1A90A

Recombinant mutant chicken egg white cystatin, nmr, 31 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
108
structure length
108
Chain Sequence
b'GAPVPVDENDEGLQRALQFAIAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPELAKYTTCTFVVYSIPWLNQIKLLESKCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN
publication title The structures of native phosphorylated chicken cystatin and of a recombinant unphosphorylated variant in solution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Thiol protease inhibitor
total genus 18
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1a90A00
4N6LA 3KSED 1IV9A 3GAXA 4N6OB 1MNLA 1A90A 3K9MC 3PYJA 5ELJA 3IMAB 4CCVA 3KFQC 1N5HA 1CYUA 1FUWA 1NB5I 1N9JA 1TIJA 1DVDA 5ELUA 1CYVA 5EQLA 1ROAA 3UL6A 1CEWI 1MOLA 1PFPA 4IT7A 3UL5A 1IV7A 1RN7A 1EQKA 4ZM8A 3S67A 1DVCA 5LC7A 2O9UX 1WNHA 4N6NB 3PS8A 4N6V0 4EYCA 2W9PA 3LH4A 5A0OB 1KWIA 2OCTA 4TX4A 1N5PA 3Q2PA 1GD3A 4N6MA 3PXMA 1A67A 1LXEA 3L0RA 1R4CA 1GD4A 4N6UA 1FA3A 1YVBI 2BO9B 2CH9A 3MWZA 3NX0A 2W9QA 1STFI 1G96A 3SVAA 2KXGA 4N6TA 1NB3I 3QRDA 1M9GA 4LZIA 5LC6A
chains in the Genus database with same CATH superfamily
1SJWA 1BOXA 4N6LA 4KFDA 4MEIA 1ASKA 2YFLB 4H3UA 5JBSA 3HIGA 1IV9A 1UUVB 1YJN3 1O7HB 2SBLA 3K7CA 1GMPA 1A2KA 4EV5A 1SPUA 3T8UA 2OTJ3 1ULJB 4HYZA 3VF1A 4LEHA 1A90A 3EB8A 3K9MC 1BUJA 4X2OA 1RHLA 2RSXA 3NQYA 1Q40A 3IMAB 2FNQA 3OV4A 1BRIA 3JUQA 3T8NA 4FCJA 1RCKA 2XF3A 1IVXA 1TTOA 3B8LA 4XBTA 3DM8A 3GZYB 1O7NB 2H0GA 3JVCA 2CFWA 4FMCA 1DVDA 1RRLA 5ELUA 3S28A 2F4YA 2HMKB 1A2VA 2RNTA 1O7GB 3MG1A 2GU1A 1Q824 1AR0A 4L8OA 2RFRA 1TP6A 4BL3A 5IG5A 5KP1A 4XBXA 1B2MA 1A2PA 2CHCA 5AEWB 3J7Yd 1VQ73 8RNTA 1AY7A 5IG0A 2E2VA 1TU5A 3UNLA 2OTL3 2K3DA 6STDA 2I9WA 1LVNA 2KCDA 1B27A 3DGLA 1VQL3 1RN7A 2F86B 1VQ93 1I70A 1RGHA 3NXJA 4HJLB 3HX8A 1W6CA 4ZM8A 4J5GA 1HYFA 1BNJA 1OHPA 1QVF2 3ZFZA 2K54A 3FSDA 3NQZA 3CU3A 2V1LA 1W2ZA 1X1XA 4BTXA 3FGYA 1DMQA 4CPKA 5HOHA 3STDA 1KQS2 4XM4A 4HM5B 3SEDA 2PNCA 2OOVC 3DGMA 2W0QA 2CG1A 1IVVA 3QK9A 5IEOA 4EBGA 1KWIA 2Z76A 3BNDA 4MMZB 3BNCA 3AMOB 1VQ63 1JBTA 3BNBA 2F99A 1RRHA 3ZG5A 1GSPA 3SOAA 7GSPA 2CWUA 3H51A 3CCL3 1FGMA 2MC8A 3B7CA 4FMAA 1JNQA 5IENA 1BNEA 1JZOA 2FGTA 2ZDJA 3MKIA 5TGNA 1SIHA 2W2CA 3Q2PA 4N3VA 4EXRA 2R41A 1NDOB 2F5WA 1QVG2 2KRTA 1AVKA 3WODG 1N8R4 3FG1A 1LXEA 1RGEA 3NV0A 3AGOA 3D9RA 3LTDA 5IW9A 3HI7A 2OQEC 2CFGA 2IY2A 4NPBA 2BNGA 1AV4A 1RGFA 3MG3A 4N6UA 1O7MB 3G4S3 2WGOA 1D6UA 1OPYA 4O2HA 1GYBA 1T3BA 2AADA 2BO9B 2F98A 3V98A 1LNIA 1WTHA 2CKFB 1UCJA 1ZS7A 2CC3A 3KCHA 2W9QA 1IVUA 1SQWA 2H0HA 4HBRA 2IUKA 3WA3A 2O3OA 3PZWA 1S5AA 3SVAA 1LQGC 3JUPA 2KXGA 4XB5A 1MGRA 1JBSA 9RNTA 1M9GA 5M1AA 1BSDA 3BNEA 4L8PA 4J5KA 1N9EA 3AHWA 1K8A4 5CF1A 3KE7A 3PCSA 3ER7A 3WA2X 1BRGA 3E99A 2ML6A 3KIIA 2PZVA 1YVSA 4FCZA 2Z7AA 5EVHA 4Q53A 3GAXA 3LXUX 4HVNA 1YJW3 5GSPA 3RGRA 1MNLA 5IF6A 3CNMA 2W03A 1IT8A 1GY7A 2M7OA 3CC23 3S27A 3N54B 1YNVX 3I553 1VQK3 3CCE3 2MF7A 2KF4A 5ELJA 2W56A 4CCVA 1NJI4 3K63A 4HAAA 1N5HA 1ISKA 1CYUA 1UCIA 3EC9A 3LYGA 4HKVB 3G713 1AQZA 1TIJA 4KFEA 1PY3A 3X3XA 2XEPA 1DYUA 1CYVA 2D1WA 1QMAA 4GB5A 3IPTA 1ROVA 3HZPA 1T2IA 1BRSA 1EG9B 2OOVA 1YI23 3KN4A 4HM0B 1US1A 1D6ZA 2B1XB 2L1SA 3EN8A 4WYKA 1B21A 1Q7HA 3UL6A 1VQ43 4WWUC 1EEJA 1JJ22 4RNYA 5BVBA 4K90B 3F8XA 3LTBA 3TDGA 3CC73 1GMQA 1CEWI 1RNTA 1I3IA 3EHCA 3GWRA 3MG2A 1PU4A 3EQQB 3LMLA 4DKIA 4NHFA 2CX0A 3UL5A 4HM4B 5IEPA 1IV7A 2RGQA 3EX9A 1HU9A 1ZX2A 7RNTA 1EQKA 1DETA 2J8XB 1RLSA 1MWSA 3NBBA 3NM7A 2CFDA 3S67A 2FXTA 4BU4A 1K28A 3SXXA 2KF3A 4HOHA 1JB2A 1B2ZA 1RSNA 1B3SA 4RZMA 1RGKA 2O9UX 3M8CA 1Q40B 3CCU3 1OACA 1BU4A 3F14A 4HM2B 2HMOB 2OQEA 1UGHI 1WMNA 2GXFA 4EYCA 1EUIC 5A0OB 1X1UA 1TUHA 3WOEB 2C4BA 3JUOA 4I4KA 1GY6A 1WMPA 1DMMA 1UUGB 2XR8B 1MGWA 1Q42A 3FZWA 3CXC2 1W00A 2F5MA 2R4IA 1LOXA 5KP4A 3LT9A 1Y4KA 3G0KA 3PCRA 2ZL8A 1W5ZA 2CG0A 4XDVA 3G6E3 1GD3A 4O3VA 4CDLA 3EBTA 1BRNL 4RBNA 2XFSA 2P38A 4N6MA 1EKMA 3NHXA 5AIGA 3CPOA 1S723 3L0RA 3RNTA 3FH1A 4FCMA 3CD63 1W7CA 1DMNA 2F56A 1K41A 3DZLA 1HZ1A 1BNSA 2P0XA 3I0YA 2GU3A 4KZ1A 5CLKA 5KP3A 1LOVA 5FW5A 2CIUA 2CH9A 2C10A 2B24B 1UI7A 5STDA 1Q7Y4 1B20A 1YIJ3 3CC43 3HOHA 3N9HA 3NX0A 4WHAA 1VQN3 3B4PA 4QWTA 1JN5A 1JZDA 1RGAA 3DY5A 1STFI 5AYSC 3SLUA 2Z77A 1W02A 4BL2A 3DUKA 4EV2A 1IQYA 4MMXB 5I97A 4U13A 2ZHXB 1DE3A 1UCKA 1RDSA 2HMNB 1BAOA 1F8NA 3Q90A 4K61A 3QRDA 4HZBB 1X1YA 1W6YA 3F9SA 1E3RA 3D4AA 4R9LA 3WHOA 3X3ZA 1TFKA 1X1WA 2H0IA 4OK0A 2CW9A 1IQXA 1JKGA 3FF0A 4BIRA 4GSPA 3EBYA 3PGBA 1YGWA 1OCVA 1RTUA 4K1UA 1UW1A 1BSAA 1T5YA 2HMLB 1WMOA 2P09A 1GMRA 2XFTA 4ILFA 1EA2A 3PYJA 2Z6BA 3N8BA 3NV0B 1ZO2A 2P05A 4XBYA 1RN4A 2JDIH 5AIFA 3Q1CA 4R4KA 1T2HA 3KFQC 2GBXB 2IYJA 1NB5I 1I2EA 1RGGA 1BSCA 1N9JA 1B2XA 1JRQA 3KZTA 5EEOA 1FGQA 2W6JH 2WO0A 3S5CA 2KF5A 1ULIB 4BTYA 3AHSA 1KSIA 2WOHA 2XSHB 1MWUA 1AVLA 3FKAA 1E3VA 4KFFA 2YX9A 1BVIA 2L4VA 4EC6A 1JV2B 1O7PB 1OGZA 3GZXB 1VQP3 1Z1SA 2YFJB 4IPBA 1MOLA 1PFPA 4IT7A 1OHOA 1RKYA 4H61A 1BNRA 3X40A 3T0UA 3EJVA 4AKYA 3X42A 1LOWA 2A15A 3OXAA 4O8SA 2BHMA 2STDA 3WMDA 1FGRA 3WR2A 2Y74A 1DVCA 3A76A 5LC7A 3FLJA 5IG4A 3O8YA 4RNZA 4OUQA 1U5OA 1OUNA 2XRXB 2W56B 1RMSA 1NU3A 1BIRA 5CXOA 2CK3H 4HM1B 3IJEB 2W9PA 1GS3A 2HMJB 3SOYA 1W6GA 3EE1A 1Q864 1OF5A 4RNTA 1IU7A 1TJDA 4X2HA 3OX9A 1U8CB 1RJOA 1B2SA 2JQ5A 1V74A 1OH0A 1STDA 4FMDA 1UUWB 4WFOA 1I0XA 1Q814 1BGSA 1D6YA 3JUNA 1VQ83 1BRHA 3DGYA 1IQ8A 2WGQA 3DGOA 4LSOA 5G1LA 1N5PA 1TRPA 3D5GA 4WYKB 1TRQA 1LNHA 1GOYA 3FG4A 4R9KA 4MMYB 5FGOA 1MWTA 3Q3FA 4IIAA 5BIRA 2OWPA 3RGAA 3CCS3 2BU4A 4J9AA 2GBWB 3F7SA 1L5GB 3HK4A 2HMMB 3PXMA 3FCSB 1A67A 3DH2A 3FG3A 3CCQ3 2XGNA 3URPA 3MPHA 1QJGA 3U1WA 1R4CA 1BSEA 1GD4A 1FA3A 6RNTA 3D3LA 3ZG0A 1YJ93 5AIHA 1GOVA 3KKGA 1FUSA 5CF2A 1JB5A 3DGNA 8CHOA 1KD14 1JBRA 1IK3A 1K734 3LTCA 2XGLA 1OGXA 5BU4A 2IA7A 3LZAA 3ALAA 2CFKA 1N8QA 3MWZA 2C11A 1NO3A 3G8ZA 2XSOB 1QAKA 4R1KA 1LOYA 4JRFA 2RBIA 4GHOA 4R80A 5M18A 4LMIA 1M904 2ZA4A 1QALA 3VSYA 1G0TA 2W04A 3K5TA 2CFLA 3B4OA 1UI8A 3CPW2 3CCM3 3LT8A 3OWYA 1FGTA 4WP5A 3NUVA 1BNIA 1W4NA 3S29A 1O7WB 3KSPA 3KSED 4AEQA 3EF8A 1FZUA 1UDII 2ML5A 5IG3A 7STDA 4N6OB 2UX0A 3CMA3 1NWWA 3EN1B 4NREA 1LQMB 1CH0A 2XH9A 4LGQA 1KC84 1BSBA 2LQVA 3MYTA 1Q9EA 1V57A 4J8TA 2IUJA 1FUWA 3OW22 1RNBA 5DRVA 3BB9A 4FR9A 1W2B2 1I2GA 1V58A 2BMOB 2BMQB 4EW5A 2CWVA 2GSPA 5DREA 2RCDA 5AYRB 1I2FA 4HM7B 3F40A 3ROBA 3AMOA 5JPUA 1C54A 3BIRA 3GZRA 1R4YA 3GSPA 2WOFA 3OWUA 4G1MB 2E2TA 2QIYA 3CME3 1JN5B 2K0MA 4HM6B 1CQSA 4HM3B 5EQLA 5G1KA 1B2UA 1ROAA 2LYXA 1IDPA 3G16A 2Y73A 3K0ZA 5HGRA 1VQO3 1PYLA 2SARA 1VQM3 2P0MA 1RGCA 2BMRB 1UCLA 1BNGA 4HZ9B 2D42A 2QGUA 3CCJ3 5G2GA 1JKGB 3GRDA 3SYUA 1YHQ3 4PEJA 3AGNA 3JUMA 2GEYA 3UB1A 4O02B 1IYYA 1E97A 3F8HA 3DMCA 4JF8A 2QA43 1SIIA 1FYSA 1MWRA 2CWTA 1ZGXA 5JPPA 1VQ53 3CNXA 2GEXA 1BUQA 2AAEA 3NM2A 5IERA 1JB4A 5RNTA 1WNHA 2BT3A 2CX1A 1C7HA 4N6NB 1J2BA 1OHSA 1YGEA 3D79A 3DXOA 3PS8A 3MHEA 3A5EA 4N6V0 5AI1A 1I0VA 3NBRA 3LH4A 3U97A 2QEX3 4K1VA 1GOUA 3H3HA 1BANA 3I563 1FW7A 4FMBA 4I5QA 2OCTA 2INXA 5M19A 3V99A 5D83A 3WOFB 1HKXA 1K9M4 1SARA 5BXQA 3NBJA 1WQLB 1FUTA 4TX4A 4GL6A 3FF2A 3RDEA 1TFOA 3MSOA 5AIIA 1IVWA 3CCR3 1RCLA 3CCV3 1NNVA 2IMJA 2KAAA 1RGLA 4XDWA 5CK6A 1BRKA 3OWSA 4AKZA 2UGIA 2BIRA 4CJNA 5D82A 3ECFA 3VGNA 1G02A 6GSPA 1M1K4 4KVHA 1I8VA 3LOYA 2UUGC 1RN1A 2HOHA 1YVBI 3BU4A 3GZBA 4MJDA 3WDGB 1I3FA 2E2UA 4STDA 1M1XB 5D81A 2KF6A 4KT3B 3UJMA 1BRJA 1IT7A 3BLZA 4ORLA 3F7XA 5AEUB 1BNFA 1OF5B 3X3YA 1W01A 3SX1A 1VZZA 1G96A 3HIIA 4LYLB 1LRAA 4N6TA 1NB3I 1FGOA 2Q07A 3D5IA 1GY5A 3V92A 3X41A 4LZIA 1QAFA 4L7KA 4OVMA 1VQQA 4BTWA 1YIT3 2YFIB 5LC6A 3LTAA 4HM8B 1UGIA
chains in the Genus database with same CATH topology
1SJWA 4N6LA 4KFDA 4MEIA 1ASKA 2YFLB 4H3UA 5JBSA 3HIGA 1IV9A 1UUVB 1YJN3 1O7HB 2SBLA 3K7CA 4EV5A 1A2KA 1SPUA 3T8UA 2OTJ3 1ULJB 4HYZA 3VF1A 4LEHA 1A90A 3EB8A 3K9MC 4X2OA 2RSXA 3NQYA 1Q40A 3IMAB 2FNQA 3OV4A 3T8NA 3JUQA 4FCJA 2XF3A 1IVXA 3B8LA 4XBTA 3DM8A 3GZYB 1O7NB 3JVCA 2CFWA 4FMCA 1DVDA 1RRLA 5ELUA 3S28A 2HMKB 1A2VA 1O7GB 3MG1A 2GU1A 1Q824 1AR0A 4L8OA 2RFRA 1TP6A 5KP1A 5IG5A 4XBXA 2CHCA 1VQ73 5AEWB 3J7Yd 5IG0A 2E2VA 1TU5A 3UNLA 2OTL3 6STDA 2I9WA 1LVNA 2KCDA 3DGLA 1VQL3 1RN7A 2F86B 1VQ93 4HJLB 3NXJA 3HX8A 1W6CA 4ZM8A 1OHPA 1QVF2 2K54A 3FSDA 3NQZA 3CU3A 2V1LA 1W2ZA 4BTXA 3FGYA 1DMQA 3STDA 1KQS2 4XM4A 4HM5B 3SEDA 2PNCA 2OOVC 3DGMA 2W0QA 2CG1A 1IVVA 3QK9A 5IEOA 4EBGA 1KWIA 2Z76A 3BNDA 4MMZB 3BNCA 3AMOB 1VQ63 3BNBA 2F99A 1RRHA 3SOAA 2CWUA 3H51A 3CCL3 1FGMA 2MC8A 3B7CA 4FMAA 1JNQA 5IENA 2ZDJA 2FGTA 3MKIA 5TGNA 1SIHA 2W2CA 3Q2PA 4N3VA 4EXRA 1NDOB 1QVG2 2KRTA 1AVKA 3WODG 1N8R4 3FG1A 1LXEA 3NV0A 3D9RA 3LTDA 5IW9A 3HI7A 2OQEC 2CFGA 2BNGA 1AV4A 3MG3A 4N6UA 3G4S3 1O7MB 2WGOA 1D6UA 1OPYA 4O2HA 1GYBA 2BO9B 2F98A 3V98A 1WTHA 2CC3A 2W9QA 1IVUA 1SQWA 4HBRA 2IUKA 3WA3A 2O3OA 3PZWA 1S5AA 3SVAA 3JUPA 2KXGA 4XB5A 1M9GA 3BNEA 4L8PA 1K8A4 1N9EA 5CF1A 3KE7A 3PCSA 3ER7A 3WA2X 3E99A 2ML6A 3KIIA 2PZVA 4FCZA 2Z7AA 5EVHA 4Q53A 3GAXA 3LXUX 4HVNA 1YJW3 3RGRA 1MNLA 5IF6A 3CNMA 2W03A 1IT8A 1GY7A 2M7OA 3CC23 3S27A 3N54B 3I553 1VQK3 3CCE3 2MF7A 5ELJA 1NJI4 2W56A 4CCVA 3K63A 1N5HA 1ISKA 1CYUA 3EC9A 3LYGA 4HKVB 3G713 1TIJA 4KFEA 3X3XA 2XEPA 1DYUA 1CYVA 2D1WA 1QMAA 4GB5A 3IPTA 1ROVA 3HZPA 1EG9B 2OOVA 1YI23 3KN4A 4HM0B 1US1A 1D6ZA 2B1XB 3EN8A 4WYKA 3UL6A 1VQ43 4WWUC 1JJ22 4RNYA 5BVBA 4K90B 3F8XA 3LTBA 3TDGA 3CC73 3EHCA 1CEWI 3MG2A 3GWRA 1PU4A 3EQQB 3LMLA 4NHFA 3UL5A 4HM4B 5IEPA 1IV7A 2RGQA 3EX9A 1HU9A 1ZX2A 1EQKA 3NBBA 3NM7A 2CFDA 3S67A 2FXTA 1K28A 3SXXA 1JB2A 4RZMA 2O9UX 3M8CA 1Q40B 3CCU3 1OACA 3F14A 4HM2B 2OQEA 2HMOB 1WMNA 2GXFA 4EYCA 5A0OB 3WOEB 1TUHA 3JUOA 4I4KA 1GY6A 1DMMA 1WMPA 2XR8B 3FZWA 1Q42A 3CXC2 1W00A 2R4IA 1LOXA 5KP4A 3LT9A 1Y4KA 3G0KA 3PCRA 2ZL8A 1W5ZA 2CG0A 4XDVA 3G6E3 1GD3A 4O3VA 4CDLA 3EBTA 4RBNA 2XFSA 2P38A 4N6MA 1EKMA 3NHXA 5AIGA 3CPOA 1S723 3L0RA 3FH1A 4FCMA 3CD63 1W7CA 1DMNA 1K41A 3DZLA 2P0XA 3I0YA 2GU3A 4KZ1A 5CLKA 5KP3A 5FW5A 2CIUA 2CH9A 2C10A 2B24B 1UI7A 5STDA 1Q7Y4 3CC43 1YIJ3 3NX0A 3N9HA 4WHAA 1VQN3 3B4PA 4QWTA 1JN5A 3DY5A 3SLUA 4EV2A 1STFI 5AYSC 2Z77A 1W02A 3DUKA 1IQYA 4MMXB 5I97A 4U13A 2HMNB 3Q90A 1F8NA 4K61A 3QRDA 4HZBB 1W6YA 3F9SA 1E3RA 4R9LA 3X3ZA 1TFKA 4OK0A 2CW9A 1IQXA 1JKGA 3FF0A 3EBYA 3PGBA 1OCVA 4K1UA 1UW1A 1T5YA 2HMLB 1WMOA 2P09A 2XFTA 1EA2A 3PYJA 2Z6BA 3N8BA 3NV0B 1ZO2A 2P05A 4XBYA 2JDIH 5AIFA 3Q1CA 4R4KA 3KFQC 2GBXB 1NB5I 1N9JA 1JRQA 3KZTA 5EEOA 1FGQA 2W6JH 2WO0A 3S5CA 1ULIB 4BTYA 1KSIA 2WOHA 2XSHB 1AVLA 3FKAA 1E3VA 4KFFA 2YX9A 2L4VA 4EC6A 1JV2B 1O7PB 1OGZA 3GZXB 1VQP3 1Z1SA 2YFJB 4IPBA 1MOLA 1PFPA 4IT7A 1OHOA 1RKYA 4H61A 3X40A 3T0UA 3EJVA 4AKYA 3X42A 2A15A 3OXAA 4O8SA 2BHMA 2STDA 3WMDA 1FGRA 2Y74A 1DVCA 3A76A 5LC7A 3FLJA 5IG4A 3O8YA 4RNZA 4OUQA 1U5OA 1OUNA 2XRXB 2W56B 1NU3A 5CXOA 2CK3H 4HM1B 3IJEB 2W9PA 1GS3A 2HMJB 3SOYA 1W6GA 3EE1A 1Q864 1OF5A 1IU7A 4X2HA 3OX9A 1U8CB 1RJOA 2JQ5A 1V74A 1OH0A 1STDA 4FMDA 1UUWB 4WFOA 1Q814 1D6YA 3JUNA 1VQ83 1IQ8A 2WGQA 3DGOA 4LSOA 1N5PA 4WYKB 1LNHA 4R9KA 3FG4A 4MMYB 5FGOA 4IIAA 2OWPA 3RGAA 3CCS3 4J9AA 2GBWB 3F7SA 1L5GB 3HK4A 2HMMB 3PXMA 3FCSB 1A67A 3FG3A 3CCQ3 2XGNA 3MPHA 1QJGA 3U1WA 1R4CA 1GD4A 1FA3A 1YJ93 3D3LA 5AIHA 3KKGA 5CF2A 8CHOA 1JB5A 3DGNA 1KD14 1IK3A 1K734 3LTCA 2XGLA 1OGXA 2IA7A 3LZAA 3ALAA 2CFKA 1N8QA 3MWZA 2C11A 1NO3A 3G8ZA 2XSOB 1QAKA 4R1KA 4JRFA 4R80A 4LMIA 1M904 1QALA 3VSYA 2W04A 3K5TA 2CFLA 3B4OA 1UI8A 3CPW2 3CCM3 3LT8A 3OWYA 1FGTA 4WP5A 3NUVA 1W4NA 3S29A 1O7WB 3KSPA 3KSED 4AEQA 3EF8A 2ML5A 5IG3A 7STDA 4N6OB 2UX0A 3CMA3 1NWWA 3EN1B 4NREA 2XH9A 4LGQA 1KC84 2LQVA 3MYTA 4J8TA 2IUJA 1FUWA 3OW22 5DRVA 3BB9A 4FR9A 1W2B2 2BMQB 2BMOB 2CWVA 5DREA 2RCDA 5AYRB 4HM7B 3F40A 3ROBA 3AMOA 5JPUA 3GZRA 2WOFA 3OWUA 4G1MB 2E2TA 2QIYA 3CME3 1JN5B 2K0MA 4HM6B 1CQSA 4HM3B 5EQLA 1ROAA 3G16A 1IDPA 3K0ZA 2Y73A 5HGRA 1VQO3 1VQM3 2P0MA 2BMRB 4HZ9B 2D42A 2QGUA 3CCJ3 5G2GA 1JKGB 3GRDA 1YHQ3 4PEJA 3JUMA 2GEYA 3UB1A 4O02B 1E97A 3F8HA 3DMCA 4JF8A 2QA43 1SIIA 2CWTA 5JPPA 1VQ53 3CNXA 2GEXA 1BUQA 3NM2A 5IERA 1JB4A 1WNHA 2BT3A 1C7HA 4N6NB 1J2BA 1OHSA 1YGEA 3DXOA 3PS8A 4N6V0 3MHEA 5AI1A 3NBRA 3LH4A 3U97A 2QEX3 4K1VA 3H3HA 3I563 4FMBA 2OCTA 2INXA 3V99A 5D83A 3WOFB 1HKXA 1K9M4 5BXQA 3NBJA 1WQLB 4TX4A 4GL6A 3FF2A 3RDEA 1TFOA 3MSOA 5AIIA 1IVWA 3CCR3 3CCV3 2IMJA 4XDWA 5CK6A 3OWSA 4AKZA 5D82A 3ECFA 3VGNA 1M1K4 4KVHA 3LOYA 1YVBI 3WDGB 3GZBA 4MJDA 2E2UA 5D81A 4STDA 1M1XB 3UJMA 1IT7A 3BLZA 4ORLA 3F7XA 5AEUB 1OF5B 3X3YA 1W01A 3SX1A 1VZZA 1G96A 3HIIA 4N6TA 1NB3I 1FGOA 2Q07A 1GY5A 3V92A 3X41A 4LZIA 1QAFA 4L7KA 4OVMA 2LYXA 4BTWA 1YIT3 2YFIB 5LC6A 3LTAA 4HM8B 2CKFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6L A;  3KSE D;  1IV9 A;  3GAX A;  4N6O B;  1MNL A;  1A90 A;  3K9M C;  3PYJ A;  5ELJ A;  3IMA B;  4CCV A;  3KFQ C;  1N5H A;  1CYU A;  1FUW A;  1NB5 I;  1N9J A;  1TIJ A;  1DVD A;  5ELU A;  1CYV A;  5EQL A;  1ROA A;  3UL6 A;  1CEW I;  1MOL A;  1PFP A;  4IT7 A;  3UL5 A;  1IV7 A;  1RN7 A;  1EQK A;  4ZM8 A;  3S67 A;  1DVC A;  5LC7 A;  2O9U X;  1WNH A;  4N6N B;  3PS8 A;  4N6V 0;  4EYC A;  2W9P A;  3LH4 A;  5A0O B;  1KWI A;  2OCT A;  4TX4 A;  1N5P A;  3Q2P A;  1GD3 A;  4N6M A;  3PXM A;  1A67 A;  1LXE A;  3L0R A;  1R4C A;  1GD4 A;  4N6U A;  1FA3 A;  1YVB I;  2BO9 B;  2CH9 A;  3MWZ A;  3NX0 A;  2W9Q A;  1STF I;  1G96 A;  3SVA A;  2KXG A;  4N6T A;  1NB3 I;  3QRD A;  1M9G A;  4LZI A;  5LC6 A; 
#chains in the Genus database with same CATH topology
 1SJW A;  1BOX A;  4N6L A;  4KFD A;  4MEI A;  1ASK A;  2YFL B;  4H3U A;  5JBS A;  3HIG A;  1IV9 A;  1UUV B;  1YJN 3;  1O7H B;  2SBL A;  3K7C A;  1GMP A;  1A2K A;  4EV5 A;  1SPU A;  3T8U A;  2OTJ 3;  1ULJ B;  4HYZ A;  3VF1 A;  4LEH A;  1A90 A;  3EB8 A;  3K9M C;  1BUJ A;  4X2O A;  1RHL A;  2RSX A;  3NQY A;  1Q40 A;  3IMA B;  2FNQ A;  3OV4 A;  1BRI A;  3JUQ A;  3T8N A;  4FCJ A;  1RCK A;  2XF3 A;  1IVX A;  1TTO A;  3B8L A;  4XBT A;  3DM8 A;  3GZY B;  1O7N B;  2H0G A;  3JVC A;  2CFW A;  4FMC A;  1DVD A;  1RRL A;  5ELU A;  3S28 A;  2F4Y A;  2HMK B;  1A2V A;  2RNT A;  1O7G B;  3MG1 A;  2GU1 A;  1Q82 4;  1AR0 A;  4L8O A;  2RFR A;  1TP6 A;  4BL3 A;  5IG5 A;  5KP1 A;  4XBX A;  1B2M A;  1A2P A;  2CHC A;  5AEW B;  3J7Y d;  1VQ7 3;  8RNT A;  1AY7 A;  5IG0 A;  2E2V A;  1TU5 A;  3UNL A;  2OTL 3;  2K3D A;  6STD A;  2I9W A;  1LVN A;  2KCD A;  1B27 A;  3DGL A;  1VQL 3;  1RN7 A;  2F86 B;  1VQ9 3;  1I70 A;  1RGH A;  3NXJ A;  4HJL B;  3HX8 A;  1W6C A;  4ZM8 A;  4J5G A;  1HYF A;  1BNJ A;  1OHP A;  1QVF 2;  3ZFZ A;  2K54 A;  3FSD A;  3NQZ A;  3CU3 A;  2V1L A;  1W2Z A;  1X1X A;  4BTX A;  3FGY A;  1DMQ A;  4CPK A;  5HOH A;  3STD A;  1KQS 2;  4XM4 A;  4HM5 B;  3SED A;  2PNC A;  2OOV C;  3DGM A;  2W0Q A;  2CG1 A;  1IVV A;  3QK9 A;  5IEO A;  4EBG A;  1KWI A;  2Z76 A;  3BND A;  4MMZ B;  3BNC A;  3AMO B;  1VQ6 3;  1JBT A;  3BNB A;  2F99 A;  1RRH A;  3ZG5 A;  1GSP A;  3SOA A;  7GSP A;  2CWU A;  3H51 A;  3CCL 3;  1FGM A;  2MC8 A;  3B7C A;  4FMA A;  1JNQ A;  5IEN A;  1BNE A;  1JZO A;  2FGT A;  2ZDJ A;  3MKI A;  5TGN A;  1SIH A;  2W2C A;  3Q2P A;  4N3V A;  4EXR A;  2R41 A;  1NDO B;  2F5W A;  1QVG 2;  2KRT A;  1AVK A;  3WOD G;  1N8R 4;  3FG1 A;  1LXE A;  1RGE A;  3NV0 A;  3AGO A;  3D9R A;  3LTD A;  5IW9 A;  3HI7 A;  2OQE C;  2CFG A;  2IY2 A;  4NPB A;  2BNG A;  1AV4 A;  1RGF A;  3MG3 A;  4N6U A;  1O7M B;  3G4S 3;  2WGO A;  1D6U A;  1OPY A;  4O2H A;  1GYB A;  1T3B A;  2AAD A;  2BO9 B;  2F98 A;  3V98 A;  1LNI A;  1WTH A;  2CKF B;  1UCJ A;  1ZS7 A;  2CC3 A;  3KCH A;  2W9Q A;  1IVU A;  1SQW A;  2H0H A;  4HBR A;  2IUK A;  3WA3 A;  2O3O A;  3PZW A;  1S5A A;  3SVA A;  1LQG C;  3JUP A;  2KXG A;  4XB5 A;  1MGR A;  1JBS A;  9RNT A;  1M9G A;  5M1A A;  1BSD A;  3BNE A;  4L8P A;  4J5K A;  1N9E A;  3AHW A;  1K8A 4;  5CF1 A;  3KE7 A;  3PCS A;  3ER7 A;  3WA2 X;  1BRG A;  3E99 A;  2ML6 A;  3KII A;  2PZV A;  1YVS A;  4FCZ A;  2Z7A A;  5EVH A;  4Q53 A;  3GAX A;  3LXU X;  4HVN A;  1YJW 3;  5GSP A;  3RGR A;  1MNL A;  5IF6 A;  3CNM A;  2W03 A;  1IT8 A;  1GY7 A;  2M7O A;  3CC2 3;  3S27 A;  3N54 B;  1YNV X;  3I55 3;  1VQK 3;  3CCE 3;  2MF7 A;  2KF4 A;  5ELJ A;  2W56 A;  4CCV A;  1NJI 4;  3K63 A;  4HAA A;  1N5H A;  1ISK A;  1CYU A;  1UCI A;  3EC9 A;  3LYG A;  4HKV B;  3G71 3;  1AQZ A;  1TIJ A;  4KFE A;  1PY3 A;  3X3X A;  2XEP A;  1DYU A;  1CYV A;  2D1W A;  1QMA A;  4GB5 A;  3IPT A;  1ROV A;  3HZP A;  1T2I A;  1BRS A;  1EG9 B;  2OOV A;  1YI2 3;  3KN4 A;  4HM0 B;  1US1 A;  1D6Z A;  2B1X B;  2L1S A;  3EN8 A;  4WYK A;  1B21 A;  1Q7H A;  3UL6 A;  1VQ4 3;  4WWU C;  1EEJ A;  1JJ2 2;  4RNY A;  5BVB A;  4K90 B;  3F8X A;  3LTB A;  3TDG A;  3CC7 3;  1GMQ A;  1CEW I;  1RNT A;  1I3I A;  3EHC A;  3GWR A;  3MG2 A;  1PU4 A;  3EQQ B;  3LML A;  4DKI A;  4NHF A;  2CX0 A;  3UL5 A;  4HM4 B;  5IEP A;  1IV7 A;  2RGQ A;  3EX9 A;  1HU9 A;  1ZX2 A;  7RNT A;  1EQK A;  1DET A;  2J8X B;  1RLS A;  1MWS A;  3NBB A;  3NM7 A;  2CFD A;  3S67 A;  2FXT A;  4BU4 A;  1K28 A;  3SXX A;  2KF3 A;  4HOH A;  1JB2 A;  1B2Z A;  1RSN A;  1B3S A;  4RZM A;  1RGK A;  2O9U X;  3M8C A;  1Q40 B;  3CCU 3;  1OAC A;  1BU4 A;  3F14 A;  4HM2 B;  2HMO B;  2OQE A;  1UGH I;  1WMN A;  2GXF A;  4EYC A;  1EUI C;  5A0O B;  1X1U A;  1TUH A;  3WOE B;  2C4B A;  3JUO A;  4I4K A;  1GY6 A;  1WMP A;  1DMM A;  1UUG B;  2XR8 B;  1MGW A;  1Q42 A;  3FZW A;  3CXC 2;  1W00 A;  2F5M A;  2R4I A;  1LOX A;  5KP4 A;  3LT9 A;  1Y4K A;  3G0K A;  3PCR A;  2ZL8 A;  1W5Z A;  2CG0 A;  4XDV A;  3G6E 3;  1GD3 A;  4O3V A;  4CDL A;  3EBT A;  1BRN L;  4RBN A;  2XFS A;  2P38 A;  4N6M A;  1EKM A;  3NHX A;  5AIG A;  3CPO A;  1S72 3;  3L0R A;  3RNT A;  3FH1 A;  4FCM A;  3CD6 3;  1W7C A;  1DMN A;  2F56 A;  1K41 A;  3DZL A;  1HZ1 A;  1BNS A;  2P0X A;  3I0Y A;  2GU3 A;  4KZ1 A;  5CLK A;  5KP3 A;  1LOV A;  5FW5 A;  2CIU A;  2CH9 A;  2C10 A;  2B24 B;  1UI7 A;  5STD A;  1Q7Y 4;  1B20 A;  1YIJ 3;  3CC4 3;  3HOH A;  3N9H A;  3NX0 A;  4WHA A;  1VQN 3;  3B4P A;  4QWT A;  1JN5 A;  1JZD A;  1RGA A;  3DY5 A;  1STF I;  5AYS C;  3SLU A;  2Z77 A;  1W02 A;  4BL2 A;  3DUK A;  4EV2 A;  1IQY A;  4MMX B;  5I97 A;  4U13 A;  2ZHX B;  1DE3 A;  1UCK A;  1RDS A;  2HMN B;  1BAO A;  1F8N A;  3Q90 A;  4K61 A;  3QRD A;  4HZB B;  1X1Y A;  1W6Y A;  3F9S A;  1E3R A;  3D4A A;  4R9L A;  3WHO A;  3X3Z A;  1TFK A;  1X1W A;  2H0I A;  4OK0 A;  2CW9 A;  1IQX A;  1JKG A;  3FF0 A;  4BIR A;  4GSP A;  3EBY A;  3PGB A;  1YGW A;  1OCV A;  1RTU A;  4K1U A;  1UW1 A;  1BSA A;  1T5Y A;  2HML B;  1WMO A;  2P09 A;  1GMR A;  2XFT A;  4ILF A;  1EA2 A;  3PYJ A;  2Z6B A;  3N8B A;  3NV0 B;  1ZO2 A;  2P05 A;  4XBY A;  1RN4 A;  2JDI H;  5AIF A;  3Q1C A;  4R4K A;  1T2H A;  3KFQ C;  2GBX B;  2IYJ A;  1NB5 I;  1I2E A;  1RGG A;  1BSC A;  1N9J A;  1B2X A;  1JRQ A;  3KZT A;  5EEO A;  1FGQ A;  2W6J H;  2WO0 A;  3S5C A;  2KF5 A;  1ULI B;  4BTY A;  3AHS A;  1KSI A;  2WOH A;  2XSH B;  1MWU A;  1AVL A;  3FKA A;  1E3V A;  4KFF A;  2YX9 A;  1BVI A;  2L4V A;  4EC6 A;  1JV2 B;  1O7P B;  1OGZ A;  3GZX B;  1VQP 3;  1Z1S A;  2YFJ B;  4IPB A;  1MOL A;  1PFP A;  4IT7 A;  1OHO A;  1RKY A;  4H61 A;  1BNR A;  3X40 A;  3T0U A;  3EJV A;  4AKY A;  3X42 A;  1LOW A;  2A15 A;  3OXA A;  4O8S A;  2BHM A;  2STD A;  3WMD A;  1FGR A;  3WR2 A;  2Y74 A;  1DVC A;  3A76 A;  5LC7 A;  3FLJ A;  5IG4 A;  3O8Y A;  4RNZ A;  4OUQ A;  1U5O A;  1OUN A;  2XRX B;  2W56 B;  1RMS A;  1NU3 A;  1BIR A;  5CXO A;  2CK3 H;  4HM1 B;  3IJE B;  2W9P A;  1GS3 A;  2HMJ B;  3SOY A;  1W6G A;  3EE1 A;  1Q86 4;  1OF5 A;  4RNT A;  1IU7 A;  1TJD A;  4X2H A;  3OX9 A;  1U8C B;  1RJO A;  1B2S A;  2JQ5 A;  1V74 A;  1OH0 A;  1STD A;  4FMD A;  1UUW B;  4WFO A;  1I0X A;  1Q81 4;  1BGS A;  1D6Y A;  3JUN A;  1VQ8 3;  1BRH A;  3DGY A;  1IQ8 A;  2WGQ A;  3DGO A;  4LSO A;  5G1L A;  1N5P A;  1TRP A;  3D5G A;  4WYK B;  1TRQ A;  1LNH A;  1GOY A;  3FG4 A;  4R9K A;  4MMY B;  5FGO A;  1MWT A;  3Q3F A;  4IIA A;  5BIR A;  2OWP A;  3RGA A;  3CCS 3;  2BU4 A;  4J9A A;  2GBW B;  3F7S A;  1L5G B;  3HK4 A;  2HMM B;  3PXM A;  3FCS B;  1A67 A;  3DH2 A;  3FG3 A;  3CCQ 3;  2XGN A;  3URP A;  3MPH A;  1QJG A;  3U1W A;  1R4C A;  1BSE A;  1GD4 A;  1FA3 A;  6RNT A;  3D3L A;  3ZG0 A;  1YJ9 3;  5AIH A;  1GOV A;  3KKG A;  1FUS A;  5CF2 A;  1JB5 A;  3DGN A;  8CHO A;  1KD1 4;  1JBR A;  1IK3 A;  1K73 4;  3LTC A;  2XGL A;  1OGX A;  5BU4 A;  2IA7 A;  3LZA A;  3ALA A;  2CFK A;  1N8Q A;  3MWZ A;  2C11 A;  1NO3 A;  3G8Z A;  2XSO B;  1QAK A;  4R1K A;  1LOY A;  4JRF A;  2RBI A;  4GHO A;  4R80 A;  5M18 A;  4LMI A;  1M90 4;  2ZA4 A;  1QAL A;  3VSY A;  1G0T A;  2W04 A;  3K5T A;  2CFL A;  3B4O A;  1UI8 A;  3CPW 2;  3CCM 3;  3LT8 A;  3OWY A;  1FGT A;  4WP5 A;  3NUV A;  1BNI A;  1W4N A;  3S29 A;  1O7W B;  3KSP A;  3KSE D;  4AEQ A;  3EF8 A;  1FZU A;  1UDI I;  2ML5 A;  5IG3 A;  7STD A;  4N6O B;  2UX0 A;  3CMA 3;  1NWW A;  3EN1 B;  4NRE A;  1LQM B;  1CH0 A;  2XH9 A;  4LGQ A;  1KC8 4;  1BSB A;  2LQV A;  3MYT A;  1Q9E A;  1V57 A;  4J8T A;  2IUJ A;  1FUW A;  3OW2 2;  1RNB A;  5DRV A;  3BB9 A;  4FR9 A;  1W2B 2;  1I2G A;  1V58 A;  2BMO B;  2BMQ B;  4EW5 A;  2CWV A;  2GSP A;  5DRE A;  2RCD A;  5AYR B;  1I2F A;  4HM7 B;  3F40 A;  3ROB A;  3AMO A;  5JPU A;  1C54 A;  3BIR A;  3GZR A;  1R4Y A;  3GSP A;  2WOF A;  3OWU A;  4G1M B;  2E2T A;  2QIY A;  3CME 3;  1JN5 B;  2K0M A;  4HM6 B;  1CQS A;  4HM3 B;  5EQL A;  5G1K A;  1B2U A;  1ROA A;  2LYX A;  1IDP A;  3G16 A;  2Y73 A;  3K0Z A;  5HGR A;  1VQO 3;  1PYL A;  2SAR A;  1VQM 3;  2P0M A;  1RGC A;  2BMR B;  1UCL A;  1BNG A;  4HZ9 B;  2D42 A;  2QGU A;  3CCJ 3;  5G2G A;  1JKG B;  3GRD A;  3SYU A;  1YHQ 3;  4PEJ A;  3AGN A;  3JUM A;  2GEY A;  3UB1 A;  4O02 B;  1IYY A;  1E97 A;  3F8H A;  3DMC A;  4JF8 A;  2QA4 3;  1SII A;  1FYS A;  1MWR A;  2CWT A;  1ZGX A;  5JPP A;  1VQ5 3;  3CNX A;  2GEX A;  1BUQ A;  2AAE A;  3NM2 A;  5IER A;  1JB4 A;  5RNT A;  1WNH A;  2BT3 A;  2CX1 A;  1C7H A;  4N6N B;  1J2B A;  1OHS A;  1YGE A;  3D79 A;  3DXO A;  3PS8 A;  3MHE A;  3A5E A;  4N6V 0;  5AI1 A;  1I0V A;  3NBR A;  3LH4 A;  3U97 A;  2QEX 3;  4K1V A;  1GOU A;  3H3H A;  1BAN A;  3I56 3;  1FW7 A;  4FMB A;  4I5Q A;  2OCT A;  2INX A;  5M19 A;  3V99 A;  5D83 A;  3WOF B;  1HKX A;  1K9M 4;  1SAR A;  5BXQ A;  3NBJ A;  1WQL B;  1FUT A;  4TX4 A;  4GL6 A;  3FF2 A;  3RDE A;  1TFO A;  3MSO A;  5AII A;  1IVW A;  3CCR 3;  1RCL A;  3CCV 3;  1NNV A;  2IMJ A;  2KAA A;  1RGL A;  4XDW A;  5CK6 A;  1BRK A;  3OWS A;  4AKZ A;  2UGI A;  2BIR A;  4CJN A;  5D82 A;  3ECF A;  3VGN A;  1G02 A;  6GSP A;  1M1K 4;  4KVH A;  1I8V A;  3LOY A;  2UUG C;  1RN1 A;  2HOH A;  1YVB I;  3BU4 A;  3GZB A;  4MJD A;  3WDG B;  1I3F A;  2E2U A;  4STD A;  1M1X B;  5D81 A;  2KF6 A;  4KT3 B;  3UJM A;  1BRJ A;  1IT7 A;  3BLZ A;  4ORL A;  3F7X A;  5AEU B;  1BNF A;  1OF5 B;  3X3Y A;  1W01 A;  3SX1 A;  1VZZ A;  1G96 A;  3HII A;  4LYL B;  1LRA A;  4N6T A;  1NB3 I;  1FGO A;  2Q07 A;  3D5I A;  1GY5 A;  3V92 A;  3X41 A;  4LZI A;  1QAF A;  4L7K A;  4OVM A;  1VQQ A;  4BTW A;  1YIT 3;  2YFI B;  5LC6 A;  3LTA A;  4HM8 B;  1UGI A; 
#chains in the Genus database with same CATH homology
 1SJW A;  4N6L A;  4KFD A;  4MEI A;  1ASK A;  2YFL B;  4H3U A;  5JBS A;  3HIG A;  1IV9 A;  1UUV B;  1YJN 3;  1O7H B;  2SBL A;  3K7C A;  4EV5 A;  1A2K A;  1SPU A;  3T8U A;  2OTJ 3;  1ULJ B;  4HYZ A;  3VF1 A;  4LEH A;  1A90 A;  3EB8 A;  3K9M C;  4X2O A;  2RSX A;  3NQY A;  1Q40 A;  3IMA B;  2FNQ A;  3OV4 A;  3T8N A;  3JUQ A;  4FCJ A;  2XF3 A;  1IVX A;  3B8L A;  4XBT A;  3DM8 A;  3GZY B;  1O7N B;  3JVC A;  2CFW A;  4FMC A;  1DVD A;  1RRL A;  5ELU A;  3S28 A;  2HMK B;  1A2V A;  1O7G B;  3MG1 A;  2GU1 A;  1Q82 4;  1AR0 A;  4L8O A;  2RFR A;  1TP6 A;  5KP1 A;  5IG5 A;  4XBX A;  2CHC A;  1VQ7 3;  5AEW B;  3J7Y d;  5IG0 A;  2E2V A;  1TU5 A;  3UNL A;  2OTL 3;  6STD A;  2I9W A;  1LVN A;  2KCD A;  3DGL A;  1VQL 3;  1RN7 A;  2F86 B;  1VQ9 3;  4HJL B;  3NXJ A;  3HX8 A;  1W6C A;  4ZM8 A;  1OHP A;  1QVF 2;  2K54 A;  3FSD A;  3NQZ A;  3CU3 A;  2V1L A;  1W2Z A;  4BTX A;  3FGY A;  1DMQ A;  3STD A;  1KQS 2;  4XM4 A;  4HM5 B;  3SED A;  2PNC A;  2OOV C;  3DGM A;  2W0Q A;  2CG1 A;  1IVV A;  3QK9 A;  5IEO A;  4EBG A;  1KWI A;  2Z76 A;  3BND A;  4MMZ B;  3BNC A;  3AMO B;  1VQ6 3;  3BNB A;  2F99 A;  1RRH A;  3SOA A;  2CWU A;  3H51 A;  3CCL 3;  1FGM A;  2MC8 A;  3B7C A;  4FMA A;  1JNQ A;  5IEN A;  2ZDJ A;  2FGT A;  3MKI A;  5TGN A;  1SIH A;  2W2C A;  3Q2P A;  4N3V A;  4EXR A;  1NDO B;  1QVG 2;  2KRT A;  1AVK A;  3WOD G;  1N8R 4;  3FG1 A;  1LXE A;  3NV0 A;  3D9R A;  3LTD A;  5IW9 A;  3HI7 A;  2OQE C;  2CFG A;  2BNG A;  1AV4 A;  3MG3 A;  4N6U A;  3G4S 3;  1O7M B;  2WGO A;  1D6U A;  1OPY A;  4O2H A;  1GYB A;  2BO9 B;  2F98 A;  3V98 A;  1WTH A;  2CC3 A;  2W9Q A;  1IVU A;  1SQW A;  4HBR A;  2IUK A;  3WA3 A;  2O3O A;  3PZW A;  1S5A A;  3SVA A;  3JUP A;  2KXG A;  4XB5 A;  1M9G A;  3BNE A;  4L8P A;  1K8A 4;  1N9E A;  5CF1 A;  3KE7 A;  3PCS A;  3ER7 A;  3WA2 X;  3E99 A;  2ML6 A;  3KII A;  2PZV A;  4FCZ A;  2Z7A A;  5EVH A;  4Q53 A;  3GAX A;  3LXU X;  4HVN A;  1YJW 3;  3RGR A;  1MNL A;  5IF6 A;  3CNM A;  2W03 A;  1IT8 A;  1GY7 A;  2M7O A;  3CC2 3;  3S27 A;  3N54 B;  3I55 3;  1VQK 3;  3CCE 3;  2MF7 A;  5ELJ A;  1NJI 4;  2W56 A;  4CCV A;  3K63 A;  1N5H A;  1ISK A;  1CYU A;  3EC9 A;  3LYG A;  4HKV B;  3G71 3;  1TIJ A;  4KFE A;  3X3X A;  2XEP A;  1DYU A;  1CYV A;  2D1W A;  1QMA A;  4GB5 A;  3IPT A;  1ROV A;  3HZP A;  1EG9 B;  2OOV A;  1YI2 3;  3KN4 A;  4HM0 B;  1US1 A;  1D6Z A;  2B1X B;  3EN8 A;  4WYK A;  3UL6 A;  1VQ4 3;  4WWU C;  1JJ2 2;  4RNY A;  5BVB A;  4K90 B;  3F8X A;  3LTB A;  3TDG A;  3CC7 3;  3EHC A;  1CEW I;  3MG2 A;  3GWR A;  1PU4 A;  3EQQ B;  3LML A;  4NHF A;  3UL5 A;  4HM4 B;  5IEP A;  1IV7 A;  2RGQ A;  3EX9 A;  1HU9 A;  1ZX2 A;  1EQK A;  3NBB A;  3NM7 A;  2CFD A;  3S67 A;  2FXT A;  1K28 A;  3SXX A;  1JB2 A;  4RZM A;  2O9U X;  3M8C A;  1Q40 B;  3CCU 3;  1OAC A;  3F14 A;  4HM2 B;  2OQE A;  2HMO B;  1WMN A;  2GXF A;  4EYC A;  5A0O B;  3WOE B;  1TUH A;  3JUO A;  4I4K A;  1GY6 A;  1DMM A;  1WMP A;  2XR8 B;  3FZW A;  1Q42 A;  3CXC 2;  1W00 A;  2R4I A;  1LOX A;  5KP4 A;  3LT9 A;  1Y4K A;  3G0K A;  3PCR A;  2ZL8 A;  1W5Z A;  2CG0 A;  4XDV A;  3G6E 3;  1GD3 A;  4O3V A;  4CDL A;  3EBT A;  4RBN A;  2XFS A;  2P38 A;  4N6M A;  1EKM A;  3NHX A;  5AIG A;  3CPO A;  1S72 3;  3L0R A;  3FH1 A;  4FCM A;  3CD6 3;  1W7C A;  1DMN A;  1K41 A;  3DZL A;  2P0X A;  3I0Y A;  2GU3 A;  4KZ1 A;  5CLK A;  5KP3 A;  5FW5 A;  2CIU A;  2CH9 A;  2C10 A;  2B24 B;  1UI7 A;  5STD A;  1Q7Y 4;  3CC4 3;  1YIJ 3;  3NX0 A;  3N9H A;  4WHA A;  1VQN 3;  3B4P A;  4QWT A;  1JN5 A;  3DY5 A;  3SLU A;  4EV2 A;  1STF I;  5AYS C;  2Z77 A;  1W02 A;  3DUK A;  1IQY A;  4MMX B;  5I97 A;  4U13 A;  2HMN B;  3Q90 A;  1F8N A;  4K61 A;  3QRD A;  4HZB B;  1W6Y A;  3F9S A;  1E3R A;  4R9L A;  3X3Z A;  1TFK A;  4OK0 A;  2CW9 A;  1IQX A;  1JKG A;  3FF0 A;  3EBY A;  3PGB A;  1OCV A;  4K1U A;  1UW1 A;  1T5Y A;  2HML B;  1WMO A;  2P09 A;  2XFT A;  1EA2 A;  3PYJ A;  2Z6B A;  3N8B A;  3NV0 B;  1ZO2 A;  2P05 A;  4XBY A;  2JDI H;  5AIF A;  3Q1C A;  4R4K A;  3KFQ C;  2GBX B;  1NB5 I;  1N9J A;  1JRQ A;  3KZT A;  5EEO A;  1FGQ A;  2W6J H;  2WO0 A;  3S5C A;  1ULI B;  4BTY A;  1KSI A;  2WOH A;  2XSH B;  1AVL A;  3FKA A;  1E3V A;  4KFF A;  2YX9 A;  2L4V A;  4EC6 A;  1JV2 B;  1O7P B;  1OGZ A;  3GZX B;  1VQP 3;  1Z1S A;  2YFJ B;  4IPB A;  1MOL A;  1PFP A;  4IT7 A;  1OHO A;  1RKY A;  4H61 A;  3X40 A;  3T0U A;  3EJV A;  4AKY A;  3X42 A;  2A15 A;  3OXA A;  4O8S A;  2BHM A;  2STD A;  3WMD A;  1FGR A;  2Y74 A;  1DVC A;  3A76 A;  5LC7 A;  3FLJ A;  5IG4 A;  3O8Y A;  4RNZ A;  4OUQ A;  1U5O A;  1OUN A;  2XRX B;  2W56 B;  1NU3 A;  5CXO A;  2CK3 H;  4HM1 B;  3IJE B;  2W9P A;  1GS3 A;  2HMJ B;  3SOY A;  1W6G A;  3EE1 A;  1Q86 4;  1OF5 A;  1IU7 A;  4X2H A;  3OX9 A;  1U8C B;  1RJO A;  2JQ5 A;  1V74 A;  1OH0 A;  1STD A;  4FMD A;  1UUW B;  4WFO A;  1Q81 4;  1D6Y A;  3JUN A;  1VQ8 3;  1IQ8 A;  2WGQ A;  3DGO A;  4LSO A;  1N5P A;  4WYK B;  1LNH A;  4R9K A;  3FG4 A;  4MMY B;  5FGO A;  4IIA A;  2OWP A;  3RGA A;  3CCS 3;  4J9A A;  2GBW B;  3F7S A;  1L5G B;  3HK4 A;  2HMM B;  3PXM A;  3FCS B;  1A67 A;  3FG3 A;  3CCQ 3;  2XGN A;  3MPH A;  1QJG A;  3U1W A;  1R4C A;  1GD4 A;  1FA3 A;  1YJ9 3;  3D3L A;  5AIH A;  3KKG A;  5CF2 A;  8CHO A;  1JB5 A;  3DGN A;  1KD1 4;  1IK3 A;  1K73 4;  3LTC A;  2XGL A;  1OGX A;  2IA7 A;  3LZA A;  3ALA A;  2CFK A;  1N8Q A;  3MWZ A;  2C11 A;  1NO3 A;  3G8Z A;  2XSO B;  1QAK A;  4R1K A;  4JRF A;  4R80 A;  4LMI A;  1M90 4;  1QAL A;  3VSY A;  2W04 A;  3K5T A;  2CFL A;  3B4O A;  1UI8 A;  3CPW 2;  3CCM 3;  3LT8 A;  3OWY A;  1FGT A;  4WP5 A;  3NUV A;  1W4N A;  3S29 A;  1O7W B;  3KSP A;  3KSE D;  4AEQ A;  3EF8 A;  2ML5 A;  5IG3 A;  7STD A;  4N6O B;  2UX0 A;  3CMA 3;  1NWW A;  3EN1 B;  4NRE A;  2XH9 A;  4LGQ A;  1KC8 4;  2LQV A;  3MYT A;  4J8T A;  2IUJ A;  1FUW A;  3OW2 2;  5DRV A;  3BB9 A;  4FR9 A;  1W2B 2;  2BMQ B;  2BMO B;  2CWV A;  5DRE A;  2RCD A;  5AYR B;  4HM7 B;  3F40 A;  3ROB A;  3AMO A;  5JPU A;  3GZR A;  2WOF A;  3OWU A;  4G1M B;  2E2T A;  2QIY A;  3CME 3;  1JN5 B;  2K0M A;  4HM6 B;  1CQS A;  4HM3 B;  5EQL A;  1ROA A;  3G16 A;  1IDP A;  3K0Z A;  2Y73 A;  5HGR A;  1VQO 3;  1VQM 3;  2P0M A;  2BMR B;  4HZ9 B;  2D42 A;  2QGU A;  3CCJ 3;  5G2G A;  1JKG B;  3GRD A;  1YHQ 3;  4PEJ A;  3JUM A;  2GEY A;  3UB1 A;  4O02 B;  1E97 A;  3F8H A;  3DMC A;  4JF8 A;  2QA4 3;  1SII A;  2CWT A;  5JPP A;  1VQ5 3;  3CNX A;  2GEX A;  1BUQ A;  3NM2 A;  5IER A;  1JB4 A;  1WNH A;  2BT3 A;  1C7H A;  4N6N B;  1J2B A;  1OHS A;  1YGE A;  3DXO A;  3PS8 A;  4N6V 0;  3MHE A;  5AI1 A;  3NBR A;  3LH4 A;  3U97 A;  2QEX 3;  4K1V A;  3H3H A;  3I56 3;  4FMB A;  2OCT A;  2INX A;  3V99 A;  5D83 A;  3WOF B;  1HKX A;  1K9M 4;  5BXQ A;  3NBJ A;  1WQL B;  4TX4 A;  4GL6 A;  3FF2 A;  3RDE A;  1TFO A;  3MSO A;  5AII A;  1IVW A;  3CCR 3;  3CCV 3;  2IMJ A;  4XDW A;  5CK6 A;  3OWS A;  4AKZ A;  5D82 A;  3ECF A;  3VGN A;  1M1K 4;  4KVH A;  3LOY A;  1YVB I;  3WDG B;  3GZB A;  4MJD A;  2E2U A;  5D81 A;  4STD A;  1M1X B;  3UJM A;  1IT7 A;  3BLZ A;  4ORL A;  3F7X A;  5AEU B;  1OF5 B;  3X3Y A;  1W01 A;  3SX1 A;  1VZZ A;  1G96 A;  3HII A;  4N6T A;  1NB3 I;  1FGO A;  2Q07 A;  1GY5 A;  3V92 A;  3X41 A;  4LZI A;  1QAF A;  4L7K A;  4OVM A;  2LYX A;  4BTW A;  1YIT 3;  2YFI B;  5LC6 A;  3LTA A;  4HM8 B;  2CKF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...