3K0ZA

Crystal structure of putative polyketide cyclase (np_977253.1) from bacillus cereus atcc 10987 at 1.91 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
149
structure length
149
Chain Sequence
EVQLLKEMPKPKAMTIDPSLSQKEATEMVHAAQRFYAFWDTGKEELIPQTVTENFFDHTLPKGRPQGTEGLKFAAQNFRKIVPNIHCEIEDLLVVGDKVTARLSFTGTHNDKKIDFFAIDILHVKDGKITEDWHLEDNLTLKQQLGLIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative polyketide cyclase
publication title Crystal structure of Putative polyketide cyclase (NP_977253.1) from BACILLUS CEREUS ATCC 10987 at 1.91 A resolution
rcsb
source organism Bacillus cereus
total genus 44
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3k0zA00
3LZAA 2GBXB 4L8OA 1GY6A 5AIFA 1NDOB 4HJLB 1W6YA 2YFJB 3MKIA 4HM3B 5JPPA 4XBYA 1GS3A 5KP1A 3EHCA 3SEDA 1S5AA 1UUWB 3GWRA 2INXA 1GY5A 5D83A 4K1VA 1A2KA 4L8PA 2RFRA 2PZVA 4PEJA 2QIYA 3FZWA 3MHEA 5D82A 3Q90A 4I4KA 4X2OA 1NU3A 4LEHA 4XBTA 1IDPA 3NV0B 2HMNB 2CKFB 3OWYA 5BXQA 1JB5A 1O7GB 2GBWB 2CHCA 4HKVB 4Q53A 4HM8B 4R1KA 3HZPA 5STDA 1JKGB 1AR0A 4HM1B 3RGAA 1O7MB 4IIAA 3OWSA 1EG9B 3EX9A 3F8HA 3FH1A 3ECFA 1Q40B 3CNXA 3K7CA 1Z1SA 3B7CA 1WQLB 2I9WA 3FSDA 4KVHA 4J9AA 3IPTA 6STDA 4WYKB 1E3VA 3H3HA 3GZBA 3ROBA 2Z77A 2XR8B 3CPOA 2YFLB 3JUQA 3MSOA 4GB5A 2F86B 3KKGA 4HVNA 3FKAA 1W00A 4XDVA 2GEYA 1TP6A 2GXFA 5AEUB 4U13A 1ULJB 4X2HA 1OH0A 4HZBB 1OHPA 3GRDA 3B4OA 3DMCA 4ORLA 2B1XB 3JUMA 5AIGA 3OV4A 2BMRB 1NWWA 1ULIB 1DMMA 3KZTA 3JUPA 1CQSA 3HK4A 5IG3A 4FCMA 3NXJA 1E3RA 5IEPA 2R4IA 4HM2B 5IERA 2HMKB 2K54A 3BB9A 3JUOA 3F7SA 2A15A 2RGQA 5AI1A 5BVBA 1OPYA 1OF5B 1OGXA 3FGYA 3NBRA 3T8NA 1ZO2A 1JN5A 2IMJA 3EJVA 1W02A 5KP4A 1EA2A 4XM4A 3STDA 3EC9A 4HM5B 3EBTA 3H51A 3MYTA 5CK6A 3ER7A 3NM2A 1JB2A 3FF2A 2GEXA 3KSPA 3M8CA 2Z76A 4STDA 3VSYA 1E97A 4XDWA 3MG1A 3WMDA 2YFIB 1W01A 5AIHA 5IEOA 3G0KA 2HMJB 3DZLA 5JPUA 1JB4A 3UNLA 1BUQA 1HKXA 3EQQB 3BLZA 5HGRA 4R9LA 4R9KA 2XSOB 4CDLA 3E99A 3S5CA 3G16A 4XBXA 1C7HA 2OWPA 3VGNA 3EN1B 3JUNA 4HM7B 4LMIA 5IF6A 3B4PA 2BNGA 3A76A 5IENA 7STDA 5AIIA 3KE7A 4HM6B 1K41A 1OHSA 1QJGA 5TGNA 3MG2A 3F40A 2F98A 3DM8A 1ISKA 3OXAA 1TUHA 3F14A 1OCVA 5EVHA 3NV0A 1GY7A 4J8TA 1OUNA 3GZYB 4HM0B 4N3VA 3DXOA 4WP5A 5AEWB 1Q42A 5CLKA 1DMQA 2HMLB 1O7PB 4FCJA 4MJDA 2F99A 5DREA 1JKGA 1O7WB 3EN8A 8CHOA 2HMMB 3B8LA 3DUKA 3GZRA 1VZZA 5DRVA 1DMNA 2HMOB 1STDA 1Q40A 4LGQA 3OWUA 2XSHB 4RZMA 1GYBA 1ZX2A 4OVMA 2RCDA 3CU3A 5IG0A 1O7HB 3G8ZA 3HX8A 3F7XA 5FW5A 4WYKA 1ASKA 3MG3A 1OHOA 3NHXA 4HM4B 1OGZA 3F9SA 2STDA 4OUQA 4HZ9B 3SOAA 3OX9A 3T8UA 5CF1A 2QGUA 5D81A 3UJMA 2UX0A 3EF8A 1SJWA 1UUVB 1JN5B 3I0YA 3K0ZA 4L7KA 5G2GA 5KP3A 3CNMA 3SOYA 3FF0A 3NUVA 2B24B 3LYGA 2BMQB 5CXOA 5CF2A 5IG5A 3D9RA 3FLJA 3GZXB 4WWUC 2W2CA 2BMOB 1U5OA 2XRXB 1O7NB 4K1UA 3EBYA 2Z7AA 1QMAA 3F8XA 4XB5A 5IG4A 2JQ5A 4H3UA 3RGRA 1OF5A
chains in the Genus database with same CATH superfamily
3LZAA 1EUIC 2GBXB 4NHFA 2XFSA 4L8OA 5G1KA 1GY6A 2BO9B 2CG0A 5AIFA 1Q7HA 1KSIA 1NDOB 4HJLB 1W6YA 1RN4A 1G0TA 2YFJB 3MKIA 4BTWA 1Q864 1VQL3 1WTHA 2IYJA 4HM3B 5ELJA 3K5TA 5JPPA 1VQO3 1DVCA 2W9PA 4XBYA 2OOVC 1GS3A 5KP1A 3EHCA 3SEDA 1PYLA 1EKMA 1UI8A 3LTBA 1S5AA 4CPKA 1UUWB 3DGYA 1LVNA 1GY5A 2INXA 3GWRA 4N6NB 5D83A 2P0XA 3WODG 5BU4A 1VQ83 2JDIH 4K1VA 4N6OB 1UCLA 1N9EA 1MGRA 1A2KA 2CFDA 1RMSA 4L8PA 3D5IA 1KWIA 1BRKA 2C11A 2RFRA 2QEX3 1KQS2 2PZVA 3DGOA 4WHAA 4PEJA 1JBTA 1FUTA 3X40A 1D6ZA 1I0VA 2QIYA 1IV7A 4J5KA 5M19A 3WA2X 3FZWA 3MHEA 1WMOA 4BTYA 1LOXA 4EXRA 3G713 1RN7A 1TRPA 2CFGA 2LYXA 3SLUA 1GMRA 3BIRA 5D82A 3Q90A 3S27A 1X1WA 1IQ8A 2O3OA 2Q07A 4FR9A 2FNQA 1BU4A 1RGEA 2CG1A 1TU5A 1M1K4 3CCV3 4I4KA 4X2OA 1NU3A 1TIJA 4MEIA 4LEHA 3URPA 1DE3A 4TX4A 4XBTA 1IDPA 1J2BA 3NV0B 4QWTA 1YGWA 3PZWA 2CK3H 2HMNB 2CKFB 1UDII 3L0RA 3OWYA 3KN4A 1JB5A 1O7GB 2BIRA 5BXQA 1NJI4 2P05A 2R41A 2CX1A 2AADA 2GBWB 3DGMA 4N6V0 2CHCA 3AMOA 3X41A 2KF4A 1G96A 1BGSA 3Q2PA 1BRSA 2ML5A 1B2SA 3Q3FA 1IVVA 4HKVB 4BL3A 1BUJA 1UCKA 4Q53A 4HM8B 4R1KA 3U1WA 3HZPA 3ZFZA 3WR2A 4AKYA 2W0QA 5STDA 2XEPA 2J8XB 2XFTA 2K3DA 1JJ22 1BNEA 1BRJA 1BSEA 3NQZA 1JKGB 1AR0A 2CIUA 4ZM8A 1IQYA 4OK0A 3IJEB 4FMCA 2XGNA 2Z6BA 2Y73A 4HM1B 3RGAA 1O7MB 3BNBA 4IIAA 3OWSA 3V98A 1B2XA 1EG9B 1OACA 3EX9A 3F8HA 3FH1A 3ECFA 1Q40B 1U8CB 3N9HA 3CNXA 3K7CA 3G4S3 1Z1SA 3NQYA 1MNLA 3S29A 3CCE3 1M904 3B7CA 1YGEA 1IU7A 1WQLB 1B2UA 2I9WA 3X3YA 3CCM3 1C54A 4NREA 2M7OA 5M1AA 2RNTA 3FSDA 2GU3A 1FGOA 1R4YA 4J9AA 3JVCA 2KCDA 1TJDA 1UGIA 3HIIA 3GAXA 3NM7A 4I5QA 5RNTA 2RSXA 3U97A 2IY2A 2E2VA 3IPTA 6STDA 4WYKB 1E3VA 4JRFA 2YX9A 3H3HA 3GZBA 3WOFB 3ROBA 2W03A 2Z77A 1W4NA 1N9JA 2XR8B 1IYYA 2H0IA 3CPOA 2YFLB 3CD63 3SVAA 1GOVA 1BIRA 1BANA 1K734 5EQLA 3JUQA 2W9QA 1IVUA 3FG3A 2GU1A 4N6UA 3MSOA 1RSNA 4GB5A 1YVSA 1VQP3 4KFDA 1NB5I 1TFOA 2F86B 3KKGA 1ZGXA 4HVNA 1SPUA 1US1A 1X1YA 2W56A 3FKAA 1W00A 4O3VA 4XDVA 2GEYA 3WA3A 1L5GB 1GMPA 1RNBA 1VQ93 1TP6A 3AHSA 3CME3 2GXFA 4O8SA 3J7Yd 1FZUA 3D4AA 5AEUB 1KD14 1KC84 3X3XA 2L1SA 2D42A 4U13A 1B3SA 1ULJB 1BSCA 1T5YA 1N8R4 4X2HA 3MPHA 1UUGB 1OH0A 2F5WA 4HZBB 4KFEA 1OHPA 3NX0A 1QALA 3GRDA 8RNTA 2AAEA 3LTAA 3D79A 4R80A 1BNGA 3B4OA 3DMCA 4EW5A 4ORLA 2B1XB 3WOEB 1NNVA 1DVDA 3JUMA 1MWUA 1FGQA 2E2UA 1A2VA 3PCSA 1T2HA 1LRAA 4EYCA 1YHQ3 5AIGA 4IT7A 3OV4A 2CFLA 2BMRB 1NWWA 2KF5A 1ULIB 1DMMA 3KZTA 3ZG0A 1I2FA 1IVXA 3JUPA 2P09A 3DGNA 2F56A 1ROAA 2SARA 5HOHA 1I3FA 1CQSA 1K28A 2CWVA 4H61A 5ELUA 3HK4A 2L4VA 4MMYB 5I97A 5IG3A 2QA43 4FCMA 1RGKA 3PS8A 4GSPA 3KFQC 1E3RA 3KSED 3NXJA 5IEPA 3N54B 4IPBA 5GSPA 1EQKA 2MF7A 4G1MB 2R4IA 4HM2B 1RCLA 1CEWI 4K61A 4LZIA 1HU9A 2H0GA 2IA7A 5IERA 1M1XB 1Q7Y4 2HMKB 1VQQA 2FXTA 1JBSA 2K54A 3BB9A 3JUOA 3HOHA 3IMAB 3F7SA 2A15A 2RGQA 4RBNA 3CC23 5AI1A 4N6LA 5BVBA 4EBGA 3CCU3 1RTUA 4KT3B 2OTJ3 1OPYA 1OF5B 1OGXA 1G02A 1RRHA 2F5MA 4GHOA 4KVHA 3FGYA 1RGHA 3NBRA 3I553 2CWTA 4N6MA 1B21A 1Q9EA 3EE1A 3T8NA 1BNIA 4AEQA 1FYSA 2ZDJA 3S28A 1ZO2A 3FG1A 5LC7A 1JN5A 2IMJA 3EJVA 1W02A 1PU4A 3G6E3 5KP4A 1EA2A 4XM4A 3STDA 1D6UA 3WHOA 3EC9A 1IVWA 2RBIA 3NBBA 4HM5B 1W7CA 1QAKA 5A0OB 5M18A 1Q824 2KXGA 2GSPA 1MOLA 1AY7A 1AVLA 3EBTA 1VQN3 4LYLB 2D1WA 4MMZB 1B27A 2V1LA 3H51A 3HI7A 3MYTA 1FGTA 2KF3A 3O8YA 1Y4KA 5CK6A 1RJOA 1GSPA 2C4BA 3ER7A 1RGCA 1RRLA 3CCJ3 1YJW3 1AV4A 3NM2A 3PCRA 1BRGA 4CCVA 1JB2A 3FF2A 3UL6A 1JZDA 1D6YA 5EEOA 5AYSC 1LNHA 3GSPA 2UUGC 3DY5A 4KFFA 2GEXA 1RGAA 1LNIA 3CCL3 1W2ZA 4CJNA 3N8BA 2K0MA 3KSPA 3CPW2 3CCQ3 1BRIA 3V92A 4BIRA 3M8CA 1BNSA 2Z76A 4STDA 3VSYA 1E97A 4MMXB 2E2TA 4XDWA 1STFI 3UB1A 2OCTA 3MG1A 2Y74A 3WMDA 1MWTA 2YFIB 1W01A 4WFOA 3AGNA 5AIHA 4HBRA 2O9UX 5IEOA 1QVG2 1WNHA 3G0KA 2HMJB 3DZLA 2BHMA 1VQ73 2FGTA 1I8VA 3FCSB 1W5ZA 3AMOB 4EV2A 5JPUA 1RLSA 1YJ93 3CMA3 3BNEA 1JB4A 3UNLA 3QK9A 2ZA4A 1BUQA 1JZOA 1HKXA 1W2B2 1GOUA 1YVBI 4BL2A 5LC6A 3EQQB 1VQ43 1RKYA 1ROVA 5AYRB 5G1LA 3BLZA 4GL6A 1JV2B 3SYUA 2XF3A 1R4CA 1LOWA 5HGRA 4R9LA 2XH9A 4R9KA 2XSOB 4CDLA 1HZ1A 3E99A 7GSPA 3S5CA 1VQK3 4K90B 3G16A 1IK3A 1T3BA 1N5PA 3LH4A 4XBXA 1UCJA 1C7HA 2OWPA 3RNTA 2OQEA 1UGHI 3BNDA 1I2GA 3LXUX 3VGNA 3EN1B 3JUNA 1RN1A 4HM7B 4LMIA 5IF6A 1VQM3 3B4PA 2BNGA 3A76A 5IENA 1CH0A 3SX1A 1UW1A 1M9GA 2IUJA 3FG4A 7STDA 3BNCA 1A2PA 5AIIA 1YJN3 3KE7A 4HM6B 1BRNL 1K41A 3LT9A 1OHSA 1W6CA 1QJGA 3LOYA 5TGNA 3MG2A 3F40A 2LQVA 4N6TA 1IQXA 2F98A 3DM8A 1ISKA 1A90A 1FA3A 1CYUA 2WGOA 2WOFA 3OXAA 3NBJA 1TUHA 3F14A 1V74A 3CCR3 1OCVA 5EVHA 3NV0A 1GY7A 1RNTA 4J8TA 1OUNA 1MWRA 3GZYB 3VF1A 4HM0B 2CWUA 3D5GA 2WOHA 3BU4A 4N3VA 2CX0A 2MC8A 3T0UA 3TDGA 4BU4A 3DXOA 1RGGA 4WP5A 5AEWB 1Q42A 1FGMA 2WGQA 1W6GA 5CLKA 1PY3A 1DYUA 4NPBA 3A5EA 2OTL3 2CFKA 1BAOA 1IT8A 4JF8A 1CYVA 1DMQA 2HMLB 3RDEA 4FMBA 2H0HA 6GSPA 2CC3A 3D3LA 1O7PB 1LXEA 4FCJA 4FCZA 4MJDA 2F99A 5DREA 2W56B 3KIIA 1K8A4 1QVF2 1JKGA 1V58A 1NB3I 1O7WB 1UI7A 3AGOA 3CCS3 1N5HA 2KRTA 1GD4A 2P38A 3PXMA 3EN8A 8CHOA 3QRDA 2HMMB 3UL5A 2XGLA 3B8LA 1PFPA 3DUKA 1LOYA 1T2IA 3GZRA 4RNZA 1VZZA 1FW7A 2CW9A 5DRVA 4AKZA 1DMNA 1RDSA 2KAAA 3CC73 2HMOB 2ZHXB 1STDA 1LOVA 2KF6A 3CC43 1Q40A 4KZ1A 5BIRA 4LGQA 5FGOA 1B20A 1F8NA 3OWUA 2HOHA 4EV5A 2XSHB 4RZMA 3CXC2 3V99A 2OOVA 1RHLA 1GYBA 1ZX2A 4OVMA 3I563 1TTOA 1YI23 3OW22 2RCDA 3CU3A 5IG0A 1O7HB 1YNVX 2ML6A 2W6JH 3G8ZA 3LMLA 3HX8A 3F7XA 2C10A 5FW5A 3ZG5A 4WYKA 4FMDA 1AVKA 9RNTA 1HYFA 4BTXA 3LTDA 3LT8A 1DETA 3PGBA 1ASKA 1BNFA 1FGRA 3ALAA 1FUWA 1B2ZA 3MG3A 1OHOA 1S723 4HOHA 1RCKA 1FUSA 3NHXA 2P0MA 3X3ZA 1YIJ3 4J5GA 1IV9A 4HM4B 3AHWA 4RNTA 3X42A 4LSOA 1B2MA 2F4YA 3SXXA 4HYZA 1JNQA 1OGZA 3F9SA 2STDA 4OUQA 1SIIA 4HZ9B 1X1XA 3SOAA 3OX9A 3MWZA 2PNCA 1WMNA 3T8UA 5CF1A 4O2HA 1RGLA 2QGUA 5D81A 1YIT3 1GMQA 3UJMA 2UX0A 1GOYA 2OQEC 6RNTA 3EF8A 3WDGB 1V57A 1I2EA 1I3IA 4DKIA 1SJWA 1RGFA 1UUVB 1BRHA 1MGWA 1I0XA 1UCIA 2BU4A 1JN5B 1QAFA 3I0YA 3K0ZA 3K9MC 3KCHA 4L7KA 1GD3A 1EEJA 1N8QA 1K9M4 5G2GA 5KP3A 3CNMA 1MWSA 1JRQA 3SOYA 3FF0A 3NUVA 2B24B 2BT3A 3LYGA 2BMQB 2CH9A 5IW9A 5CXOA 3Q1CA 4ILFA 5CF2A 5IG5A 1WMPA 3EB8A 1JBRA 3D9RA 3FLJA 1A67A 3GZXB 2UGIA 4WWUC 5JBSA 4EC6A 4O02B 1SIHA 2W2CA 1I70A 1VQ63 1BOXA 1BSDA 2W04A 2BMOB 1Q814 1SQWA 4R4KA 1BSAA 1TFKA 3LTCA 4RNYA 1U5OA 1TRQA 2XRXB 1BVIA 4FMAA 4HAAA 1BNJA 1BSBA 1VQ53 1O7NB 4K1UA 3PYJA 2WO0A 1X1UA 2SBLA 3DH2A 3EBYA 3HIGA 2Z7AA 1BNRA 1QMAA 2CFWA 3F8XA 4XB5A 1AQZA 5IG4A 3S67A 7RNTA 1NO3A 1LQGC 1ZS7A 3K63A 1SARA 1IT7A 1LQMB 2JQ5A 2ZL8A 4H3UA 2IUKA 3DGLA 3RGRA 1OF5A
chains in the Genus database with same CATH topology
3LZAA 2GBXB 4NHFA 2XFSA 4L8OA 1GY6A 2BO9B 2CG0A 5AIFA 1KSIA 1NDOB 4HJLB 1W6YA 2YFJB 3MKIA 4BTWA 1Q864 1VQL3 1WTHA 4HM3B 5ELJA 3K5TA 5JPPA 1VQO3 1DVCA 2W9PA 4XBYA 2OOVC 1GS3A 5KP1A 3EHCA 3SEDA 3LTBA 1EKMA 1UI8A 1S5AA 1UUWB 3GWRA 1LVNA 1GY5A 2INXA 4N6NB 5D83A 2P0XA 3WODG 1VQ83 2JDIH 4K1VA 4N6OB 1N9EA 2CFDA 1A2KA 4L8PA 1KWIA 2C11A 2RFRA 2QEX3 1KQS2 2PZVA 3DGOA 4WHAA 4PEJA 3X40A 1D6ZA 2QIYA 1IV7A 3WA2X 3FZWA 3MHEA 1WMOA 4BTYA 1LOXA 4EXRA 3G713 1RN7A 2CFGA 2LYXA 3SLUA 5D82A 3Q90A 3S27A 1IQ8A 2O3OA 2Q07A 4FR9A 2FNQA 2CG1A 1TU5A 1M1K4 3CCV3 4I4KA 4X2OA 1NU3A 1TIJA 4MEIA 4LEHA 4TX4A 4XBTA 1IDPA 1J2BA 3NV0B 4QWTA 3PZWA 2CK3H 2HMNB 2CKFB 3L0RA 3OWYA 3KN4A 1JB5A 1O7GB 5BXQA 1NJI4 2P05A 2GBWB 3DGMA 4N6V0 2CHCA 3AMOA 3X41A 1G96A 3Q2PA 2ML5A 1IVVA 4HKVB 3U1WA 4Q53A 4HM8B 4R1KA 3HZPA 4AKYA 2W0QA 5STDA 2XEPA 2XFTA 1JJ22 3NQZA 1JKGB 1AR0A 2CIUA 4ZM8A 1IQYA 4OK0A 3IJEB 4FMCA 2XGNA 2Z6BA 2Y73A 4HM1B 3RGAA 1O7MB 3BNBA 4IIAA 3OWSA 3V98A 1EG9B 1OACA 3EX9A 3F8HA 3FH1A 3ECFA 1Q40B 1U8CB 3N9HA 3CNXA 3K7CA 3G4S3 1Z1SA 3NQYA 1MNLA 3S29A 3CCE3 1M904 3B7CA 1YGEA 1IU7A 1WQLB 2I9WA 3X3YA 3CCM3 4NREA 2M7OA 3FSDA 2GU3A 1FGOA 4KVHA 4J9AA 3JVCA 2KCDA 3HIIA 3NM7A 3GAXA 2RSXA 3U97A 2E2VA 3IPTA 6STDA 4WYKB 1E3VA 4JRFA 2YX9A 3H3HA 3GZBA 3WOFB 3ROBA 2W03A 2Z77A 1W4NA 1N9JA 2XR8B 3CPOA 2YFLB 3CD63 3SVAA 1K734 5EQLA 3JUQA 2W9QA 1IVUA 3FG3A 2GU1A 4N6UA 3MSOA 4GB5A 1VQP3 4KFDA 1NB5I 1TFOA 2F86B 3KKGA 4HVNA 1SPUA 1US1A 3FKAA 2W56A 4O3VA 1W00A 3WA3A 4XDVA 2GEYA 1L5GB 1VQ93 1TP6A 3CME3 2GXFA 4O8SA 3J7Yd 5AEUB 1KD14 1KC84 3X3XA 2D42A 4U13A 1ULJB 1T5YA 1N8R4 4X2HA 3MPHA 1OH0A 4HZBB 4KFEA 1OHPA 3NX0A 1QALA 3GRDA 3LTAA 4R80A 3B4OA 3DMCA 4ORLA 2B1XB 3WOEB 1DVDA 3JUMA 1FGQA 2E2UA 1A2VA 3PCSA 4EYCA 1YHQ3 5AIGA 4IT7A 3OV4A 2CFLA 2BMRB 1NWWA 1ULIB 1DMMA 3KZTA 3JUPA 1IVXA 2P09A 3DGNA 1ROAA 1CQSA 1K28A 2CWVA 4H61A 5ELUA 3HK4A 2L4VA 4MMYB 5I97A 5IG3A 2QA43 4FCMA 3PS8A 3KFQC 1E3RA 3KSED 3NXJA 5IEPA 3N54B 4IPBA 1EQKA 2MF7A 4G1MB 2R4IA 4HM2B 4K61A 1CEWI 4LZIA 1HU9A 2IA7A 5IERA 1M1XB 1Q7Y4 2HMKB 2FXTA 2K54A 3BB9A 3JUOA 3IMAB 3F7SA 2A15A 2RGQA 4RBNA 3CC23 5AI1A 4N6LA 5BVBA 4EBGA 3CCU3 2OTJ3 1OPYA 1OF5B 1OGXA 1RRHA 3FGYA 3NBRA 3I553 2CWTA 4N6MA 3EE1A 3T8NA 4AEQA 2ZDJA 3S28A 1ZO2A 3FG1A 5LC7A 1JN5A 2IMJA 3EJVA 1W02A 1PU4A 3G6E3 5KP4A 1EA2A 4XM4A 3STDA 1D6UA 3EC9A 1IVWA 3NBBA 4HM5B 5A0OB 1W7CA 1QAKA 1Q824 2KXGA 1MOLA 1AVLA 3EBTA 1VQN3 2D1WA 4MMZB 2V1LA 3H51A 3HI7A 3MYTA 1FGTA 3O8YA 1Y4KA 5CK6A 1RJOA 3ER7A 1RRLA 3CCJ3 1YJW3 1AV4A 3NM2A 3PCRA 4CCVA 1JB2A 3FF2A 3UL6A 5EEOA 1D6YA 5AYSC 1LNHA 3DY5A 4KFFA 2GEXA 3CCL3 1W2ZA 3N8BA 2K0MA 3KSPA 3CPW2 3CCQ3 3V92A 3M8CA 2Z76A 4STDA 3VSYA 1E97A 4MMXB 2E2TA 4XDWA 1STFI 3UB1A 2OCTA 3MG1A 2Y74A 3WMDA 2YFIB 1W01A 4WFOA 5AIHA 4HBRA 2O9UX 5IEOA 1QVG2 1WNHA 3G0KA 2HMJB 3DZLA 2BHMA 1VQ73 2FGTA 3FCSB 4EV2A 1W5ZA 3AMOB 5JPUA 1YJ93 3CMA3 3BNEA 1JB4A 3UNLA 3QK9A 1BUQA 1HKXA 1W2B2 1YVBI 5LC6A 3EQQB 1VQ43 1RKYA 1ROVA 5AYRB 3BLZA 4GL6A 1JV2B 2XF3A 1R4CA 5HGRA 4R9LA 2XH9A 4R9KA 2XSOB 4CDLA 3E99A 3S5CA 1VQK3 4K90B 3G16A 1IK3A 1N5PA 3LH4A 4XBXA 1C7HA 2OWPA 2OQEA 3BNDA 3LXUX 3VGNA 3EN1B 3JUNA 1VQM3 4HM7B 4LMIA 5IF6A 3B4PA 2BNGA 3A76A 5IENA 3SX1A 1UW1A 1M9GA 2IUJA 3FG4A 7STDA 3BNCA 5AIIA 1YJN3 3KE7A 4HM6B 1K41A 3LT9A 1OHSA 1W6CA 1QJGA 3LOYA 5TGNA 3MG2A 3F40A 2LQVA 4N6TA 1IQXA 2F98A 3DM8A 1ISKA 1A90A 1FA3A 1CYUA 2WGOA 2WOFA 3OXAA 3NBJA 1TUHA 3F14A 1V74A 3CCR3 1OCVA 5EVHA 3NV0A 1GY7A 4J8TA 1OUNA 3GZYB 3VF1A 4HM0B 2CWUA 2MC8A 2WOHA 3TDGA 4N3VA 3T0UA 3DXOA 4WP5A 5AEWB 1Q42A 1FGMA 2WGQA 1W6GA 5CLKA 1DYUA 2OTL3 2CFKA 1IT8A 4JF8A 1CYVA 1DMQA 2HMLB 3RDEA 4FMBA 2CC3A 3D3LA 1O7PB 1LXEA 4FCJA 4FCZA 4MJDA 2F99A 5DREA 2W56B 3KIIA 1K8A4 1QVF2 1JKGA 1NB3I 1O7WB 1UI7A 3CCS3 1N5HA 2KRTA 1GD4A 2P38A 3PXMA 3EN8A 8CHOA 3QRDA 2HMMB 3UL5A 2XGLA 3B8LA 1PFPA 3DUKA 3GZRA 4RNZA 1VZZA 2CW9A 5DRVA 4AKZA 1DMNA 3CC73 2HMOB 1STDA 3CC43 1Q40A 4KZ1A 4LGQA 5FGOA 1F8NA 3OWUA 4EV5A 2XSHB 4RZMA 3CXC2 3V99A 2OOVA 1GYBA 1ZX2A 4OVMA 3I563 1YI23 3OW22 2RCDA 3CU3A 5IG0A 1O7HB 2ML6A 2W6JH 3G8ZA 3LMLA 3HX8A 3F7XA 2C10A 5FW5A 4WYKA 4FMDA 1AVKA 4BTXA 3LTDA 3LT8A 3PGBA 1ASKA 1FGRA 3ALAA 1FUWA 3MG3A 1OHOA 1S723 3NHXA 2P0MA 3X3ZA 1YIJ3 1IV9A 4HM4B 3X42A 4LSOA 3SXXA 4HYZA 1JNQA 1OGZA 3F9SA 2STDA 4OUQA 1SIIA 4HZ9B 3SOAA 3OX9A 3MWZA 2PNCA 1WMNA 3T8UA 5CF1A 4O2HA 2QGUA 5D81A 1YIT3 3UJMA 2UX0A 2OQEC 3EF8A 3WDGB 1SJWA 1UUVB 1JN5B 1QAFA 3I0YA 3K0ZA 3K9MC 4L7KA 1GD3A 1N8QA 1K9M4 5G2GA 5KP3A 3CNMA 1JRQA 3SOYA 3FF0A 3NUVA 2B24B 2BT3A 3LYGA 2BMQB 2CH9A 5IW9A 5CXOA 3Q1CA 5CF2A 5IG5A 1A67A 1WMPA 3EB8A 3D9RA 3FLJA 3GZXB 4WWUC 5JBSA 4EC6A 4O02B 1SIHA 2W2CA 1VQ63 2W04A 2BMOB 1Q814 1SQWA 4R4KA 1TFKA 3LTCA 4RNYA 1U5OA 2XRXB 4FMAA 1VQ53 1O7NB 4K1UA 3PYJA 2WO0A 2SBLA 3EBYA 3HIGA 2Z7AA 1QMAA 2CFWA 3F8XA 4XB5A 5IG4A 3S67A 1NO3A 3K63A 2JQ5A 1IT7A 4H3UA 2ZL8A 2IUKA 3DGLA 3RGRA 1OF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZA A;  2GBX B;  4L8O A;  1GY6 A;  5AIF A;  1NDO B;  4HJL B;  1W6Y A;  2YFJ B;  3MKI A;  4HM3 B;  5JPP A;  4XBY A;  1GS3 A;  5KP1 A;  3EHC A;  3SED A;  1S5A A;  1UUW B;  3GWR A;  2INX A;  1GY5 A;  5D83 A;  4K1V A;  1A2K A;  4L8P A;  2RFR A;  2PZV A;  4PEJ A;  2QIY A;  3FZW A;  3MHE A;  5D82 A;  3Q90 A;  4I4K A;  4X2O A;  1NU3 A;  4LEH A;  4XBT A;  1IDP A;  3NV0 B;  2HMN B;  2CKF B;  3OWY A;  5BXQ A;  1JB5 A;  1O7G B;  2GBW B;  2CHC A;  4HKV B;  4Q53 A;  4HM8 B;  4R1K A;  3HZP A;  5STD A;  1JKG B;  1AR0 A;  4HM1 B;  3RGA A;  1O7M B;  4IIA A;  3OWS A;  1EG9 B;  3EX9 A;  3F8H A;  3FH1 A;  3ECF A;  1Q40 B;  3CNX A;  3K7C A;  1Z1S A;  3B7C A;  1WQL B;  2I9W A;  3FSD A;  4KVH A;  4J9A A;  3IPT A;  6STD A;  4WYK B;  1E3V A;  3H3H A;  3GZB A;  3ROB A;  2Z77 A;  2XR8 B;  3CPO A;  2YFL B;  3JUQ A;  3MSO A;  4GB5 A;  2F86 B;  3KKG A;  4HVN A;  3FKA A;  1W00 A;  4XDV A;  2GEY A;  1TP6 A;  2GXF A;  5AEU B;  4U13 A;  1ULJ B;  4X2H A;  1OH0 A;  4HZB B;  1OHP A;  3GRD A;  3B4O A;  3DMC A;  4ORL A;  2B1X B;  3JUM A;  5AIG A;  3OV4 A;  2BMR B;  1NWW A;  1ULI B;  1DMM A;  3KZT A;  3JUP A;  1CQS A;  3HK4 A;  5IG3 A;  4FCM A;  3NXJ A;  1E3R A;  5IEP A;  2R4I A;  4HM2 B;  5IER A;  2HMK B;  2K54 A;  3BB9 A;  3JUO A;  3F7S A;  2A15 A;  2RGQ A;  5AI1 A;  5BVB A;  1OPY A;  1OF5 B;  1OGX A;  3FGY A;  3NBR A;  3T8N A;  1ZO2 A;  1JN5 A;  2IMJ A;  3EJV A;  1W02 A;  5KP4 A;  1EA2 A;  4XM4 A;  3STD A;  3EC9 A;  4HM5 B;  3EBT A;  3H51 A;  3MYT A;  5CK6 A;  3ER7 A;  3NM2 A;  1JB2 A;  3FF2 A;  2GEX A;  3KSP A;  3M8C A;  2Z76 A;  4STD A;  3VSY A;  1E97 A;  4XDW A;  3MG1 A;  3WMD A;  2YFI B;  1W01 A;  5AIH A;  5IEO A;  3G0K A;  2HMJ B;  3DZL A;  5JPU A;  1JB4 A;  3UNL A;  1BUQ A;  1HKX A;  3EQQ B;  3BLZ A;  5HGR A;  4R9L A;  4R9K A;  2XSO B;  4CDL A;  3E99 A;  3S5C A;  3G16 A;  4XBX A;  1C7H A;  2OWP A;  3VGN A;  3EN1 B;  3JUN A;  4HM7 B;  4LMI A;  5IF6 A;  3B4P A;  2BNG A;  3A76 A;  5IEN A;  7STD A;  5AII A;  3KE7 A;  4HM6 B;  1K41 A;  1OHS A;  1QJG A;  5TGN A;  3MG2 A;  3F40 A;  2F98 A;  3DM8 A;  1ISK A;  3OXA A;  1TUH A;  3F14 A;  1OCV A;  5EVH A;  3NV0 A;  1GY7 A;  4J8T A;  1OUN A;  3GZY B;  4HM0 B;  4N3V A;  3DXO A;  4WP5 A;  5AEW B;  1Q42 A;  5CLK A;  1DMQ A;  2HML B;  1O7P B;  4FCJ A;  4MJD A;  2F99 A;  5DRE A;  1JKG A;  1O7W B;  3EN8 A;  8CHO A;  2HMM B;  3B8L A;  3DUK A;  3GZR A;  1VZZ A;  5DRV A;  1DMN A;  2HMO B;  1STD A;  1Q40 A;  4LGQ A;  3OWU A;  2XSH B;  4RZM A;  1GYB A;  1ZX2 A;  4OVM A;  2RCD A;  3CU3 A;  5IG0 A;  1O7H B;  3G8Z A;  3HX8 A;  3F7X A;  5FW5 A;  4WYK A;  1ASK A;  3MG3 A;  1OHO A;  3NHX A;  4HM4 B;  1OGZ A;  3F9S A;  2STD A;  4OUQ A;  4HZ9 B;  3SOA A;  3OX9 A;  3T8U A;  5CF1 A;  2QGU A;  5D81 A;  3UJM A;  2UX0 A;  3EF8 A;  1SJW A;  1UUV B;  1JN5 B;  3I0Y A;  3K0Z A;  4L7K A;  5G2G A;  5KP3 A;  3CNM A;  3SOY A;  3FF0 A;  3NUV A;  2B24 B;  3LYG A;  2BMQ B;  5CXO A;  5CF2 A;  5IG5 A;  3D9R A;  3FLJ A;  3GZX B;  4WWU C;  2W2C A;  2BMO B;  1U5O A;  2XRX B;  1O7N B;  4K1U A;  3EBY A;  2Z7A A;  1QMA A;  3F8X A;  4XB5 A;  5IG4 A;  2JQ5 A;  4H3U A;  3RGR A;  1OF5 A; 
#chains in the Genus database with same CATH topology
 3LZA A;  1EUI C;  2GBX B;  4NHF A;  2XFS A;  4L8O A;  5G1K A;  1GY6 A;  2BO9 B;  2CG0 A;  5AIF A;  1Q7H A;  1KSI A;  1NDO B;  4HJL B;  1W6Y A;  1RN4 A;  1G0T A;  2YFJ B;  3MKI A;  4BTW A;  1Q86 4;  1VQL 3;  1WTH A;  2IYJ A;  4HM3 B;  5ELJ A;  3K5T A;  5JPP A;  1VQO 3;  1DVC A;  2W9P A;  4XBY A;  2OOV C;  1GS3 A;  5KP1 A;  3EHC A;  3SED A;  1PYL A;  1EKM A;  1UI8 A;  3LTB A;  1S5A A;  4CPK A;  1UUW B;  3DGY A;  1LVN A;  1GY5 A;  2INX A;  3GWR A;  4N6N B;  5D83 A;  2P0X A;  3WOD G;  5BU4 A;  1VQ8 3;  2JDI H;  4K1V A;  4N6O B;  1UCL A;  1N9E A;  1MGR A;  1A2K A;  2CFD A;  1RMS A;  4L8P A;  3D5I A;  1KWI A;  1BRK A;  2C11 A;  2RFR A;  2QEX 3;  1KQS 2;  2PZV A;  3DGO A;  4WHA A;  4PEJ A;  1JBT A;  1FUT A;  3X40 A;  1D6Z A;  1I0V A;  2QIY A;  1IV7 A;  4J5K A;  5M19 A;  3WA2 X;  3FZW A;  3MHE A;  1WMO A;  4BTY A;  1LOX A;  4EXR A;  3G71 3;  1RN7 A;  1TRP A;  2CFG A;  2LYX A;  3SLU A;  1GMR A;  3BIR A;  5D82 A;  3Q90 A;  3S27 A;  1X1W A;  1IQ8 A;  2O3O A;  2Q07 A;  4FR9 A;  2FNQ A;  1BU4 A;  1RGE A;  2CG1 A;  1TU5 A;  1M1K 4;  3CCV 3;  4I4K A;  4X2O A;  1NU3 A;  1TIJ A;  4MEI A;  4LEH A;  3URP A;  1DE3 A;  4TX4 A;  4XBT A;  1IDP A;  1J2B A;  3NV0 B;  4QWT A;  1YGW A;  3PZW A;  2CK3 H;  2HMN B;  2CKF B;  1UDI I;  3L0R A;  3OWY A;  3KN4 A;  1JB5 A;  1O7G B;  2BIR A;  5BXQ A;  1NJI 4;  2P05 A;  2R41 A;  2CX1 A;  2AAD A;  2GBW B;  3DGM A;  4N6V 0;  2CHC A;  3AMO A;  3X41 A;  2KF4 A;  1G96 A;  1BGS A;  3Q2P A;  1BRS A;  2ML5 A;  1B2S A;  3Q3F A;  1IVV A;  4HKV B;  4BL3 A;  1BUJ A;  1UCK A;  4Q53 A;  4HM8 B;  4R1K A;  3U1W A;  3HZP A;  3ZFZ A;  3WR2 A;  4AKY A;  2W0Q A;  5STD A;  2XEP A;  2J8X B;  2XFT A;  2K3D A;  1JJ2 2;  1BNE A;  1BRJ A;  1BSE A;  3NQZ A;  1JKG B;  1AR0 A;  2CIU A;  4ZM8 A;  1IQY A;  4OK0 A;  3IJE B;  4FMC A;  2XGN A;  2Z6B A;  2Y73 A;  4HM1 B;  3RGA A;  1O7M B;  3BNB A;  4IIA A;  3OWS A;  3V98 A;  1B2X A;  1EG9 B;  1OAC A;  3EX9 A;  3F8H A;  3FH1 A;  3ECF A;  1Q40 B;  1U8C B;  3N9H A;  3CNX A;  3K7C A;  3G4S 3;  1Z1S A;  3NQY A;  1MNL A;  3S29 A;  3CCE 3;  1M90 4;  3B7C A;  1YGE A;  1IU7 A;  1WQL B;  1B2U A;  2I9W A;  3X3Y A;  3CCM 3;  1C54 A;  4NRE A;  2M7O A;  5M1A A;  2RNT A;  3FSD A;  2GU3 A;  1FGO A;  1R4Y A;  4J9A A;  3JVC A;  2KCD A;  1TJD A;  1UGI A;  3HII A;  3GAX A;  3NM7 A;  4I5Q A;  5RNT A;  2RSX A;  3U97 A;  2IY2 A;  2E2V A;  3IPT A;  6STD A;  4WYK B;  1E3V A;  4JRF A;  2YX9 A;  3H3H A;  3GZB A;  3WOF B;  3ROB A;  2W03 A;  2Z77 A;  1W4N A;  1N9J A;  2XR8 B;  1IYY A;  2H0I A;  3CPO A;  2YFL B;  3CD6 3;  3SVA A;  1GOV A;  1BIR A;  1BAN A;  1K73 4;  5EQL A;  3JUQ A;  2W9Q A;  1IVU A;  3FG3 A;  2GU1 A;  4N6U A;  3MSO A;  1RSN A;  4GB5 A;  1YVS A;  1VQP 3;  4KFD A;  1NB5 I;  1TFO A;  2F86 B;  3KKG A;  1ZGX A;  4HVN A;  1SPU A;  1US1 A;  1X1Y A;  2W56 A;  3FKA A;  1W00 A;  4O3V A;  4XDV A;  2GEY A;  3WA3 A;  1L5G B;  1GMP A;  1RNB A;  1VQ9 3;  1TP6 A;  3AHS A;  3CME 3;  2GXF A;  4O8S A;  3J7Y d;  1FZU A;  3D4A A;  5AEU B;  1KD1 4;  1KC8 4;  3X3X A;  2L1S A;  2D42 A;  4U13 A;  1B3S A;  1ULJ B;  1BSC A;  1T5Y A;  1N8R 4;  4X2H A;  3MPH A;  1UUG B;  1OH0 A;  2F5W A;  4HZB B;  4KFE A;  1OHP A;  3NX0 A;  1QAL A;  3GRD A;  8RNT A;  2AAE A;  3LTA A;  3D79 A;  4R80 A;  1BNG A;  3B4O A;  3DMC A;  4EW5 A;  4ORL A;  2B1X B;  3WOE B;  1NNV A;  1DVD A;  3JUM A;  1MWU A;  1FGQ A;  2E2U A;  1A2V A;  3PCS A;  1T2H A;  1LRA A;  4EYC A;  1YHQ 3;  5AIG A;  4IT7 A;  3OV4 A;  2CFL A;  2BMR B;  1NWW A;  2KF5 A;  1ULI B;  1DMM A;  3KZT A;  3ZG0 A;  1I2F A;  1IVX A;  3JUP A;  2P09 A;  3DGN A;  2F56 A;  1ROA A;  2SAR A;  5HOH A;  1I3F A;  1CQS A;  1K28 A;  2CWV A;  4H61 A;  5ELU A;  3HK4 A;  2L4V A;  4MMY B;  5I97 A;  5IG3 A;  2QA4 3;  4FCM A;  1RGK A;  3PS8 A;  4GSP A;  3KFQ C;  1E3R A;  3KSE D;  3NXJ A;  5IEP A;  3N54 B;  4IPB A;  5GSP A;  1EQK A;  2MF7 A;  4G1M B;  2R4I A;  4HM2 B;  1RCL A;  1CEW I;  4K61 A;  4LZI A;  1HU9 A;  2H0G A;  2IA7 A;  5IER A;  1M1X B;  1Q7Y 4;  2HMK B;  1VQQ A;  2FXT A;  1JBS A;  2K54 A;  3BB9 A;  3JUO A;  3HOH A;  3IMA B;  3F7S A;  2A15 A;  2RGQ A;  4RBN A;  3CC2 3;  5AI1 A;  4N6L A;  5BVB A;  4EBG A;  3CCU 3;  1RTU A;  4KT3 B;  2OTJ 3;  1OPY A;  1OF5 B;  1OGX A;  1G02 A;  1RRH A;  2F5M A;  4GHO A;  4KVH A;  3FGY A;  1RGH A;  3NBR A;  3I55 3;  2CWT A;  4N6M A;  1B21 A;  1Q9E A;  3EE1 A;  3T8N A;  1BNI A;  4AEQ A;  1FYS A;  2ZDJ A;  3S28 A;  1ZO2 A;  3FG1 A;  5LC7 A;  1JN5 A;  2IMJ A;  3EJV A;  1W02 A;  1PU4 A;  3G6E 3;  5KP4 A;  1EA2 A;  4XM4 A;  3STD A;  1D6U A;  3WHO A;  3EC9 A;  1IVW A;  2RBI A;  3NBB A;  4HM5 B;  1W7C A;  1QAK A;  5A0O B;  5M18 A;  1Q82 4;  2KXG A;  2GSP A;  1MOL A;  1AY7 A;  1AVL A;  3EBT A;  1VQN 3;  4LYL B;  2D1W A;  4MMZ B;  1B27 A;  2V1L A;  3H51 A;  3HI7 A;  3MYT A;  1FGT A;  2KF3 A;  3O8Y A;  1Y4K A;  5CK6 A;  1RJO A;  1GSP A;  2C4B A;  3ER7 A;  1RGC A;  1RRL A;  3CCJ 3;  1YJW 3;  1AV4 A;  3NM2 A;  3PCR A;  1BRG A;  4CCV A;  1JB2 A;  3FF2 A;  3UL6 A;  1JZD A;  1D6Y A;  5EEO A;  5AYS C;  1LNH A;  3GSP A;  2UUG C;  3DY5 A;  4KFF A;  2GEX A;  1RGA A;  1LNI A;  3CCL 3;  1W2Z A;  4CJN A;  3N8B A;  2K0M A;  3KSP A;  3CPW 2;  3CCQ 3;  1BRI A;  3V92 A;  4BIR A;  3M8C A;  1BNS A;  2Z76 A;  4STD A;  3VSY A;  1E97 A;  4MMX B;  2E2T A;  4XDW A;  1STF I;  3UB1 A;  2OCT A;  3MG1 A;  2Y74 A;  3WMD A;  1MWT A;  2YFI B;  1W01 A;  4WFO A;  3AGN A;  5AIH A;  4HBR A;  2O9U X;  5IEO A;  1QVG 2;  1WNH A;  3G0K A;  2HMJ B;  3DZL A;  2BHM A;  1VQ7 3;  2FGT A;  1I8V A;  3FCS B;  1W5Z A;  3AMO B;  4EV2 A;  5JPU A;  1RLS A;  1YJ9 3;  3CMA 3;  3BNE A;  1JB4 A;  3UNL A;  3QK9 A;  2ZA4 A;  1BUQ A;  1JZO A;  1HKX A;  1W2B 2;  1GOU A;  1YVB I;  4BL2 A;  5LC6 A;  3EQQ B;  1VQ4 3;  1RKY A;  1ROV A;  5AYR B;  5G1L A;  3BLZ A;  4GL6 A;  1JV2 B;  3SYU A;  2XF3 A;  1R4C A;  1LOW A;  5HGR A;  4R9L A;  2XH9 A;  4R9K A;  2XSO B;  4CDL A;  1HZ1 A;  3E99 A;  7GSP A;  3S5C A;  1VQK 3;  4K90 B;  3G16 A;  1IK3 A;  1T3B A;  1N5P A;  3LH4 A;  4XBX A;  1UCJ A;  1C7H A;  2OWP A;  3RNT A;  2OQE A;  1UGH I;  3BND A;  1I2G A;  3LXU X;  3VGN A;  3EN1 B;  3JUN A;  1RN1 A;  4HM7 B;  4LMI A;  5IF6 A;  1VQM 3;  3B4P A;  2BNG A;  3A76 A;  5IEN A;  1CH0 A;  3SX1 A;  1UW1 A;  1M9G A;  2IUJ A;  3FG4 A;  7STD A;  3BNC A;  1A2P A;  5AII A;  1YJN 3;  3KE7 A;  4HM6 B;  1BRN L;  1K41 A;  3LT9 A;  1OHS A;  1W6C A;  1QJG A;  3LOY A;  5TGN A;  3MG2 A;  3F40 A;  2LQV A;  4N6T A;  1IQX A;  2F98 A;  3DM8 A;  1ISK A;  1A90 A;  1FA3 A;  1CYU A;  2WGO A;  2WOF A;  3OXA A;  3NBJ A;  1TUH A;  3F14 A;  1V74 A;  3CCR 3;  1OCV A;  5EVH A;  3NV0 A;  1GY7 A;  1RNT A;  4J8T A;  1OUN A;  1MWR A;  3GZY B;  3VF1 A;  4HM0 B;  2CWU A;  3D5G A;  2WOH A;  3BU4 A;  4N3V A;  2CX0 A;  2MC8 A;  3T0U A;  3TDG A;  4BU4 A;  3DXO A;  1RGG A;  4WP5 A;  5AEW B;  1Q42 A;  1FGM A;  2WGQ A;  1W6G A;  5CLK A;  1PY3 A;  1DYU A;  4NPB A;  3A5E A;  2OTL 3;  2CFK A;  1BAO A;  1IT8 A;  4JF8 A;  1CYV A;  1DMQ A;  2HML B;  3RDE A;  4FMB A;  2H0H A;  6GSP A;  2CC3 A;  3D3L A;  1O7P B;  1LXE A;  4FCJ A;  4FCZ A;  4MJD A;  2F99 A;  5DRE A;  2W56 B;  3KII A;  1K8A 4;  1QVF 2;  1JKG A;  1V58 A;  1NB3 I;  1O7W B;  1UI7 A;  3AGO A;  3CCS 3;  1N5H A;  2KRT A;  1GD4 A;  2P38 A;  3PXM A;  3EN8 A;  8CHO A;  3QRD A;  2HMM B;  3UL5 A;  2XGL A;  3B8L A;  1PFP A;  3DUK A;  1LOY A;  1T2I A;  3GZR A;  4RNZ A;  1VZZ A;  1FW7 A;  2CW9 A;  5DRV A;  4AKZ A;  1DMN A;  1RDS A;  2KAA A;  3CC7 3;  2HMO B;  2ZHX B;  1STD A;  1LOV A;  2KF6 A;  3CC4 3;  1Q40 A;  4KZ1 A;  5BIR A;  4LGQ A;  5FGO A;  1B20 A;  1F8N A;  3OWU A;  2HOH A;  4EV5 A;  2XSH B;  4RZM A;  3CXC 2;  3V99 A;  2OOV A;  1RHL A;  1GYB A;  1ZX2 A;  4OVM A;  3I56 3;  1TTO A;  1YI2 3;  3OW2 2;  2RCD A;  3CU3 A;  5IG0 A;  1O7H B;  1YNV X;  2ML6 A;  2W6J H;  3G8Z A;  3LML A;  3HX8 A;  3F7X A;  2C10 A;  5FW5 A;  3ZG5 A;  4WYK A;  4FMD A;  1AVK A;  9RNT A;  1HYF A;  4BTX A;  3LTD A;  3LT8 A;  1DET A;  3PGB A;  1ASK A;  1BNF A;  1FGR A;  3ALA A;  1FUW A;  1B2Z A;  3MG3 A;  1OHO A;  1S72 3;  4HOH A;  1RCK A;  1FUS A;  3NHX A;  2P0M A;  3X3Z A;  1YIJ 3;  4J5G A;  1IV9 A;  4HM4 B;  3AHW A;  4RNT A;  3X42 A;  4LSO A;  1B2M A;  2F4Y A;  3SXX A;  4HYZ A;  1JNQ A;  1OGZ A;  3F9S A;  2STD A;  4OUQ A;  1SII A;  4HZ9 B;  1X1X A;  3SOA A;  3OX9 A;  3MWZ A;  2PNC A;  1WMN A;  3T8U A;  5CF1 A;  4O2H A;  1RGL A;  2QGU A;  5D81 A;  1YIT 3;  1GMQ A;  3UJM A;  2UX0 A;  1GOY A;  2OQE C;  6RNT A;  3EF8 A;  3WDG B;  1V57 A;  1I2E A;  1I3I A;  4DKI A;  1SJW A;  1RGF A;  1UUV B;  1BRH A;  1MGW A;  1I0X A;  1UCI A;  2BU4 A;  1JN5 B;  1QAF A;  3I0Y A;  3K0Z A;  3K9M C;  3KCH A;  4L7K A;  1GD3 A;  1EEJ A;  1N8Q A;  1K9M 4;  5G2G A;  5KP3 A;  3CNM A;  1MWS A;  1JRQ A;  3SOY A;  3FF0 A;  3NUV A;  2B24 B;  2BT3 A;  3LYG A;  2BMQ B;  2CH9 A;  5IW9 A;  5CXO A;  3Q1C A;  4ILF A;  5CF2 A;  5IG5 A;  1WMP A;  3EB8 A;  1JBR A;  3D9R A;  3FLJ A;  1A67 A;  3GZX B;  2UGI A;  4WWU C;  5JBS A;  4EC6 A;  4O02 B;  1SIH A;  2W2C A;  1I70 A;  1VQ6 3;  1BOX A;  1BSD A;  2W04 A;  2BMO B;  1Q81 4;  1SQW A;  4R4K A;  1BSA A;  1TFK A;  3LTC A;  4RNY A;  1U5O A;  1TRQ A;  2XRX B;  1BVI A;  4FMA A;  4HAA A;  1BNJ A;  1BSB A;  1VQ5 3;  1O7N B;  4K1U A;  3PYJ A;  2WO0 A;  1X1U A;  2SBL A;  3DH2 A;  3EBY A;  3HIG A;  2Z7A A;  1BNR A;  1QMA A;  2CFW A;  3F8X A;  4XB5 A;  1AQZ A;  5IG4 A;  3S67 A;  7RNT A;  1NO3 A;  1LQG C;  1ZS7 A;  3K63 A;  1SAR A;  1IT7 A;  1LQM B;  2JQ5 A;  2ZL8 A;  4H3U A;  2IUK A;  3DGL A;  3RGR A;  1OF5 A; 
#chains in the Genus database with same CATH homology
 3LZA A;  2GBX B;  4NHF A;  2XFS A;  4L8O A;  1GY6 A;  2BO9 B;  2CG0 A;  5AIF A;  1KSI A;  1NDO B;  4HJL B;  1W6Y A;  2YFJ B;  3MKI A;  4BTW A;  1Q86 4;  1VQL 3;  1WTH A;  4HM3 B;  5ELJ A;  3K5T A;  5JPP A;  1VQO 3;  1DVC A;  2W9P A;  4XBY A;  2OOV C;  1GS3 A;  5KP1 A;  3EHC A;  3SED A;  3LTB A;  1EKM A;  1UI8 A;  1S5A A;  1UUW B;  3GWR A;  1LVN A;  1GY5 A;  2INX A;  4N6N B;  5D83 A;  2P0X A;  3WOD G;  1VQ8 3;  2JDI H;  4K1V A;  4N6O B;  1N9E A;  2CFD A;  1A2K A;  4L8P A;  1KWI A;  2C11 A;  2RFR A;  2QEX 3;  1KQS 2;  2PZV A;  3DGO A;  4WHA A;  4PEJ A;  3X40 A;  1D6Z A;  2QIY A;  1IV7 A;  3WA2 X;  3FZW A;  3MHE A;  1WMO A;  4BTY A;  1LOX A;  4EXR A;  3G71 3;  1RN7 A;  2CFG A;  2LYX A;  3SLU A;  5D82 A;  3Q90 A;  3S27 A;  1IQ8 A;  2O3O A;  2Q07 A;  4FR9 A;  2FNQ A;  2CG1 A;  1TU5 A;  1M1K 4;  3CCV 3;  4I4K A;  4X2O A;  1NU3 A;  1TIJ A;  4MEI A;  4LEH A;  4TX4 A;  4XBT A;  1IDP A;  1J2B A;  3NV0 B;  4QWT A;  3PZW A;  2CK3 H;  2HMN B;  2CKF B;  3L0R A;  3OWY A;  3KN4 A;  1JB5 A;  1O7G B;  5BXQ A;  1NJI 4;  2P05 A;  2GBW B;  3DGM A;  4N6V 0;  2CHC A;  3AMO A;  3X41 A;  1G96 A;  3Q2P A;  2ML5 A;  1IVV A;  4HKV B;  3U1W A;  4Q53 A;  4HM8 B;  4R1K A;  3HZP A;  4AKY A;  2W0Q A;  5STD A;  2XEP A;  2XFT A;  1JJ2 2;  3NQZ A;  1JKG B;  1AR0 A;  2CIU A;  4ZM8 A;  1IQY A;  4OK0 A;  3IJE B;  4FMC A;  2XGN A;  2Z6B A;  2Y73 A;  4HM1 B;  3RGA A;  1O7M B;  3BNB A;  4IIA A;  3OWS A;  3V98 A;  1EG9 B;  1OAC A;  3EX9 A;  3F8H A;  3FH1 A;  3ECF A;  1Q40 B;  1U8C B;  3N9H A;  3CNX A;  3K7C A;  3G4S 3;  1Z1S A;  3NQY A;  1MNL A;  3S29 A;  3CCE 3;  1M90 4;  3B7C A;  1YGE A;  1IU7 A;  1WQL B;  2I9W A;  3X3Y A;  3CCM 3;  4NRE A;  2M7O A;  3FSD A;  2GU3 A;  1FGO A;  4KVH A;  4J9A A;  3JVC A;  2KCD A;  3HII A;  3NM7 A;  3GAX A;  2RSX A;  3U97 A;  2E2V A;  3IPT A;  6STD A;  4WYK B;  1E3V A;  4JRF A;  2YX9 A;  3H3H A;  3GZB A;  3WOF B;  3ROB A;  2W03 A;  2Z77 A;  1W4N A;  1N9J A;  2XR8 B;  3CPO A;  2YFL B;  3CD6 3;  3SVA A;  1K73 4;  5EQL A;  3JUQ A;  2W9Q A;  1IVU A;  3FG3 A;  2GU1 A;  4N6U A;  3MSO A;  4GB5 A;  1VQP 3;  4KFD A;  1NB5 I;  1TFO A;  2F86 B;  3KKG A;  4HVN A;  1SPU A;  1US1 A;  3FKA A;  2W56 A;  4O3V A;  1W00 A;  3WA3 A;  4XDV A;  2GEY A;  1L5G B;  1VQ9 3;  1TP6 A;  3CME 3;  2GXF A;  4O8S A;  3J7Y d;  5AEU B;  1KD1 4;  1KC8 4;  3X3X A;  2D42 A;  4U13 A;  1ULJ B;  1T5Y A;  1N8R 4;  4X2H A;  3MPH A;  1OH0 A;  4HZB B;  4KFE A;  1OHP A;  3NX0 A;  1QAL A;  3GRD A;  3LTA A;  4R80 A;  3B4O A;  3DMC A;  4ORL A;  2B1X B;  3WOE B;  1DVD A;  3JUM A;  1FGQ A;  2E2U A;  1A2V A;  3PCS A;  4EYC A;  1YHQ 3;  5AIG A;  4IT7 A;  3OV4 A;  2CFL A;  2BMR B;  1NWW A;  1ULI B;  1DMM A;  3KZT A;  3JUP A;  1IVX A;  2P09 A;  3DGN A;  1ROA A;  1CQS A;  1K28 A;  2CWV A;  4H61 A;  5ELU A;  3HK4 A;  2L4V A;  4MMY B;  5I97 A;  5IG3 A;  2QA4 3;  4FCM A;  3PS8 A;  3KFQ C;  1E3R A;  3KSE D;  3NXJ A;  5IEP A;  3N54 B;  4IPB A;  1EQK A;  2MF7 A;  4G1M B;  2R4I A;  4HM2 B;  4K61 A;  1CEW I;  4LZI A;  1HU9 A;  2IA7 A;  5IER A;  1M1X B;  1Q7Y 4;  2HMK B;  2FXT A;  2K54 A;  3BB9 A;  3JUO A;  3IMA B;  3F7S A;  2A15 A;  2RGQ A;  4RBN A;  3CC2 3;  5AI1 A;  4N6L A;  5BVB A;  4EBG A;  3CCU 3;  2OTJ 3;  1OPY A;  1OF5 B;  1OGX A;  1RRH A;  3FGY A;  3NBR A;  3I55 3;  2CWT A;  4N6M A;  3EE1 A;  3T8N A;  4AEQ A;  2ZDJ A;  3S28 A;  1ZO2 A;  3FG1 A;  5LC7 A;  1JN5 A;  2IMJ A;  3EJV A;  1W02 A;  1PU4 A;  3G6E 3;  5KP4 A;  1EA2 A;  4XM4 A;  3STD A;  1D6U A;  3EC9 A;  1IVW A;  3NBB A;  4HM5 B;  5A0O B;  1W7C A;  1QAK A;  1Q82 4;  2KXG A;  1MOL A;  1AVL A;  3EBT A;  1VQN 3;  2D1W A;  4MMZ B;  2V1L A;  3H51 A;  3HI7 A;  3MYT A;  1FGT A;  3O8Y A;  1Y4K A;  5CK6 A;  1RJO A;  3ER7 A;  1RRL A;  3CCJ 3;  1YJW 3;  1AV4 A;  3NM2 A;  3PCR A;  4CCV A;  1JB2 A;  3FF2 A;  3UL6 A;  5EEO A;  1D6Y A;  5AYS C;  1LNH A;  3DY5 A;  4KFF A;  2GEX A;  3CCL 3;  1W2Z A;  3N8B A;  2K0M A;  3KSP A;  3CPW 2;  3CCQ 3;  3V92 A;  3M8C A;  2Z76 A;  4STD A;  3VSY A;  1E97 A;  4MMX B;  2E2T A;  4XDW A;  1STF I;  3UB1 A;  2OCT A;  3MG1 A;  2Y74 A;  3WMD A;  2YFI B;  1W01 A;  4WFO A;  5AIH A;  4HBR A;  2O9U X;  5IEO A;  1QVG 2;  1WNH A;  3G0K A;  2HMJ B;  3DZL A;  2BHM A;  1VQ7 3;  2FGT A;  3FCS B;  4EV2 A;  1W5Z A;  3AMO B;  5JPU A;  1YJ9 3;  3CMA 3;  3BNE A;  1JB4 A;  3UNL A;  3QK9 A;  1BUQ A;  1HKX A;  1W2B 2;  1YVB I;  5LC6 A;  3EQQ B;  1VQ4 3;  1RKY A;  1ROV A;  5AYR B;  3BLZ A;  4GL6 A;  1JV2 B;  2XF3 A;  1R4C A;  5HGR A;  4R9L A;  2XH9 A;  4R9K A;  2XSO B;  4CDL A;  3E99 A;  3S5C A;  1VQK 3;  4K90 B;  3G16 A;  1IK3 A;  1N5P A;  3LH4 A;  4XBX A;  1C7H A;  2OWP A;  2OQE A;  3BND A;  3LXU X;  3VGN A;  3EN1 B;  3JUN A;  1VQM 3;  4HM7 B;  4LMI A;  5IF6 A;  3B4P A;  2BNG A;  3A76 A;  5IEN A;  3SX1 A;  1UW1 A;  1M9G A;  2IUJ A;  3FG4 A;  7STD A;  3BNC A;  5AII A;  1YJN 3;  3KE7 A;  4HM6 B;  1K41 A;  3LT9 A;  1OHS A;  1W6C A;  1QJG A;  3LOY A;  5TGN A;  3MG2 A;  3F40 A;  2LQV A;  4N6T A;  1IQX A;  2F98 A;  3DM8 A;  1ISK A;  1A90 A;  1FA3 A;  1CYU A;  2WGO A;  2WOF A;  3OXA A;  3NBJ A;  1TUH A;  3F14 A;  1V74 A;  3CCR 3;  1OCV A;  5EVH A;  3NV0 A;  1GY7 A;  4J8T A;  1OUN A;  3GZY B;  3VF1 A;  4HM0 B;  2CWU A;  2MC8 A;  2WOH A;  3TDG A;  4N3V A;  3T0U A;  3DXO A;  4WP5 A;  5AEW B;  1Q42 A;  1FGM A;  2WGQ A;  1W6G A;  5CLK A;  1DYU A;  2OTL 3;  2CFK A;  1IT8 A;  4JF8 A;  1CYV A;  1DMQ A;  2HML B;  3RDE A;  4FMB A;  2CC3 A;  3D3L A;  1O7P B;  1LXE A;  4FCJ A;  4FCZ A;  4MJD A;  2F99 A;  5DRE A;  2W56 B;  3KII A;  1K8A 4;  1QVF 2;  1JKG A;  1NB3 I;  1O7W B;  1UI7 A;  3CCS 3;  1N5H A;  2KRT A;  1GD4 A;  2P38 A;  3PXM A;  3EN8 A;  8CHO A;  3QRD A;  2HMM B;  3UL5 A;  2XGL A;  3B8L A;  1PFP A;  3DUK A;  3GZR A;  4RNZ A;  1VZZ A;  2CW9 A;  5DRV A;  4AKZ A;  1DMN A;  3CC7 3;  2HMO B;  1STD A;  3CC4 3;  1Q40 A;  4KZ1 A;  4LGQ A;  5FGO A;  1F8N A;  3OWU A;  4EV5 A;  2XSH B;  4RZM A;  3CXC 2;  3V99 A;  2OOV A;  1GYB A;  1ZX2 A;  4OVM A;  3I56 3;  1YI2 3;  3OW2 2;  2RCD A;  3CU3 A;  5IG0 A;  1O7H B;  2ML6 A;  2W6J H;  3G8Z A;  3LML A;  3HX8 A;  3F7X A;  2C10 A;  5FW5 A;  4WYK A;  4FMD A;  1AVK A;  4BTX A;  3LTD A;  3LT8 A;  3PGB A;  1ASK A;  1FGR A;  3ALA A;  1FUW A;  3MG3 A;  1OHO A;  1S72 3;  3NHX A;  2P0M A;  3X3Z A;  1YIJ 3;  1IV9 A;  4HM4 B;  3X42 A;  4LSO A;  3SXX A;  4HYZ A;  1JNQ A;  1OGZ A;  3F9S A;  2STD A;  4OUQ A;  1SII A;  4HZ9 B;  3SOA A;  3OX9 A;  3MWZ A;  2PNC A;  1WMN A;  3T8U A;  5CF1 A;  4O2H A;  2QGU A;  5D81 A;  1YIT 3;  3UJM A;  2UX0 A;  2OQE C;  3EF8 A;  3WDG B;  1SJW A;  1UUV B;  1JN5 B;  1QAF A;  3I0Y A;  3K0Z A;  3K9M C;  4L7K A;  1GD3 A;  1N8Q A;  1K9M 4;  5G2G A;  5KP3 A;  3CNM A;  1JRQ A;  3SOY A;  3FF0 A;  3NUV A;  2B24 B;  2BT3 A;  3LYG A;  2BMQ B;  2CH9 A;  5IW9 A;  5CXO A;  3Q1C A;  5CF2 A;  5IG5 A;  1A67 A;  1WMP A;  3EB8 A;  3D9R A;  3FLJ A;  3GZX B;  4WWU C;  5JBS A;  4EC6 A;  4O02 B;  1SIH A;  2W2C A;  1VQ6 3;  2W04 A;  2BMO B;  1Q81 4;  1SQW A;  4R4K A;  1TFK A;  3LTC A;  4RNY A;  1U5O A;  2XRX B;  4FMA A;  1VQ5 3;  1O7N B;  4K1U A;  3PYJ A;  2WO0 A;  2SBL A;  3EBY A;  3HIG A;  2Z7A A;  1QMA A;  2CFW A;  3F8X A;  4XB5 A;  5IG4 A;  3S67 A;  1NO3 A;  3K63 A;  2JQ5 A;  1IT7 A;  4H3U A;  2ZL8 A;  2IUK A;  3DGL A;  3RGR A;  1OF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...