1A90A

Recombinant mutant chicken egg white cystatin, nmr, 31 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
108
structure length
108
Chain Sequence
GAPVPVDENDEGLQRALQFAIAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPELAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Thiol protease inhibitor
molecule keywords CYSTATIN
publication title The structures of native phosphorylated chicken cystatin and of a recombinant unphosphorylated variant in solution.
pubmed doi rcsb
source organism Gallus gallus
total genus 18
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1a90A00
4TX4A 1NB5I 1R4CA 1GD4A 3KFQC 5A0OB 1A67A 1N9JA 1RN7A 1CYVA 4IT7A 3UL5A 1ROAA 1MOLA 1MNLA 4CCVA 1G96A 4ZM8A 3KSED 1STFI 1CYUA 1WNHA 3MWZA 4N6V0 3GAXA 4N6OB 3K9MC 3L0RA 1DVCA 1IV7A 1NB3I 4EYCA 3IMAB 2BO9B 1EQKA 1DVDA 1A90A 1N5HA 3SVAA 1YVBI 1GD3A 3NX0A 2KXGA 2O9UX 3PYJA 5EQLA 4N6UA 4N6MA 3PS8A 2OCTA 1FUWA 3PXMA 3S67A 1LXEA 5LC6A 2W9QA 1IV9A 4N6TA 1CEWI 1M9GA 4N6NB 5ELJA 2CH9A 3UL6A 5LC7A 4LZIA 1KWIA 4N6LA 1N5PA 1TIJA 3Q2PA 1PFPA 3QRDA 3LH4A 5ELUA 2W9PA 1FA3A
chains in the Genus database with same CATH superfamily
1D6ZA 1UCKA 1NB5I 3CCQ3 2Z77A 3JUPA 1T2HA 1R4CA 4R4KA 1GD4A 3E99A 1CQSA 2GU3A 1T2IA 2IMJA 3MG1A 1YHQ3 4L8PA 2C10A 3T8UA 2KCDA 5A0OB 1I2FA 3NUVA 1A67A 3F40A 3K7CA 2CWTA 3NBRA 3SXXA 3CCV3 2K0MA 2AAEA 1TRPA 4R9LA 1RGAA 1U5OA 3AHWA 3DGLA 3WA3A 3DUKA 4CCVA 1ZO2A 3OWUA 5KP3A 2OWPA 1B2XA 1U8CB 2BIRA 3FG4A 1GY5A 2L4VA 3KSED 2OOVA 3K0ZA 2IY2A 4HVNA 1STFI 3HIIA 1QALA 1WNHA 1O7HB 1M904 1B2MA 1YIT3 4WHAA 3ZFZA 4DKIA 4N6V0 4XM4A 1GS3A 4RNYA 1Q7Y4 4K90B 3CCE3 4OK0A 2CX1A 1ISKA 4N6OB 1RMSA 1FW7A 5M18A 4LYLB 1X1UA 1W02A 2W04A 3K9MC 4AEQA 2CIUA 3AMOA 3AHSA 1QVF2 5D82A 3EN1B 1MWSA 1NO3A 6STDA 1DYUA 3FKAA 3G16A 3L0RA 1BNGA 2XSOB 1NB3I 1Y4KA 3WODG 2WGOA 3B8LA 1JBTA 1BNRA 3EBYA 3HOHA 4HKVB 4IIAA 4NPBA 1UUWB 3K5TA 1V74A 1RRLA 1X1YA 3JUMA 3KIIA 4WWUC 5DRVA 1A90A 1HYFA 1RGCA 3DMCA 3NQYA 3K63A 1YI23 5D81A 2OQEA 3X3YA 2KF3A 2Q07A 3F8HA 1M1XB 1QVG2 3MSOA 1BRNL 1QAKA 3SOAA 3VSYA 2O9UX 1V57A 4N6UA 3LTCA 4KFDA 1WMPA 5BU4A 5AIIA 1WTHA 1RGEA 3KKGA 3VF1A 1BNJA 3S28A 3WHOA 1VQL3 3PS8A 4HM6B 3PZWA 1V58A 2P05A 1BIRA 1I70A 1YIJ3 3I553 3I0YA 1TJDA 3F7SA 3LTBA 4AKYA 1BNEA 3CC73 3BNEA 3WA2X 2ML6A 4U13A 3HIGA 1LXEA 2XFSA 1FGTA 1E3RA 4HAAA 1BSBA 1LQMB 2W9QA 4J9AA 1EEJA 2KF4A 4HYZA 1SARA 3D79A 4N6TA 3CCU3 3N9HA 5HGRA 1CEWI 1Q40A 5HOHA 1NDOB 1OF5B 4XBYA 4R1KA 4R80A 1LNHA 3OWYA 1UCIA 2W03A 3F14A 4LZIA 3X41A 1O7WB 5TGNA 1I0VA 2CW9A 4MMYB 4RNTA 5G1KA 1L5GB 1I2GA 1TU5A 3CCJ3 1O7NB 1LOXA 1GYBA 5D83A 1PFPA 3CCS3 3WMDA 1RLSA 3QRDA 4N3VA 1AV4A 4HM7B 4RZMA 3V92A 1N9EA 3GRDA 5AIHA 3X3ZA 1EUIC 2BNGA 3G713 1K28A 1JB2A 4J5KA 2C11A 8RNTA 3LT9A 1BSAA 4JRFA 3SEDA 4EC6A 4PEJA 1BGSA 1A2VA 1BRKA 5AI1A 1EG9B 3CXC2 2RGQA 3EJVA 3FCSB 3OXAA 4BU4A 2Z6BA 1Q814 2H0IA 2I9WA 1OGXA 4IT7A 3T8NA 3LTDA 1W5ZA 5JPUA 4KT3B 1MOLA 1JJ22 1RTUA 2LQVA 2SARA 3NV0B 5IERA 1RGHA 2ZDJA 3D4AA 3FF0A 3MKIA 1JKGA 3SX1A 1VQP3 5CK6A 1JZOA 3MYTA 3A5EA 1JBRA 1BRIA 3V98A 1CYUA 2CWUA 3MWZA 4LSOA 2C4BA 1VQM3 2ZHXB 3OW22 3D3LA 1D6YA 4FMBA 3BB9A 1UGIA 4HM2B 3S5CA 4CDLA 7GSPA 1UGHI 2GEXA 3KCHA 3LOYA 3RDEA 3X42A 5AEWB 1KD14 2MC8A 4HM8B 3A76A 3NBBA 1OGZA 2HMJB 1Q9EA 1UCLA 2LYXA 2W56A 3U1WA 1TRQA 1ULJB 1UUGB 3H3HA 1N8R4 4BIRA 4FMCA 4K1UA 2XGLA 2UGIA 4I5QA 3MPHA 3PCRA 5GSPA 1NWWA 2K54A 4EYCA 6GSPA 3EB8A 4AKZA 2E2VA 1GOUA 1DETA 3NM7A 2BO9B 3BU4A 4FR9A 1VQK3 2PZVA 1DVDA 3N54B 1Z1SA 3FGYA 1N5HA 5I97A 1NNVA 3U97A 3DGOA 2CFLA 6RNTA 2J8XB 3FH1A 1SQWA 4OUQA 4KVHA 4WYKA 1YVBI 4HM0B 1W2B2 4OVMA 3NX0A 2F4YA 2HMMB 1KC84 2Z7AA 1AVKA 1W7CA 1JBSA 1WMNA 3B4OA 4WP5A 4EW5A 4HOHA 1OH0A 2F5MA 3B4PA 2B24B 4HJLB 8CHOA 2R41A 3V99A 3UJMA 2H0GA 4O2HA 1IK3A 2SBLA 1RKYA 3OV4A 2YFLB 1GMPA 3DY5A 1FUWA 1STDA 3PXMA 2CHCA 1JN5B 2OTJ3 4FCJA 1IDPA 3MHEA 4GB5A 5IG0A 1DE3A 3FF2A 1X1WA 1O7MB 2UUGC 3CCM3 1IV9A 1I8VA 3CPW2 1M9GA 1IU7A 2CC3A 5ELJA 3CPOA 1RRHA 1B2ZA 1BSEA 5LC7A 1TTOA 1QJGA 5AEUB 1ROVA 5M1AA 1Q824 2P38A 1N5PA 4BTXA 1BOXA 3RGRA 2XSHB 1IVXA 3Q2PA 4X2HA 4LMIA 1C7HA 3FZWA 1M1K4 1C54A 1Q7HA 2BMRB 5CF2A 4LGQA 1D6UA 1BAOA 4RBNA 5IF6A 1BNSA 1RN4A 2CFKA 3EX9A 3EHCA 1K41A 1YJ93 4GL6A 4TX4A 4BL2A 1HZ1A 1UDII 3HK4A 4EV5A 2GXFA 1VQ63 1R4YA 4MMXB 1RDSA 1F8NA 1AR0A 1QAFA 1YGEA 2FNQA 3CME3 1PY3A 1B27A 1CYVA 1CH0A 2F86B 1BANA 1JRQA 3AMOB 1BUJA 1OACA 3LMLA 4BTYA 5DREA 7STDA 1RGFA 4KFEA 3Q90A 3N8BA 1OHPA 3SLUA 2P09A 5BXQA 5KP1A 3D9RA 4IPBA 1UW1A 3M8CA 1RGLA 1MWRA 1I0XA 2HMOB 4STDA 1I3IA 2GBWB 2CG0A 3FG1A 4HM5B 3HZPA 3GZRA 3Q1CA 7RNTA 1BNIA 3GAXA 1IVWA 1K9M4 3I563 3DGYA 3NXJA 2PNCA 1I2EA 3EE1A 2RFRA 1HU9A 4NHFA 3MG3A 1I3FA 2W0QA 4I4KA 4XDVA 4R9KA 1PYLA 1S5AA 1G0TA 3AGNA 1VZZA 1GSPA 4XBTA 2AADA 2ZA4A 2YFJB 3G4S3 3WOEB 1ASKA 1KSIA 1UCJA 1W6YA 3JUOA 1DVCA 2GSPA 3GSPA 1IV7A 2M7OA 3GZYB 5AYRB 1SIHA 4XDWA 3IMAB 1JNQA 1Q864 3NHXA 2QGUA 2QEX3 2F99A 2GU1A 1UUVB 2L1SA 3RNTA 3VGNA 4H3UA 4H61A 1VQN3 2Z76A 4ILFA 3SVAA 3WOFB 1YNVX 1VQO3 1FGRA 3FG3A 4HM4B 2CKFB 1A2PA 4HZ9B 3CNMA 4WFOA 4EV2A 1NU3A 2KF6A 1E3VA 1GMRA 1IQYA 1Q40B 1MWTA 3KE7A 2KF5A 1UI7A 2KXGA 3SYUA 1W2ZA 3PYJA 1KQS2 2Y74A 2UX0A 2F56A 1LOVA 2GEYA 2WOHA 3J7Yd 1WMOA 4N6MA 2R4IA 3IJEB 3STDA 1WQLB 3S27A 2OCTA 4EXRA 1BVIA 1GOYA 5BIRA 1AVLA 2GBXB 2HMKB 1YVSA 1FGOA 2Y73A 4ORLA 1VQ83 1LQGC 2O3OA 3BNDA 1JB5A 3D5GA 3ALAA 3DZLA 4CPKA 1B20A 2JDIH 3KN4A 3PCSA 2ML5A 3CCR3 1VQ53 3JVCA 3SOYA 1TFKA 5LC6A 1O7GB 3BNBA 3LTAA 1DMNA 1LVNA 3ZG0A 2OOVC 3CD63 4MEIA 2BT3A 2KAAA 3TDGA 3UL6A 3UNLA 3JUQA 4LEHA 2XR8B 3AGOA 4O8SA 5CF1A 1KWIA 4N6LA 3CNXA 1TIJA 1X1XA 1RHLA 2XH9A 1GY6A 1ZS7A 1BRGA 2YFIB 1RGGA 3URPA 2B1XB 4MJDA 1UI8A 5EVHA 2BU4A 1JKGB 1OCVA 3OX9A 5AYSC 5ELUA 4RNZA 4QWTA 2CK3H 2W9PA 1FA3A 3X3XA 1BRHA 3DXOA 2OTL3 1FZUA 1FGQA 3BLZA 1OUNA 1O7PB 1BSDA 2H0HA 1FUSA 2CFWA 3KFQC 3LXUX 1VQ93 1BNFA 1OF5A 4K61A 2P0XA 3BIRA 1YJN3 1IQXA 2RBIA 1N9JA 1RN7A 2RCDA 3HI7A 1MGRA 3BNCA 2JQ5A 4HM1B 4FMDA 5CXOA 1W4NA 2W56B 5STDA 1IT8A 1DMQA 1JV2B 3UL5A 4BTWA 1ROAA 3D5IA 1RNBA 1MNLA 2OQEC 1GY7A 2W6JH 1G96A 1RN1A 3ECFA 4ZM8A 5JBSA 1TUHA 1ZX2A 1BRSA 2A15A 2K3DA 3NBJA 2ZL8A 3OWSA 5G2GA 3X40A 3GZBA 3CC23 2IUKA 2W2CA 1G02A 4Q53A 1RSNA 2XGNA 4HZBB 5EEOA 1DMMA 1NJI4 1W01A 3T0UA 1LOYA 2WOFA 1YGWA 1VQ73 2IUJA 1JZDA 1LOWA 3EF8A 3PGBA 1EA2A 5JPPA 2XFTA 4GHOA 1IQ8A 1B21A 1OHSA 2E2UA 2XRXB 3EQQB 2E2TA 2HOHA 4G1MB 4WYKB 1BRJA 3NQZA 4MMZB 2INXA 2KRTA 3O8YA 4O3VA 1Q42A 1RJOA 1BSCA 1QMAA 2CG1A 1B2SA 3WDGB 3WR2A 1T3BA 1LNIA 2CFDA 4HM3B 4X2OA 1OPYA 1K8A4 4FMAA 4L8OA 3NV0A 1A2KA 5IENA 3G6E3 1RCLA 1GOVA 2F5WA 2P0MA 5IW9A 3UB1A 1J2BA 1EQKA 1W6CA 2QA43 3GZXB 5M19A 4EBGA 2CWVA 2CFGA 1AQZA 2HMLB 3RGAA 9RNTA 4KFFA 2CX0A 4FCZA 1LRAA 4NREA 4BL3A 1IYYA 3MG2A 3JUNA 3S29A 2QIYA 3DM8A 1RCKA 1BUQA 4KZ1A 5IEOA 1GD3A 4XBXA 1EKMA 2STDA 1HKXA 2YX9A 3EC9A 2HMNB 5IEPA 3FSDA 1N8QA 1ZGXA 2BHMA 4JF8A 5EQLA 1GMQA 1TP6A 1JB4A 1W6GA 5AIGA 3F8XA 3KSPA 3H51A 3LT8A 5IG3A 1YJW3 2XF3A 5FGOA 3ZG5A 3CCL3 1T5YA 4J5GA 1TFOA 1B2UA 1IVVA 1MGWA 2D42A 2D1WA 2IA7A 1BU4A 1VQQA 3DGMA 3EN8A 3G0KA 3G8ZA 2RNTA 5G1LA 5BVBA 4O02B 5KP4A 4K1VA 1SJWA 5RNTA 5IG5A 3IPTA 3S67A 1VQ43 2FGTA 1E97A 1OHOA 1K734 2RSXA 2V1LA 4FCMA 5FW5A 2BMOB 3LZAA 1US1A 4GSPA 2BMQB 2FXTA 4N6NB 1RGKA 3DH2A 2CH9A 3ER7A 4XB5A 1PU4A 1SPUA 1ULIB 3EBTA 3CMA3 1FGMA 3LYGA 3DGNA 2MF7A 1IVUA 3FLJA 1AY7A 3F7XA 4HBRA 4CJNA 3NM2A 1MWUA 2WO0A 3CC43 3KZTA 1B3SA 3QK9A 1FUTA 5AIFA 1FYSA 2F98A 2WGQA 3CU3A 3F9SA 1W00A 2IYJA 3Q3FA 4J8TA 3LH4A 5CLKA 3B7CA 1S723 2XEPA 3HX8A 4L7KA 1IT7A 3ROBA 5IG4A 1JN5A 1RNTA 3GWRA 1SIIA
chains in the Genus database with same CATH topology
1D6ZA 1NB5I 3CCQ3 2Z77A 3JUPA 1R4CA 4R4KA 1GD4A 3E99A 1CQSA 2GU3A 3MG1A 2IMJA 4L8PA 2C10A 3T8UA 2KCDA 5A0OB 3NUVA 1A67A 3F40A 3K7CA 2CWTA 3NBRA 3SXXA 3CCV3 2K0MA 4R9LA 1U5OA 3DGLA 3WA3A 3DUKA 4CCVA 1ZO2A 3OWUA 5KP3A 2OWPA 1U8CB 3FG4A 1GY5A 2L4VA 3KSED 2OOVA 3K0ZA 4HVNA 1STFI 3HIIA 1QALA 1WNHA 1O7HB 1M904 1YIT3 4WHAA 4N6V0 4XM4A 1GS3A 4RNYA 1Q7Y4 4K90B 3CCE3 4OK0A 1ISKA 4N6OB 1W02A 2W04A 3K9MC 4AEQA 2CIUA 3AMOA 1QVF2 5D82A 3EN1B 1NO3A 6STDA 1DYUA 3FKAA 3G16A 3L0RA 2XSOB 1NB3I 1Y4KA 3WODG 2WGOA 3B8LA 3EBYA 4HKVB 4IIAA 1UUWB 3K5TA 1V74A 1RRLA 3JUMA 3KIIA 5DRVA 4WWUC 1A90A 3DMCA 3NQYA 3K63A 1YI23 5D81A 2OQEA 3X3YA 2Q07A 3F8HA 1M1XB 1QVG2 3MSOA 1QAKA 3SOAA 3VSYA 2O9UX 4N6UA 3LTCA 4KFDA 1WMPA 5AIIA 1WTHA 3KKGA 3VF1A 3S28A 1VQL3 3PS8A 4HM6B 3PZWA 2P05A 1YIJ3 3I553 3I0YA 3F7SA 3LTBA 4AKYA 3CC73 3BNEA 3WA2X 2ML6A 4U13A 3HIGA 1LXEA 2XFSA 1FGTA 1E3RA 2W9QA 4J9AA 4HYZA 4N6TA 3CCU3 3N9HA 5HGRA 1CEWI 1Q40A 1NDOB 1OF5B 4XBYA 4R1KA 4R80A 1LNHA 3OWYA 2W03A 3F14A 4LZIA 3X41A 1O7WB 5TGNA 4MMYB 2CW9A 1L5GB 1TU5A 1YHQ3 3CCJ3 1O7NB 1LOXA 1GYBA 5D83A 1PFPA 3CCS3 3WMDA 3QRDA 4N3VA 1AV4A 4HM7B 4RZMA 3V92A 1N9EA 3GRDA 5AIHA 3X3ZA 2BNGA 3G713 1K28A 1JB2A 2C11A 3LT9A 4JRFA 3SEDA 4EC6A 4PEJA 1A2VA 5AI1A 1EG9B 3CXC2 2RGQA 3EJVA 3FCSB 3OXAA 1Q814 2Z6BA 2I9WA 1OGXA 4IT7A 3T8NA 3LTDA 1W5ZA 5JPUA 1MOLA 1JJ22 2LQVA 3NV0B 5IERA 2ZDJA 3FF0A 3MKIA 1JKGA 3SX1A 1VQP3 5CK6A 3MYTA 1CYUA 3V98A 2CWUA 3MWZA 4LSOA 1VQM3 3OW22 3D3LA 1D6YA 4FMBA 3BB9A 4HM2B 3S5CA 4CDLA 3RDEA 2GEXA 3X42A 3LOYA 5AEWB 1KD14 2MC8A 4HM8B 3A76A 3NBBA 1OGZA 2HMJB 2LYXA 2W56A 3U1WA 1ULJB 3H3HA 1N8R4 4FMCA 4K1UA 2XGLA 3MPHA 3PCRA 1NWWA 2K54A 4EYCA 3EB8A 4AKZA 2E2VA 3NM7A 2BO9B 4FR9A 1VQK3 1DVDA 2PZVA 3N54B 1Z1SA 3FGYA 1N5HA 5I97A 3U97A 3DGOA 2CFLA 3FH1A 1SQWA 4OUQA 4KVHA 4WYKA 1YVBI 4HM0B 1W2B2 4OVMA 3NX0A 2HMMB 1KC84 2Z7AA 1AVKA 1W7CA 1WMNA 3B4OA 4WP5A 1OH0A 3B4PA 2B24B 4HJLB 8CHOA 3V99A 3UJMA 4O2HA 1IK3A 2SBLA 1RKYA 3OV4A 2YFLB 3DY5A 1FUWA 1STDA 3PXMA 2CHCA 1JN5B 2OTJ3 4FCJA 1IDPA 3MHEA 4GB5A 5IG0A 3FF2A 1O7MB 3CCM3 1IV9A 3CPW2 1M9GA 1IU7A 2CC3A 5ELJA 3CPOA 1RRHA 5LC7A 1QJGA 5AEUB 1ROVA 1Q824 2P38A 1N5PA 4BTXA 3RGRA 2XSHB 1IVXA 3Q2PA 4X2HA 4LMIA 1C7HA 3FZWA 1M1K4 2BMRB 5CF2A 4LGQA 1D6UA 4RBNA 5IF6A 2CFKA 3EX9A 3EHCA 1K41A 1YJ93 4GL6A 4TX4A 3HK4A 4EV5A 2GXFA 1VQ63 4MMXB 1F8NA 1AR0A 1QAFA 1YGEA 2FNQA 3CME3 1CYVA 2F86B 1JRQA 3AMOB 1OACA 3LMLA 4BTYA 5DREA 7STDA 4KFEA 3Q90A 3N8BA 1OHPA 3SLUA 2P09A 5BXQA 5KP1A 3D9RA 4IPBA 1UW1A 3M8CA 2HMOB 4STDA 2GBWB 2CG0A 3FG1A 4HM5B 3HZPA 3GZRA 3Q1CA 1K9M4 3GAXA 1IVWA 3I563 3NXJA 2PNCA 3EE1A 2RFRA 1HU9A 4NHFA 3MG3A 2W0QA 4I4KA 4XDVA 4R9KA 1S5AA 1VZZA 4XBTA 2YFJB 3G4S3 3WOEB 1ASKA 1KSIA 1W6YA 3JUOA 1DVCA 1IV7A 2M7OA 3GZYB 5AYRB 1SIHA 4XDWA 3IMAB 1JNQA 1Q864 3NHXA 2QGUA 2QEX3 2F99A 2GU1A 1UUVB 3VGNA 4H3UA 4H61A 1VQN3 2Z76A 3SVAA 3WOFB 1VQO3 1FGRA 3FG3A 4HM4B 2CKFB 4HZ9B 3CNMA 4WFOA 4EV2A 1NU3A 1E3VA 1IQYA 1Q40B 3KE7A 2KXGA 1UI7A 1W2ZA 3PYJA 1KQS2 2Y74A 2UX0A 2GEYA 2WOHA 3J7Yd 1WMOA 4N6MA 2R4IA 3IJEB 3STDA 1WQLB 3S27A 2OCTA 4EXRA 1AVLA 2GBXB 2HMKB 2Y73A 1FGOA 4ORLA 1VQ83 2O3OA 3BNDA 1JB5A 3DZLA 3ALAA 3CCR3 3KN4A 2JDIH 3PCSA 2ML5A 1VQ53 3JVCA 3SOYA 1TFKA 5LC6A 1O7GB 3BNBA 3LTAA 1DMNA 1LVNA 2OOVC 3CD63 4MEIA 2BT3A 3TDGA 3UL6A 3UNLA 3JUQA 4LEHA 2XR8B 4O8SA 5CF1A 1KWIA 4N6LA 3CNXA 1TIJA 2XH9A 1GY6A 2YFIB 2B1XB 4MJDA 1UI8A 5EVHA 1JKGB 1OCVA 3OX9A 5AYSC 5ELUA 4RNZA 4QWTA 2W9PA 2CK3H 1FA3A 3X3XA 3DXOA 2OTL3 1FGQA 3BLZA 1OUNA 1O7PB 2CFWA 3KFQC 3LXUX 1VQ93 1OF5A 4K61A 2P0XA 1YJN3 1IQXA 2RCDA 1N9JA 1RN7A 3HI7A 4HM1B 3BNCA 2JQ5A 4FMDA 5CXOA 1W4NA 2W56B 5STDA 1IT8A 1DMQA 1JV2B 3UL5A 4BTWA 1ROAA 1MNLA 2OQEC 1GY7A 2W6JH 1G96A 3ECFA 4ZM8A 5JBSA 1TUHA 1ZX2A 2A15A 3NBJA 3OWSA 2ZL8A 5G2GA 3X40A 3GZBA 3CC23 2IUKA 2W2CA 4Q53A 2XGNA 4HZBB 5EEOA 1DMMA 1NJI4 1W01A 3T0UA 2WOFA 1VQ73 2IUJA 3EF8A 3PGBA 1EA2A 5JPPA 2XFTA 1IQ8A 1OHSA 2E2UA 4WYKB 2XRXB 3EQQB 2E2TA 4G1MB 3NQZA 4MMZB 2INXA 2KRTA 3O8YA 4O3VA 1Q42A 1RJOA 2CG1A 1QMAA 3WDGB 2CFDA 4HM3B 4X2OA 1OPYA 1K8A4 4FMAA 4L8OA 3NV0A 1A2KA 5IENA 3G6E3 5IW9A 2P0MA 3UB1A 1J2BA 1EQKA 1W6CA 2QA43 3GZXB 4EBGA 2CWVA 2CFGA 2HMLB 3RGAA 4KFFA 4FCZA 4NREA 3MG2A 3JUNA 3S29A 2QIYA 3DM8A 1BUQA 4KZ1A 1GD3A 4XBXA 1EKMA 2STDA 1HKXA 2YX9A 3EC9A 2HMNB 5IEPA 3FSDA 1N8QA 2BHMA 4JF8A 5EQLA 1TP6A 1JB4A 1W6GA 5AIGA 3F8XA 3KSPA 3H51A 3LT8A 5IG3A 1YJW3 2XF3A 5FGOA 3CCL3 1T5YA 1TFOA 1IVVA 2D42A 2D1WA 2IA7A 3DGMA 3EN8A 3G0KA 3G8ZA 5BVBA 4O02B 5KP4A 4K1VA 1SJWA 5IG5A 3IPTA 3S67A 1VQ43 2FGTA 1E97A 1OHOA 1K734 2RSXA 2V1LA 4FCMA 5FW5A 2BMOB 3LZAA 1US1A 2FXTA 2BMQB 4N6NB 1PU4A 2CH9A 3ER7A 4XB5A 1SPUA 1ULIB 3EBTA 3CMA3 1FGMA 3LYGA 3DGNA 2MF7A 1IVUA 3FLJA 3F7XA 4HBRA 3NM2A 2WO0A 3CC43 3KZTA 3QK9A 5AIFA 2F98A 2WGQA 3CU3A 3F9SA 4J8TA 1W00A 5CLKA 5IEOA 1S723 3LH4A 3B7CA 2XEPA 3HX8A 4L7KA 1IT7A 3ROBA 5IG4A 1JN5A 3GWRA 1SIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TX4 A;  1NB5 I;  1R4C A;  1GD4 A;  3KFQ C;  5A0O B;  1A67 A;  1N9J A;  1RN7 A;  1CYV A;  4IT7 A;  3UL5 A;  1ROA A;  1MOL A;  1MNL A;  4CCV A;  1G96 A;  4ZM8 A;  3KSE D;  1STF I;  1CYU A;  1WNH A;  3MWZ A;  4N6V 0;  3GAX A;  4N6O B;  3K9M C;  3L0R A;  1DVC A;  1IV7 A;  1NB3 I;  4EYC A;  3IMA B;  2BO9 B;  1EQK A;  1DVD A;  1A90 A;  1N5H A;  3SVA A;  1YVB I;  1GD3 A;  3NX0 A;  2KXG A;  2O9U X;  3PYJ A;  5EQL A;  4N6U A;  4N6M A;  3PS8 A;  2OCT A;  1FUW A;  3PXM A;  3S67 A;  1LXE A;  5LC6 A;  2W9Q A;  1IV9 A;  4N6T A;  1CEW I;  1M9G A;  4N6N B;  5ELJ A;  2CH9 A;  3UL6 A;  5LC7 A;  4LZI A;  1KWI A;  4N6L A;  1N5P A;  1TIJ A;  3Q2P A;  1PFP A;  3QRD A;  3LH4 A;  5ELU A;  2W9P A;  1FA3 A; 
#chains in the Genus database with same CATH topology
 1D6Z A;  1UCK A;  1NB5 I;  3CCQ 3;  2Z77 A;  3JUP A;  1T2H A;  1R4C A;  4R4K A;  1GD4 A;  3E99 A;  1CQS A;  2GU3 A;  1T2I A;  2IMJ A;  3MG1 A;  1YHQ 3;  4L8P A;  2C10 A;  3T8U A;  2KCD A;  5A0O B;  1I2F A;  3NUV A;  1A67 A;  3F40 A;  3K7C A;  2CWT A;  3NBR A;  3SXX A;  3CCV 3;  2K0M A;  2AAE A;  1TRP A;  4R9L A;  1RGA A;  1U5O A;  3AHW A;  3DGL A;  3WA3 A;  3DUK A;  4CCV A;  1ZO2 A;  3OWU A;  5KP3 A;  2OWP A;  1B2X A;  1U8C B;  2BIR A;  3FG4 A;  1GY5 A;  2L4V A;  3KSE D;  2OOV A;  3K0Z A;  2IY2 A;  4HVN A;  1STF I;  3HII A;  1QAL A;  1WNH A;  1O7H B;  1M90 4;  1B2M A;  1YIT 3;  4WHA A;  3ZFZ A;  4DKI A;  4N6V 0;  4XM4 A;  1GS3 A;  4RNY A;  1Q7Y 4;  4K90 B;  3CCE 3;  4OK0 A;  2CX1 A;  1ISK A;  4N6O B;  1RMS A;  1FW7 A;  5M18 A;  4LYL B;  1X1U A;  1W02 A;  2W04 A;  3K9M C;  4AEQ A;  2CIU A;  3AMO A;  3AHS A;  1QVF 2;  5D82 A;  3EN1 B;  1MWS A;  1NO3 A;  6STD A;  1DYU A;  3FKA A;  3G16 A;  3L0R A;  1BNG A;  2XSO B;  1NB3 I;  1Y4K A;  3WOD G;  2WGO A;  3B8L A;  1JBT A;  1BNR A;  3EBY A;  3HOH A;  4HKV B;  4IIA A;  4NPB A;  1UUW B;  3K5T A;  1V74 A;  1RRL A;  1X1Y A;  3JUM A;  3KII A;  4WWU C;  5DRV A;  1A90 A;  1HYF A;  1RGC A;  3DMC A;  3NQY A;  3K63 A;  1YI2 3;  5D81 A;  2OQE A;  3X3Y A;  2KF3 A;  2Q07 A;  3F8H A;  1M1X B;  1QVG 2;  3MSO A;  1BRN L;  1QAK A;  3SOA A;  3VSY A;  2O9U X;  1V57 A;  4N6U A;  3LTC A;  4KFD A;  1WMP A;  5BU4 A;  5AII A;  1WTH A;  1RGE A;  3KKG A;  3VF1 A;  1BNJ A;  3S28 A;  3WHO A;  1VQL 3;  3PS8 A;  4HM6 B;  3PZW A;  1V58 A;  2P05 A;  1BIR A;  1I70 A;  1YIJ 3;  3I55 3;  3I0Y A;  1TJD A;  3F7S A;  3LTB A;  4AKY A;  1BNE A;  3CC7 3;  3BNE A;  3WA2 X;  2ML6 A;  4U13 A;  3HIG A;  1LXE A;  2XFS A;  1FGT A;  1E3R A;  4HAA A;  1BSB A;  1LQM B;  2W9Q A;  4J9A A;  1EEJ A;  2KF4 A;  4HYZ A;  1SAR A;  3D79 A;  4N6T A;  3CCU 3;  3N9H A;  5HGR A;  1CEW I;  1Q40 A;  5HOH A;  1NDO B;  1OF5 B;  4XBY A;  4R1K A;  4R80 A;  1LNH A;  3OWY A;  1UCI A;  2W03 A;  3F14 A;  4LZI A;  3X41 A;  1O7W B;  5TGN A;  1I0V A;  2CW9 A;  4MMY B;  4RNT A;  5G1K A;  1L5G B;  1I2G A;  1TU5 A;  3CCJ 3;  1O7N B;  1LOX A;  1GYB A;  5D83 A;  1PFP A;  3CCS 3;  3WMD A;  1RLS A;  3QRD A;  4N3V A;  1AV4 A;  4HM7 B;  4RZM A;  3V92 A;  1N9E A;  3GRD A;  5AIH A;  3X3Z A;  1EUI C;  2BNG A;  3G71 3;  1K28 A;  1JB2 A;  4J5K A;  2C11 A;  8RNT A;  3LT9 A;  1BSA A;  4JRF A;  3SED A;  4EC6 A;  4PEJ A;  1BGS A;  1A2V A;  1BRK A;  5AI1 A;  1EG9 B;  3CXC 2;  2RGQ A;  3EJV A;  3FCS B;  3OXA A;  4BU4 A;  2Z6B A;  1Q81 4;  2H0I A;  2I9W A;  1OGX A;  4IT7 A;  3T8N A;  3LTD A;  1W5Z A;  5JPU A;  4KT3 B;  1MOL A;  1JJ2 2;  1RTU A;  2LQV A;  2SAR A;  3NV0 B;  5IER A;  1RGH A;  2ZDJ A;  3D4A A;  3FF0 A;  3MKI A;  1JKG A;  3SX1 A;  1VQP 3;  5CK6 A;  1JZO A;  3MYT A;  3A5E A;  1JBR A;  1BRI A;  3V98 A;  1CYU A;  2CWU A;  3MWZ A;  4LSO A;  2C4B A;  1VQM 3;  2ZHX B;  3OW2 2;  3D3L A;  1D6Y A;  4FMB A;  3BB9 A;  1UGI A;  4HM2 B;  3S5C A;  4CDL A;  7GSP A;  1UGH I;  2GEX A;  3KCH A;  3LOY A;  3RDE A;  3X42 A;  5AEW B;  1KD1 4;  2MC8 A;  4HM8 B;  3A76 A;  3NBB A;  1OGZ A;  2HMJ B;  1Q9E A;  1UCL A;  2LYX A;  2W56 A;  3U1W A;  1TRQ A;  1ULJ B;  1UUG B;  3H3H A;  1N8R 4;  4BIR A;  4FMC A;  4K1U A;  2XGL A;  2UGI A;  4I5Q A;  3MPH A;  3PCR A;  5GSP A;  1NWW A;  2K54 A;  4EYC A;  6GSP A;  3EB8 A;  4AKZ A;  2E2V A;  1GOU A;  1DET A;  3NM7 A;  2BO9 B;  3BU4 A;  4FR9 A;  1VQK 3;  2PZV A;  1DVD A;  3N54 B;  1Z1S A;  3FGY A;  1N5H A;  5I97 A;  1NNV A;  3U97 A;  3DGO A;  2CFL A;  6RNT A;  2J8X B;  3FH1 A;  1SQW A;  4OUQ A;  4KVH A;  4WYK A;  1YVB I;  4HM0 B;  1W2B 2;  4OVM A;  3NX0 A;  2F4Y A;  2HMM B;  1KC8 4;  2Z7A A;  1AVK A;  1W7C A;  1JBS A;  1WMN A;  3B4O A;  4WP5 A;  4EW5 A;  4HOH A;  1OH0 A;  2F5M A;  3B4P A;  2B24 B;  4HJL B;  8CHO A;  2R41 A;  3V99 A;  3UJM A;  2H0G A;  4O2H A;  1IK3 A;  2SBL A;  1RKY A;  3OV4 A;  2YFL B;  1GMP A;  3DY5 A;  1FUW A;  1STD A;  3PXM A;  2CHC A;  1JN5 B;  2OTJ 3;  4FCJ A;  1IDP A;  3MHE A;  4GB5 A;  5IG0 A;  1DE3 A;  3FF2 A;  1X1W A;  1O7M B;  2UUG C;  3CCM 3;  1IV9 A;  1I8V A;  3CPW 2;  1M9G A;  1IU7 A;  2CC3 A;  5ELJ A;  3CPO A;  1RRH A;  1B2Z A;  1BSE A;  5LC7 A;  1TTO A;  1QJG A;  5AEU B;  1ROV A;  5M1A A;  1Q82 4;  2P38 A;  1N5P A;  4BTX A;  1BOX A;  3RGR A;  2XSH B;  1IVX A;  3Q2P A;  4X2H A;  4LMI A;  1C7H A;  3FZW A;  1M1K 4;  1C54 A;  1Q7H A;  2BMR B;  5CF2 A;  4LGQ A;  1D6U A;  1BAO A;  4RBN A;  5IF6 A;  1BNS A;  1RN4 A;  2CFK A;  3EX9 A;  3EHC A;  1K41 A;  1YJ9 3;  4GL6 A;  4TX4 A;  4BL2 A;  1HZ1 A;  1UDI I;  3HK4 A;  4EV5 A;  2GXF A;  1VQ6 3;  1R4Y A;  4MMX B;  1RDS A;  1F8N A;  1AR0 A;  1QAF A;  1YGE A;  2FNQ A;  3CME 3;  1PY3 A;  1B27 A;  1CYV A;  1CH0 A;  2F86 B;  1BAN A;  1JRQ A;  3AMO B;  1BUJ A;  1OAC A;  3LML A;  4BTY A;  5DRE A;  7STD A;  1RGF A;  4KFE A;  3Q90 A;  3N8B A;  1OHP A;  3SLU A;  2P09 A;  5BXQ A;  5KP1 A;  3D9R A;  4IPB A;  1UW1 A;  3M8C A;  1RGL A;  1MWR A;  1I0X A;  2HMO B;  4STD A;  1I3I A;  2GBW B;  2CG0 A;  3FG1 A;  4HM5 B;  3HZP A;  3GZR A;  3Q1C A;  7RNT A;  1BNI A;  3GAX A;  1IVW A;  1K9M 4;  3I56 3;  3DGY A;  3NXJ A;  2PNC A;  1I2E A;  3EE1 A;  2RFR A;  1HU9 A;  4NHF A;  3MG3 A;  1I3F A;  2W0Q A;  4I4K A;  4XDV A;  4R9K A;  1PYL A;  1S5A A;  1G0T A;  3AGN A;  1VZZ A;  1GSP A;  4XBT A;  2AAD A;  2ZA4 A;  2YFJ B;  3G4S 3;  3WOE B;  1ASK A;  1KSI A;  1UCJ A;  1W6Y A;  3JUO A;  1DVC A;  2GSP A;  3GSP A;  1IV7 A;  2M7O A;  3GZY B;  5AYR B;  1SIH A;  4XDW A;  3IMA B;  1JNQ A;  1Q86 4;  3NHX A;  2QGU A;  2QEX 3;  2F99 A;  2GU1 A;  1UUV B;  2L1S A;  3RNT A;  3VGN A;  4H3U A;  4H61 A;  1VQN 3;  2Z76 A;  4ILF A;  3SVA A;  3WOF B;  1YNV X;  1VQO 3;  1FGR A;  3FG3 A;  4HM4 B;  2CKF B;  1A2P A;  4HZ9 B;  3CNM A;  4WFO A;  4EV2 A;  1NU3 A;  2KF6 A;  1E3V A;  1GMR A;  1IQY A;  1Q40 B;  1MWT A;  3KE7 A;  2KF5 A;  1UI7 A;  2KXG A;  3SYU A;  1W2Z A;  3PYJ A;  1KQS 2;  2Y74 A;  2UX0 A;  2F56 A;  1LOV A;  2GEY A;  2WOH A;  3J7Y d;  1WMO A;  4N6M A;  2R4I A;  3IJE B;  3STD A;  1WQL B;  3S27 A;  2OCT A;  4EXR A;  1BVI A;  1GOY A;  5BIR A;  1AVL A;  2GBX B;  2HMK B;  1YVS A;  1FGO A;  2Y73 A;  4ORL A;  1VQ8 3;  1LQG C;  2O3O A;  3BND A;  1JB5 A;  3D5G A;  3ALA A;  3DZL A;  4CPK A;  1B20 A;  2JDI H;  3KN4 A;  3PCS A;  2ML5 A;  3CCR 3;  1VQ5 3;  3JVC A;  3SOY A;  1TFK A;  5LC6 A;  1O7G B;  3BNB A;  3LTA A;  1DMN A;  1LVN A;  3ZG0 A;  2OOV C;  3CD6 3;  4MEI A;  2BT3 A;  2KAA A;  3TDG A;  3UL6 A;  3UNL A;  3JUQ A;  4LEH A;  2XR8 B;  3AGO A;  4O8S A;  5CF1 A;  1KWI A;  4N6L A;  3CNX A;  1TIJ A;  1X1X A;  1RHL A;  2XH9 A;  1GY6 A;  1ZS7 A;  1BRG A;  2YFI B;  1RGG A;  3URP A;  2B1X B;  4MJD A;  1UI8 A;  5EVH A;  2BU4 A;  1JKG B;  1OCV A;  3OX9 A;  5AYS C;  5ELU A;  4RNZ A;  4QWT A;  2CK3 H;  2W9P A;  1FA3 A;  3X3X A;  1BRH A;  3DXO A;  2OTL 3;  1FZU A;  1FGQ A;  3BLZ A;  1OUN A;  1O7P B;  1BSD A;  2H0H A;  1FUS A;  2CFW A;  3KFQ C;  3LXU X;  1VQ9 3;  1BNF A;  1OF5 A;  4K61 A;  2P0X A;  3BIR A;  1YJN 3;  1IQX A;  2RBI A;  1N9J A;  1RN7 A;  2RCD A;  3HI7 A;  1MGR A;  3BNC A;  2JQ5 A;  4HM1 B;  4FMD A;  5CXO A;  1W4N A;  2W56 B;  5STD A;  1IT8 A;  1DMQ A;  1JV2 B;  3UL5 A;  4BTW A;  1ROA A;  3D5I A;  1RNB A;  1MNL A;  2OQE C;  1GY7 A;  2W6J H;  1G96 A;  1RN1 A;  3ECF A;  4ZM8 A;  5JBS A;  1TUH A;  1ZX2 A;  1BRS A;  2A15 A;  2K3D A;  3NBJ A;  2ZL8 A;  3OWS A;  5G2G A;  3X40 A;  3GZB A;  3CC2 3;  2IUK A;  2W2C A;  1G02 A;  4Q53 A;  1RSN A;  2XGN A;  4HZB B;  5EEO A;  1DMM A;  1NJI 4;  1W01 A;  3T0U A;  1LOY A;  2WOF A;  1YGW A;  1VQ7 3;  2IUJ A;  1JZD A;  1LOW A;  3EF8 A;  3PGB A;  1EA2 A;  5JPP A;  2XFT A;  4GHO A;  1IQ8 A;  1B21 A;  1OHS A;  2E2U A;  2XRX B;  3EQQ B;  2E2T A;  2HOH A;  4G1M B;  4WYK B;  1BRJ A;  3NQZ A;  4MMZ B;  2INX A;  2KRT A;  3O8Y A;  4O3V A;  1Q42 A;  1RJO A;  1BSC A;  1QMA A;  2CG1 A;  1B2S A;  3WDG B;  3WR2 A;  1T3B A;  1LNI A;  2CFD A;  4HM3 B;  4X2O A;  1OPY A;  1K8A 4;  4FMA A;  4L8O A;  3NV0 A;  1A2K A;  5IEN A;  3G6E 3;  1RCL A;  1GOV A;  2F5W A;  2P0M A;  5IW9 A;  3UB1 A;  1J2B A;  1EQK A;  1W6C A;  2QA4 3;  3GZX B;  5M19 A;  4EBG A;  2CWV A;  2CFG A;  1AQZ A;  2HML B;  3RGA A;  9RNT A;  4KFF A;  2CX0 A;  4FCZ A;  1LRA A;  4NRE A;  4BL3 A;  1IYY A;  3MG2 A;  3JUN A;  3S29 A;  2QIY A;  3DM8 A;  1RCK A;  1BUQ A;  4KZ1 A;  5IEO A;  1GD3 A;  4XBX A;  1EKM A;  2STD A;  1HKX A;  2YX9 A;  3EC9 A;  2HMN B;  5IEP A;  3FSD A;  1N8Q A;  1ZGX A;  2BHM A;  4JF8 A;  5EQL A;  1GMQ A;  1TP6 A;  1JB4 A;  1W6G A;  5AIG A;  3F8X A;  3KSP A;  3H51 A;  3LT8 A;  5IG3 A;  1YJW 3;  2XF3 A;  5FGO A;  3ZG5 A;  3CCL 3;  1T5Y A;  4J5G A;  1TFO A;  1B2U A;  1IVV A;  1MGW A;  2D42 A;  2D1W A;  2IA7 A;  1BU4 A;  1VQQ A;  3DGM A;  3EN8 A;  3G0K A;  3G8Z A;  2RNT A;  5G1L A;  5BVB A;  4O02 B;  5KP4 A;  4K1V A;  1SJW A;  5RNT A;  5IG5 A;  3IPT A;  3S67 A;  1VQ4 3;  2FGT A;  1E97 A;  1OHO A;  1K73 4;  2RSX A;  2V1L A;  4FCM A;  5FW5 A;  2BMO B;  3LZA A;  1US1 A;  4GSP A;  2BMQ B;  2FXT A;  4N6N B;  1RGK A;  3DH2 A;  2CH9 A;  3ER7 A;  4XB5 A;  1PU4 A;  1SPU A;  1ULI B;  3EBT A;  3CMA 3;  1FGM A;  3LYG A;  3DGN A;  2MF7 A;  1IVU A;  3FLJ A;  1AY7 A;  3F7X A;  4HBR A;  4CJN A;  3NM2 A;  1MWU A;  2WO0 A;  3CC4 3;  3KZT A;  1B3S A;  3QK9 A;  1FUT A;  5AIF A;  1FYS A;  2F98 A;  2WGQ A;  3CU3 A;  3F9S A;  1W00 A;  2IYJ A;  3Q3F A;  4J8T A;  3LH4 A;  5CLK A;  3B7C A;  1S72 3;  2XEP A;  3HX8 A;  4L7K A;  1IT7 A;  3ROB A;  5IG4 A;  1JN5 A;  1RNT A;  3GWR A;  1SII A; 
#chains in the Genus database with same CATH homology
 1D6Z A;  1NB5 I;  3CCQ 3;  2Z77 A;  3JUP A;  1R4C A;  4R4K A;  1GD4 A;  3E99 A;  1CQS A;  2GU3 A;  3MG1 A;  2IMJ A;  4L8P A;  2C10 A;  3T8U A;  2KCD A;  5A0O B;  3NUV A;  1A67 A;  3F40 A;  3K7C A;  2CWT A;  3NBR A;  3SXX A;  3CCV 3;  2K0M A;  4R9L A;  1U5O A;  3DGL A;  3WA3 A;  3DUK A;  4CCV A;  1ZO2 A;  3OWU A;  5KP3 A;  2OWP A;  1U8C B;  3FG4 A;  1GY5 A;  2L4V A;  3KSE D;  2OOV A;  3K0Z A;  4HVN A;  1STF I;  3HII A;  1QAL A;  1WNH A;  1O7H B;  1M90 4;  1YIT 3;  4WHA A;  4N6V 0;  4XM4 A;  1GS3 A;  4RNY A;  1Q7Y 4;  4K90 B;  3CCE 3;  4OK0 A;  1ISK A;  4N6O B;  1W02 A;  2W04 A;  3K9M C;  4AEQ A;  2CIU A;  3AMO A;  1QVF 2;  5D82 A;  3EN1 B;  1NO3 A;  6STD A;  1DYU A;  3FKA A;  3G16 A;  3L0R A;  2XSO B;  1NB3 I;  1Y4K A;  3WOD G;  2WGO A;  3B8L A;  3EBY A;  4HKV B;  4IIA A;  1UUW B;  3K5T A;  1V74 A;  1RRL A;  3JUM A;  3KII A;  5DRV A;  4WWU C;  1A90 A;  3DMC A;  3NQY A;  3K63 A;  1YI2 3;  5D81 A;  2OQE A;  3X3Y A;  2Q07 A;  3F8H A;  1M1X B;  1QVG 2;  3MSO A;  1QAK A;  3SOA A;  3VSY A;  2O9U X;  4N6U A;  3LTC A;  4KFD A;  1WMP A;  5AII A;  1WTH A;  3KKG A;  3VF1 A;  3S28 A;  1VQL 3;  3PS8 A;  4HM6 B;  3PZW A;  2P05 A;  1YIJ 3;  3I55 3;  3I0Y A;  3F7S A;  3LTB A;  4AKY A;  3CC7 3;  3BNE A;  3WA2 X;  2ML6 A;  4U13 A;  3HIG A;  1LXE A;  2XFS A;  1FGT A;  1E3R A;  2W9Q A;  4J9A A;  4HYZ A;  4N6T A;  3CCU 3;  3N9H A;  5HGR A;  1CEW I;  1Q40 A;  1NDO B;  1OF5 B;  4XBY A;  4R1K A;  4R80 A;  1LNH A;  3OWY A;  2W03 A;  3F14 A;  4LZI A;  3X41 A;  1O7W B;  5TGN A;  4MMY B;  2CW9 A;  1L5G B;  1TU5 A;  1YHQ 3;  3CCJ 3;  1O7N B;  1LOX A;  1GYB A;  5D83 A;  1PFP A;  3CCS 3;  3WMD A;  3QRD A;  4N3V A;  1AV4 A;  4HM7 B;  4RZM A;  3V92 A;  1N9E A;  3GRD A;  5AIH A;  3X3Z A;  2BNG A;  3G71 3;  1K28 A;  1JB2 A;  2C11 A;  3LT9 A;  4JRF A;  3SED A;  4EC6 A;  4PEJ A;  1A2V A;  5AI1 A;  1EG9 B;  3CXC 2;  2RGQ A;  3EJV A;  3FCS B;  3OXA A;  1Q81 4;  2Z6B A;  2I9W A;  1OGX A;  4IT7 A;  3T8N A;  3LTD A;  1W5Z A;  5JPU A;  1MOL A;  1JJ2 2;  2LQV A;  3NV0 B;  5IER A;  2ZDJ A;  3FF0 A;  3MKI A;  1JKG A;  3SX1 A;  1VQP 3;  5CK6 A;  3MYT A;  1CYU A;  3V98 A;  2CWU A;  3MWZ A;  4LSO A;  1VQM 3;  3OW2 2;  3D3L A;  1D6Y A;  4FMB A;  3BB9 A;  4HM2 B;  3S5C A;  4CDL A;  3RDE A;  2GEX A;  3X42 A;  3LOY A;  5AEW B;  1KD1 4;  2MC8 A;  4HM8 B;  3A76 A;  3NBB A;  1OGZ A;  2HMJ B;  2LYX A;  2W56 A;  3U1W A;  1ULJ B;  3H3H A;  1N8R 4;  4FMC A;  4K1U A;  2XGL A;  3MPH A;  3PCR A;  1NWW A;  2K54 A;  4EYC A;  3EB8 A;  4AKZ A;  2E2V A;  3NM7 A;  2BO9 B;  4FR9 A;  1VQK 3;  1DVD A;  2PZV A;  3N54 B;  1Z1S A;  3FGY A;  1N5H A;  5I97 A;  3U97 A;  3DGO A;  2CFL A;  3FH1 A;  1SQW A;  4OUQ A;  4KVH A;  4WYK A;  1YVB I;  4HM0 B;  1W2B 2;  4OVM A;  3NX0 A;  2HMM B;  1KC8 4;  2Z7A A;  1AVK A;  1W7C A;  1WMN A;  3B4O A;  4WP5 A;  1OH0 A;  3B4P A;  2B24 B;  4HJL B;  8CHO A;  3V99 A;  3UJM A;  4O2H A;  1IK3 A;  2SBL A;  1RKY A;  3OV4 A;  2YFL B;  3DY5 A;  1FUW A;  1STD A;  3PXM A;  2CHC A;  1JN5 B;  2OTJ 3;  4FCJ A;  1IDP A;  3MHE A;  4GB5 A;  5IG0 A;  3FF2 A;  1O7M B;  3CCM 3;  1IV9 A;  3CPW 2;  1M9G A;  1IU7 A;  2CC3 A;  5ELJ A;  3CPO A;  1RRH A;  5LC7 A;  1QJG A;  5AEU B;  1ROV A;  1Q82 4;  2P38 A;  1N5P A;  4BTX A;  3RGR A;  2XSH B;  1IVX A;  3Q2P A;  4X2H A;  4LMI A;  1C7H A;  3FZW A;  1M1K 4;  2BMR B;  5CF2 A;  4LGQ A;  1D6U A;  4RBN A;  5IF6 A;  2CFK A;  3EX9 A;  3EHC A;  1K41 A;  1YJ9 3;  4GL6 A;  4TX4 A;  3HK4 A;  4EV5 A;  2GXF A;  1VQ6 3;  4MMX B;  1F8N A;  1AR0 A;  1QAF A;  1YGE A;  2FNQ A;  3CME 3;  1CYV A;  2F86 B;  1JRQ A;  3AMO B;  1OAC A;  3LML A;  4BTY A;  5DRE A;  7STD A;  4KFE A;  3Q90 A;  3N8B A;  1OHP A;  3SLU A;  2P09 A;  5BXQ A;  5KP1 A;  3D9R A;  4IPB A;  1UW1 A;  3M8C A;  2HMO B;  4STD A;  2GBW B;  2CG0 A;  3FG1 A;  4HM5 B;  3HZP A;  3GZR A;  3Q1C A;  1K9M 4;  3GAX A;  1IVW A;  3I56 3;  3NXJ A;  2PNC A;  3EE1 A;  2RFR A;  1HU9 A;  4NHF A;  3MG3 A;  2W0Q A;  4I4K A;  4XDV A;  4R9K A;  1S5A A;  1VZZ A;  4XBT A;  2YFJ B;  3G4S 3;  3WOE B;  1ASK A;  1KSI A;  1W6Y A;  3JUO A;  1DVC A;  1IV7 A;  2M7O A;  3GZY B;  5AYR B;  1SIH A;  4XDW A;  3IMA B;  1JNQ A;  1Q86 4;  3NHX A;  2QGU A;  2QEX 3;  2F99 A;  2GU1 A;  1UUV B;  3VGN A;  4H3U A;  4H61 A;  1VQN 3;  2Z76 A;  3SVA A;  3WOF B;  1VQO 3;  1FGR A;  3FG3 A;  4HM4 B;  2CKF B;  4HZ9 B;  3CNM A;  4WFO A;  4EV2 A;  1NU3 A;  1E3V A;  1IQY A;  1Q40 B;  3KE7 A;  2KXG A;  1UI7 A;  1W2Z A;  3PYJ A;  1KQS 2;  2Y74 A;  2UX0 A;  2GEY A;  2WOH A;  3J7Y d;  1WMO A;  4N6M A;  2R4I A;  3IJE B;  3STD A;  1WQL B;  3S27 A;  2OCT A;  4EXR A;  1AVL A;  2GBX B;  2HMK B;  2Y73 A;  1FGO A;  4ORL A;  1VQ8 3;  2O3O A;  3BND A;  1JB5 A;  3DZL A;  3ALA A;  3CCR 3;  3KN4 A;  2JDI H;  3PCS A;  2ML5 A;  1VQ5 3;  3JVC A;  3SOY A;  1TFK A;  5LC6 A;  1O7G B;  3BNB A;  3LTA A;  1DMN A;  1LVN A;  2OOV C;  3CD6 3;  4MEI A;  2BT3 A;  3TDG A;  3UL6 A;  3UNL A;  3JUQ A;  4LEH A;  2XR8 B;  4O8S A;  5CF1 A;  1KWI A;  4N6L A;  3CNX A;  1TIJ A;  2XH9 A;  1GY6 A;  2YFI B;  2B1X B;  4MJD A;  1UI8 A;  5EVH A;  1JKG B;  1OCV A;  3OX9 A;  5AYS C;  5ELU A;  4RNZ A;  4QWT A;  2W9P A;  2CK3 H;  1FA3 A;  3X3X A;  3DXO A;  2OTL 3;  1FGQ A;  3BLZ A;  1OUN A;  1O7P B;  2CFW A;  3KFQ C;  3LXU X;  1VQ9 3;  1OF5 A;  4K61 A;  2P0X A;  1YJN 3;  1IQX A;  2RCD A;  1N9J A;  1RN7 A;  3HI7 A;  4HM1 B;  3BNC A;  2JQ5 A;  4FMD A;  5CXO A;  1W4N A;  2W56 B;  5STD A;  1IT8 A;  1DMQ A;  1JV2 B;  3UL5 A;  4BTW A;  1ROA A;  1MNL A;  2OQE C;  1GY7 A;  2W6J H;  1G96 A;  3ECF A;  4ZM8 A;  5JBS A;  1TUH A;  1ZX2 A;  2A15 A;  3NBJ A;  3OWS A;  2ZL8 A;  5G2G A;  3X40 A;  3GZB A;  3CC2 3;  2IUK A;  2W2C A;  4Q53 A;  2XGN A;  4HZB B;  5EEO A;  1DMM A;  1NJI 4;  1W01 A;  3T0U A;  2WOF A;  1VQ7 3;  2IUJ A;  3EF8 A;  3PGB A;  1EA2 A;  5JPP A;  2XFT A;  1IQ8 A;  1OHS A;  2E2U A;  4WYK B;  2XRX B;  3EQQ B;  2E2T A;  4G1M B;  3NQZ A;  4MMZ B;  2INX A;  2KRT A;  3O8Y A;  4O3V A;  1Q42 A;  1RJO A;  2CG1 A;  1QMA A;  3WDG B;  2CFD A;  4HM3 B;  4X2O A;  1OPY A;  1K8A 4;  4FMA A;  4L8O A;  3NV0 A;  1A2K A;  5IEN A;  3G6E 3;  5IW9 A;  2P0M A;  3UB1 A;  1J2B A;  1EQK A;  1W6C A;  2QA4 3;  3GZX B;  4EBG A;  2CWV A;  2CFG A;  2HML B;  3RGA A;  4KFF A;  4FCZ A;  4NRE A;  3MG2 A;  3JUN A;  3S29 A;  2QIY A;  3DM8 A;  1BUQ A;  4KZ1 A;  1GD3 A;  4XBX A;  1EKM A;  2STD A;  1HKX A;  2YX9 A;  3EC9 A;  2HMN B;  5IEP A;  3FSD A;  1N8Q A;  2BHM A;  4JF8 A;  5EQL A;  1TP6 A;  1JB4 A;  1W6G A;  5AIG A;  3F8X A;  3KSP A;  3H51 A;  3LT8 A;  5IG3 A;  1YJW 3;  2XF3 A;  5FGO A;  3CCL 3;  1T5Y A;  1TFO A;  1IVV A;  2D42 A;  2D1W A;  2IA7 A;  3DGM A;  3EN8 A;  3G0K A;  3G8Z A;  5BVB A;  4O02 B;  5KP4 A;  4K1V A;  1SJW A;  5IG5 A;  3IPT A;  3S67 A;  1VQ4 3;  2FGT A;  1E97 A;  1OHO A;  1K73 4;  2RSX A;  2V1L A;  4FCM A;  5FW5 A;  2BMO B;  3LZA A;  1US1 A;  2FXT A;  2BMQ B;  4N6N B;  1PU4 A;  2CH9 A;  3ER7 A;  4XB5 A;  1SPU A;  1ULI B;  3EBT A;  3CMA 3;  1FGM A;  3LYG A;  3DGN A;  2MF7 A;  1IVU A;  3FLJ A;  3F7X A;  4HBR A;  3NM2 A;  2WO0 A;  3CC4 3;  3KZT A;  3QK9 A;  5AIF A;  2F98 A;  2WGQ A;  3CU3 A;  3F9S A;  4J8T A;  1W00 A;  5CLK A;  5IEO A;  1S72 3;  3LH4 A;  3B7C A;  2XEP A;  3HX8 A;  4L7K A;  1IT7 A;  3ROB A;  5IG4 A;  1JN5 A;  3GWR A;  1SII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...