1A90A

Recombinant mutant chicken egg white cystatin, nmr, 31 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
108
structure length
108
Chain Sequence
GAPVPVDENDEGLQRALQFAIAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPELAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN
publication title The structures of native phosphorylated chicken cystatin and of a recombinant unphosphorylated variant in solution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Thiol protease inhibitor
total genus 18
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1a90A00
4EYCA 3PS8A 1FA3A 3KFQC 1PFPA 2BO9B 3UL6A 2OCTA 1STFI 2W9PA 1FUWA 1A90A 1GD3A 3L0RA 1MNLA 4IT7A 1KWIA 5A0OB 4N6V0 5ELJA 2W9QA 4N6TA 1R4CA 1IV9A 4N6UA 4TX4A 1CYUA 3LH4A 1EQKA 5LC6A 3K9MC 2O9UX 4CCVA 3MWZA 1GD4A 1N5PA 3IMAB 4N6NB 3UL5A 4ZM8A 1TIJA 2CH9A 4N6MA 1MOLA 5EQLA 3PYJA 1N5HA 1YVBI 3KSED 3QRDA 5LC7A 4N6LA 1IV7A 1NB5I 1G96A 1NB3I 1LXEA 1A67A 1DVCA 1RN7A 5ELUA 1DVDA 1CYVA 3PXMA 4LZIA 3SVAA 1N9JA 3S67A 3NX0A 1WNHA 1ROAA 3Q2PA 2KXGA 3GAXA 1M9GA 1CEWI 4N6OB
chains in the Genus database with same CATH superfamily
5DREA 3DGMA 1BGSA 3AGOA 3FSDA 5IW9A 5IERA 1OHSA 1W4NA 3AGNA 4N3VA 1U8CB 1FW7A 2QA43 2D1WA 4ILFA 3CD63 1IU7A 4FCMA 2XF3A 3MPHA 1DYUA 2BT3A 4KVHA 3JVCA 1Q42A 3K0ZA 3D79A 4XBYA 1RGKA 1BRGA 1I0VA 2W56A 1O7WB 1LOVA 3NQYA 3EB8A 3LZAA 1D6ZA 2BMQB 3I563 5HOHA 1SIIA 3NBBA 1NNVA 3DM8A 1I2FA 1MNLA 1HKXA 1IQYA 1JKGA 4IT7A 1N8QA 1KWIA 4OK0A 3CCJ3 5A0OB 3CCQ3 3F8XA 4N6V0 1OHPA 4K1UA 4RNZA 4HM5B 4N6TA 1O7NB 1BNSA 4HM3B 3RGAA 3FF0A 1FGOA 1PY3A 4HM4B 1IV9A 1RGFA 2AAEA 2HMLB 3FG4A 4HM1B 4I4KA 3KE7A 3S29A 1Q864 5CXOA 2D42A 3T8NA 1FGRA 1S5AA 4HM2B 3PGBA 3H3HA 5G1LA 3NQZA 4PEJA 1TTOA 3I553 1U5OA 1WMOA 3JUMA 2CFLA 2O9UX 3A5EA 1W5ZA 2XSHB 3DGLA 3URPA 4CCVA 5CF2A 4N6NB 1UW1A 1STDA 4GHOA 5STDA 3CXC2 2W56B 3BNEA 1YJW3 1VQ93 1OF5B 2C11A 1RNTA 1EA2A 8RNTA 1BANA 3UL5A 1BUJA 1JBSA 3NV0A 1JKGB 1X1WA 3DUKA 2KAAA 2F5WA 5JPUA 2CFGA 1RGGA 3EBTA 3OWSA 1MOLA 3LYGA 1ISKA 3X3YA 1N9EA 6GSPA 2UGIA 4HKVB 2AADA 1I3IA 4BTYA 3OX9A 1SJWA 1CH0A 1V58A 4GB5A 2FXTA 1GMQA 1ASKA 2K0MA 3TDGA 3EN8A 1RCLA 1W6CA 1WQLB 3CPOA 5BXQA 3CCR3 1VQ53 3OWYA 3DH2A 2GXFA 3F9SA 4N6LA 1GY6A 3JUQA 1A2VA 1AR0A 2LYXA 1X1UA 4QWTA 2ZDJA 4H3UA 1NB5I 1LRAA 1UI7A 2KF5A 1G96A 4X2HA 1NB3I 3N54B 3GZYB 5JPPA 3G713 1IVWA 3ALAA 4NPBA 3RDEA 1UUVB 1UCKA 4WWUC 1MGWA 2J8XB 4CDLA 1RN1A 5G1KA 1DVDA 4OVMA 1K28A 4J8TA 4L8OA 4I5QA 1YGEA 3PXMA 3PCSA 4LZIA 1VQQA 1O7PB 4EW5A 3DMCA 1UI8A 3CCU3 2XR8B 4L8PA 1DETA 1GYBA 2CG0A 3SVAA 5IG4A 1BRJA 5TGNA 1N9JA 2P05A 4KZ1A 3FGYA 2ML6A 3CC43 1T2IA 4KT3B 1RMSA 2FNQA 1WNHA 3BLZA 1JNQA 4WHAA 1IQ8A 2GEYA 2XH9A 2KF4A 1Y4KA 5AIHA 3UNLA 1JZDA 1ULJB 2R41A 4HBRA 3OW22 1HYFA 3KN4A 5CLKA 1UCJA 4XBTA 3ZG0A 2L1SA 1NU3A 1BSDA 1EEJA 1BNFA 5DRVA 1ZO2A 2W03A 3PS8A 4HZ9B 1FA3A 3ER7A 3KFQC 5IEPA 3CPW2 1A2PA 1B2MA 5AI1A 3CMA3 1O7GB 2RGQA 4O2HA 2XEPA 3UL6A 2BO9B 1RGLA 2CFWA 3VSYA 2PZVA 3X42A 2OCTA 1STFI 1DMQA 3GZXB 3PCRA 1D6UA 1T3BA 1LQGC 4MMYB 4BU4A 4ORLA 4EV2A 1DMNA 3I0YA 3CNMA 1A90A 1GMPA 3L0RA 1IT7A 1GOYA 3WHOA 3WOFB 1BVIA 3NBJA 1I8VA 5AEUB 1AV4A 5ELJA 2XGLA 1N8R4 3B7CA 2C10A 5BU4A 1VQK3 2W9QA 2O3OA 1KD14 1BU4A 1VQO3 1RGEA 3MYTA 4FCJA 4J9AA 2CIUA 3U97A 2HMNB 1IT8A 3T0UA 3V92A 1YHQ3 5FGOA 1UUWB 3UJMA 1WMNA 1RGHA 3NM2A 1VQ43 3B4OA 3EF8A 3SX1A 3B8LA 3PZWA 2OQEC 5CF1A 1CYUA 1EQKA 3BIRA 2MC8A 7STDA 1TRPA 2ML5A 4FMBA 5D81A 1NWWA 2XSOB 3AHWA 3X3ZA 1HU9A 3V99A 2Z77A 1D6YA 3WA2X 4RZMA 1I3FA 1EUIC 2E2VA 3K9MC 3DZLA 3T8UA 2OTL3 1NO3A 2WGOA 1GD4A 3MWZA 1MWSA 1JBTA 3AHSA 4HZBB 1VQ63 3VGNA 3S27A 2BHMA 4R80A 5AEWB 1Q814 2WO0A 4R1KA 1YIT3 6RNTA 4X2OA 2P0XA 3CNXA 2RBIA 3NM7A 3FG3A 3KIIA 1RHLA 2R4IA 3HK4A 3JUNA 4RBNA 4AKYA 5IG5A 3CC23 2Z76A 4FMAA 3STDA 3CCM3 2F4YA 3OV4A 4LGQA 2IUJA 4LYLB 1X1YA 4MMXB 1YVBI 3KSED 3FZWA 3G16A 3SEDA 3WOEB 1Q40A 2W2CA 3B4PA 3J7Yd 2RCDA 4XB5A 3GRDA 5HGRA 1BRNL 2SARA 4KFEA 1L5GB 4WFOA 4WYKA 2OWPA 1KQS2 2IYJA 1DE3A 1LXEA 4R4KA 3ECFA 1E3VA 3CCS3 4HM0B 1Q824 1DVCA 1I70A 1FUSA 1RN7A 2WOFA 2IMJA 1K734 2YFJB 1IVUA 2KCDA 4IPBA 2KRTA 2KF6A 2CX1A 1ZX2A 5I97A 1B27A 1LNIA 4DKIA 2H0IA 1SQWA 4BTXA 1MWRA 2RNTA 3EN1B 2HMKB 1I0XA 3EHCA 1K9M4 4GSPA 1UCLA 7GSPA 1YJ93 5D82A 1RTUA 4XBXA 2E2TA 1VQM3 3HIGA 5BIRA 1LOYA 1BNEA 1GOVA 1ROAA 2INXA 1SPUA 9RNTA 4HOHA 3KCHA 1OHOA 3RNTA 1B21A 1M9GA 1PYLA 3FCSB 3WMDA 4BTWA 4N6OB 1VQ73 1Q40B 3WA3A 1IYYA 1JJ22 3FF2A 5AIFA 2B24B 7RNTA 1Q9EA 3G6E3 1X1XA 1IQXA 1GMRA 1UDII 3ROBA 1BSEA 1BNGA 1AQZA 2K54A 1BSAA 4Q53A 1JZOA 1B2ZA 1JN5A 1QAKA 1UGHI 2SBLA 3NV0B 1W6YA 2GSPA 3EX9A 3ZG5A 1TU5A 1B2XA 3CCV3 1OACA 2W9PA 1PU4A 3BNBA 5IF6A 3NBRA 3LT9A 2QGUA 1M1XB 1QJGA 1LQMB 1FUWA 3HI7A 3DGYA 2I9WA 4XDVA 1I2GA 3NUVA 3OXAA 1IVVA 1B20A 1RCKA 1RJOA 2UX0A 3SOYA 3WDGB 3CC73 2HOHA 3M8CA 1HZ1A 1VZZA 1GY5A 3LTAA 4FMCA 3FG1A 1G02A 1W00A 3LT8A 1RRHA 4K61A 4IIAA 4KFFA 5G2GA 1TFOA 1ULIB 3K7CA 4HYZA 1RSNA 2L4VA 4N6UA 2GBXB 4HM6B 3LTCA 3AMOA 3DXOA 1BRHA 1RGAA 4OUQA 1W6GA 2BMOB 2C4BA 2W6JH 1QMAA 2CWUA 5IG0A 1GY7A 1O7HB 1A2KA 1BSCA 1JB5A 1UUGB 1B3SA 1B2UA 2LQVA 2QEX3 3HIIA 2OTJ3 1OH0A 3D5IA 1RNBA 3N8BA 1W01A 2CWTA 3Q1CA 1VQN3 1RKYA 4MMZB 1N5PA 3BNDA 3H51A 1T2HA 1IDPA 2UUGC 2W04A 3G4S3 3DGOA 2JDIH 1ZS7A 2YX9A 1JRQA 2CFKA 1ZGXA 2WOHA 3EC9A 1FYSA 1AVLA 3F14A 3F40A 2F99A 3N9HA 2H0GA 4EXRA 4CPKA 3CCL3 1UCIA 5M19A 1OGZA 3HZPA 3GSPA 1LNHA 2P38A 1BSBA 5AIIA 1RGCA 2OOVC 2Z6BA 3PYJA 3OWUA 4BIRA 1OUNA 3LTDA 2YFLB 3VF1A 5LC7A 1LOXA 1ROVA 1IV7A 1YIJ3 1GSPA 4HAAA 4FMDA 4HJLB 1BNRA 3GWRA 4L7KA 1QALA 2V1LA 3SYUA 1C54A 1GOUA 1F8NA 1BRKA 1SARA 2Y73A 4XDWA 1NJI4 1A67A 1W02A 3MKIA 5GSPA 3K5TA 5EEOA 4GL6A 3BU4A 4O8SA 1YJN3 1BNJA 3F8HA 5EVHA 2IA7A 1AY7A 3SXXA 1BRSA 2F56A 2F5MA 4EV5A 3LTBA 3X41A 3LMLA 5KP3A 1OF5A 3FLJA 3KZTA 1Q7Y4 2A15A 2RSXA 1DMMA 8CHOA 3S67A 1K8A4 1BOXA 4MJDA 2RFRA 1W7CA 2CK3H 3JUPA 3MHEA 1RN4A 4AEQA 3Q2PA 2KXGA 3FH1A 3GAXA 3JUOA 3V98A 3CME3 4BL3A 1FGTA 1CEWI 3EBYA 5AYRB 1BUQA 1YVSA 2W0QA 2ZL8A 3EQQB 3KKGA 3WR2A 4EYCA 3MSOA 5IG3A 1BRIA 1VQL3 4LMIA 1EKMA 4FCZA 3NHXA 3FKAA 2CFDA 3S5CA 1O7MB 3SOAA 4FR9A 1PFPA 4O02B 1YGWA 1RRLA 1YNVX 2CX0A 2K3DA 1FUTA 3ZFZA 3CCE3 5IEOA 4RNTA 2WGQA 3O8YA 1FGQA 1Z1SA 2CC3A 2HMMB 4R9KA 1GD3A 2BIRA 1V74A 2CW9A 1WTHA 2BMRB 1MWUA 2Q07A 3LOYA 3QK9A 1BAOA 2CHCA 3EJVA 2CG1A 3S28A 1VQ83 2IUKA 2F98A 2XFTA 1YI23 1TRQA 2GEXA 3RGRA 6STDA 1TP6A 1SIHA 1C7HA 3BB9A 1TJDA 4LEHA 1K41A 1BIRA 2GU3A 1QVF2 2JQ5A 1S723 2B1XB 1QAFA 1GS3A 1R4CA 3X3XA 2HMOB 2HMJB 3F7SA 4TX4A 4WYKB 4JF8A 2GU1A 3LH4A 4K90B 3KSPA 2E2UA 2Z7AA 5IENA 1E97A 2OQEA 3D9RA 5JBSA 1M1K4 1R4YA 4EC6A 3E99A 5LC6A 2XGNA 2PNCA 2OOVA 1IK3A 4BL2A 1JV2B 4RNYA 3X40A 1G0TA 5RNTA 4WP5A 4STDA 4J5KA 3IMAB 4CJNA 1J2BA 5AIGA 4H61A 2XFSA 1RDSA 3Q3FA 4HM8B 4JRFA 4ZM8A 1BNIA 3U1WA 1TIJA 2CWVA 4HVNA 5BVBA 1JB4A 1I2EA 1TFKA 2CH9A 3A76A 3K63A 1V57A 4N6MA 3NXJA 5M18A 4AKZA 3EE1A 4KFDA 5D83A 3D4AA 3HX8A 3MG3A 1JBRA 1CQSA 4MEIA 1LVNA 5AYSC 3GZRA 3G8ZA 1UGIA 2P09A 4LSOA 1T5YA 5FW5A 4G1MB 5EQLA 3G0KA 1US1A 2P0MA 5M1AA 1N5HA 1OCVA 1KC84 2KF3A 3D3LA 1VQP3 3HOHA 1JN5B 3QRDA 3F7XA 3IPTA 4K1VA 1FGMA 1OGXA 1QVG2 2ZHXB 4NREA 1JB2A 1FZUA 3DY5A 3WODG 1KSIA 2BU4A 2GBWB 3Q90A 4J5GA 1OPYA 4U13A 5ELUA 1M904 3GZBA 5KP4A 1CYVA 1NDOB 5CK6A 1E3RA 1MGRA 3SLUA 2H0HA 3IJEB 2M7OA 3MG1A 1EG9B 3BNCA 1TUHA 2ZA4A 1Q7HA 4HM7B 2FGTA 1RLSA 4NHFA 4R9LA 2YFIB 1LOWA 3DGNA 3AMOB 2XRXB 3UB1A 2MF7A 1AVKA 2IY2A 2QIYA 2STDA 1WMPA 3MG2A 3NX0A 4EBGA 3LXUX 4XM4A 1MWTA 1IVXA 2Y74A 3D5GA 1W2B2 2F86B 1W2ZA 2BNGA 3CU3A 4O3VA 1B2SA 2CKFB 5KP1A
chains in the Genus database with same CATH topology
5DREA 3DGMA 3FSDA 5IW9A 5IERA 1OHSA 1W4NA 4N3VA 1U8CB 2QA43 2D1WA 3CD63 1IU7A 4FCMA 2XF3A 3MPHA 1DYUA 2BT3A 4KVHA 3JVCA 1Q42A 3K0ZA 4XBYA 2W56A 1O7WB 3NQYA 3EB8A 3LZAA 1D6ZA 2BMQB 3I563 1SIIA 3NBBA 3DM8A 1MNLA 1HKXA 1IQYA 1JKGA 4IT7A 1N8QA 1KWIA 4OK0A 3CCJ3 5A0OB 3CCQ3 3F8XA 4N6V0 1OHPA 4K1UA 4RNZA 4HM5B 4N6TA 1O7NB 4HM3B 3RGAA 3FF0A 1FGOA 4HM4B 1IV9A 2HMLB 3FG4A 4HM1B 4I4KA 3KE7A 3S29A 1Q864 5CXOA 2D42A 3T8NA 1FGRA 1S5AA 4HM2B 3PGBA 3H3HA 3NQZA 4PEJA 3I553 1WMOA 3JUMA 2CFLA 2O9UX 5CF2A 1W5ZA 2XSHB 3DGLA 4CCVA 4N6NB 1UW1A 1STDA 5STDA 3CXC2 1YJW3 2W56B 3BNEA 1VQ93 1OF5B 2C11A 1EA2A 3UL5A 3NV0A 1JKGB 3DUKA 5JPUA 2CFGA 3OWSA 3EBTA 1MOLA 3LYGA 1ISKA 3X3YA 1N9EA 4HKVB 4BTYA 3OX9A 1SJWA 4GB5A 2FXTA 1ASKA 2K0MA 3TDGA 3EN8A 1WQLB 1W6CA 5BXQA 3CPOA 3CCR3 1VQ53 3OWYA 2GXFA 3F9SA 4N6LA 1GY6A 3JUQA 1A2VA 1AR0A 2LYXA 4QWTA 1NB5I 2ZDJA 4H3UA 1UI7A 4X2HA 1G96A 1NB3I 3N54B 3GZYB 5JPPA 3G713 1IVWA 3ALAA 3RDEA 1UUVB 4WWUC 4CDLA 1DVDA 4OVMA 1K28A 4J8TA 4L8OA 1YGEA 3PXMA 3PCSA 4LZIA 1O7PB 3DMCA 1UI8A 3CCU3 2XR8B 4L8PA 2CG0A 1GYBA 3SVAA 5IG4A 5TGNA 1N9JA 2P05A 4KZ1A 3FGYA 2ML6A 3CC43 2FNQA 3BLZA 1WNHA 4WHAA 1JNQA 1IQ8A 2GEYA 2XH9A 1Y4KA 5AIHA 3UNLA 1ULJB 4HBRA 3OW22 5CLKA 3KN4A 4XBTA 1NU3A 5DRVA 1ZO2A 2W03A 3PS8A 4HZ9B 1FA3A 3ER7A 3KFQC 5IEPA 3CPW2 5AI1A 3CMA3 1O7GB 2RGQA 4O2HA 2XEPA 3UL6A 2BO9B 3VSYA 2CFWA 2PZVA 3X42A 2OCTA 1STFI 1DMQA 3GZXB 3PCRA 1D6UA 4MMYB 4ORLA 4EV2A 1DMNA 3I0YA 3CNMA 1A90A 3L0RA 1IT7A 3WOFB 3NBJA 5AEUB 1AV4A 5ELJA 2XGLA 1N8R4 3B7CA 2C10A 1VQK3 2W9QA 2O3OA 1KD14 1VQO3 4FCJA 3MYTA 4J9AA 2CIUA 3U97A 2HMNB 1IT8A 3T0UA 3V92A 1YHQ3 5FGOA 1UUWB 3UJMA 1WMNA 3NM2A 1VQ43 3B4OA 3EF8A 3SX1A 3B8LA 3PZWA 2OQEC 5CF1A 1CYUA 1EQKA 2MC8A 7STDA 2ML5A 4FMBA 5D81A 1NWWA 2XSOB 3X3ZA 1HU9A 3V99A 2Z77A 1D6YA 3WA2X 4RZMA 2E2VA 3K9MC 3DZLA 3T8UA 2OTL3 1NO3A 2WGOA 1GD4A 3MWZA 4HZBB 1VQ63 3VGNA 3S27A 2BHMA 4R80A 5AEWB 1Q814 2WO0A 4R1KA 1YIT3 4X2OA 2P0XA 3CNXA 3NM7A 3FG3A 3KIIA 2R4IA 3HK4A 3JUNA 4RBNA 4AKYA 5IG5A 3CC23 2Z76A 4FMAA 3STDA 3CCM3 3OV4A 4LGQA 2IUJA 4MMXB 1YVBI 3KSED 3FZWA 3G16A 3SEDA 3WOEB 1Q40A 2W2CA 3B4PA 3J7Yd 2RCDA 4XB5A 3GRDA 5HGRA 4KFEA 1L5GB 4WFOA 4WYKA 2OWPA 1KQS2 1LXEA 4R4KA 3ECFA 1E3VA 3CCS3 4HM0B 1Q824 1DVCA 1RN7A 2WOFA 2IMJA 1K734 2YFJB 1IVUA 2KCDA 4IPBA 2KRTA 1ZX2A 5I97A 1SQWA 4BTXA 3EN1B 2HMKB 3EHCA 1K9M4 1YJ93 5D82A 4XBXA 2E2TA 1VQM3 3HIGA 2INXA 1ROAA 1SPUA 1OHOA 1M9GA 3FCSB 3WMDA 4BTWA 4N6OB 1VQ73 1Q40B 3WA3A 1JJ22 3FF2A 5AIFA 2B24B 3G6E3 1IQXA 3ROBA 2K54A 4Q53A 1JN5A 1QAKA 2SBLA 3NV0B 1W6YA 3EX9A 1TU5A 3CCV3 1OACA 2W9PA 1PU4A 3BNBA 5IF6A 3NBRA 3LT9A 2QGUA 1M1XB 1QJGA 1FUWA 3HI7A 2I9WA 4XDVA 3NUVA 3OXAA 1IVVA 1RJOA 2UX0A 3WDGB 3SOYA 3CC73 3M8CA 3LTAA 1VZZA 1GY5A 4FMCA 3FG1A 1W00A 3LT8A 1RRHA 4K61A 4IIAA 4KFFA 5G2GA 1TFOA 1ULIB 3K7CA 4HYZA 2L4VA 4N6UA 2GBXB 4HM6B 3LTCA 3AMOA 3DXOA 4OUQA 1W6GA 2BMOB 2W6JH 1QMAA 2CWUA 5IG0A 1GY7A 1O7HB 1A2KA 2LQVA 1JB5A 2OTJ3 2QEX3 3HIIA 1OH0A 3N8BA 1W01A 2CWTA 3Q1CA 1VQN3 1RKYA 4MMZB 1N5PA 3BNDA 3H51A 1IDPA 2W04A 3G4S3 3DGOA 2JDIH 2YX9A 1JRQA 2CFKA 2WOHA 3EC9A 1AVLA 3F14A 3F40A 2F99A 3N9HA 4EXRA 3CCL3 1OGZA 3HZPA 1LNHA 2P38A 5AIIA 2OOVC 2Z6BA 3PYJA 3OWUA 1OUNA 3LTDA 2YFLB 3VF1A 5LC7A 1LOXA 1ROVA 1IV7A 1YIJ3 4FMDA 4HJLB 3GWRA 4L7KA 1QALA 2V1LA 4XDWA 1F8NA 2Y73A 1NJI4 1A67A 1W02A 3MKIA 3K5TA 5EEOA 4GL6A 1YJN3 4O8SA 3F8HA 5EVHA 2IA7A 3SXXA 4EV5A 3LTBA 3X41A 3LMLA 5KP3A 1OF5A 3FLJA 3KZTA 1Q7Y4 2A15A 2RSXA 1DMMA 8CHOA 3S67A 1K8A4 4MJDA 2RFRA 1W7CA 2CK3H 3JUPA 3MHEA 4AEQA 3Q2PA 2KXGA 3FH1A 3GAXA 3JUOA 3V98A 3CME3 1FGTA 1CEWI 3EBYA 5AYRB 1BUQA 2W0QA 2ZL8A 3EQQB 3KKGA 4EYCA 3MSOA 5IG3A 1VQL3 4LMIA 1EKMA 4FCZA 3NHXA 3FKAA 2CFDA 3S5CA 1O7MB 3SOAA 4FR9A 1PFPA 4O02B 1RRLA 3CCE3 5IEOA 2WGQA 3O8YA 1FGQA 1Z1SA 2CC3A 2HMMB 4R9KA 1GD3A 1V74A 2CW9A 1WTHA 2BMRB 2Q07A 3LOYA 3QK9A 3S28A 2CHCA 3EJVA 2CG1A 1VQ83 2IUKA 2F98A 2XFTA 1YI23 2GEXA 3RGRA 6STDA 1TP6A 1SIHA 1C7HA 3BB9A 4LEHA 1QVF2 1K41A 2GU3A 2JQ5A 1S723 2B1XB 1QAFA 1GS3A 1R4CA 3X3XA 2HMOB 2HMJB 3F7SA 4TX4A 4WYKB 4JF8A 2GU1A 3LH4A 4K90B 3KSPA 2E2UA 2Z7AA 5IENA 1E97A 2OQEA 3D9RA 5JBSA 1M1K4 4EC6A 3E99A 5LC6A 2XGNA 2PNCA 2OOVA 1IK3A 1JV2B 4RNYA 3X40A 4WP5A 4STDA 3IMAB 1J2BA 5AIGA 4H61A 2XFSA 4HM8B 4JRFA 4ZM8A 3U1WA 1TIJA 2CWVA 4HVNA 5BVBA 1JB4A 2CH9A 1TFKA 3A76A 3K63A 4N6MA 3NXJA 4AKZA 3EE1A 4KFDA 5D83A 3HX8A 3MG3A 1CQSA 4MEIA 1LVNA 5AYSC 3GZRA 3G8ZA 4LSOA 2P09A 5FW5A 1T5YA 4G1MB 5EQLA 3G0KA 1US1A 2P0MA 1N5HA 1OCVA 1KC84 3D3LA 1VQP3 1JN5B 3QRDA 3F7XA 3IPTA 4K1VA 1FGMA 1OGXA 1QVG2 4NREA 1JB2A 3DY5A 3WODG 1KSIA 2GBWB 3Q90A 1OPYA 4U13A 5ELUA 1M904 3GZBA 5KP4A 1CYVA 1NDOB 5CK6A 1E3RA 3SLUA 3IJEB 2M7OA 3MG1A 1EG9B 3BNCA 1TUHA 4HM7B 4R9LA 2FGTA 4NHFA 2YFIB 3DGNA 3UB1A 3AMOB 2XRXB 2MF7A 1AVKA 2QIYA 2STDA 1WMPA 3MG2A 3NX0A 4EBGA 3LXUX 4XM4A 1IVXA 2Y74A 1W2B2 2F86B 1W2ZA 2BNGA 3CU3A 4O3VA 1U5OA 2CKFB 5KP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EYC A;  3PS8 A;  1FA3 A;  3KFQ C;  1PFP A;  2BO9 B;  3UL6 A;  2OCT A;  1STF I;  2W9P A;  1FUW A;  1A90 A;  1GD3 A;  3L0R A;  1MNL A;  4IT7 A;  1KWI A;  5A0O B;  4N6V 0;  5ELJ A;  2W9Q A;  4N6T A;  1R4C A;  1IV9 A;  4N6U A;  4TX4 A;  1CYU A;  3LH4 A;  1EQK A;  5LC6 A;  3K9M C;  2O9U X;  4CCV A;  3MWZ A;  1GD4 A;  1N5P A;  3IMA B;  4N6N B;  3UL5 A;  4ZM8 A;  1TIJ A;  2CH9 A;  4N6M A;  1MOL A;  5EQL A;  3PYJ A;  1N5H A;  1YVB I;  3KSE D;  3QRD A;  5LC7 A;  4N6L A;  1IV7 A;  1NB5 I;  1G96 A;  1NB3 I;  1LXE A;  1A67 A;  1DVC A;  1RN7 A;  5ELU A;  1DVD A;  1CYV A;  3PXM A;  4LZI A;  3SVA A;  1N9J A;  3S67 A;  3NX0 A;  1WNH A;  1ROA A;  3Q2P A;  2KXG A;  3GAX A;  1M9G A;  1CEW I;  4N6O B; 
#chains in the Genus database with same CATH topology
 5DRE A;  3DGM A;  1BGS A;  3AGO A;  3FSD A;  5IW9 A;  5IER A;  1OHS A;  1W4N A;  3AGN A;  4N3V A;  1U8C B;  1FW7 A;  2QA4 3;  2D1W A;  4ILF A;  3CD6 3;  1IU7 A;  4FCM A;  2XF3 A;  3MPH A;  1DYU A;  2BT3 A;  4KVH A;  3JVC A;  1Q42 A;  3K0Z A;  3D79 A;  4XBY A;  1RGK A;  1BRG A;  1I0V A;  2W56 A;  1O7W B;  1LOV A;  3NQY A;  3EB8 A;  3LZA A;  1D6Z A;  2BMQ B;  3I56 3;  5HOH A;  1SII A;  3NBB A;  1NNV A;  3DM8 A;  1I2F A;  1MNL A;  1HKX A;  1IQY A;  1JKG A;  4IT7 A;  1N8Q A;  1KWI A;  4OK0 A;  3CCJ 3;  5A0O B;  3CCQ 3;  3F8X A;  4N6V 0;  1OHP A;  4K1U A;  4RNZ A;  4HM5 B;  4N6T A;  1O7N B;  1BNS A;  4HM3 B;  3RGA A;  3FF0 A;  1FGO A;  1PY3 A;  4HM4 B;  1IV9 A;  1RGF A;  2AAE A;  2HML B;  3FG4 A;  4HM1 B;  4I4K A;  3KE7 A;  3S29 A;  1Q86 4;  5CXO A;  2D42 A;  3T8N A;  1FGR A;  1S5A A;  4HM2 B;  3PGB A;  3H3H A;  5G1L A;  3NQZ A;  4PEJ A;  1TTO A;  3I55 3;  1U5O A;  1WMO A;  3JUM A;  2CFL A;  2O9U X;  3A5E A;  1W5Z A;  2XSH B;  3DGL A;  3URP A;  4CCV A;  5CF2 A;  4N6N B;  1UW1 A;  1STD A;  4GHO A;  5STD A;  3CXC 2;  2W56 B;  3BNE A;  1YJW 3;  1VQ9 3;  1OF5 B;  2C11 A;  1RNT A;  1EA2 A;  8RNT A;  1BAN A;  3UL5 A;  1BUJ A;  1JBS A;  3NV0 A;  1JKG B;  1X1W A;  3DUK A;  2KAA A;  2F5W A;  5JPU A;  2CFG A;  1RGG A;  3EBT A;  3OWS A;  1MOL A;  3LYG A;  1ISK A;  3X3Y A;  1N9E A;  6GSP A;  2UGI A;  4HKV B;  2AAD A;  1I3I A;  4BTY A;  3OX9 A;  1SJW A;  1CH0 A;  1V58 A;  4GB5 A;  2FXT A;  1GMQ A;  1ASK A;  2K0M A;  3TDG A;  3EN8 A;  1RCL A;  1W6C A;  1WQL B;  3CPO A;  5BXQ A;  3CCR 3;  1VQ5 3;  3OWY A;  3DH2 A;  2GXF A;  3F9S A;  4N6L A;  1GY6 A;  3JUQ A;  1A2V A;  1AR0 A;  2LYX A;  1X1U A;  4QWT A;  2ZDJ A;  4H3U A;  1NB5 I;  1LRA A;  1UI7 A;  2KF5 A;  1G96 A;  4X2H A;  1NB3 I;  3N54 B;  3GZY B;  5JPP A;  3G71 3;  1IVW A;  3ALA A;  4NPB A;  3RDE A;  1UUV B;  1UCK A;  4WWU C;  1MGW A;  2J8X B;  4CDL A;  1RN1 A;  5G1K A;  1DVD A;  4OVM A;  1K28 A;  4J8T A;  4L8O A;  4I5Q A;  1YGE A;  3PXM A;  3PCS A;  4LZI A;  1VQQ A;  1O7P B;  4EW5 A;  3DMC A;  1UI8 A;  3CCU 3;  2XR8 B;  4L8P A;  1DET A;  1GYB A;  2CG0 A;  3SVA A;  5IG4 A;  1BRJ A;  5TGN A;  1N9J A;  2P05 A;  4KZ1 A;  3FGY A;  2ML6 A;  3CC4 3;  1T2I A;  4KT3 B;  1RMS A;  2FNQ A;  1WNH A;  3BLZ A;  1JNQ A;  4WHA A;  1IQ8 A;  2GEY A;  2XH9 A;  2KF4 A;  1Y4K A;  5AIH A;  3UNL A;  1JZD A;  1ULJ B;  2R41 A;  4HBR A;  3OW2 2;  1HYF A;  3KN4 A;  5CLK A;  1UCJ A;  4XBT A;  3ZG0 A;  2L1S A;  1NU3 A;  1BSD A;  1EEJ A;  1BNF A;  5DRV A;  1ZO2 A;  2W03 A;  3PS8 A;  4HZ9 B;  1FA3 A;  3ER7 A;  3KFQ C;  5IEP A;  3CPW 2;  1A2P A;  1B2M A;  5AI1 A;  3CMA 3;  1O7G B;  2RGQ A;  4O2H A;  2XEP A;  3UL6 A;  2BO9 B;  1RGL A;  2CFW A;  3VSY A;  2PZV A;  3X42 A;  2OCT A;  1STF I;  1DMQ A;  3GZX B;  3PCR A;  1D6U A;  1T3B A;  1LQG C;  4MMY B;  4BU4 A;  4ORL A;  4EV2 A;  1DMN A;  3I0Y A;  3CNM A;  1A90 A;  1GMP A;  3L0R A;  1IT7 A;  1GOY A;  3WHO A;  3WOF B;  1BVI A;  3NBJ A;  1I8V A;  5AEU B;  1AV4 A;  5ELJ A;  2XGL A;  1N8R 4;  3B7C A;  2C10 A;  5BU4 A;  1VQK 3;  2W9Q A;  2O3O A;  1KD1 4;  1BU4 A;  1VQO 3;  1RGE A;  3MYT A;  4FCJ A;  4J9A A;  2CIU A;  3U97 A;  2HMN B;  1IT8 A;  3T0U A;  3V92 A;  1YHQ 3;  5FGO A;  1UUW B;  3UJM A;  1WMN A;  1RGH A;  3NM2 A;  1VQ4 3;  3B4O A;  3EF8 A;  3SX1 A;  3B8L A;  3PZW A;  2OQE C;  5CF1 A;  1CYU A;  1EQK A;  3BIR A;  2MC8 A;  7STD A;  1TRP A;  2ML5 A;  4FMB A;  5D81 A;  1NWW A;  2XSO B;  3AHW A;  3X3Z A;  1HU9 A;  3V99 A;  2Z77 A;  1D6Y A;  3WA2 X;  4RZM A;  1I3F A;  1EUI C;  2E2V A;  3K9M C;  3DZL A;  3T8U A;  2OTL 3;  1NO3 A;  2WGO A;  1GD4 A;  3MWZ A;  1MWS A;  1JBT A;  3AHS A;  4HZB B;  1VQ6 3;  3VGN A;  3S27 A;  2BHM A;  4R80 A;  5AEW B;  1Q81 4;  2WO0 A;  4R1K A;  1YIT 3;  6RNT A;  4X2O A;  2P0X A;  3CNX A;  2RBI A;  3NM7 A;  3FG3 A;  3KII A;  1RHL A;  2R4I A;  3HK4 A;  3JUN A;  4RBN A;  4AKY A;  5IG5 A;  3CC2 3;  2Z76 A;  4FMA A;  3STD A;  3CCM 3;  2F4Y A;  3OV4 A;  4LGQ A;  2IUJ A;  4LYL B;  1X1Y A;  4MMX B;  1YVB I;  3KSE D;  3FZW A;  3G16 A;  3SED A;  3WOE B;  1Q40 A;  2W2C A;  3B4P A;  3J7Y d;  2RCD A;  4XB5 A;  3GRD A;  5HGR A;  1BRN L;  2SAR A;  4KFE A;  1L5G B;  4WFO A;  4WYK A;  2OWP A;  1KQS 2;  2IYJ A;  1DE3 A;  1LXE A;  4R4K A;  3ECF A;  1E3V A;  3CCS 3;  4HM0 B;  1Q82 4;  1DVC A;  1I70 A;  1FUS A;  1RN7 A;  2WOF A;  2IMJ A;  1K73 4;  2YFJ B;  1IVU A;  2KCD A;  4IPB A;  2KRT A;  2KF6 A;  2CX1 A;  1ZX2 A;  5I97 A;  1B27 A;  1LNI A;  4DKI A;  2H0I A;  1SQW A;  4BTX A;  1MWR A;  2RNT A;  3EN1 B;  2HMK B;  1I0X A;  3EHC A;  1K9M 4;  4GSP A;  1UCL A;  7GSP A;  1YJ9 3;  5D82 A;  1RTU A;  4XBX A;  2E2T A;  1VQM 3;  3HIG A;  5BIR A;  1LOY A;  1BNE A;  1GOV A;  1ROA A;  2INX A;  1SPU A;  9RNT A;  4HOH A;  3KCH A;  1OHO A;  3RNT A;  1B21 A;  1M9G A;  1PYL A;  3FCS B;  3WMD A;  4BTW A;  4N6O B;  1VQ7 3;  1Q40 B;  3WA3 A;  1IYY A;  1JJ2 2;  3FF2 A;  5AIF A;  2B24 B;  7RNT A;  1Q9E A;  3G6E 3;  1X1X A;  1IQX A;  1GMR A;  1UDI I;  3ROB A;  1BSE A;  1BNG A;  1AQZ A;  2K54 A;  1BSA A;  4Q53 A;  1JZO A;  1B2Z A;  1JN5 A;  1QAK A;  1UGH I;  2SBL A;  3NV0 B;  1W6Y A;  2GSP A;  3EX9 A;  3ZG5 A;  1TU5 A;  1B2X A;  3CCV 3;  1OAC A;  2W9P A;  1PU4 A;  3BNB A;  5IF6 A;  3NBR A;  3LT9 A;  2QGU A;  1M1X B;  1QJG A;  1LQM B;  1FUW A;  3HI7 A;  3DGY A;  2I9W A;  4XDV A;  1I2G A;  3NUV A;  3OXA A;  1IVV A;  1B20 A;  1RCK A;  1RJO A;  2UX0 A;  3SOY A;  3WDG B;  3CC7 3;  2HOH A;  3M8C A;  1HZ1 A;  1VZZ A;  1GY5 A;  3LTA A;  4FMC A;  3FG1 A;  1G02 A;  1W00 A;  3LT8 A;  1RRH A;  4K61 A;  4IIA A;  4KFF A;  5G2G A;  1TFO A;  1ULI B;  3K7C A;  4HYZ A;  1RSN A;  2L4V A;  4N6U A;  2GBX B;  4HM6 B;  3LTC A;  3AMO A;  3DXO A;  1BRH A;  1RGA A;  4OUQ A;  1W6G A;  2BMO B;  2C4B A;  2W6J H;  1QMA A;  2CWU A;  5IG0 A;  1GY7 A;  1O7H B;  1A2K A;  1BSC A;  1JB5 A;  1UUG B;  1B3S A;  1B2U A;  2LQV A;  2QEX 3;  3HII A;  2OTJ 3;  1OH0 A;  3D5I A;  1RNB A;  3N8B A;  1W01 A;  2CWT A;  3Q1C A;  1VQN 3;  1RKY A;  4MMZ B;  1N5P A;  3BND A;  3H51 A;  1T2H A;  1IDP A;  2UUG C;  2W04 A;  3G4S 3;  3DGO A;  2JDI H;  1ZS7 A;  2YX9 A;  1JRQ A;  2CFK A;  1ZGX A;  2WOH A;  3EC9 A;  1FYS A;  1AVL A;  3F14 A;  3F40 A;  2F99 A;  3N9H A;  2H0G A;  4EXR A;  4CPK A;  3CCL 3;  1UCI A;  5M19 A;  1OGZ A;  3HZP A;  3GSP A;  1LNH A;  2P38 A;  1BSB A;  5AII A;  1RGC A;  2OOV C;  2Z6B A;  3PYJ A;  3OWU A;  4BIR A;  1OUN A;  3LTD A;  2YFL B;  3VF1 A;  5LC7 A;  1LOX A;  1ROV A;  1IV7 A;  1YIJ 3;  1GSP A;  4HAA A;  4FMD A;  4HJL B;  1BNR A;  3GWR A;  4L7K A;  1QAL A;  2V1L A;  3SYU A;  1C54 A;  1GOU A;  1F8N A;  1BRK A;  1SAR A;  2Y73 A;  4XDW A;  1NJI 4;  1A67 A;  1W02 A;  3MKI A;  5GSP A;  3K5T A;  5EEO A;  4GL6 A;  3BU4 A;  4O8S A;  1YJN 3;  1BNJ A;  3F8H A;  5EVH A;  2IA7 A;  1AY7 A;  3SXX A;  1BRS A;  2F56 A;  2F5M A;  4EV5 A;  3LTB A;  3X41 A;  3LML A;  5KP3 A;  1OF5 A;  3FLJ A;  3KZT A;  1Q7Y 4;  2A15 A;  2RSX A;  1DMM A;  8CHO A;  3S67 A;  1K8A 4;  1BOX A;  4MJD A;  2RFR A;  1W7C A;  2CK3 H;  3JUP A;  3MHE A;  1RN4 A;  4AEQ A;  3Q2P A;  2KXG A;  3FH1 A;  3GAX A;  3JUO A;  3V98 A;  3CME 3;  4BL3 A;  1FGT A;  1CEW I;  3EBY A;  5AYR B;  1BUQ A;  1YVS A;  2W0Q A;  2ZL8 A;  3EQQ B;  3KKG A;  3WR2 A;  4EYC A;  3MSO A;  5IG3 A;  1BRI A;  1VQL 3;  4LMI A;  1EKM A;  4FCZ A;  3NHX A;  3FKA A;  2CFD A;  3S5C A;  1O7M B;  3SOA A;  4FR9 A;  1PFP A;  4O02 B;  1YGW A;  1RRL A;  1YNV X;  2CX0 A;  2K3D A;  1FUT A;  3ZFZ A;  3CCE 3;  5IEO A;  4RNT A;  2WGQ A;  3O8Y A;  1FGQ A;  1Z1S A;  2CC3 A;  2HMM B;  4R9K A;  1GD3 A;  2BIR A;  1V74 A;  2CW9 A;  1WTH A;  2BMR B;  1MWU A;  2Q07 A;  3LOY A;  3QK9 A;  1BAO A;  2CHC A;  3EJV A;  2CG1 A;  3S28 A;  1VQ8 3;  2IUK A;  2F98 A;  2XFT A;  1YI2 3;  1TRQ A;  2GEX A;  3RGR A;  6STD A;  1TP6 A;  1SIH A;  1C7H A;  3BB9 A;  1TJD A;  4LEH A;  1K41 A;  1BIR A;  2GU3 A;  1QVF 2;  2JQ5 A;  1S72 3;  2B1X B;  1QAF A;  1GS3 A;  1R4C A;  3X3X A;  2HMO B;  2HMJ B;  3F7S A;  4TX4 A;  4WYK B;  4JF8 A;  2GU1 A;  3LH4 A;  4K90 B;  3KSP A;  2E2U A;  2Z7A A;  5IEN A;  1E97 A;  2OQE A;  3D9R A;  5JBS A;  1M1K 4;  1R4Y A;  4EC6 A;  3E99 A;  5LC6 A;  2XGN A;  2PNC A;  2OOV A;  1IK3 A;  4BL2 A;  1JV2 B;  4RNY A;  3X40 A;  1G0T A;  5RNT A;  4WP5 A;  4STD A;  4J5K A;  3IMA B;  4CJN A;  1J2B A;  5AIG A;  4H61 A;  2XFS A;  1RDS A;  3Q3F A;  4HM8 B;  4JRF A;  4ZM8 A;  1BNI A;  3U1W A;  1TIJ A;  2CWV A;  4HVN A;  5BVB A;  1JB4 A;  1I2E A;  1TFK A;  2CH9 A;  3A76 A;  3K63 A;  1V57 A;  4N6M A;  3NXJ A;  5M18 A;  4AKZ A;  3EE1 A;  4KFD A;  5D83 A;  3D4A A;  3HX8 A;  3MG3 A;  1JBR A;  1CQS A;  4MEI A;  1LVN A;  5AYS C;  3GZR A;  3G8Z A;  1UGI A;  2P09 A;  4LSO A;  1T5Y A;  5FW5 A;  4G1M B;  5EQL A;  3G0K A;  1US1 A;  2P0M A;  5M1A A;  1N5H A;  1OCV A;  1KC8 4;  2KF3 A;  3D3L A;  1VQP 3;  3HOH A;  1JN5 B;  3QRD A;  3F7X A;  3IPT A;  4K1V A;  1FGM A;  1OGX A;  1QVG 2;  2ZHX B;  4NRE A;  1JB2 A;  1FZU A;  3DY5 A;  3WOD G;  1KSI A;  2BU4 A;  2GBW B;  3Q90 A;  4J5G A;  1OPY A;  4U13 A;  5ELU A;  1M90 4;  3GZB A;  5KP4 A;  1CYV A;  1NDO B;  5CK6 A;  1E3R A;  1MGR A;  3SLU A;  2H0H A;  3IJE B;  2M7O A;  3MG1 A;  1EG9 B;  3BNC A;  1TUH A;  2ZA4 A;  1Q7H A;  4HM7 B;  2FGT A;  1RLS A;  4NHF A;  4R9L A;  2YFI B;  1LOW A;  3DGN A;  3AMO B;  2XRX B;  3UB1 A;  2MF7 A;  1AVK A;  2IY2 A;  2QIY A;  2STD A;  1WMP A;  3MG2 A;  3NX0 A;  4EBG A;  3LXU X;  4XM4 A;  1MWT A;  1IVX A;  2Y74 A;  3D5G A;  1W2B 2;  2F86 B;  1W2Z A;  2BNG A;  3CU3 A;  4O3V A;  1B2S A;  2CKF B;  5KP1 A; 
#chains in the Genus database with same CATH homology
 5DRE A;  3DGM A;  3FSD A;  5IW9 A;  5IER A;  1OHS A;  1W4N A;  4N3V A;  1U8C B;  2QA4 3;  2D1W A;  3CD6 3;  1IU7 A;  4FCM A;  2XF3 A;  3MPH A;  1DYU A;  2BT3 A;  4KVH A;  3JVC A;  1Q42 A;  3K0Z A;  4XBY A;  2W56 A;  1O7W B;  3NQY A;  3EB8 A;  3LZA A;  1D6Z A;  2BMQ B;  3I56 3;  1SII A;  3NBB A;  3DM8 A;  1MNL A;  1HKX A;  1IQY A;  1JKG A;  4IT7 A;  1N8Q A;  1KWI A;  4OK0 A;  3CCJ 3;  5A0O B;  3CCQ 3;  3F8X A;  4N6V 0;  1OHP A;  4K1U A;  4RNZ A;  4HM5 B;  4N6T A;  1O7N B;  4HM3 B;  3RGA A;  3FF0 A;  1FGO A;  4HM4 B;  1IV9 A;  2HML B;  3FG4 A;  4HM1 B;  4I4K A;  3KE7 A;  3S29 A;  1Q86 4;  5CXO A;  2D42 A;  3T8N A;  1FGR A;  1S5A A;  4HM2 B;  3PGB A;  3H3H A;  3NQZ A;  4PEJ A;  3I55 3;  1WMO A;  3JUM A;  2CFL A;  2O9U X;  5CF2 A;  1W5Z A;  2XSH B;  3DGL A;  4CCV A;  4N6N B;  1UW1 A;  1STD A;  5STD A;  3CXC 2;  1YJW 3;  2W56 B;  3BNE A;  1VQ9 3;  1OF5 B;  2C11 A;  1EA2 A;  3UL5 A;  3NV0 A;  1JKG B;  3DUK A;  5JPU A;  2CFG A;  3OWS A;  3EBT A;  1MOL A;  3LYG A;  1ISK A;  3X3Y A;  1N9E A;  4HKV B;  4BTY A;  3OX9 A;  1SJW A;  4GB5 A;  2FXT A;  1ASK A;  2K0M A;  3TDG A;  3EN8 A;  1WQL B;  1W6C A;  5BXQ A;  3CPO A;  3CCR 3;  1VQ5 3;  3OWY A;  2GXF A;  3F9S A;  4N6L A;  1GY6 A;  3JUQ A;  1A2V A;  1AR0 A;  2LYX A;  4QWT A;  1NB5 I;  2ZDJ A;  4H3U A;  1UI7 A;  4X2H A;  1G96 A;  1NB3 I;  3N54 B;  3GZY B;  5JPP A;  3G71 3;  1IVW A;  3ALA A;  3RDE A;  1UUV B;  4WWU C;  4CDL A;  1DVD A;  4OVM A;  1K28 A;  4J8T A;  4L8O A;  1YGE A;  3PXM A;  3PCS A;  4LZI A;  1O7P B;  3DMC A;  1UI8 A;  3CCU 3;  2XR8 B;  4L8P A;  2CG0 A;  1GYB A;  3SVA A;  5IG4 A;  5TGN A;  1N9J A;  2P05 A;  4KZ1 A;  3FGY A;  2ML6 A;  3CC4 3;  2FNQ A;  3BLZ A;  1WNH A;  4WHA A;  1JNQ A;  1IQ8 A;  2GEY A;  2XH9 A;  1Y4K A;  5AIH A;  3UNL A;  1ULJ B;  4HBR A;  3OW2 2;  5CLK A;  3KN4 A;  4XBT A;  1NU3 A;  5DRV A;  1ZO2 A;  2W03 A;  3PS8 A;  4HZ9 B;  1FA3 A;  3ER7 A;  3KFQ C;  5IEP A;  3CPW 2;  5AI1 A;  3CMA 3;  1O7G B;  2RGQ A;  4O2H A;  2XEP A;  3UL6 A;  2BO9 B;  3VSY A;  2CFW A;  2PZV A;  3X42 A;  2OCT A;  1STF I;  1DMQ A;  3GZX B;  3PCR A;  1D6U A;  4MMY B;  4ORL A;  4EV2 A;  1DMN A;  3I0Y A;  3CNM A;  1A90 A;  3L0R A;  1IT7 A;  3WOF B;  3NBJ A;  5AEU B;  1AV4 A;  5ELJ A;  2XGL A;  1N8R 4;  3B7C A;  2C10 A;  1VQK 3;  2W9Q A;  2O3O A;  1KD1 4;  1VQO 3;  4FCJ A;  3MYT A;  4J9A A;  2CIU A;  3U97 A;  2HMN B;  1IT8 A;  3T0U A;  3V92 A;  1YHQ 3;  5FGO A;  1UUW B;  3UJM A;  1WMN A;  3NM2 A;  1VQ4 3;  3B4O A;  3EF8 A;  3SX1 A;  3B8L A;  3PZW A;  2OQE C;  5CF1 A;  1CYU A;  1EQK A;  2MC8 A;  7STD A;  2ML5 A;  4FMB A;  5D81 A;  1NWW A;  2XSO B;  3X3Z A;  1HU9 A;  3V99 A;  2Z77 A;  1D6Y A;  3WA2 X;  4RZM A;  2E2V A;  3K9M C;  3DZL A;  3T8U A;  2OTL 3;  1NO3 A;  2WGO A;  1GD4 A;  3MWZ A;  4HZB B;  1VQ6 3;  3VGN A;  3S27 A;  2BHM A;  4R80 A;  5AEW B;  1Q81 4;  2WO0 A;  4R1K A;  1YIT 3;  4X2O A;  2P0X A;  3CNX A;  3NM7 A;  3FG3 A;  3KII A;  2R4I A;  3HK4 A;  3JUN A;  4RBN A;  4AKY A;  5IG5 A;  3CC2 3;  2Z76 A;  4FMA A;  3STD A;  3CCM 3;  3OV4 A;  4LGQ A;  2IUJ A;  4MMX B;  1YVB I;  3KSE D;  3FZW A;  3G16 A;  3SED A;  3WOE B;  1Q40 A;  2W2C A;  3B4P A;  3J7Y d;  2RCD A;  4XB5 A;  3GRD A;  5HGR A;  4KFE A;  1L5G B;  4WFO A;  4WYK A;  2OWP A;  1KQS 2;  1LXE A;  4R4K A;  3ECF A;  1E3V A;  3CCS 3;  4HM0 B;  1Q82 4;  1DVC A;  1RN7 A;  2WOF A;  2IMJ A;  1K73 4;  2YFJ B;  1IVU A;  2KCD A;  4IPB A;  2KRT A;  1ZX2 A;  5I97 A;  1SQW A;  4BTX A;  3EN1 B;  2HMK B;  3EHC A;  1K9M 4;  1YJ9 3;  5D82 A;  4XBX A;  2E2T A;  1VQM 3;  3HIG A;  2INX A;  1ROA A;  1SPU A;  1OHO A;  1M9G A;  3FCS B;  3WMD A;  4BTW A;  4N6O B;  1VQ7 3;  1Q40 B;  3WA3 A;  1JJ2 2;  3FF2 A;  5AIF A;  2B24 B;  3G6E 3;  1IQX A;  3ROB A;  2K54 A;  4Q53 A;  1JN5 A;  1QAK A;  2SBL A;  3NV0 B;  1W6Y A;  3EX9 A;  1TU5 A;  3CCV 3;  1OAC A;  2W9P A;  1PU4 A;  3BNB A;  5IF6 A;  3NBR A;  3LT9 A;  2QGU A;  1M1X B;  1QJG A;  1FUW A;  3HI7 A;  2I9W A;  4XDV A;  3NUV A;  3OXA A;  1IVV A;  1RJO A;  2UX0 A;  3WDG B;  3SOY A;  3CC7 3;  3M8C A;  3LTA A;  1VZZ A;  1GY5 A;  4FMC A;  3FG1 A;  1W00 A;  3LT8 A;  1RRH A;  4K61 A;  4IIA A;  4KFF A;  5G2G A;  1TFO A;  1ULI B;  3K7C A;  4HYZ A;  2L4V A;  4N6U A;  2GBX B;  4HM6 B;  3LTC A;  3AMO A;  3DXO A;  4OUQ A;  1W6G A;  2BMO B;  2W6J H;  1QMA A;  2CWU A;  5IG0 A;  1GY7 A;  1O7H B;  1A2K A;  2LQV A;  1JB5 A;  2OTJ 3;  2QEX 3;  3HII A;  1OH0 A;  3N8B A;  1W01 A;  2CWT A;  3Q1C A;  1VQN 3;  1RKY A;  4MMZ B;  1N5P A;  3BND A;  3H51 A;  1IDP A;  2W04 A;  3G4S 3;  3DGO A;  2JDI H;  2YX9 A;  1JRQ A;  2CFK A;  2WOH A;  3EC9 A;  1AVL A;  3F14 A;  3F40 A;  2F99 A;  3N9H A;  4EXR A;  3CCL 3;  1OGZ A;  3HZP A;  1LNH A;  2P38 A;  5AII A;  2OOV C;  2Z6B A;  3PYJ A;  3OWU A;  1OUN A;  3LTD A;  2YFL B;  3VF1 A;  5LC7 A;  1LOX A;  1ROV A;  1IV7 A;  1YIJ 3;  4FMD A;  4HJL B;  3GWR A;  4L7K A;  1QAL A;  2V1L A;  4XDW A;  1F8N A;  2Y73 A;  1NJI 4;  1A67 A;  1W02 A;  3MKI A;  3K5T A;  5EEO A;  4GL6 A;  1YJN 3;  4O8S A;  3F8H A;  5EVH A;  2IA7 A;  3SXX A;  4EV5 A;  3LTB A;  3X41 A;  3LML A;  5KP3 A;  1OF5 A;  3FLJ A;  3KZT A;  1Q7Y 4;  2A15 A;  2RSX A;  1DMM A;  8CHO A;  3S67 A;  1K8A 4;  4MJD A;  2RFR A;  1W7C A;  2CK3 H;  3JUP A;  3MHE A;  4AEQ A;  3Q2P A;  2KXG A;  3FH1 A;  3GAX A;  3JUO A;  3V98 A;  3CME 3;  1FGT A;  1CEW I;  3EBY A;  5AYR B;  1BUQ A;  2W0Q A;  2ZL8 A;  3EQQ B;  3KKG A;  4EYC A;  3MSO A;  5IG3 A;  1VQL 3;  4LMI A;  1EKM A;  4FCZ A;  3NHX A;  3FKA A;  2CFD A;  3S5C A;  1O7M B;  3SOA A;  4FR9 A;  1PFP A;  4O02 B;  1RRL A;  3CCE 3;  5IEO A;  2WGQ A;  3O8Y A;  1FGQ A;  1Z1S A;  2CC3 A;  2HMM B;  4R9K A;  1GD3 A;  1V74 A;  2CW9 A;  1WTH A;  2BMR B;  2Q07 A;  3LOY A;  3QK9 A;  3S28 A;  2CHC A;  3EJV A;  2CG1 A;  1VQ8 3;  2IUK A;  2F98 A;  2XFT A;  1YI2 3;  2GEX A;  3RGR A;  6STD A;  1TP6 A;  1SIH A;  1C7H A;  3BB9 A;  4LEH A;  1QVF 2;  1K41 A;  2GU3 A;  2JQ5 A;  1S72 3;  2B1X B;  1QAF A;  1GS3 A;  1R4C A;  3X3X A;  2HMO B;  2HMJ B;  3F7S A;  4TX4 A;  4WYK B;  4JF8 A;  2GU1 A;  3LH4 A;  4K90 B;  3KSP A;  2E2U A;  2Z7A A;  5IEN A;  1E97 A;  2OQE A;  3D9R A;  5JBS A;  1M1K 4;  4EC6 A;  3E99 A;  5LC6 A;  2XGN A;  2PNC A;  2OOV A;  1IK3 A;  1JV2 B;  4RNY A;  3X40 A;  4WP5 A;  4STD A;  3IMA B;  1J2B A;  5AIG A;  4H61 A;  2XFS A;  4HM8 B;  4JRF A;  4ZM8 A;  3U1W A;  1TIJ A;  2CWV A;  4HVN A;  5BVB A;  1JB4 A;  2CH9 A;  1TFK A;  3A76 A;  3K63 A;  4N6M A;  3NXJ A;  4AKZ A;  3EE1 A;  4KFD A;  5D83 A;  3HX8 A;  3MG3 A;  1CQS A;  4MEI A;  1LVN A;  5AYS C;  3GZR A;  3G8Z A;  4LSO A;  2P09 A;  5FW5 A;  1T5Y A;  4G1M B;  5EQL A;  3G0K A;  1US1 A;  2P0M A;  1N5H A;  1OCV A;  1KC8 4;  3D3L A;  1VQP 3;  1JN5 B;  3QRD A;  3F7X A;  3IPT A;  4K1V A;  1FGM A;  1OGX A;  1QVG 2;  4NRE A;  1JB2 A;  3DY5 A;  3WOD G;  1KSI A;  2GBW B;  3Q90 A;  1OPY A;  4U13 A;  5ELU A;  1M90 4;  3GZB A;  5KP4 A;  1CYV A;  1NDO B;  5CK6 A;  1E3R A;  3SLU A;  3IJE B;  2M7O A;  3MG1 A;  1EG9 B;  3BNC A;  1TUH A;  4HM7 B;  4R9L A;  2FGT A;  4NHF A;  2YFI B;  3DGN A;  3UB1 A;  3AMO B;  2XRX B;  2MF7 A;  1AVK A;  2QIY A;  2STD A;  1WMP A;  3MG2 A;  3NX0 A;  4EBG A;  3LXU X;  4XM4 A;  1IVX A;  2Y74 A;  1W2B 2;  2F86 B;  1W2Z A;  2BNG A;  3CU3 A;  4O3V A;  1U5O A;  2CKF B;  5KP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...