  1GSP A;  4X2O A;  1IT7 A;  4EYC A;  1BRK A;  1TIJ A;  4H61 A;  5TGN A;  2W6J H;  2ZA4 A;  3SYU A;  4K61 A;  3ROB A;  1BGS A;  3AGN A;  1VQ6 3;  2BMO B;  5HGR A;  1RCK A;  5IEO A;  2Y73 A;  1OUN A;  2CFD A;  1KQS 2;  3EE1 A;  4EBG A;  3RDE A;  3DM8 A;  3CCL 3;  2F86 B;  3PS8 A;  5AIF A;  2XSO B;  4BTY A;  3DUK A;  3K5T A;  3S28 A;  3FZW A;  3ZG5 A;  1BNJ A;  4LZI A;  5BXQ A;  3CCV 3;  3FG3 A;  5CF2 A;  4BIR A;  1YHQ 3;  1KSI A;  1K8A 4;  2Z76 A;  4I4K A;  2J8X B;  1IYY A;  3NM7 A;  1GS3 A;  2HML B;  2XSH B;  4R1K A;  4HM0 B;  1Z1S A;  1BRJ A;  2IUK A;  3RNT A;  2HMM B;  1TUH A;  4XBX A;  1NJI 4;  1SQW A;  3NX0 A;  1JB5 A;  3WR2 A;  4HM2 B;  4RNT A;  4HZB B;  1BSB A;  1RJO A;  2RNT A;  4KVH A;  1VQM 3;  1ZS7 A;  9RNT A;  3DGN A;  4O2H A;  2OOV A;  2YFJ B;  3LXU X;  4AEQ A;  1X1U A;  2E2V A;  1O7N B;  1SAR A;  1I2E A;  3Q2P A;  1US1 A;  3SED A;  3I55 3;  5FGO A;  1NB3 I;  2O3O A;  2RGQ A;  4KZ1 A;  4LMI A;  3CD6 3;  1RDS A;  2HMO B;  4LSO A;  1TTO A;  4N6V 0;  1RGA A;  2H0G A;  1FGQ A;  1LOX A;  3NQZ A;  3Q1C A;  4AKZ A;  4ZM8 A;  3ZG0 A;  2W9P A;  1G96 A;  3BLZ A;  3EX9 A;  3D9R A;  1HZ1 A;  3T0U A;  3PYJ A;  1AQZ A;  2D42 A;  4DKI A;  3AMO B;  3GRD A;  1Q42 A;  1W6Y A;  1M9G A;  2KF3 A;  1FUW A;  2CX1 A;  1DET A;  3IPT A;  5ELU A;  1UCI A;  3F7S A;  1RKY A;  1TFK A;  1BAN A;  3NQY A;  4R80 A;  3WDG B;  3HZP A;  1D6Z A;  4BTX A;  5I97 A;  3N8B A;  1K73 4;  5IG0 A;  2HOH A;  3FG1 A;  1GD3 A;  2WGO A;  3RGA A;  1BNG A;  1QVG 2;  2H0H A;  2GEX A;  2OCT A;  3F40 A;  4HM5 B;  6GSP A;  1VQ4 3;  1YNV X;  1FYS A;  1TRQ A;  2Q07 A;  1TFO A;  2CWT A;  1UI8 A;  1UW1 A;  3GZY B;  3PCR A;  4N6O B;  5AII A;  4EC6 A;  3FCS B;  4FMB A;  5HOH A;  1OF5 B;  3SOY A;  1LNI A;  1TRP A;  3EN1 B;  2UX0 A;  1EA2 A;  1S72 3;  1FGR A;  1O7H B;  2GU3 A;  2C4B A;  6STD A;  1I3F A;  1IQX A;  2BIR A;  2IA7 A;  4IPB A;  3DXO A;  3TDG A;  7RNT A;  1FW7 A;  1B2X A;  5A0O B;  4WYK A;  3FGY A;  2E2T A;  1OF5 A;  2WGQ A;  2W56 B;  3GSP A;  1OGZ A;  2P05 A;  3K0Z A;  4L8P A;  1MGR A;  1RGL A;  4GL6 A;  3U1W A;  1FZU A;  1W4N A;  1ULI B;  2IMJ A;  2O9U X;  3B4P A;  1DVD A;  2F99 A;  1Q7H A;  3MKI A;  3JUN A;  4HVN A;  1U8C B;  1B20 A;  1LVN A;  4EV2 A;  2CH9 A;  1KC8 4;  2GU1 A;  3N54 B;  3WOF B;  1YVB I;  1UGH I;  2QA4 3;  2F5M A;  2Z77 A;  3S67 A;  1ISK A;  3KSE D;  1ROA A;  1HYF A;  1T2H A;  2CFK A;  1BSE A;  2CFL A;  3D79 A;  5M18 A;  1OCV A;  1RN7 A;  1T2I A;  2XGL A;  1RHL A;  2YFL B;  3DGL A;  1UI7 A;  4GB5 A;  3S29 A;  1LQM B;  2CFG A;  4OUQ A;  5IG4 A;  3K63 A;  1K9M 4;  1LOW A;  1JKG A;  1HU9 A;  3GZX B;  1BRG A;  3PGB A;  7STD A;  4HZ9 B;  1M90 4;  3URP A;  1N5P A;  2BT3 A;  3X3Z A;  2B24 B;  2IY2 A;  3WHO A;  1Y4K A;  1A90 A;  3S27 A;  1IT8 A;  3EC9 A;  3ER7 A;  1V58 A;  4HYZ A;  3CCM 3;  2FNQ A;  3CC4 3;  1GY7 A;  1RGC A;  2BNG A;  3CC7 3;  1I3I A;  2UGI A;  2A15 A;  1D6Y A;  1O7G B;  2LYX A;  1SPU A;  5EQL A;  2CC3 A;  4NRE A;  3F8X A;  4J5K A;  5IEN A;  1MWR A;  1GMR A;  1OHP A;  3FH1 A;  1YIT 3;  2HMN B;  3UL5 A;  3SXX A;  2HMJ B;  3JUM A;  3S5C A;  2F56 A;  1RSN A;  4EXR A;  1IQ8 A;  2OOV C;  2KF5 A;  2W0Q A;  3KZT A;  3D4A A;  5AIG A;  2CX0 A;  1YGW A;  3CPW 2;  8RNT A;  1KWI A;  1W6G A;  1RGE A;  3LT9 A;  1DMQ A;  2RFR A;  3ZFZ A;  3SLU A;  5AEW B;  3OWS A;  3A5E A;  2P09 A;  2CG1 A;  3NM2 A;  3DH2 A;  2W9Q A;  5EEO A;  2CHC A;  1IU7 A;  5D82 A;  1TP6 A;  3OXA A;  1A2K A;  1IVV A;  1RGH A;  4MJD A;  1QJG A;  3MG2 A;  3JUP A;  1VQ8 3;  1F8N A;  3LH4 A;  1LRA A;  3LTA A;  5CK6 A;  1BRH A;  3QK9 A;  2LQV A;  2MF7 A;  4X2H A;  1UCL A;  4RZM A;  3WOD G;  1VQ7 3;  3M8C A;  2XR8 B;  5FW5 A;  2XGN A;  4PEJ A;  4AKY A;  1BUQ A;  2W03 A;  1DVC A;  4R4K A;  3G0K A;  1O7W B;  1U5O A;  3NBR A;  3AGO A;  3F14 A;  5DRE A;  3U97 A;  2P0M A;  1YGE A;  1GOV A;  3SOA A;  5D83 A;  3UL6 A;  4BU4 A;  4KFD A;  1CQS A;  1O7M B;  1W2Z A;  3VGN A; 
#chains in the Genus database with same CATH homology
 1FYS A;  4HAA A;  3HOH A;  1BRN L;  1B27 A;  1BSD A;  5HOH A;  1I2F A;  1CH0 A;  1JBR A;  1BAO A;  1BNI A;  1YVS A;  1LNI A;  1TRP A;  1B2U A;  3DGY A;  3Q3F A;  1MGW A;  1RGK A;  1JBT A;  4HOH A;  2C4B A;  1FW7 A;  1I3F A;  1B3S A;  2BIR A;  1GMP A;  7RNT A;  1B2X A;  4GHO A;  1BSC A;  1BOX A;  1RMS A;  3GSP A;  2GSP A;  1B2Z A;  2F5W A;  1MGR A;  3D5G A;  1RGL A;  1G02 A;  1RTU A;  1FZU A;  1GMQ A;  2AAD A;  6RNT A;  1PY3 A;  2F4Y A;  1I2G A;  2KAA A;  5BIR A;  1B20 A;  1UCK A;  2F5M A;  1RNB A;  1AY7 A;  1BRI A;  1RLS A;  1HYF A;  1T2H A;  1BSE A;  1B2M A;  1I70 A;  1A2P A;  3D5I A;  1T2I A;  2KF6 A;  1RHL A;  1UCJ A;  1BRS A;  4J5G A;  1BNF A;  1LOW A;  1BUJ A;  1BRG A;  1GSP A;  3URP A;  2SAR A;  1BRK A;  2ZA4 A;  3SYU A;  3WHO A;  1BGS A;  1FUS A;  3AGN A;  7GSP A;  1GOY A;  1RCK A;  2RBI A;  1RGC A;  1I3I A;  1X1W A;  1BNS A;  1BNJ A;  1BNE A;  1LOV A;  4BIR A;  4J5K A;  1B21 A;  1GMR A;  1IYY A;  3BU4 A;  3KCH A;  1BRJ A;  3RNT A;  3WR2 A;  2F56 A;  1RSN A;  1JBS A;  4RNT A;  1BSB A;  2RNT A;  1RN4 A;  2KF5 A;  2KF4 A;  1RCL A;  3D4A A;  2AAE A;  9RNT A;  1FUT A;  1YGW A;  8RNT A;  1X1U A;  1RGE A;  1RNT A;  3AHW A;  1SAR A;  1I2E A;  5BU4 A;  3BIR A;  1BU4 A;  1I0X A;  1X1Y A;  3A5E A;  1RN1 A;  1RDS A;  1R4Y A;  3DH2 A;  1TTO A;  1RGA A;  1BVI A;  1BIR A;  1LOY A;  5RNT A;  1HZ1 A;  1RGH A;  1ZGX A;  1AQZ A;  1RGG A;  1DE3 A;  1I8V A;  1YNV X;  1Q9E A;  2KF3 A;  1LRA A;  1DET A;  1BRH A;  1UCI A;  4GSP A;  1B2S A;  1BAN A;  1UCL A;  1PYL A;  1C54 A;  3AHS A;  2HOH A;  1RGF A;  1I0V A;  1GOU A;  5GSP A;  1BNR A;  3AGO A;  1BSA A;  1X1X A;  4BU4 A;  1GOV A;  1BNG A;  6GSP A;  2BU4 A;  1TRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...