3K0ZA

Crystal structure of putative polyketide cyclase (np_977253.1) from bacillus cereus atcc 10987 at 1.91 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
149
structure length
149
Chain Sequence
EVQLLKEMPKPKAMTIDPSLSQKEATEMVHAAQRFYAFWDTGKEELIPQTVTENFFDHTLPKGRPQGTEGLKFAAQNFRKIVPNIHCEIEDLLVVGDKVTARLSFTGTHNDKKIDFFAIDILHVKDGKITEDWHLEDNLTLKQQLGLIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative polyketide cyclase
publication title Crystal structure of Putative polyketide cyclase (NP_977253.1) from BACILLUS CEREUS ATCC 10987 at 1.91 A resolution
rcsb
source organism Bacillus cereus
molecule tags Lyase
total genus 44
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3k0zA00
3MHEA 1OHSA 5IEOA 3OWYA 2RGQA 3DMCA 2XR8B 1GYBA 1C7HA 4R9LA 3GZBA 1JKGB 3BLZA 4HM5B 3NV0A 3JUQA 3EQQB 3S5CA 3CNXA 1ULIB 5JPPA 3F7SA 4WWUC 4HZ9B 5AIIA 1SJWA 4IIAA 3D9RA 5DRVA 3T8NA 3NV0B 4HZBB 5CK6A 3F14A 3EBYA 1K41A 3EC9A 2OWPA 3MKIA 3MYTA 2GBWB 2CHCA 3B4OA 3EBTA 5IEPA 2GXFA 3HX8A 4HM1B 3DM8A 1S5AA 1EA2A 1DMMA 1Q40A 2CKFB 3UJMA 4Q53A 2JQ5A 3G16A 2YFJB 2BMOB 3JUPA 3DXOA 1HKXA 1O7PB 5IG4A 1OHOA 3STDA 4HVNA 3SOAA 6STDA 4HJLB 1U5OA 2RFRA 3FGYA 1E3VA 3JUNA 1Q40B 5CLKA 5BVBA 1JN5A 3JUOA 3EN1B 5AI1A 4X2HA 1O7HB 2STDA 4X2OA 3K7CA 3FLJA 2Z77A 2K54A 2F86B 3RGAA 1DMQA 3GWRA 1DMNA 3NUVA 3OWUA 3MG2A 4N3VA 1JN5B 5STDA 1ZO2A 3WMDA 2YFLB 1OF5A 3CNMA 1W6YA 5KP1A 4XDVA 4H3UA 1NWWA 3OX9A 4ORLA 2RCDA 4LEHA 4XBYA 2YFIB 5AIHA 2R4IA 4WP5A 3OV4A 3JUMA 3I0YA 4K1UA 1BUQA 1OCVA 3KKGA 5KP4A 5FW5A 1JB2A 1OF5B 4HM3B 3F7XA 1UUWB 5IG3A 3CPOA 5D81A 3FZWA 4L8OA 3B4PA 3MG3A 1GS3A 5TGNA 3GZYB 1GY6A 3FKAA 5CF2A 4HM0B 4OUQA 2BMRB 3E99A 2INXA 4CDLA 1Q42A 1OHPA 5D82A 3T8UA 1WQLB 2BMQB 3VSYA 4HM7B 1OH0A 3KSPA 4HM8B 5JPUA 1ASKA 4KVHA 1OGXA 2F98A 3FF2A 4HKVB 5IG5A 3H51A 5IG0A 3F8XA 5CXOA 3ER7A 3GZXB 4HM2B 2GEYA 4I4KA 3G0KA 5AIFA 1JB4A 1CQSA 3A76A 1TUHA 3H3HA 5IENA 4LMIA 2HMKB 5CF1A 4XDWA 1E97A 3ECFA 3FH1A 1QJGA 2QIYA 2W2CA 4STDA 4LGQA 1O7NB 2XRXB 3LZAA 5IERA 3B7CA 5G2GA 3NM2A 3F40A 3RGRA 4FCMA 4OVMA 4GB5A 3OWSA 3M8CA 5D83A 1OUNA 1W02A 7STDA 3LYGA 3MG1A 1OGZA 2QGUA 2F99A 3ROBA 1ULJB 3EX9A 3SEDA 2PZVA 2HMMB 3KE7A 1W00A 1GY7A 1O7GB 4XBXA 3EJVA 3EF8A 3NHXA 4RZMA 4J8TA 2B1XB 1EG9B 1ISKA 3HK4A 4K1VA 5BXQA 8CHOA 5DREA 2Z7AA 1UUVB 4R1KA 3DZLA 2HMJB 1E3RA 1GY5A 4XM4A 3KZTA 3F8HA 4XB5A 3FF0A 1W01A 5EVHA 3HZPA 2I9WA 3MSOA 1O7MB 1JB5A 1STDA 3OXAA 1ZX2A 2XSHB 2B24B 3EN8A 3EHCA 4WYKA 3Q90A 1A2KA 2Z76A 4R9KA 1VZZA 3BB9A 1QMAA 2HMLB 3B8LA 4XBTA 1TP6A 4WYKB 2UX0A 4HM4B 1OPYA 4L7KA 4MJDA 5HGRA 3FSDA 5AEWB 3GZRA 2HMNB 4PEJA 1O7WB 3DUKA 2A15A 1NDOB 3UNLA 5AEUB 2GEXA 5IF6A 3NXJA 3F9SA 2GBXB 3K0ZA 1IDPA 3G8ZA 3IPTA 1NU3A 4U13A 4HM6B 4J9AA 3VGNA 3NBRA 2BNGA 4FCJA 1AR0A 3SOYA 4L8PA 5AIGA 5KP3A 1JKGA 3GRDA 1Z1SA 3CU3A 2HMOB 2IMJA 2XSOB
chains in the Genus database with same CATH superfamily
4AKZA 3X3YA 1AVKA 1WTHA 5IW9A 3MHEA 3O8YA 1OHSA 5IEOA 3OWYA 3TDGA 3DY5A 2RGQA 1BNJA 2BHMA 1B2ZA 1BNFA 3DMCA 2XR8B 3PGBA 3L0RA 4BL2A 1W2ZA 1GYBA 1C7HA 1NB3I 5M19A 3CC23 1W5ZA 4R9LA 3LMLA 1BGSA 1DYUA 1JRQA 4AKYA 3GZBA 1G0TA 1BSBA 1IQ8A 1JKGB 3BLZA 3LT9A 1SARA 2KF3A 2C10A 3JUQA 3NV0A 4HM5B 1KD14 2H0GA 2BU4A 2O3OA 3EQQB 5ELUA 3S5CA 1RN7A 1TIJA 3CNXA 1IYYA 3FCSB 3KSED 3WA2X 1VQP3 3HIIA 1B20A 1ULIB 3KCHA 5JPPA 3F7SA 4WWUC 3GSPA 1U8CB 1G96A 4N6V0 1N8QA 1BUJA 1W6GA 4HZ9B 2GU3A 4GHOA 8RNTA 5AIIA 1V57A 1HYFA 1IT8A 1SJWA 1W6CA 2CFWA 1VQ73 3LT8A 4KT3B 3V92A 2CG0A 3LTDA 1LOYA 3MPHA 4IIAA 3D9RA 1JBSA 1VQN3 5DRVA 3T8NA 3WOEB 1X1UA 3NV0B 1GSPA 4MMZB 4N6NB 1X1WA 4HZBB 5CK6A 3F14A 4KFDA 1SIHA 4BL3A 1D6UA 1VQ43 1BRSA 4J5GA 1RHLA 3EBYA 1K41A 2BIRA 2SBLA 3X42A 3WHOA 2E2VA 2OWPA 3EC9A 3MKIA 3MYTA 6RNTA 1FYSA 1RRHA 2GBWB 3KN4A 5LC7A 2CHCA 3N9HA 1VQL3 1BOXA 2F56A 3B4OA 3EBTA 4R4KA 2GXFA 1B21A 3HX8A 5IEPA 3CCQ3 4HM1B 5M18A 1BSEA 3DM8A 1S5AA 1UW1A 3N8BA 1VQK3 3HI7A 3WR2A 1B2UA 1EA2A 1DMMA 1D6ZA 1Q40A 2CKFB 1QALA 1I3FA 4FMBA 3UJMA 1AY7A 1NB5I 3NM7A 4K90B 4O02B 4Q53A 2JQ5A 1YIJ3 3G16A 1LOVA 5M1AA 2YFJB 2CIUA 2CX0A 3SVAA 2IY2A 2KF4A 2BMOB 2WGQA 1N9EA 4O2HA 1BSCA 3V99A 1JZOA 3HOHA 2KCDA 1YJ93 3JUPA 1MGWA 4G1MB 3DXOA 1B3SA 1IVWA 1HKXA 2CX1A 1YJN3 2L1SA 4AEQA 1O7PB 1LXEA 5IG4A 2Y74A 1IQYA 2IA7A 1US1A 1OHOA 3U97A 1V74A 3STDA 4HVNA 3SOAA 3UL5A 1IVVA 6STDA 4HJLB 1U5OA 2H0IA 1T2HA 1IV9A 2RFRA 3Q1CA 1RN4A 3FGYA 1E3VA 4GSPA 1BRGA 3JUNA 1Q40B 4N6MA 5CLKA 5BVBA 1RMSA 1JN5A 1MWSA 3D5IA 3DGLA 3AGNA 3JUOA 3I563 3FG4A 3CCJ3 3KFQC 2O9UX 3AHSA 3EN1B 4HBRA 5AI1A 1O7HB 4X2HA 2STDA 4X2OA 3K7CA 3FLJA 7RNTA 1EKMA 5I97A 3U1WA 2QA43 2K0MA 1UCKA 2K54A 2Z77A 4EXRA 2F86B 4FMDA 3RGAA 1J2BA 1DMQA 3GWRA 1FGMA 1BNIA 1GOVA 1DMNA 3PCSA 3PXMA 3NUVA 2RSXA 3OWUA 4HYZA 3ZG0A 3MG2A 1LQGC 4N3VA 1QVF2 1JN5B 4EV2A 4RBNA 1IK3A 3URPA 1RGLA 1ZO2A 1MWRA 5STDA 3WMDA 2YFLB 1BAOA 2R41A 1OF5A 3CNMA 1W6YA 5KP1A 3LH4A 2CFLA 4XDVA 3CCV3 1RNBA 4H3UA 1NWWA 1UDII 3OX9A 5BIRA 4ORLA 3CME3 4IT7A 2OQEC 2RCDA 2W0QA 4KFEA 1I2FA 4LEHA 4XBYA 3DGOA 1DE3A 1UI7A 1A2PA 2KAAA 3CCM3 1JJ22 2YFIB 5AIHA 2W6JH 2R4IA 3ALAA 1RKYA 3NQYA 3ZG5A 4WP5A 1B2XA 1N5HA 1RCLA 1WMNA 3LXUX 2QEX3 3OV4A 3NBBA 5JBSA 3JUMA 3I0YA 4K1UA 3ZFZA 1BUQA 1OCVA 3KKGA 3RNTA 4LZIA 1WMOA 1YNVX 4FR9A 5AYSC 1FUTA 5KP4A 5FW5A 4MMXB 1T2IA 1M9GA 5EQLA 1RDSA 1JB2A 1VQM3 1OF5B 1LRAA 3X41A 4HM3B 2JDIH 3F7XA 1UUWB 2CFKA 5IG3A 3CPOA 5D81A 3FZWA 1DVCA 4L8OA 3B4PA 3MG3A 2IUKA 1GS3A 2OCTA 2D42A 4GL6A 3S29A 5TGNA 3GZYB 4J5KA 1GY6A 2CFGA 3FKAA 1RLSA 2XFTA 1Q9EA 4HM0B 1EUIC 5CF2A 1Q7Y4 1B2MA 4OUQA 2BMRB 3E99A 2INXA 5G1KA 4CDLA 4CJNA 1Q42A 1OHPA 1RN1A 2W9PA 1BRJA 5D82A 3K9MC 1K8A4 1KSIA 1RRLA 1BRIA 3T8UA 1BANA 4N6UA 1WQLB 3CCL3 2V1LA 2BMQB 3VSYA 1I0XA 1FW7A 1GMPA 2ZA4A 3X3XA 1BRNL 4HM7B 1UCIA 4HOHA 2L4VA 1BVIA 1NO3A 1OH0A 3KSPA 1LOXA 1LOWA 1LNHA 3IJEB 3LTCA 3I553 1UCJA 2CWVA 4HM8B 2ZHXB 2C4BA 1BU4A 2Y73A 5JPUA 3WDGB 1BNGA 1ASKA 2ZL8A 1A90A 2W03A 4EYCA 2UGIA 4JF8A 1X1YA 4KVHA 4EBGA 1TU5A 1MWUA 1OGXA 1VQ83 1UI8A 2F98A 3FF2A 1RJOA 4HKVB 4EV5A 5IG5A 1DVDA 4MEIA 4BTYA 2MF7A 3H51A 5IG0A 2BT3A 3F8XA 2PNCA 3X3ZA 5CXOA 1V58A 3ER7A 3GZXB 3A5EA 2UUGC 3OW22 1SPUA 4HM2B 1YI23 1ROAA 2GEYA 1RCKA 1I0VA 3EB8A 4LYLB 2ML5A 4I4KA 2ZDJA 3SYUA 1VQO3 3G0KA 3PS8A 2XF3A 2D1WA 5AIFA 1JB4A 1JBTA 1JZDA 2RNTA 1CQSA 3A76A 1FZUA 2KF5A 1MOLA 1TUHA 3D3LA 1B27A 1CH0A 2E2TA 1I2EA 1PY3A 2P05A 3H3HA 2F5MA 5IENA 1Q7HA 4LMIA 2HMKB 5CF1A 2CK3H 1JBRA 4FMCA 2XFSA 1OACA 1FGTA 4XDWA 4ILFA 2J8XB 3T0UA 2GU1A 1R4YA 1STFI 1JNQA 3BU4A 3CMA3 4K61A 1E97A 4WFOA 3ECFA 2M7OA 3BIRA 3S28A 2FNQA 5G1LA 1RGKA 3FH1A 3PZWA 1QJGA 1HU9A 2QIYA 5HOHA 3CCR3 2W2CA 1BNRA 2CH9A 1CYVA 1RGCA 2CWUA 3PCRA 4STDA 1ROVA 2XGLA 3D4AA 1LVNA 4LGQA 3K5TA 2P09A 1TFKA 1UGHI 3CC73 2YX9A 1SQWA 1IVXA 1ZS7A 1O7NB 1KC84 2XRXB 3CCS3 3LZAA 3S27A 5RNTA 3CPW2 3CD63 1RGAA 2OOVA 2AAEA 1ZGXA 2ML6A 5IERA 3SX1A 3FG1A 3B7CA 5G2GA 1I70A 2CW9A 1YHQ3 3NM2A 4O8SA 3F40A 2H0HA 3RGRA 3N54B 1SIIA 4FCMA 2IYJA 2Z6BA 3D5GA 4OVMA 4GB5A 3OWSA 4CCVA 1GMRA 3M8CA 5D83A 1NJI4 1OUNA 1EQKA 1W02A 7STDA 2XGNA 2W9QA 1FGOA 2OTL3 4BTWA 3LYGA 3MG1A 3WODG 1OGZA 3DGMA 4OK0A 2QGUA 4RNZA 2CFDA 2F99A 3AGOA 3ROBA 1ULJB 3EX9A 3SEDA 1RGEA 1GD4A 3FG3A 1BSAA 1MWTA 3G713 3LOYA 1I3IA 4DKIA 1RTUA 2PZVA 1VQ53 2HMMB 2WGOA 2K3DA 3MWZA 3V98A 4EW5A 1GOYA 3KE7A 4N6TA 5AYRB 1VQQA 3EE1A 1W00A 1T5YA 3RDEA 1I2GA 6GSPA 1VQ63 1GY7A 4BU4A 1AQZA 1IQXA 1O7GB 3QK9A 3AMOA 4LSOA 1RNTA 4XBXA 3SLUA 2P0MA 1K9M4 2Q07A 3EF8A 3EJVA 3HIGA 1BNEA 3NHXA 1N8R4 4RZMA 3DGNA 4J8TA 4RNTA 2B1XB 1EG9B 1ISKA 4KFFA 5EEOA 1QAKA 2WO0A 1W2B2 4NREA 1T3BA 3UB1A 3GAXA 3HK4A 3QRDA 3WA3A 4K1VA 5BXQA 2CWTA 8CHOA 5DREA 2Z7AA 1MGRA 1YGEA 1AV4A 3Q2PA 2KXGA 1MNLA 1UUVB 1LQMB 1UCLA 3DH2A 4R1KA 3DZLA 5FGOA 2HMJB 4JRFA 4QWTA 3G4S3 1YJW3 2P38A 1IVUA 1E3RA 1GY5A 2HOHA 3KZTA 4XM4A 3AMOB 3F8HA 1Q864 4XB5A 2LYXA 3FF0A 1F8NA 1W01A 1EEJA 4I5QA 3HZPA 5EVHA 2I9WA 3MSOA 1O7MB 4IPBA 1JB5A 1NNVA 1STDA 1W4NA 2SARA 3OXAA 4EC6A 1ZX2A 1QVG2 1PYLA 3CXC2 2XSHB 1TRQA 2B24B 1S723 2OOVC 5LC6A 3S67A 3J7Yd 1IV7A 3EN8A 5BU4A 1VQ93 3EHCA 1RGFA 2E2UA 4BIRA 1UUGB 3DGYA 1RGHA 2F4YA 1C54A 1CEWI 4WYKA 1GOUA 1R4CA 3BNCA 3Q3FA 1FGRA 2WOHA 4NHFA 1RGGA 3Q90A 1D6YA 4CPKA 1HZ1A 1A2KA 2Z76A 2W56A 4R9KA 4TX4A 1CYUA 1VZZA 3IMAB 1RSNA 3BB9A 2OQEA 1QMAA 1TJDA 1YGWA 4FMAA 2HMLB 1LNIA 1BRKA 3B8LA 1YVSA 4N6LA 1TRPA 3D79A 1K734 3SXXA 1YIT3 4XBTA 2C11A 1FA3A 2AADA 1BRHA 1TP6A 1TTOA 3AHWA 3NQZA 1L5GB 1FUWA 9RNTA 1GD3A 2P0XA 4WYKB 1B2SA 2BO9B 1PU4A 2UX0A 4HM4B 4WHAA 1BNSA 1OPYA 4NPBA 4L7KA 2OTJ3 2CC3A 2W56B 4MJDA 4HAAA 1M1XB 5HGRA 3G6E3 1Q824 4O3VA 1N5PA 1UGIA 3K63A 2FXTA 3BNBA 3FSDA 5AEWB 1AVLA 1Y4KA 2GSPA 2KF6A 4KZ1A 3GZRA 2HMNB 4PEJA 1Q814 1O7WB 3CC43 3DUKA 7GSPA 2A15A 1QAFA 1NDOB 1DETA 1KWIA 2FGTA 3UNLA 1X1XA 1TFOA 5AEUB 2GEXA 2WOFA 4FCZA 3X40A 5IF6A 3BNEA 1G02A 5ELJA 3UL6A 3NXJA 1IU7A 1YVBI 3F9SA 2GBXB 1IT7A 3LTBA 3K0ZA 1IDPA 3PYJA 1GMQA 1WNHA 4RNYA 3VF1A 2IUJA 4BTXA 2XEPA 1W7CA 1A67A 3G8ZA 3IPTA 3NX0A 4ZM8A 1NU3A 4U13A 4HM6B 2CG1A 1WMPA 4J9AA 1I8VA 4R80A 3VGNA 3NBRA 1BIRA 1FUSA 3BNDA 2MC8A 1M904 1FGQA 1M1K4 3JVCA 1KQS2 2BNGA 1BSDA 4FCJA 2LQVA 2XH9A 1AR0A 3KIIA 1JV2B 4N6OB 3SOYA 2W04A 4L8PA 5AIGA 3WOFB 4MMYB 2F5WA 1PFPA 2RBIA 3CCU3 2KRTA 1JKGA 3GRDA 1Z1SA 3CU3A 3NBJA 5KP3A 2HMOB 2IMJA 1A2VA 4H61A 3LTAA 3CCE3 2XSOB 5A0OB 1K28A 5GSPA 1N9JA
chains in the Genus database with same CATH topology
4AKZA 3X3YA 1AVKA 1WTHA 5IW9A 3MHEA 3O8YA 1OHSA 5IEOA 3OWYA 3TDGA 3DY5A 2RGQA 2BHMA 3DMCA 2XR8B 3PGBA 3L0RA 1W2ZA 1GYBA 1C7HA 1NB3I 3CC23 1W5ZA 4R9LA 3LMLA 1DYUA 1JRQA 4AKYA 3GZBA 1IQ8A 1JKGB 3BLZA 3LT9A 4HM5B 3NV0A 2C10A 3JUQA 3G6E3 1KD14 2O3OA 3EQQB 5ELUA 3S5CA 1RN7A 1TIJA 3CNXA 3FCSB 3KSED 3WA2X 1VQP3 3HIIA 1ULIB 5JPPA 3F7SA 4WWUC 1U8CB 1G96A 4N6V0 1N8QA 1W6GA 4HZ9B 2GU3A 5AIIA 1IT8A 1SJWA 1W6CA 2CFWA 1VQ73 3LT8A 3V92A 2CG0A 3LTDA 3MPHA 4IIAA 1VQN3 3D9RA 5DRVA 3T8NA 3WOEB 3NV0B 4MMZB 4N6NB 4HZBB 5CK6A 3F14A 4KFDA 1SIHA 1D6UA 1VQ43 3EBYA 1K41A 2SBLA 3X42A 2E2VA 2OWPA 3EC9A 3MKIA 3MYTA 1RRHA 3KN4A 2GBWB 5LC7A 2CHCA 3N9HA 1VQL3 3B4OA 3EBTA 4R4KA 2GXFA 3HX8A 5IEPA 3CCQ3 4HM1B 3DM8A 1S5AA 1UW1A 3N8BA 1VQK3 3HI7A 1EA2A 1DMMA 1D6ZA 1Q40A 2CKFB 1QALA 4FMBA 3UJMA 1NB5I 3NM7A 4K90B 4O02B 4Q53A 2JQ5A 1YIJ3 3G16A 2YFJB 2CIUA 3SVAA 2BMOB 2WGQA 1N9EA 4O2HA 3V99A 2KCDA 1YJ93 3JUPA 4G1MB 3DXOA 1IVWA 1HKXA 1YJN3 4AEQA 1O7PB 1LXEA 5IG4A 2Y74A 1IQYA 2IA7A 1US1A 1OHOA 3U97A 1V74A 3STDA 4HVNA 3SOAA 3UL5A 1IVVA 6STDA 4HJLB 1U5OA 1IV9A 2RFRA 3Q1CA 3FGYA 1E3VA 3JUNA 1Q40B 4N6MA 5CLKA 5BVBA 1JN5A 3DGLA 3JUOA 3I563 3FG4A 3CCJ3 3KFQC 2O9UX 3EN1B 4HBRA 5AI1A 1O7HB 4X2HA 2STDA 4X2OA 3K7CA 3FLJA 1EKMA 5I97A 3U1WA 2QA43 2K0MA 2Z77A 2K54A 4EXRA 2F86B 4FMDA 3RGAA 1J2BA 1DMQA 3GWRA 1FGMA 1DMNA 3PCSA 3PXMA 3NUVA 2RSXA 3OWUA 4HYZA 3MG2A 4N3VA 1QVF2 1JN5B 4EV2A 4RBNA 1IK3A 5STDA 1ZO2A 3WMDA 2YFLB 3CCV3 1OF5A 3CNMA 1W6YA 5KP1A 3LH4A 2CFLA 4XDVA 4H3UA 1NWWA 3OX9A 4ORLA 3CME3 4IT7A 2OQEC 2RCDA 2W0QA 4KFEA 4LEHA 4XBYA 3DGOA 1UI7A 3CCM3 1JJ22 2YFIB 5AIHA 2W6JH 2R4IA 3ALAA 1RKYA 3NQYA 4WP5A 1N5HA 1WMNA 3LXUX 2QEX3 3OV4A 3NBBA 5JBSA 3JUMA 3I0YA 4K1UA 1BUQA 1OCVA 3KKGA 4LZIA 1WMOA 5AYSC 4FR9A 5KP4A 5FW5A 4MMXB 1M9GA 5EQLA 1JB2A 1VQM3 1OF5B 3X41A 4HM3B 2JDIH 3F7XA 1UUWB 2CFKA 5IG3A 3CPOA 5D81A 3FZWA 1DVCA 4L8OA 3B4PA 3MG3A 2IUKA 1GS3A 2OCTA 2D42A 4GL6A 3S29A 5TGNA 3GZYB 1GY6A 2CFGA 3FKAA 5CF2A 2XFTA 4HM0B 1Q7Y4 4OUQA 2BMRB 3E99A 2INXA 4CDLA 1Q42A 1OHPA 2W9PA 5D82A 3K9MC 1K8A4 1KSIA 1RRLA 3T8UA 4N6UA 1WQLB 3CCL3 2V1LA 2BMQB 3VSYA 3X3XA 4HM7B 2L4VA 1NO3A 1OH0A 3KSPA 1LOXA 3LTCA 1LNHA 3IJEB 3I553 2CWVA 4HM8B 2Y73A 5JPUA 3WDGB 1ASKA 2ZL8A 1A90A 2W03A 4EYCA 4JF8A 4KVHA 4EBGA 1TU5A 1OGXA 1VQ83 1UI8A 2F98A 3FF2A 1RJOA 4HKVB 4EV5A 5IG5A 1DVDA 4MEIA 4BTYA 2MF7A 3H51A 5IG0A 2BT3A 3F8XA 2PNCA 3X3ZA 5CXOA 3ER7A 3GZXB 3OW22 1SPUA 4HM2B 1YI23 1ROAA 2GEYA 3EB8A 2ML5A 4I4KA 2ZDJA 1VQO3 3G0KA 3PS8A 2XF3A 2D1WA 5AIFA 1JB4A 1CQSA 3A76A 1MOLA 1TUHA 3D3LA 2E2TA 2P05A 3H3HA 5IENA 4LMIA 2HMKB 5CF1A 2CK3H 4FMCA 2XFSA 1OACA 1FGTA 4XDWA 3T0UA 2GU1A 1STFI 1JNQA 3CMA3 4K61A 1E97A 4WFOA 3ECFA 2M7OA 3S28A 2FNQA 3FH1A 3PZWA 1QJGA 1HU9A 2QIYA 3CCR3 2W2CA 2CH9A 1CYVA 2CWUA 3PCRA 4STDA 1ROVA 2XGLA 1LVNA 4LGQA 3K5TA 2P09A 1TFKA 3CC73 2YX9A 1SQWA 1IVXA 1KC84 1O7NB 2XRXB 3CCS3 3LZAA 3S27A 3CPW2 3CD63 2OOVA 2ML6A 5IERA 3SX1A 3FG1A 3B7CA 5G2GA 2CW9A 1YHQ3 3NM2A 4O8SA 3F40A 3RGRA 3N54B 1SIIA 4FCMA 2Z6BA 4OVMA 4GB5A 3OWSA 4CCVA 3M8CA 5D83A 1NJI4 1OUNA 1EQKA 1W02A 7STDA 2XGNA 2W9QA 1FGOA 2OTL3 4BTWA 3LYGA 3MG1A 3WODG 1OGZA 3DGMA 4OK0A 2QGUA 4RNZA 2CFDA 2F99A 3ROBA 1ULJB 3EX9A 3SEDA 3FG3A 1GD4A 3G713 3LOYA 2PZVA 1VQ53 2HMMB 2WGOA 3MWZA 3V98A 5AYRB 3KE7A 4N6TA 3EE1A 1W00A 1T5YA 3RDEA 1VQ63 1GY7A 1IQXA 1O7GB 3QK9A 3AMOA 4LSOA 4XBXA 3SLUA 2P0MA 1K9M4 2Q07A 3EF8A 3EJVA 3HIGA 3NHXA 1N8R4 4RZMA 3DGNA 4J8TA 2B1XB 1EG9B 1ISKA 4KFFA 5EEOA 1QAKA 2WO0A 1W2B2 4NREA 3UB1A 3GAXA 3HK4A 3QRDA 3WA3A 4K1VA 5BXQA 2CWTA 8CHOA 5DREA 2Z7AA 1YGEA 1AV4A 3Q2PA 2KXGA 1MNLA 1UUVB 4R1KA 3DZLA 5FGOA 2HMJB 4JRFA 4QWTA 3G4S3 1YJW3 2P38A 1IVUA 1E3RA 1GY5A 4XM4A 3KZTA 1Q864 3AMOB 3F8HA 4XB5A 2LYXA 3FF0A 1F8NA 1W01A 5EVHA 3HZPA 2I9WA 3MSOA 1O7MB 4IPBA 1JB5A 1STDA 1W4NA 3OXAA 4EC6A 1ZX2A 1QVG2 3CXC2 2XSHB 2B24B 1S723 2OOVC 5LC6A 3S67A 3J7Yd 1IV7A 3EN8A 1VQ93 3EHCA 2E2UA 1CEWI 4WYKA 1R4CA 3BNCA 1FGRA 2WOHA 4NHFA 3Q90A 1D6YA 1A2KA 2Z76A 2W56A 4R9KA 4TX4A 1CYUA 1VZZA 3IMAB 3BB9A 2OQEA 1QMAA 4FMAA 2HMLB 3B8LA 4N6LA 1K734 3SXXA 1YIT3 4XBTA 2C11A 1FA3A 1TP6A 3NQZA 1L5GB 1FUWA 1GD3A 2P0XA 4WYKB 2BO9B 1PU4A 2UX0A 4HM4B 4WHAA 1OPYA 2OTJ3 4L7KA 2CC3A 2W56B 4MJDA 5HGRA 1M1XB 1Q824 4O3VA 1N5PA 3K63A 2FXTA 3BNBA 3FSDA 5AEWB 1AVLA 1Y4KA 4KZ1A 3GZRA 2HMNB 4PEJA 1Q814 1O7WB 3CC43 3DUKA 2A15A 1QAFA 1NDOB 1KWIA 2FGTA 3UNLA 1TFOA 5AEUB 2GEXA 2WOFA 4FCZA 3X40A 5IF6A 3BNEA 5ELJA 3UL6A 3NXJA 1IU7A 1YVBI 3F9SA 2GBXB 1IT7A 3LTBA 3K0ZA 1IDPA 3PYJA 1WNHA 4RNYA 3VF1A 4BTXA 2IUJA 2XEPA 1W7CA 1A67A 3G8ZA 3IPTA 3NX0A 4ZM8A 1NU3A 4U13A 4HM6B 2CG1A 1WMPA 4J9AA 4R80A 3VGNA 3NBRA 3BNDA 2MC8A 1M904 1FGQA 1M1K4 3JVCA 1KQS2 2BNGA 4FCJA 2LQVA 2XH9A 1AR0A 3KIIA 1JV2B 4N6OB 3SOYA 2W04A 4L8PA 5AIGA 3WOFB 4MMYB 1PFPA 3CCU3 2KRTA 1JKGA 3GRDA 1Z1SA 3CU3A 3NBJA 5KP3A 2HMOB 2IMJA 1A2VA 4H61A 3LTAA 3CCE3 2XSOB 5A0OB 1K28A 1N9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHE A;  1OHS A;  5IEO A;  3OWY A;  2RGQ A;  3DMC A;  2XR8 B;  1GYB A;  1C7H A;  4R9L A;  3GZB A;  1JKG B;  3BLZ A;  4HM5 B;  3NV0 A;  3JUQ A;  3EQQ B;  3S5C A;  3CNX A;  1ULI B;  5JPP A;  3F7S A;  4WWU C;  4HZ9 B;  5AII A;  1SJW A;  4IIA A;  3D9R A;  5DRV A;  3T8N A;  3NV0 B;  4HZB B;  5CK6 A;  3F14 A;  3EBY A;  1K41 A;  3EC9 A;  2OWP A;  3MKI A;  3MYT A;  2GBW B;  2CHC A;  3B4O A;  3EBT A;  5IEP A;  2GXF A;  3HX8 A;  4HM1 B;  3DM8 A;  1S5A A;  1EA2 A;  1DMM A;  1Q40 A;  2CKF B;  3UJM A;  4Q53 A;  2JQ5 A;  3G16 A;  2YFJ B;  2BMO B;  3JUP A;  3DXO A;  1HKX A;  1O7P B;  5IG4 A;  1OHO A;  3STD A;  4HVN A;  3SOA A;  6STD A;  4HJL B;  1U5O A;  2RFR A;  3FGY A;  1E3V A;  3JUN A;  1Q40 B;  5CLK A;  5BVB A;  1JN5 A;  3JUO A;  3EN1 B;  5AI1 A;  4X2H A;  1O7H B;  2STD A;  4X2O A;  3K7C A;  3FLJ A;  2Z77 A;  2K54 A;  2F86 B;  3RGA A;  1DMQ A;  3GWR A;  1DMN A;  3NUV A;  3OWU A;  3MG2 A;  4N3V A;  1JN5 B;  5STD A;  1ZO2 A;  3WMD A;  2YFL B;  1OF5 A;  3CNM A;  1W6Y A;  5KP1 A;  4XDV A;  4H3U A;  1NWW A;  3OX9 A;  4ORL A;  2RCD A;  4LEH A;  4XBY A;  2YFI B;  5AIH A;  2R4I A;  4WP5 A;  3OV4 A;  3JUM A;  3I0Y A;  4K1U A;  1BUQ A;  1OCV A;  3KKG A;  5KP4 A;  5FW5 A;  1JB2 A;  1OF5 B;  4HM3 B;  3F7X A;  1UUW B;  5IG3 A;  3CPO A;  5D81 A;  3FZW A;  4L8O A;  3B4P A;  3MG3 A;  1GS3 A;  5TGN A;  3GZY B;  1GY6 A;  3FKA A;  5CF2 A;  4HM0 B;  4OUQ A;  2BMR B;  3E99 A;  2INX A;  4CDL A;  1Q42 A;  1OHP A;  5D82 A;  3T8U A;  1WQL B;  2BMQ B;  3VSY A;  4HM7 B;  1OH0 A;  3KSP A;  4HM8 B;  5JPU A;  1ASK A;  4KVH A;  1OGX A;  2F98 A;  3FF2 A;  4HKV B;  5IG5 A;  3H51 A;  5IG0 A;  3F8X A;  5CXO A;  3ER7 A;  3GZX B;  4HM2 B;  2GEY A;  4I4K A;  3G0K A;  5AIF A;  1JB4 A;  1CQS A;  3A76 A;  1TUH A;  3H3H A;  5IEN A;  4LMI A;  2HMK B;  5CF1 A;  4XDW A;  1E97 A;  3ECF A;  3FH1 A;  1QJG A;  2QIY A;  2W2C A;  4STD A;  4LGQ A;  1O7N B;  2XRX B;  3LZA A;  5IER A;  3B7C A;  5G2G A;  3NM2 A;  3F40 A;  3RGR A;  4FCM A;  4OVM A;  4GB5 A;  3OWS A;  3M8C A;  5D83 A;  1OUN A;  1W02 A;  7STD A;  3LYG A;  3MG1 A;  1OGZ A;  2QGU A;  2F99 A;  3ROB A;  1ULJ B;  3EX9 A;  3SED A;  2PZV A;  2HMM B;  3KE7 A;  1W00 A;  1GY7 A;  1O7G B;  4XBX A;  3EJV A;  3EF8 A;  3NHX A;  4RZM A;  4J8T A;  2B1X B;  1EG9 B;  1ISK A;  3HK4 A;  4K1V A;  5BXQ A;  8CHO A;  5DRE A;  2Z7A A;  1UUV B;  4R1K A;  3DZL A;  2HMJ B;  1E3R A;  1GY5 A;  4XM4 A;  3KZT A;  3F8H A;  4XB5 A;  3FF0 A;  1W01 A;  5EVH A;  3HZP A;  2I9W A;  3MSO A;  1O7M B;  1JB5 A;  1STD A;  3OXA A;  1ZX2 A;  2XSH B;  2B24 B;  3EN8 A;  3EHC A;  4WYK A;  3Q90 A;  1A2K A;  2Z76 A;  4R9K A;  1VZZ A;  3BB9 A;  1QMA A;  2HML B;  3B8L A;  4XBT A;  1TP6 A;  4WYK B;  2UX0 A;  4HM4 B;  1OPY A;  4L7K A;  4MJD A;  5HGR A;  3FSD A;  5AEW B;  3GZR A;  2HMN B;  4PEJ A;  1O7W B;  3DUK A;  2A15 A;  1NDO B;  3UNL A;  5AEU B;  2GEX A;  5IF6 A;  3NXJ A;  3F9S A;  2GBX B;  3K0Z A;  1IDP A;  3G8Z A;  3IPT A;  1NU3 A;  4U13 A;  4HM6 B;  4J9A A;  3VGN A;  3NBR A;  2BNG A;  4FCJ A;  1AR0 A;  3SOY A;  4L8P A;  5AIG A;  5KP3 A;  1JKG A;  3GRD A;  1Z1S A;  3CU3 A;  2HMO B;  2IMJ A;  2XSO B; 
#chains in the Genus database with same CATH topology
 4AKZ A;  3X3Y A;  1AVK A;  1WTH A;  5IW9 A;  3MHE A;  3O8Y A;  1OHS A;  5IEO A;  3OWY A;  3TDG A;  3DY5 A;  2RGQ A;  1BNJ A;  2BHM A;  1B2Z A;  1BNF A;  3DMC A;  2XR8 B;  3PGB A;  3L0R A;  4BL2 A;  1W2Z A;  1GYB A;  1C7H A;  1NB3 I;  5M19 A;  3CC2 3;  1W5Z A;  4R9L A;  3LML A;  1BGS A;  1DYU A;  1JRQ A;  4AKY A;  3GZB A;  1G0T A;  1BSB A;  1IQ8 A;  1JKG B;  3BLZ A;  3LT9 A;  1SAR A;  2KF3 A;  2C10 A;  3JUQ A;  3NV0 A;  4HM5 B;  1KD1 4;  2H0G A;  2BU4 A;  2O3O A;  3EQQ B;  5ELU A;  3S5C A;  1RN7 A;  1TIJ A;  3CNX A;  1IYY A;  3FCS B;  3KSE D;  3WA2 X;  1VQP 3;  3HII A;  1B20 A;  1ULI B;  3KCH A;  5JPP A;  3F7S A;  4WWU C;  3GSP A;  1U8C B;  1G96 A;  4N6V 0;  1N8Q A;  1BUJ A;  1W6G A;  4HZ9 B;  2GU3 A;  4GHO A;  8RNT A;  5AII A;  1V57 A;  1HYF A;  1IT8 A;  1SJW A;  1W6C A;  2CFW A;  1VQ7 3;  3LT8 A;  4KT3 B;  3V92 A;  2CG0 A;  3LTD A;  1LOY A;  3MPH A;  4IIA A;  3D9R A;  1JBS A;  1VQN 3;  5DRV A;  3T8N A;  3WOE B;  1X1U A;  3NV0 B;  1GSP A;  4MMZ B;  4N6N B;  1X1W A;  4HZB B;  5CK6 A;  3F14 A;  4KFD A;  1SIH A;  4BL3 A;  1D6U A;  1VQ4 3;  1BRS A;  4J5G A;  1RHL A;  3EBY A;  1K41 A;  2BIR A;  2SBL A;  3X42 A;  3WHO A;  2E2V A;  2OWP A;  3EC9 A;  3MKI A;  3MYT A;  6RNT A;  1FYS A;  1RRH A;  2GBW B;  3KN4 A;  5LC7 A;  2CHC A;  3N9H A;  1VQL 3;  1BOX A;  2F56 A;  3B4O A;  3EBT A;  4R4K A;  2GXF A;  1B21 A;  3HX8 A;  5IEP A;  3CCQ 3;  4HM1 B;  5M18 A;  1BSE A;  3DM8 A;  1S5A A;  1UW1 A;  3N8B A;  1VQK 3;  3HI7 A;  3WR2 A;  1B2U A;  1EA2 A;  1DMM A;  1D6Z A;  1Q40 A;  2CKF B;  1QAL A;  1I3F A;  4FMB A;  3UJM A;  1AY7 A;  1NB5 I;  3NM7 A;  4K90 B;  4O02 B;  4Q53 A;  2JQ5 A;  1YIJ 3;  3G16 A;  1LOV A;  5M1A A;  2YFJ B;  2CIU A;  2CX0 A;  3SVA A;  2IY2 A;  2KF4 A;  2BMO B;  2WGQ A;  1N9E A;  4O2H A;  1BSC A;  3V99 A;  1JZO A;  3HOH A;  2KCD A;  1YJ9 3;  3JUP A;  1MGW A;  4G1M B;  3DXO A;  1B3S A;  1IVW A;  1HKX A;  2CX1 A;  1YJN 3;  2L1S A;  4AEQ A;  1O7P B;  1LXE A;  5IG4 A;  2Y74 A;  1IQY A;  2IA7 A;  1US1 A;  1OHO A;  3U97 A;  1V74 A;  3STD A;  4HVN A;  3SOA A;  3UL5 A;  1IVV A;  6STD A;  4HJL B;  1U5O A;  2H0I A;  1T2H A;  1IV9 A;  2RFR A;  3Q1C A;  1RN4 A;  3FGY A;  1E3V A;  4GSP A;  1BRG A;  3JUN A;  1Q40 B;  4N6M A;  5CLK A;  5BVB A;  1RMS A;  1JN5 A;  1MWS A;  3D5I A;  3DGL A;  3AGN A;  3JUO A;  3I56 3;  3FG4 A;  3CCJ 3;  3KFQ C;  2O9U X;  3AHS A;  3EN1 B;  4HBR A;  5AI1 A;  1O7H B;  4X2H A;  2STD A;  4X2O A;  3K7C A;  3FLJ A;  7RNT A;  1EKM A;  5I97 A;  3U1W A;  2QA4 3;  2K0M A;  1UCK A;  2K54 A;  2Z77 A;  4EXR A;  2F86 B;  4FMD A;  3RGA A;  1J2B A;  1DMQ A;  3GWR A;  1FGM A;  1BNI A;  1GOV A;  1DMN A;  3PCS A;  3PXM A;  3NUV A;  2RSX A;  3OWU A;  4HYZ A;  3ZG0 A;  3MG2 A;  1LQG C;  4N3V A;  1QVF 2;  1JN5 B;  4EV2 A;  4RBN A;  1IK3 A;  3URP A;  1RGL A;  1ZO2 A;  1MWR A;  5STD A;  3WMD A;  2YFL B;  1BAO A;  2R41 A;  1OF5 A;  3CNM A;  1W6Y A;  5KP1 A;  3LH4 A;  2CFL A;  4XDV A;  3CCV 3;  1RNB A;  4H3U A;  1NWW A;  1UDI I;  3OX9 A;  5BIR A;  4ORL A;  3CME 3;  4IT7 A;  2OQE C;  2RCD A;  2W0Q A;  4KFE A;  1I2F A;  4LEH A;  4XBY A;  3DGO A;  1DE3 A;  1UI7 A;  1A2P A;  2KAA A;  3CCM 3;  1JJ2 2;  2YFI B;  5AIH A;  2W6J H;  2R4I A;  3ALA A;  1RKY A;  3NQY A;  3ZG5 A;  4WP5 A;  1B2X A;  1N5H A;  1RCL A;  1WMN A;  3LXU X;  2QEX 3;  3OV4 A;  3NBB A;  5JBS A;  3JUM A;  3I0Y A;  4K1U A;  3ZFZ A;  1BUQ A;  1OCV A;  3KKG A;  3RNT A;  4LZI A;  1WMO A;  1YNV X;  4FR9 A;  5AYS C;  1FUT A;  5KP4 A;  5FW5 A;  4MMX B;  1T2I A;  1M9G A;  5EQL A;  1RDS A;  1JB2 A;  1VQM 3;  1OF5 B;  1LRA A;  3X41 A;  4HM3 B;  2JDI H;  3F7X A;  1UUW B;  2CFK A;  5IG3 A;  3CPO A;  5D81 A;  3FZW A;  1DVC A;  4L8O A;  3B4P A;  3MG3 A;  2IUK A;  1GS3 A;  2OCT A;  2D42 A;  4GL6 A;  3S29 A;  5TGN A;  3GZY B;  4J5K A;  1GY6 A;  2CFG A;  3FKA A;  1RLS A;  2XFT A;  1Q9E A;  4HM0 B;  1EUI C;  5CF2 A;  1Q7Y 4;  1B2M A;  4OUQ A;  2BMR B;  3E99 A;  2INX A;  5G1K A;  4CDL A;  4CJN A;  1Q42 A;  1OHP A;  1RN1 A;  2W9P A;  1BRJ A;  5D82 A;  3K9M C;  1K8A 4;  1KSI A;  1RRL A;  1BRI A;  3T8U A;  1BAN A;  4N6U A;  1WQL B;  3CCL 3;  2V1L A;  2BMQ B;  3VSY A;  1I0X A;  1FW7 A;  1GMP A;  2ZA4 A;  3X3X A;  1BRN L;  4HM7 B;  1UCI A;  4HOH A;  2L4V A;  1BVI A;  1NO3 A;  1OH0 A;  3KSP A;  1LOX A;  1LOW A;  1LNH A;  3IJE B;  3LTC A;  3I55 3;  1UCJ A;  2CWV A;  4HM8 B;  2ZHX B;  2C4B A;  1BU4 A;  2Y73 A;  5JPU A;  3WDG B;  1BNG A;  1ASK A;  2ZL8 A;  1A90 A;  2W03 A;  4EYC A;  2UGI A;  4JF8 A;  1X1Y A;  4KVH A;  4EBG A;  1TU5 A;  1MWU A;  1OGX A;  1VQ8 3;  1UI8 A;  2F98 A;  3FF2 A;  1RJO A;  4HKV B;  4EV5 A;  5IG5 A;  1DVD A;  4MEI A;  4BTY A;  2MF7 A;  3H51 A;  5IG0 A;  2BT3 A;  3F8X A;  2PNC A;  3X3Z A;  5CXO A;  1V58 A;  3ER7 A;  3GZX B;  3A5E A;  2UUG C;  3OW2 2;  1SPU A;  4HM2 B;  1YI2 3;  1ROA A;  2GEY A;  1RCK A;  1I0V A;  3EB8 A;  4LYL B;  2ML5 A;  4I4K A;  2ZDJ A;  3SYU A;  1VQO 3;  3G0K A;  3PS8 A;  2XF3 A;  2D1W A;  5AIF A;  1JB4 A;  1JBT A;  1JZD A;  2RNT A;  1CQS A;  3A76 A;  1FZU A;  2KF5 A;  1MOL A;  1TUH A;  3D3L A;  1B27 A;  1CH0 A;  2E2T A;  1I2E A;  1PY3 A;  2P05 A;  3H3H A;  2F5M A;  5IEN A;  1Q7H A;  4LMI A;  2HMK B;  5CF1 A;  2CK3 H;  1JBR A;  4FMC A;  2XFS A;  1OAC A;  1FGT A;  4XDW A;  4ILF A;  2J8X B;  3T0U A;  2GU1 A;  1R4Y A;  1STF I;  1JNQ A;  3BU4 A;  3CMA 3;  4K61 A;  1E97 A;  4WFO A;  3ECF A;  2M7O A;  3BIR A;  3S28 A;  2FNQ A;  5G1L A;  1RGK A;  3FH1 A;  3PZW A;  1QJG A;  1HU9 A;  2QIY A;  5HOH A;  3CCR 3;  2W2C A;  1BNR A;  2CH9 A;  1CYV A;  1RGC A;  2CWU A;  3PCR A;  4STD A;  1ROV A;  2XGL A;  3D4A A;  1LVN A;  4LGQ A;  3K5T A;  2P09 A;  1TFK A;  1UGH I;  3CC7 3;  2YX9 A;  1SQW A;  1IVX A;  1ZS7 A;  1O7N B;  1KC8 4;  2XRX B;  3CCS 3;  3LZA A;  3S27 A;  5RNT A;  3CPW 2;  3CD6 3;  1RGA A;  2OOV A;  2AAE A;  1ZGX A;  2ML6 A;  5IER A;  3SX1 A;  3FG1 A;  3B7C A;  5G2G A;  1I70 A;  2CW9 A;  1YHQ 3;  3NM2 A;  4O8S A;  3F40 A;  2H0H A;  3RGR A;  3N54 B;  1SII A;  4FCM A;  2IYJ A;  2Z6B A;  3D5G A;  4OVM A;  4GB5 A;  3OWS A;  4CCV A;  1GMR A;  3M8C A;  5D83 A;  1NJI 4;  1OUN A;  1EQK A;  1W02 A;  7STD A;  2XGN A;  2W9Q A;  1FGO A;  2OTL 3;  4BTW A;  3LYG A;  3MG1 A;  3WOD G;  1OGZ A;  3DGM A;  4OK0 A;  2QGU A;  4RNZ A;  2CFD A;  2F99 A;  3AGO A;  3ROB A;  1ULJ B;  3EX9 A;  3SED A;  1RGE A;  1GD4 A;  3FG3 A;  1BSA A;  1MWT A;  3G71 3;  3LOY A;  1I3I A;  4DKI A;  1RTU A;  2PZV A;  1VQ5 3;  2HMM B;  2WGO A;  2K3D A;  3MWZ A;  3V98 A;  4EW5 A;  1GOY A;  3KE7 A;  4N6T A;  5AYR B;  1VQQ A;  3EE1 A;  1W00 A;  1T5Y A;  3RDE A;  1I2G A;  6GSP A;  1VQ6 3;  1GY7 A;  4BU4 A;  1AQZ A;  1IQX A;  1O7G B;  3QK9 A;  3AMO A;  4LSO A;  1RNT A;  4XBX A;  3SLU A;  2P0M A;  1K9M 4;  2Q07 A;  3EF8 A;  3EJV A;  3HIG A;  1BNE A;  3NHX A;  1N8R 4;  4RZM A;  3DGN A;  4J8T A;  4RNT A;  2B1X B;  1EG9 B;  1ISK A;  4KFF A;  5EEO A;  1QAK A;  2WO0 A;  1W2B 2;  4NRE A;  1T3B A;  3UB1 A;  3GAX A;  3HK4 A;  3QRD A;  3WA3 A;  4K1V A;  5BXQ A;  2CWT A;  8CHO A;  5DRE A;  2Z7A A;  1MGR A;  1YGE A;  1AV4 A;  3Q2P A;  2KXG A;  1MNL A;  1UUV B;  1LQM B;  1UCL A;  3DH2 A;  4R1K A;  3DZL A;  5FGO A;  2HMJ B;  4JRF A;  4QWT A;  3G4S 3;  1YJW 3;  2P38 A;  1IVU A;  1E3R A;  1GY5 A;  2HOH A;  3KZT A;  4XM4 A;  3AMO B;  3F8H A;  1Q86 4;  4XB5 A;  2LYX A;  3FF0 A;  1F8N A;  1W01 A;  1EEJ A;  4I5Q A;  3HZP A;  5EVH A;  2I9W A;  3MSO A;  1O7M B;  4IPB A;  1JB5 A;  1NNV A;  1STD A;  1W4N A;  2SAR A;  3OXA A;  4EC6 A;  1ZX2 A;  1QVG 2;  1PYL A;  3CXC 2;  2XSH B;  1TRQ A;  2B24 B;  1S72 3;  2OOV C;  5LC6 A;  3S67 A;  3J7Y d;  1IV7 A;  3EN8 A;  5BU4 A;  1VQ9 3;  3EHC A;  1RGF A;  2E2U A;  4BIR A;  1UUG B;  3DGY A;  1RGH A;  2F4Y A;  1C54 A;  1CEW I;  4WYK A;  1GOU A;  1R4C A;  3BNC A;  3Q3F A;  1FGR A;  2WOH A;  4NHF A;  1RGG A;  3Q90 A;  1D6Y A;  4CPK A;  1HZ1 A;  1A2K A;  2Z76 A;  2W56 A;  4R9K A;  4TX4 A;  1CYU A;  1VZZ A;  3IMA B;  1RSN A;  3BB9 A;  2OQE A;  1QMA A;  1TJD A;  1YGW A;  4FMA A;  2HML B;  1LNI A;  1BRK A;  3B8L A;  1YVS A;  4N6L A;  1TRP A;  3D79 A;  1K73 4;  3SXX A;  1YIT 3;  4XBT A;  2C11 A;  1FA3 A;  2AAD A;  1BRH A;  1TP6 A;  1TTO A;  3AHW A;  3NQZ A;  1L5G B;  1FUW A;  9RNT A;  1GD3 A;  2P0X A;  4WYK B;  1B2S A;  2BO9 B;  1PU4 A;  2UX0 A;  4HM4 B;  4WHA A;  1BNS A;  1OPY A;  4NPB A;  4L7K A;  2OTJ 3;  2CC3 A;  2W56 B;  4MJD A;  4HAA A;  1M1X B;  5HGR A;  3G6E 3;  1Q82 4;  4O3V A;  1N5P A;  1UGI A;  3K63 A;  2FXT A;  3BNB A;  3FSD A;  5AEW B;  1AVL A;  1Y4K A;  2GSP A;  2KF6 A;  4KZ1 A;  3GZR A;  2HMN B;  4PEJ A;  1Q81 4;  1O7W B;  3CC4 3;  3DUK A;  7GSP A;  2A15 A;  1QAF A;  1NDO B;  1DET A;  1KWI A;  2FGT A;  3UNL A;  1X1X A;  1TFO A;  5AEU B;  2GEX A;  2WOF A;  4FCZ A;  3X40 A;  5IF6 A;  3BNE A;  1G02 A;  5ELJ A;  3UL6 A;  3NXJ A;  1IU7 A;  1YVB I;  3F9S A;  2GBX B;  1IT7 A;  3LTB A;  3K0Z A;  1IDP A;  3PYJ A;  1GMQ A;  1WNH A;  4RNY A;  3VF1 A;  2IUJ A;  4BTX A;  2XEP A;  1W7C A;  1A67 A;  3G8Z A;  3IPT A;  3NX0 A;  4ZM8 A;  1NU3 A;  4U13 A;  4HM6 B;  2CG1 A;  1WMP A;  4J9A A;  1I8V A;  4R80 A;  3VGN A;  3NBR A;  1BIR A;  1FUS A;  3BND A;  2MC8 A;  1M90 4;  1FGQ A;  1M1K 4;  3JVC A;  1KQS 2;  2BNG A;  1BSD A;  4FCJ A;  2LQV A;  2XH9 A;  1AR0 A;  3KII A;  1JV2 B;  4N6O B;  3SOY A;  2W04 A;  4L8P A;  5AIG A;  3WOF B;  4MMY B;  2F5W A;  1PFP A;  2RBI A;  3CCU 3;  2KRT A;  1JKG A;  3GRD A;  1Z1S A;  3CU3 A;  3NBJ A;  5KP3 A;  2HMO B;  2IMJ A;  1A2V A;  4H61 A;  3LTA A;  3CCE 3;  2XSO B;  5A0O B;  1K28 A;  5GSP A;  1N9J A; 
#chains in the Genus database with same CATH homology
 4AKZ A;  3X3Y A;  1AVK A;  1WTH A;  5IW9 A;  3MHE A;  3O8Y A;  1OHS A;  5IEO A;  3OWY A;  3TDG A;  3DY5 A;  2RGQ A;  2BHM A;  3DMC A;  2XR8 B;  3PGB A;  3L0R A;  1W2Z A;  1GYB A;  1C7H A;  1NB3 I;  3CC2 3;  1W5Z A;  4R9L A;  3LML A;  1DYU A;  1JRQ A;  4AKY A;  3GZB A;  1IQ8 A;  1JKG B;  3BLZ A;  3LT9 A;  4HM5 B;  3NV0 A;  2C10 A;  3JUQ A;  3G6E 3;  1KD1 4;  2O3O A;  3EQQ B;  5ELU A;  3S5C A;  1RN7 A;  1TIJ A;  3CNX A;  3FCS B;  3KSE D;  3WA2 X;  1VQP 3;  3HII A;  1ULI B;  5JPP A;  3F7S A;  4WWU C;  1U8C B;  1G96 A;  4N6V 0;  1N8Q A;  1W6G A;  4HZ9 B;  2GU3 A;  5AII A;  1IT8 A;  1SJW A;  1W6C A;  2CFW A;  1VQ7 3;  3LT8 A;  3V92 A;  2CG0 A;  3LTD A;  3MPH A;  4IIA A;  1VQN 3;  3D9R A;  5DRV A;  3T8N A;  3WOE B;  3NV0 B;  4MMZ B;  4N6N B;  4HZB B;  5CK6 A;  3F14 A;  4KFD A;  1SIH A;  1D6U A;  1VQ4 3;  3EBY A;  1K41 A;  2SBL A;  3X42 A;  2E2V A;  2OWP A;  3EC9 A;  3MKI A;  3MYT A;  1RRH A;  3KN4 A;  2GBW B;  5LC7 A;  2CHC A;  3N9H A;  1VQL 3;  3B4O A;  3EBT A;  4R4K A;  2GXF A;  3HX8 A;  5IEP A;  3CCQ 3;  4HM1 B;  3DM8 A;  1S5A A;  1UW1 A;  3N8B A;  1VQK 3;  3HI7 A;  1EA2 A;  1DMM A;  1D6Z A;  1Q40 A;  2CKF B;  1QAL A;  4FMB A;  3UJM A;  1NB5 I;  3NM7 A;  4K90 B;  4O02 B;  4Q53 A;  2JQ5 A;  1YIJ 3;  3G16 A;  2YFJ B;  2CIU A;  3SVA A;  2BMO B;  2WGQ A;  1N9E A;  4O2H A;  3V99 A;  2KCD A;  1YJ9 3;  3JUP A;  4G1M B;  3DXO A;  1IVW A;  1HKX A;  1YJN 3;  4AEQ A;  1O7P B;  1LXE A;  5IG4 A;  2Y74 A;  1IQY A;  2IA7 A;  1US1 A;  1OHO A;  3U97 A;  1V74 A;  3STD A;  4HVN A;  3SOA A;  3UL5 A;  1IVV A;  6STD A;  4HJL B;  1U5O A;  1IV9 A;  2RFR A;  3Q1C A;  3FGY A;  1E3V A;  3JUN A;  1Q40 B;  4N6M A;  5CLK A;  5BVB A;  1JN5 A;  3DGL A;  3JUO A;  3I56 3;  3FG4 A;  3CCJ 3;  3KFQ C;  2O9U X;  3EN1 B;  4HBR A;  5AI1 A;  1O7H B;  4X2H A;  2STD A;  4X2O A;  3K7C A;  3FLJ A;  1EKM A;  5I97 A;  3U1W A;  2QA4 3;  2K0M A;  2Z77 A;  2K54 A;  4EXR A;  2F86 B;  4FMD A;  3RGA A;  1J2B A;  1DMQ A;  3GWR A;  1FGM A;  1DMN A;  3PCS A;  3PXM A;  3NUV A;  2RSX A;  3OWU A;  4HYZ A;  3MG2 A;  4N3V A;  1QVF 2;  1JN5 B;  4EV2 A;  4RBN A;  1IK3 A;  5STD A;  1ZO2 A;  3WMD A;  2YFL B;  3CCV 3;  1OF5 A;  3CNM A;  1W6Y A;  5KP1 A;  3LH4 A;  2CFL A;  4XDV A;  4H3U A;  1NWW A;  3OX9 A;  4ORL A;  3CME 3;  4IT7 A;  2OQE C;  2RCD A;  2W0Q A;  4KFE A;  4LEH A;  4XBY A;  3DGO A;  1UI7 A;  3CCM 3;  1JJ2 2;  2YFI B;  5AIH A;  2W6J H;  2R4I A;  3ALA A;  1RKY A;  3NQY A;  4WP5 A;  1N5H A;  1WMN A;  3LXU X;  2QEX 3;  3OV4 A;  3NBB A;  5JBS A;  3JUM A;  3I0Y A;  4K1U A;  1BUQ A;  1OCV A;  3KKG A;  4LZI A;  1WMO A;  5AYS C;  4FR9 A;  5KP4 A;  5FW5 A;  4MMX B;  1M9G A;  5EQL A;  1JB2 A;  1VQM 3;  1OF5 B;  3X41 A;  4HM3 B;  2JDI H;  3F7X A;  1UUW B;  2CFK A;  5IG3 A;  3CPO A;  5D81 A;  3FZW A;  1DVC A;  4L8O A;  3B4P A;  3MG3 A;  2IUK A;  1GS3 A;  2OCT A;  2D42 A;  4GL6 A;  3S29 A;  5TGN A;  3GZY B;  1GY6 A;  2CFG A;  3FKA A;  5CF2 A;  2XFT A;  4HM0 B;  1Q7Y 4;  4OUQ A;  2BMR B;  3E99 A;  2INX A;  4CDL A;  1Q42 A;  1OHP A;  2W9P A;  5D82 A;  3K9M C;  1K8A 4;  1KSI A;  1RRL A;  3T8U A;  4N6U A;  1WQL B;  3CCL 3;  2V1L A;  2BMQ B;  3VSY A;  3X3X A;  4HM7 B;  2L4V A;  1NO3 A;  1OH0 A;  3KSP A;  1LOX A;  3LTC A;  1LNH A;  3IJE B;  3I55 3;  2CWV A;  4HM8 B;  2Y73 A;  5JPU A;  3WDG B;  1ASK A;  2ZL8 A;  1A90 A;  2W03 A;  4EYC A;  4JF8 A;  4KVH A;  4EBG A;  1TU5 A;  1OGX A;  1VQ8 3;  1UI8 A;  2F98 A;  3FF2 A;  1RJO A;  4HKV B;  4EV5 A;  5IG5 A;  1DVD A;  4MEI A;  4BTY A;  2MF7 A;  3H51 A;  5IG0 A;  2BT3 A;  3F8X A;  2PNC A;  3X3Z A;  5CXO A;  3ER7 A;  3GZX B;  3OW2 2;  1SPU A;  4HM2 B;  1YI2 3;  1ROA A;  2GEY A;  3EB8 A;  2ML5 A;  4I4K A;  2ZDJ A;  1VQO 3;  3G0K A;  3PS8 A;  2XF3 A;  2D1W A;  5AIF A;  1JB4 A;  1CQS A;  3A76 A;  1MOL A;  1TUH A;  3D3L A;  2E2T A;  2P05 A;  3H3H A;  5IEN A;  4LMI A;  2HMK B;  5CF1 A;  2CK3 H;  4FMC A;  2XFS A;  1OAC A;  1FGT A;  4XDW A;  3T0U A;  2GU1 A;  1STF I;  1JNQ A;  3CMA 3;  4K61 A;  1E97 A;  4WFO A;  3ECF A;  2M7O A;  3S28 A;  2FNQ A;  3FH1 A;  3PZW A;  1QJG A;  1HU9 A;  2QIY A;  3CCR 3;  2W2C A;  2CH9 A;  1CYV A;  2CWU A;  3PCR A;  4STD A;  1ROV A;  2XGL A;  1LVN A;  4LGQ A;  3K5T A;  2P09 A;  1TFK A;  3CC7 3;  2YX9 A;  1SQW A;  1IVX A;  1KC8 4;  1O7N B;  2XRX B;  3CCS 3;  3LZA A;  3S27 A;  3CPW 2;  3CD6 3;  2OOV A;  2ML6 A;  5IER A;  3SX1 A;  3FG1 A;  3B7C A;  5G2G A;  2CW9 A;  1YHQ 3;  3NM2 A;  4O8S A;  3F40 A;  3RGR A;  3N54 B;  1SII A;  4FCM A;  2Z6B A;  4OVM A;  4GB5 A;  3OWS A;  4CCV A;  3M8C A;  5D83 A;  1NJI 4;  1OUN A;  1EQK A;  1W02 A;  7STD A;  2XGN A;  2W9Q A;  1FGO A;  2OTL 3;  4BTW A;  3LYG A;  3MG1 A;  3WOD G;  1OGZ A;  3DGM A;  4OK0 A;  2QGU A;  4RNZ A;  2CFD A;  2F99 A;  3ROB A;  1ULJ B;  3EX9 A;  3SED A;  3FG3 A;  1GD4 A;  3G71 3;  3LOY A;  2PZV A;  1VQ5 3;  2HMM B;  2WGO A;  3MWZ A;  3V98 A;  5AYR B;  3KE7 A;  4N6T A;  3EE1 A;  1W00 A;  1T5Y A;  3RDE A;  1VQ6 3;  1GY7 A;  1IQX A;  1O7G B;  3QK9 A;  3AMO A;  4LSO A;  4XBX A;  3SLU A;  2P0M A;  1K9M 4;  2Q07 A;  3EF8 A;  3EJV A;  3HIG A;  3NHX A;  1N8R 4;  4RZM A;  3DGN A;  4J8T A;  2B1X B;  1EG9 B;  1ISK A;  4KFF A;  5EEO A;  1QAK A;  2WO0 A;  1W2B 2;  4NRE A;  3UB1 A;  3GAX A;  3HK4 A;  3QRD A;  3WA3 A;  4K1V A;  5BXQ A;  2CWT A;  8CHO A;  5DRE A;  2Z7A A;  1YGE A;  1AV4 A;  3Q2P A;  2KXG A;  1MNL A;  1UUV B;  4R1K A;  3DZL A;  5FGO A;  2HMJ B;  4JRF A;  4QWT A;  3G4S 3;  1YJW 3;  2P38 A;  1IVU A;  1E3R A;  1GY5 A;  4XM4 A;  3KZT A;  1Q86 4;  3AMO B;  3F8H A;  4XB5 A;  2LYX A;  3FF0 A;  1F8N A;  1W01 A;  5EVH A;  3HZP A;  2I9W A;  3MSO A;  1O7M B;  4IPB A;  1JB5 A;  1STD A;  1W4N A;  3OXA A;  4EC6 A;  1ZX2 A;  1QVG 2;  3CXC 2;  2XSH B;  2B24 B;  1S72 3;  2OOV C;  5LC6 A;  3S67 A;  3J7Y d;  1IV7 A;  3EN8 A;  1VQ9 3;  3EHC A;  2E2U A;  1CEW I;  4WYK A;  1R4C A;  3BNC A;  1FGR A;  2WOH A;  4NHF A;  3Q90 A;  1D6Y A;  1A2K A;  2Z76 A;  2W56 A;  4R9K A;  4TX4 A;  1CYU A;  1VZZ A;  3IMA B;  3BB9 A;  2OQE A;  1QMA A;  4FMA A;  2HML B;  3B8L A;  4N6L A;  1K73 4;  3SXX A;  1YIT 3;  4XBT A;  2C11 A;  1FA3 A;  1TP6 A;  3NQZ A;  1L5G B;  1FUW A;  1GD3 A;  2P0X A;  4WYK B;  2BO9 B;  1PU4 A;  2UX0 A;  4HM4 B;  4WHA A;  1OPY A;  2OTJ 3;  4L7K A;  2CC3 A;  2W56 B;  4MJD A;  5HGR A;  1M1X B;  1Q82 4;  4O3V A;  1N5P A;  3K63 A;  2FXT A;  3BNB A;  3FSD A;  5AEW B;  1AVL A;  1Y4K A;  4KZ1 A;  3GZR A;  2HMN B;  4PEJ A;  1Q81 4;  1O7W B;  3CC4 3;  3DUK A;  2A15 A;  1QAF A;  1NDO B;  1KWI A;  2FGT A;  3UNL A;  1TFO A;  5AEU B;  2GEX A;  2WOF A;  4FCZ A;  3X40 A;  5IF6 A;  3BNE A;  5ELJ A;  3UL6 A;  3NXJ A;  1IU7 A;  1YVB I;  3F9S A;  2GBX B;  1IT7 A;  3LTB A;  3K0Z A;  1IDP A;  3PYJ A;  1WNH A;  4RNY A;  3VF1 A;  4BTX A;  2IUJ A;  2XEP A;  1W7C A;  1A67 A;  3G8Z A;  3IPT A;  3NX0 A;  4ZM8 A;  1NU3 A;  4U13 A;  4HM6 B;  2CG1 A;  1WMP A;  4J9A A;  4R80 A;  3VGN A;  3NBR A;  3BND A;  2MC8 A;  1M90 4;  1FGQ A;  1M1K 4;  3JVC A;  1KQS 2;  2BNG A;  4FCJ A;  2LQV A;  2XH9 A;  1AR0 A;  3KII A;  1JV2 B;  4N6O B;  3SOY A;  2W04 A;  4L8P A;  5AIG A;  3WOF B;  4MMY B;  1PFP A;  3CCU 3;  2KRT A;  1JKG A;  3GRD A;  1Z1S A;  3CU3 A;  3NBJ A;  5KP3 A;  2HMO B;  2IMJ A;  1A2V A;  4H61 A;  3LTA A;  3CCE 3;  2XSO B;  5A0O B;  1K28 A;  1N9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...