2CKFB

Crystal structure of the terminal component of the pah-hydroxylating dioxygenase from sphingomonas sp chy-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
170
structure length
170
Chain Sequence
QVPVTPDVHYAVEAHYRAEVRLLQTGQYREWLHGMVAEDIHYWMPIYEQRFVRDRRPDPTPDDAAIYNDDFEELKQRVERLYSGQVWMEDPPSKIRYFVSNVEAFEAENGELDVLSNILVYRNRRQTEVTVHTLGREDKLRQDGNGFKVFRRKLILDARVTQDKNLYFFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RING-HYDROXYLATING DIOXYGENASE ALPHA SUBUNIT
publication title The Catalytic Pocket of the Ring-Hydroxylating Dioxygenase from Sphingomonas Chy-1.
pubmed doi rcsb
source organism Sphingomonas sp.
molecule tags Oxidoreductase
total genus 47
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ckfB00
2B1XB 1Q40A 4HM2B 4CDLA 1C7HA 5IERA 4J9AA 5HGRA 2GBXB 3JUMA 3OWSA 4X2HA 3DUKA 1EA2A 2HMNB 3M8CA 1AR0A 1O7WB 1SJWA 2B24B 1ZX2A 3KSPA 1ASKA 3F8XA 3MG2A 1QMAA 5BXQA 5D81A 3FZWA 1DMNA 4HM0B 4STDA 1TUHA 2CKFB 2XSOB 2F98A 5TGNA 3WMDA 3OXAA 5IF6A 5FW5A 3MYTA 5KP3A 3HX8A 3G8ZA 5JPUA 1UUVB 1OH0A 4J8TA 5IG5A 1JN5B 4WP5A 5IG0A 1O7MB 3STDA 4L8PA 2UX0A 1HKXA 2K54A 3B4PA 3MHEA 5JPPA 1OCVA 3FF2A 3UJMA 3BLZA 6STDA 1Q42A 3EBTA 3Q90A 1ULIB 2F99A 2I9WA 2BNGA 4ORLA 1NWWA 1QJGA 4U13A 3KKGA 5IENA 1OF5B 3OWYA 1ULJB 3CPOA 3DM8A 2QGUA 3JUNA 3UNLA 1NDOB 2HMOB 2YFLB 2RGQA 3OWUA 2BMOB 4HM3B 3FLJA 2GBWB 5AIIA 1TP6A 4OVMA 1ZO2A 1O7PB 1OGXA 1OUNA 2XR8B 4RZMA 5AEWB 2YFIB 5AIGA 1Q40B 3H3HA 3FH1A 4R9KA 1IDPA 2HMLB 1EG9B 3CNXA 1OPYA 2HMKB 3EX9A 4R1KA 5DREA 1VZZA 3GZBA 2STDA 1O7GB 3FGYA 3KE7A 3NM2A 1OHPA 4H3UA 1NU3A 4OUQA 1CQSA 2Z76A 4HM5B 4XDWA 1Z1SA 3FSDA 4L8OA 4FCJA 2OWPA 3K0ZA 2A15A 3LZAA 5CK6A 5AEUB 3JUOA 5KP1A 3IPTA 3KZTA 1JB5A 3NUVA 3NV0A 3G16A 5D82A 2YFJB 3MG1A 4WYKA 1O7NB 3T8UA 3LYGA 1DMMA 2HMJB 1GY6A 3DZLA 2GEYA 2Z77A 2HMMB 3DXOA 4N3VA 4L7KA 3EJVA 3B4OA 3OV4A 2PZVA 4K1UA 3I0YA 2IMJA 4XBXA 1K41A 3F40A 1ISKA 3F7XA 1OHSA 4HM6B 1JKGA 3GWRA 1O7HB 1BUQA 2GXFA 3JUPA 4R9LA 1W6YA 3E99A 3F7SA 3NXJA 3OX9A 5EVHA 3CNMA 2INXA 4PEJA 4HKVB 4GB5A 5KP4A 3D9RA 3NHXA 4HM4B 2W2CA 1E3VA 2JQ5A 3A76A 4LMIA 5CLKA 1S5AA 2CHCA 2XSHB 1UUWB 3BB9A 8CHOA 3S5CA 3SOAA 3EHCA 3MG3A 3T8NA 5AI1A 1JB2A 4WWUC 4HM8B 4LEHA 3NV0B 1W01A 5IEPA 1W00A 3F8HA 2RCDA 4WYKB 4HZBB 3ER7A 4XBTA 1STDA 5G2GA 1JB4A 3RGRA 3FF0A 4HVNA 4KVHA 1GYBA 3EN8A 4XDVA 3F9SA 3HK4A 2F86B 2R4IA 1U5OA 2Z7AA 1A2KA 5AIFA 4HM7B 3G0KA 4IIAA 3VSYA 1JKGB 3FKAA 2BMQB 1GY5A 4MJDA 5D83A 1E3RA 5STDA 1OGZA 3RGAA 5AIHA 3EQQB 2BMRB 3GZRA 3MSOA 3F14A 2XRXB 4XM4A 1GY7A 4X2OA 1W02A 3EN1B 3HZPA 3EC9A 1JN5A 5CF2A 5DRVA 5CF1A 3ROBA 1OHOA 3EF8A 2QIYA 4FCMA 3K7CA 4K1VA 2GEXA 4HZ9B 3SEDA 4HJLB 1WQLB 4XBYA 3MKIA 5IG4A 1OF5A 1GS3A 3NBRA 5IEOA 1E97A 3GZXB 3H51A 1DMQA 4HM1B 4Q53A 5CXOA 4XB5A 5BVBA 3CU3A 3GZYB 3VGNA 7STDA 3DMCA 4I4KA 3EBYA 3GRDA 4LGQA 2RFRA 5IG3A 3JUQA 3B8LA 3ECFA 3SOYA 3B7CA
chains in the Genus database with same CATH superfamily
1RN4A 2B1XB 3ZG5A 1Q40A 4HM2B 3DY5A 4CDLA 3X40A 1C7HA 5IERA 4J9AA 5HGRA 3G4S3 1CEWI 2GBXB 3JUMA 3OWSA 4X2HA 3BNCA 1WMOA 3DUKA 2OQEA 1EA2A 7GSPA 2GU1A 1YIJ3 2HMNB 2ML5A 2CWTA 1RSNA 2QA43 1RNTA 3M8CA 1AR0A 3TDGA 4EC6A 1B2MA 1I2EA 1O7WB 3NM7A 2P0MA 1WMPA 2L4VA 1SJWA 3CMA3 2B24B 1HZ1A 1ZX2A 4EV5A 3CCS3 1RGLA 4KT3B 3KSPA 1ASKA 3NBBA 3EE1A 7RNTA 1I0XA 3N54B 3NQYA 3D4AA 3F8XA 3MG2A 3X3YA 4AKZA 1NNVA 1QMAA 4KZ1A 5BXQA 5D81A 3FZWA 2SBLA 2IUKA 1JBRA 2K3DA 4FMDA 3RNTA 1AV4A 3PZWA 2W9QA 1UW1A 5G1KA 3WODG 1RLSA 2OTJ3 1NB3I 1DMNA 1MWTA 1BRHA 1GMPA 5M1AA 1U8CB 2XEPA 4HM0B 3N8BA 1EKMA 4STDA 1HYFA 1TUHA 2CKFB 1RGKA 4ILFA 1FYSA 2XSOB 3PS8A 4JF8A 2F98A 4O02B 3A5EA 1PY3A 5TGNA 2KRTA 3WMDA 3MPHA 2CG1A 2FNQA 4FCZA 3DGLA 3OXAA 5IF6A 1RKYA 1GOVA 4LSOA 5FW5A 1UGIA 1UGHI 3UL6A 1N5HA 3SLUA 3X42A 2PNCA 3KCHA 1FGOA 5BU4A 1AVLA 3MYTA 1KQS2 1N5PA 2F5WA 5KP3A 3HX8A 2ML6A 3G8ZA 1K8A4 4HBRA 5JPUA 3BNEA 1T3BA 1OH0A 1UUVB 2L1SA 4N6LA 2ZDJA 4N6NB 4J8TA 2HOHA 4BU4A 3URPA 5IG5A 3WOFB 1FGRA 2OOVC 1BNGA 5EEOA 1JN5B 1VQL3 4WP5A 5IG0A 4TX4A 2CFDA 1O7MB 3STDA 3I563 1BRKA 1FGMA 4L8PA 2UX0A 3CC23 4LYLB 4N6OB 1HKXA 1TFOA 2K54A 3B4PA 3MHEA 2D1WA 5JPPA 1B2UA 1OCVA 2ZA4A 3FF2A 2KF5A 3UJMA 1D6YA 2V1LA 1IVVA 3BLZA 6STDA 1Q42A 2KF4A 3EBTA 2OTL3 2MF7A 3Q90A 3CCR3 1BUJA 1ULIB 3AHSA 2P38A 1BOXA 3WA2X 4FMBA 3CCV3 2FXTA 2F99A 1L5GB 2I9WA 2BNGA 1RCKA 2OCTA 1NWWA 4ORLA 1QJGA 3HIIA 2M7OA 3LT9A 1BANA 3KKGA 4U13A 5IENA 1OF5B 2XGLA 3OWYA 4CPKA 2BU4A 1RGGA 1ULJB 1VQP3 4HOHA 1IVUA 3D5GA 1F8NA 3CPOA 3DM8A 2QGUA 1RDSA 2C11A 3JUNA 1EQKA 3UNLA 1X1XA 4BTWA 5JBSA 1NDOB 2HMOB 2YFLB 1WTHA 2RGQA 1N8R4 2BHMA 1GMRA 3LH4A 2XFTA 3WA3A 3OWUA 2BMOB 4O3VA 1BNRA 3BU4A 4HM3B 1LXEA 1DVDA 3FLJA 1W6CA 2GBWB 1JJ22 2W0QA 4NPBA 5AIIA 1AVKA 1NJI4 1TP6A 1W7CA 2Y74A 4OVMA 1STFI 1ZO2A 1VQM3 1PFPA 2BIRA 3WDGB 1O7PB 1OGXA 1OUNA 2XR8B 2C4BA 1KD14 4GL6A 4RZMA 4MMYB 5AEWB 2YFIB 1N8QA 1UCLA 4N6TA 3LOYA 5AIGA 1Q40B 1VQO3 1KC84 3H3HA 3HIGA 2CW9A 1VQ83 1JBSA 4BIRA 3FH1A 2W9PA 4R9KA 1YJN3 1IDPA 2H0IA 2HMLB 4N6MA 1G02A 1IQXA 3DGNA 3JVCA 3U97A 1IVXA 3AGOA 3V98A 1EG9B 2IUJA 1DYUA 1W6GA 4BTYA 3CNXA 2GSPA 1SIIA 1OPYA 3T0UA 2HMKB 2KF3A 1M9GA 1RRHA 1VQQA 2J8XB 3EX9A 3ALAA 4R1KA 5DREA 2H0GA 4G1MB 1VZZA 3I553 3GZBA 2STDA 1O7GB 3FGYA 2OOVA 3KE7A 1G96A 3NM2A 3IJEB 2CX0A 1OHPA 4H3UA 1IT8A 1NU3A 1CQSA 2Z76A 4HM5B 1UUGB 2F5MA 4OUQA 4XDWA 2D42A 1Z1SA 1V58A 3SVAA 4GSPA 1B27A 2CX1A 2FGTA 2KF6A 1Y4KA 3BNDA 3FSDA 2XGNA 1JBTA 4L8OA 1GOUA 1MWSA 5ELUA 4BL2A 1TU5A 1R4CA 4FCJA 1LNHA 5BIRA 1MGRA 2OWPA 4R4KA 3K0ZA 2A15A 4CJNA 3CC73 3NBJA 3LZAA 5CK6A 1N9EA 5AEUB 2O3OA 1SQWA 3JUOA 3D5IA 1JZDA 3IPTA 3AGNA 5KP1A 3KZTA 1JB5A 3NUVA 1RRLA 3NV0A 4JRFA 3MWZA 4N6V0 3G16A 3K63A 3PCRA 1IU7A 1I70A 1BSDA 1LQGC 2KCDA 5D82A 1A2PA 1BRSA 1BVIA 2YFJB 3MG1A 1V57A 1RJOA 2E2VA 2RBIA 1EUIC 4J5GA 4WYKA 1IK3A 3X41A 1SPUA 1O7NB 1RN7A 3T8UA 3CCM3 2P05A 1DMMA 1W4NA 3LYGA 3CPW2 5M19A 4LZIA 3S27A 1MOLA 1X1WA 2IY2A 2WGOA 3CCU3 2HMJB 1QAFA 3UL5A 1UI8A 1MWRA 1G0TA 1GY6A 1B2XA 3DZLA 2CWVA 2GEYA 2Z77A 2HMMB 1CYVA 3Q2PA 1A67A 3X3ZA 3DXOA 3G6E3 4N3VA 1FGTA 4RNTA 3CCJ3 4L7KA 3LT8A 3KN4A 3LTAA 3EJVA 1B20A 1ROVA 3B4OA 3OV4A 1VQ53 2PZVA 4K1UA 3V99A 3I0YA 1RN1A 1Q7HA 2E2TA 8RNTA 5EQLA 2IMJA 3DGOA 4XBXA 4EBGA 1CYUA 1K41A 2MC8A 3F40A 4HAAA 4EYCA 5RNTA 1I0VA 1GSPA 2CK3H 1YI23 1ISKA 5AYRB 2F56A 3PXMA 3HI7A 3F7XA 4O2HA 2C10A 2SARA 1OHSA 2RNTA 4HM6B 2KAAA 1JKGA 1HU9A 1A90A 4IPBA 3GWRA 1O7HB 3O8YA 1BUQA 2GXFA 3JUPA 2E2UA 2F4YA 1W6YA 4R9LA 1BNJA 1NB5I 3E99A 4O8SA 3PYJA 1UCIA 3F7SA 3NXJA 3OX9A 2UGIA 3QK9A 5EVHA 1TIJA 2W04A 2W03A 1JZOA 3K9MC 4WFOA 4J5KA 1SARA 1B3SA 2CFKA 3CNMA 4K61A 1OACA 2INXA 4PEJA 4HKVB 2JDIH 3PCSA 3J7Yd 2IA7A 4GB5A 4RNZA 5KP4A 1SIHA 3D9RA 1N9JA 3NHXA 3SYUA 3HOHA 4HM4B 2W2CA 3DH2A 1X1UA 1E3VA 2JQ5A 3A76A 4LMIA 5CLKA 1Q864 4CCVA 1B2SA 3KSED 1MWUA 2CFGA 2CIUA 3IMAB 4IT7A 4FR9A 2CWUA 3OW22 1MGWA 4FMAA 4BL3A 1S5AA 1T2HA 2CHCA 1D6ZA 1IV7A 1I2GA 2CFWA 2XSHB 1UUWB 1RNBA 5I97A 1UDII 2GU3A 1VQ63 3BB9A 3CC43 3WOEB 1IT7A 1IVWA 4H61A 3LMLA 1YVBI 8CHOA 3WHOA 3AMOA 3D3LA 1I3IA 2WGQA 2Y73A 3S5CA 1WMNA 1B2ZA 3SOAA 2ZHXB 3CME3 4NHFA 3EB8A 2P0XA 1VQ93 1RCLA 3LTDA 1US1A 4AKYA 1YHQ3 1FA3A 3LTCA 1RMSA 4RNYA 3FG4A 1RGHA 1RGCA 3EHCA 1ROAA 2KXGA 3MG3A 2WOFA 3T8NA 4R80A 1A2VA 1B21A 1UI7A 5AI1A 1LOXA 1BNEA 1FW7A 1BRJA 1JB2A 4OK0A 5A0OB 4WWUC 1BNFA 2W56A 1J2BA 1VQ43 2R41A 4HM8B 4LEHA 1MNLA 3NV0B 3RDEA 2WO0A 1W01A 1WNHA 4HYZA 5IEPA 1W00A 3GAXA 1LRAA 1QVG2 1YGEA 1QAKA 3F8HA 1I3FA 2CC3A 2W6JH 2YX9A 2RCDA 3ZFZA 4WYKB 3KFQC 4HZBB 1YVSA 3ER7A 4XBTA 1STDA 3WR2A 1LQMB 3Q3FA 3BNBA 1BNSA 1D6UA 2BO9B 5FGOA 5G2GA 4ZM8A 4QWTA 1JB4A 4GHOA 3G713 1JRQA 3RGRA 1W2B2 3FF0A 4EV2A 4HVNA 2AAEA 1W2ZA 1UCKA 2P09A 1M1K4 1S723 4KVHA 1FGQA 1GYBA 1VQK3 3FG1A 3EN8A 1BSAA 3CCE3 4MMZB 4XDVA 2BT3A 2RSXA 1BGSA 3F9SA 1W5ZA 1ZGXA 3HK4A 1IQ8A 1CH0A 1I8VA 3CCL3 2F86B 1AQZA 3S67A 1V74A 2R4IA 1RGEA 3K5TA 1RGFA 1LNIA 1U5OA 2Z7AA 3FG3A 1A2KA 4BTXA 3X3XA 1KSIA 2IYJA 2LQVA 4HM7B 3G0KA 4KFDA 5AIFA 2K0MA 1QVF2 1GD4A 4IIAA 3KIIA 3SXXA 3DGMA 5GSPA 3VSYA 5AYSC 5M18A 1YGWA 1Q7Y4 1LOVA 1TTOA 1R4YA 1JKGB 1BRIA 2QEX3 1FUWA 3FKAA 2BMQB 1GY5A 4MJDA 1BAOA 5D83A 1E3RA 1K734 2WOHA 3CD63 2CH9A 5STDA 1FUTA 1M904 1GD3A 1OGZA 3RGAA 5AIHA 1PU4A 1IYYA 3EQQB 2BMRB 3BIRA 9RNTA 3GZRA 2OQEC 1LOYA 3MSOA 1X1YA 2Q07A 3F14A 3NQZA 4I5QA 3S28A 3V92A 4AEQA 3CXC2 2XRXB 4XM4A 1GY7A 3VF1A 3PGBA 1IQYA 4X2OA 1JNQA 1RTUA 3Q1CA 3CCQ3 1W02A 3EN1B 3U1WA 6GSPA 5HOHA 3HZPA 1DE3A 3ZG0A 2UUGC 3EC9A 3NX0A 1VQN3 1JN5A 1BIRA 3UB1A 5CF2A 5ELJA 5DRVA 1YIT3 4DKIA 1UCJA 5IW9A 3DGYA 5CF1A 3ROBA 1OHOA 3EF8A 2QIYA 2CG0A 2XH9A 1PYLA 3QRDA 4FCMA 5G1LA 1DVCA 1BSEA 4NREA 4KFFA 4RBNA 1QALA 1LOWA 3S29A 3K7CA 3AMOB 4K1VA 2GEXA 4K90B 1BRGA 1EEJA 4N6UA 2AADA 4HZ9B 1NO3A 3SEDA 4HJLB 1I2FA 3LXUX 1FUSA 1VQ73 3B7CA 1KWIA 1BSBA 3D79A 1BU4A 1TFKA 1FZUA 1TRPA 1WQLB 2CFLA 4XBYA 1BRNL 1RHLA 1BSCA 1M1XB 1OF5A 3MKIA 5IG4A 1GS3A 2ZL8A 1GOYA 1K28A 3NBRA 5IEOA 4MMXB 2Z6BA 3GSPA 1YJW3 2XFSA 1E97A 2LYXA 4FMCA 3GZXB 3AHWA 3H51A 1JV2B 1GMQA 1DMQA 4HM1B 4Q53A 5LC7A 4XB5A 5CXOA 1Q814 1C54A 5BVBA 3CU3A 2W56B 3GZYB 3VGNA 1BNIA 3SX1A 1RGAA 4EW5A 1YNVX 1AY7A 7STDA 1Q824 1TRQA 3DMCA 1TJDA 1IV9A 4KFEA 4WHAA 2H0HA 4I4KA 3EBYA 3GRDA 1T5YA 4LGQA 3FCSB 4EXRA 6RNTA 1DETA 2RFRA 3L0RA 1YJ93 5LC6A 2O9UX 5IG3A 3JUQA 3LTBA 1LVNA 4MEIA 3B8LA 3ECFA 1ZS7A 3SOYA 2XF3A 1K9M4 1Q9EA 3N9HA 1T2IA
chains in the Genus database with same CATH topology
2B1XB 1Q40A 4HM2B 3DY5A 4CDLA 3X40A 1C7HA 5IERA 4J9AA 5HGRA 3G4S3 1CEWI 2GBXB 3JUMA 3OWSA 4X2HA 3BNCA 1WMOA 3DUKA 2OQEA 1EA2A 1YIJ3 2GU1A 2HMNB 2ML5A 2CWTA 2QA43 3M8CA 4EC6A 1AR0A 3TDGA 1O7WB 3NM7A 2P0MA 1WMPA 2L4VA 1SJWA 3CMA3 2B24B 1ZX2A 4EV5A 3CCS3 3KSPA 1ASKA 3NBBA 3EE1A 3N54B 3NQYA 3F8XA 3MG2A 3X3YA 4AKZA 1QMAA 4KZ1A 5BXQA 5D81A 3FZWA 2SBLA 2IUKA 4FMDA 1AV4A 3PZWA 2W9QA 1UW1A 3WODG 2OTJ3 1NB3I 1DMNA 1U8CB 2XEPA 4HM0B 3N8BA 1EKMA 4STDA 1TUHA 2CKFB 2XSOB 3PS8A 4JF8A 2F98A 4O02B 5TGNA 2KRTA 3WMDA 3MPHA 2CG1A 2FNQA 4FCZA 3DGLA 3OXAA 5IF6A 1RKYA 4LSOA 5FW5A 3UL6A 1N5HA 3SLUA 3X42A 2PNCA 1FGOA 1AVLA 3MYTA 1KQS2 1N5PA 5KP3A 3HX8A 2ML6A 3G8ZA 1K8A4 4HBRA 5JPUA 3BNEA 1UUVB 1OH0A 4N6LA 4N6NB 2ZDJA 4J8TA 5IG5A 3WOFB 1FGRA 2OOVC 5EEOA 1JN5B 1VQL3 4WP5A 5IG0A 4TX4A 2CFDA 1O7MB 3STDA 3I563 1FGMA 4L8PA 2UX0A 3CC23 4N6OB 1HKXA 1TFOA 2K54A 3B4PA 3MHEA 2D1WA 5JPPA 1OCVA 3FF2A 3UJMA 1D6YA 2V1LA 1IVVA 3BLZA 6STDA 1Q42A 3EBTA 2OTL3 2MF7A 3Q90A 3CCR3 1ULIB 2P38A 3WA2X 4FMBA 3CCV3 2FXTA 2F99A 1L5GB 2I9WA 2BNGA 2OCTA 4ORLA 1NWWA 1QJGA 3HIIA 2M7OA 3LT9A 4U13A 3KKGA 5IENA 1OF5B 2XGLA 3OWYA 1ULJB 1VQP3 1IVUA 1F8NA 3CPOA 3DM8A 2QGUA 2C11A 3JUNA 1EQKA 3UNLA 4BTWA 5JBSA 1NDOB 2HMOB 2YFLB 1WTHA 2RGQA 1N8R4 2BHMA 3LH4A 2XFTA 3WA3A 3OWUA 2BMOB 4O3VA 4HM3B 1LXEA 1DVDA 3FLJA 1W6CA 2GBWB 1JJ22 2W0QA 5AIIA 1AVKA 1TP6A 1W7CA 2Y74A 4OVMA 1STFI 1ZO2A 1VQM3 1PFPA 3WDGB 1O7PB 1OGXA 1OUNA 2XR8B 1KD14 4GL6A 4RZMA 4MMYB 5AEWB 2YFIB 1N8QA 4N6TA 3LOYA 5AIGA 1Q40B 1VQO3 1KC84 3H3HA 3HIGA 2CW9A 1VQ83 3FH1A 2W9PA 4R9KA 1YJN3 1IDPA 2HMLB 4N6MA 1IQXA 3DGNA 3JVCA 3U97A 1IVXA 3V98A 1EG9B 2IUJA 1DYUA 1W6GA 4BTYA 3CNXA 1SIIA 1OPYA 3T0UA 2HMKB 1M9GA 1RRHA 3EX9A 3ALAA 4R1KA 5DREA 4G1MB 1VZZA 3I553 3GZBA 2STDA 1O7GB 3FGYA 2OOVA 3KE7A 1G96A 3NM2A 3IJEB 1OHPA 4H3UA 1IT8A 1NU3A 1CQSA 2Z76A 4HM5B 4OUQA 4XDWA 2D42A 1Z1SA 3SVAA 2FGTA 1Y4KA 3BNDA 3FSDA 2XGNA 4L8OA 5ELUA 1TU5A 1R4CA 4FCJA 1LNHA 4R4KA 2OWPA 3K0ZA 2A15A 3CC73 3NBJA 3LZAA 5CK6A 1N9EA 5AEUB 2O3OA 1SQWA 3JUOA 5KP1A 3IPTA 3KZTA 1JB5A 3NUVA 1RRLA 3NV0A 4JRFA 3MWZA 4N6V0 3G16A 3K63A 3PCRA 1IU7A 5D82A 2KCDA 2YFJB 3MG1A 1RJOA 2E2VA 4WYKA 1IK3A 3X41A 1SPUA 1O7NB 1RN7A 3T8UA 3CCM3 2P05A 1DMMA 1W4NA 3LYGA 3CPW2 4LZIA 3S27A 1MOLA 2WGOA 3CCU3 2HMJB 1QAFA 3UL5A 1UI8A 1GY6A 3DZLA 2CWVA 2GEYA 2Z77A 2HMMB 1CYVA 3Q2PA 1A67A 3X3ZA 3DXOA 3G6E3 4N3VA 1FGTA 3CCJ3 4L7KA 3LT8A 3KN4A 3LTAA 3EJVA 1ROVA 3B4OA 3OV4A 1VQ53 2PZVA 4K1UA 3V99A 3I0YA 2E2TA 5EQLA 2IMJA 3DGOA 4XBXA 4EBGA 1CYUA 1K41A 2MC8A 3F40A 4EYCA 2CK3H 1YI23 1ISKA 5AYRB 3PXMA 3HI7A 3F7XA 4O2HA 2C10A 1OHSA 4HM6B 1JKGA 1HU9A 1A90A 4IPBA 3GWRA 1O7HB 3O8YA 1BUQA 2GXFA 3JUPA 2E2UA 4R9LA 1W6YA 1NB5I 3E99A 4O8SA 3PYJA 3F7SA 3NXJA 3OX9A 3QK9A 5EVHA 1TIJA 2W04A 2W03A 3K9MC 4WFOA 2CFKA 3CNMA 4K61A 1OACA 2INXA 4PEJA 4HKVB 2JDIH 3PCSA 3J7Yd 2IA7A 4GB5A 4RNZA 5KP4A 1SIHA 3D9RA 1N9JA 3NHXA 4HM4B 2W2CA 1E3VA 2JQ5A 3A76A 4LMIA 5CLKA 1Q864 4CCVA 3KSED 2CFGA 3IMAB 2CIUA 4IT7A 4FR9A 2CWUA 3OW22 4FMAA 1S5AA 2CHCA 1D6ZA 1IV7A 2CFWA 2XSHB 1UUWB 5I97A 2GU3A 1VQ63 3BB9A 3CC43 3WOEB 1IT7A 1IVWA 4H61A 3LMLA 1YVBI 8CHOA 3AMOA 3D3LA 2WGQA 2Y73A 3S5CA 1WMNA 3SOAA 3CME3 4NHFA 3EB8A 2P0XA 1VQ93 3LTDA 1US1A 4AKYA 1YHQ3 1FA3A 3LTCA 4RNYA 3FG4A 3EHCA 1ROAA 2KXGA 3MG3A 2WOFA 3T8NA 4R80A 1A2VA 1UI7A 5AI1A 1LOXA 1JB2A 4OK0A 5A0OB 4WWUC 2W56A 1J2BA 1VQ43 4HM8B 4LEHA 1MNLA 3NV0B 3RDEA 2WO0A 1W01A 1WNHA 4HYZA 5IEPA 1W00A 3GAXA 1QVG2 1YGEA 1QAKA 3F8HA 2CC3A 2W6JH 2YX9A 2RCDA 4WYKB 3KFQC 4HZBB 3ER7A 4XBTA 1STDA 3BNBA 2BO9B 1D6UA 5FGOA 5G2GA 4ZM8A 4QWTA 1JB4A 3G713 1JRQA 3RGRA 1W2B2 3FF0A 4EV2A 4HVNA 1W2ZA 2P09A 1M1K4 1S723 4KVHA 1FGQA 1GYBA 1VQK3 3FG1A 3EN8A 3CCE3 4MMZB 4XDVA 2BT3A 2RSXA 3F9SA 1W5ZA 3HK4A 3CCL3 1IQ8A 2F86B 3S67A 1V74A 2R4IA 3K5TA 1U5OA 2Z7AA 3FG3A 1A2KA 4BTXA 3X3XA 1KSIA 4KFDA 2LQVA 4HM7B 3G0KA 5AIFA 2K0MA 1QVF2 1GD4A 4IIAA 3KIIA 3SXXA 3DGMA 3VSYA 5AYSC 1Q7Y4 1JKGB 2QEX3 1FUWA 3FKAA 2BMQB 1GY5A 4MJDA 5D83A 1E3RA 1K734 2WOHA 3CD63 2CH9A 5STDA 1M904 1GD3A 1OGZA 3RGAA 5AIHA 1PU4A 3EQQB 2BMRB 3GZRA 2OQEC 4AEQA 3MSOA 3S28A 2Q07A 3F14A 3NQZA 1NJI4 3CXC2 3V92A 2XRXB 4XM4A 1GY7A 3VF1A 3PGBA 1IQYA 4X2OA 1JNQA 3Q1CA 3CCQ3 1W02A 3EN1B 3U1WA 3HZPA 3EC9A 3NX0A 1VQN3 1JN5A 3UB1A 5CF2A 5ELJA 5DRVA 1YIT3 5IW9A 5CF1A 3ROBA 1OHOA 3EF8A 2QIYA 2CG0A 2XH9A 3QRDA 4FCMA 1DVCA 4NREA 4KFFA 4RBNA 1QALA 3S29A 3K7CA 3AMOB 4K1VA 2GEXA 4K90B 4N6UA 4HZ9B 1NO3A 3SEDA 4HJLB 3LXUX 1VQ73 1KWIA 1TFKA 1WQLB 2CFLA 4XBYA 3MKIA 1M1XB 1OF5A 5IG4A 1GS3A 2ZL8A 1K28A 3NBRA 5IEOA 4MMXB 2Z6BA 1YJW3 2XFSA 1E97A 2LYXA 4FMCA 3GZXB 3H51A 1JV2B 1DMQA 4HM1B 4Q53A 5LC7A 4XB5A 5CXOA 1Q814 5BVBA 3CU3A 2W56B 3GZYB 3VGNA 3SX1A 7STDA 1Q824 3DMCA 1IV9A 4KFEA 4WHAA 4I4KA 3EBYA 3GRDA 1T5YA 4LGQA 3FCSB 4EXRA 2RFRA 3L0RA 1YJ93 5LC6A 2O9UX 5IG3A 3JUQA 3LTBA 1LVNA 4MEIA 3B8LA 3ECFA 3SOYA 2XF3A 1K9M4 3B7CA 3N9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1X B;  1Q40 A;  4HM2 B;  4CDL A;  1C7H A;  5IER A;  4J9A A;  5HGR A;  2GBX B;  3JUM A;  3OWS A;  4X2H A;  3DUK A;  1EA2 A;  2HMN B;  3M8C A;  1AR0 A;  1O7W B;  1SJW A;  2B24 B;  1ZX2 A;  3KSP A;  1ASK A;  3F8X A;  3MG2 A;  1QMA A;  5BXQ A;  5D81 A;  3FZW A;  1DMN A;  4HM0 B;  4STD A;  1TUH A;  2CKF B;  2XSO B;  2F98 A;  5TGN A;  3WMD A;  3OXA A;  5IF6 A;  5FW5 A;  3MYT A;  5KP3 A;  3HX8 A;  3G8Z A;  5JPU A;  1UUV B;  1OH0 A;  4J8T A;  5IG5 A;  1JN5 B;  4WP5 A;  5IG0 A;  1O7M B;  3STD A;  4L8P A;  2UX0 A;  1HKX A;  2K54 A;  3B4P A;  3MHE A;  5JPP A;  1OCV A;  3FF2 A;  3UJM A;  3BLZ A;  6STD A;  1Q42 A;  3EBT A;  3Q90 A;  1ULI B;  2F99 A;  2I9W A;  2BNG A;  4ORL A;  1NWW A;  1QJG A;  4U13 A;  3KKG A;  5IEN A;  1OF5 B;  3OWY A;  1ULJ B;  3CPO A;  3DM8 A;  2QGU A;  3JUN A;  3UNL A;  1NDO B;  2HMO B;  2YFL B;  2RGQ A;  3OWU A;  2BMO B;  4HM3 B;  3FLJ A;  2GBW B;  5AII A;  1TP6 A;  4OVM A;  1ZO2 A;  1O7P B;  1OGX A;  1OUN A;  2XR8 B;  4RZM A;  5AEW B;  2YFI B;  5AIG A;  1Q40 B;  3H3H A;  3FH1 A;  4R9K A;  1IDP A;  2HML B;  1EG9 B;  3CNX A;  1OPY A;  2HMK B;  3EX9 A;  4R1K A;  5DRE A;  1VZZ A;  3GZB A;  2STD A;  1O7G B;  3FGY A;  3KE7 A;  3NM2 A;  1OHP A;  4H3U A;  1NU3 A;  4OUQ A;  1CQS A;  2Z76 A;  4HM5 B;  4XDW A;  1Z1S A;  3FSD A;  4L8O A;  4FCJ A;  2OWP A;  3K0Z A;  2A15 A;  3LZA A;  5CK6 A;  5AEU B;  3JUO A;  5KP1 A;  3IPT A;  3KZT A;  1JB5 A;  3NUV A;  3NV0 A;  3G16 A;  5D82 A;  2YFJ B;  3MG1 A;  4WYK A;  1O7N B;  3T8U A;  3LYG A;  1DMM A;  2HMJ B;  1GY6 A;  3DZL A;  2GEY A;  2Z77 A;  2HMM B;  3DXO A;  4N3V A;  4L7K A;  3EJV A;  3B4O A;  3OV4 A;  2PZV A;  4K1U A;  3I0Y A;  2IMJ A;  4XBX A;  1K41 A;  3F40 A;  1ISK A;  3F7X A;  1OHS A;  4HM6 B;  1JKG A;  3GWR A;  1O7H B;  1BUQ A;  2GXF A;  3JUP A;  4R9L A;  1W6Y A;  3E99 A;  3F7S A;  3NXJ A;  3OX9 A;  5EVH A;  3CNM A;  2INX A;  4PEJ A;  4HKV B;  4GB5 A;  5KP4 A;  3D9R A;  3NHX A;  4HM4 B;  2W2C A;  1E3V A;  2JQ5 A;  3A76 A;  4LMI A;  5CLK A;  1S5A A;  2CHC A;  2XSH B;  1UUW B;  3BB9 A;  8CHO A;  3S5C A;  3SOA A;  3EHC A;  3MG3 A;  3T8N A;  5AI1 A;  1JB2 A;  4WWU C;  4HM8 B;  4LEH A;  3NV0 B;  1W01 A;  5IEP A;  1W00 A;  3F8H A;  2RCD A;  4WYK B;  4HZB B;  3ER7 A;  4XBT A;  1STD A;  5G2G A;  1JB4 A;  3RGR A;  3FF0 A;  4HVN A;  4KVH A;  1GYB A;  3EN8 A;  4XDV A;  3F9S A;  3HK4 A;  2F86 B;  2R4I A;  1U5O A;  2Z7A A;  1A2K A;  5AIF A;  4HM7 B;  3G0K A;  4IIA A;  3VSY A;  1JKG B;  3FKA A;  2BMQ B;  1GY5 A;  4MJD A;  5D83 A;  1E3R A;  5STD A;  1OGZ A;  3RGA A;  5AIH A;  3EQQ B;  2BMR B;  3GZR A;  3MSO A;  3F14 A;  2XRX B;  4XM4 A;  1GY7 A;  4X2O A;  1W02 A;  3EN1 B;  3HZP A;  3EC9 A;  1JN5 A;  5CF2 A;  5DRV A;  5CF1 A;  3ROB A;  1OHO A;  3EF8 A;  2QIY A;  4FCM A;  3K7C A;  4K1V A;  2GEX A;  4HZ9 B;  3SED A;  4HJL B;  1WQL B;  4XBY A;  3MKI A;  5IG4 A;  1OF5 A;  1GS3 A;  3NBR A;  5IEO A;  1E97 A;  3GZX B;  3H51 A;  1DMQ A;  4HM1 B;  4Q53 A;  5CXO A;  4XB5 A;  5BVB A;  3CU3 A;  3GZY B;  3VGN A;  7STD A;  3DMC A;  4I4K A;  3EBY A;  3GRD A;  4LGQ A;  2RFR A;  5IG3 A;  3JUQ A;  3B8L A;  3ECF A;  3SOY A;  3B7C A; 
#chains in the Genus database with same CATH topology
 1RN4 A;  2B1X B;  3ZG5 A;  1Q40 A;  4HM2 B;  3DY5 A;  4CDL A;  3X40 A;  1C7H A;  5IER A;  4J9A A;  5HGR A;  3G4S 3;  1CEW I;  2GBX B;  3JUM A;  3OWS A;  4X2H A;  3BNC A;  1WMO A;  3DUK A;  2OQE A;  1EA2 A;  7GSP A;  2GU1 A;  1YIJ 3;  2HMN B;  2ML5 A;  2CWT A;  1RSN A;  2QA4 3;  1RNT A;  3M8C A;  1AR0 A;  3TDG A;  4EC6 A;  1B2M A;  1I2E A;  1O7W B;  3NM7 A;  2P0M A;  1WMP A;  2L4V A;  1SJW A;  3CMA 3;  2B24 B;  1HZ1 A;  1ZX2 A;  4EV5 A;  3CCS 3;  1RGL A;  4KT3 B;  3KSP A;  1ASK A;  3NBB A;  3EE1 A;  7RNT A;  1I0X A;  3N54 B;  3NQY A;  3D4A A;  3F8X A;  3MG2 A;  3X3Y A;  4AKZ A;  1NNV A;  1QMA A;  4KZ1 A;  5BXQ A;  5D81 A;  3FZW A;  2SBL A;  2IUK A;  1JBR A;  2K3D A;  4FMD A;  3RNT A;  1AV4 A;  3PZW A;  2W9Q A;  1UW1 A;  5G1K A;  3WOD G;  1RLS A;  2OTJ 3;  1NB3 I;  1DMN A;  1MWT A;  1BRH A;  1GMP A;  5M1A A;  1U8C B;  2XEP A;  4HM0 B;  3N8B A;  1EKM A;  4STD A;  1HYF A;  1TUH A;  2CKF B;  1RGK A;  4ILF A;  1FYS A;  2XSO B;  3PS8 A;  4JF8 A;  2F98 A;  4O02 B;  3A5E A;  1PY3 A;  5TGN A;  2KRT A;  3WMD A;  3MPH A;  2CG1 A;  2FNQ A;  4FCZ A;  3DGL A;  3OXA A;  5IF6 A;  1RKY A;  1GOV A;  4LSO A;  5FW5 A;  1UGI A;  1UGH I;  3UL6 A;  1N5H A;  3SLU A;  3X42 A;  2PNC A;  3KCH A;  1FGO A;  5BU4 A;  1AVL A;  3MYT A;  1KQS 2;  1N5P A;  2F5W A;  5KP3 A;  3HX8 A;  2ML6 A;  3G8Z A;  1K8A 4;  4HBR A;  5JPU A;  3BNE A;  1T3B A;  1OH0 A;  1UUV B;  2L1S A;  4N6L A;  2ZDJ A;  4N6N B;  4J8T A;  2HOH A;  4BU4 A;  3URP A;  5IG5 A;  3WOF B;  1FGR A;  2OOV C;  1BNG A;  5EEO A;  1JN5 B;  1VQL 3;  4WP5 A;  5IG0 A;  4TX4 A;  2CFD A;  1O7M B;  3STD A;  3I56 3;  1BRK A;  1FGM A;  4L8P A;  2UX0 A;  3CC2 3;  4LYL B;  4N6O B;  1HKX A;  1TFO A;  2K54 A;  3B4P A;  3MHE A;  2D1W A;  5JPP A;  1B2U A;  1OCV A;  2ZA4 A;  3FF2 A;  2KF5 A;  3UJM A;  1D6Y A;  2V1L A;  1IVV A;  3BLZ A;  6STD A;  1Q42 A;  2KF4 A;  3EBT A;  2OTL 3;  2MF7 A;  3Q90 A;  3CCR 3;  1BUJ A;  1ULI B;  3AHS A;  2P38 A;  1BOX A;  3WA2 X;  4FMB A;  3CCV 3;  2FXT A;  2F99 A;  1L5G B;  2I9W A;  2BNG A;  1RCK A;  2OCT A;  1NWW A;  4ORL A;  1QJG A;  3HII A;  2M7O A;  3LT9 A;  1BAN A;  3KKG A;  4U13 A;  5IEN A;  1OF5 B;  2XGL A;  3OWY A;  4CPK A;  2BU4 A;  1RGG A;  1ULJ B;  1VQP 3;  4HOH A;  1IVU A;  3D5G A;  1F8N A;  3CPO A;  3DM8 A;  2QGU A;  1RDS A;  2C11 A;  3JUN A;  1EQK A;  3UNL A;  1X1X A;  4BTW A;  5JBS A;  1NDO B;  2HMO B;  2YFL B;  1WTH A;  2RGQ A;  1N8R 4;  2BHM A;  1GMR A;  3LH4 A;  2XFT A;  3WA3 A;  3OWU A;  2BMO B;  4O3V A;  1BNR A;  3BU4 A;  4HM3 B;  1LXE A;  1DVD A;  3FLJ A;  1W6C A;  2GBW B;  1JJ2 2;  2W0Q A;  4NPB A;  5AII A;  1AVK A;  1NJI 4;  1TP6 A;  1W7C A;  2Y74 A;  4OVM A;  1STF I;  1ZO2 A;  1VQM 3;  1PFP A;  2BIR A;  3WDG B;  1O7P B;  1OGX A;  1OUN A;  2XR8 B;  2C4B A;  1KD1 4;  4GL6 A;  4RZM A;  4MMY B;  5AEW B;  2YFI B;  1N8Q A;  1UCL A;  4N6T A;  3LOY A;  5AIG A;  1Q40 B;  1VQO 3;  1KC8 4;  3H3H A;  3HIG A;  2CW9 A;  1VQ8 3;  1JBS A;  4BIR A;  3FH1 A;  2W9P A;  4R9K A;  1YJN 3;  1IDP A;  2H0I A;  2HML B;  4N6M A;  1G02 A;  1IQX A;  3DGN A;  3JVC A;  3U97 A;  1IVX A;  3AGO A;  3V98 A;  1EG9 B;  2IUJ A;  1DYU A;  1W6G A;  4BTY A;  3CNX A;  2GSP A;  1SII A;  1OPY A;  3T0U A;  2HMK B;  2KF3 A;  1M9G A;  1RRH A;  1VQQ A;  2J8X B;  3EX9 A;  3ALA A;  4R1K A;  5DRE A;  2H0G A;  4G1M B;  1VZZ A;  3I55 3;  3GZB A;  2STD A;  1O7G B;  3FGY A;  2OOV A;  3KE7 A;  1G96 A;  3NM2 A;  3IJE B;  2CX0 A;  1OHP A;  4H3U A;  1IT8 A;  1NU3 A;  1CQS A;  2Z76 A;  4HM5 B;  1UUG B;  2F5M A;  4OUQ A;  4XDW A;  2D42 A;  1Z1S A;  1V58 A;  3SVA A;  4GSP A;  1B27 A;  2CX1 A;  2FGT A;  2KF6 A;  1Y4K A;  3BND A;  3FSD A;  2XGN A;  1JBT A;  4L8O A;  1GOU A;  1MWS A;  5ELU A;  4BL2 A;  1TU5 A;  1R4C A;  4FCJ A;  1LNH A;  5BIR A;  1MGR A;  2OWP A;  4R4K A;  3K0Z A;  2A15 A;  4CJN A;  3CC7 3;  3NBJ A;  3LZA A;  5CK6 A;  1N9E A;  5AEU B;  2O3O A;  1SQW A;  3JUO A;  3D5I A;  1JZD A;  3IPT A;  3AGN A;  5KP1 A;  3KZT A;  1JB5 A;  3NUV A;  1RRL A;  3NV0 A;  4JRF A;  3MWZ A;  4N6V 0;  3G16 A;  3K63 A;  3PCR A;  1IU7 A;  1I70 A;  1BSD A;  1LQG C;  2KCD A;  5D82 A;  1A2P A;  1BRS A;  1BVI A;  2YFJ B;  3MG1 A;  1V57 A;  1RJO A;  2E2V A;  2RBI A;  1EUI C;  4J5G A;  4WYK A;  1IK3 A;  3X41 A;  1SPU A;  1O7N B;  1RN7 A;  3T8U A;  3CCM 3;  2P05 A;  1DMM A;  1W4N A;  3LYG A;  3CPW 2;  5M19 A;  4LZI A;  3S27 A;  1MOL A;  1X1W A;  2IY2 A;  2WGO A;  3CCU 3;  2HMJ B;  1QAF A;  3UL5 A;  1UI8 A;  1MWR A;  1G0T A;  1GY6 A;  1B2X A;  3DZL A;  2CWV A;  2GEY A;  2Z77 A;  2HMM B;  1CYV A;  3Q2P A;  1A67 A;  3X3Z A;  3DXO A;  3G6E 3;  4N3V A;  1FGT A;  4RNT A;  3CCJ 3;  4L7K A;  3LT8 A;  3KN4 A;  3LTA A;  3EJV A;  1B20 A;  1ROV A;  3B4O A;  3OV4 A;  1VQ5 3;  2PZV A;  4K1U A;  3V99 A;  3I0Y A;  1RN1 A;  1Q7H A;  2E2T A;  8RNT A;  5EQL A;  2IMJ A;  3DGO A;  4XBX A;  4EBG A;  1CYU A;  1K41 A;  2MC8 A;  3F40 A;  4HAA A;  4EYC A;  5RNT A;  1I0V A;  1GSP A;  2CK3 H;  1YI2 3;  1ISK A;  5AYR B;  2F56 A;  3PXM A;  3HI7 A;  3F7X A;  4O2H A;  2C10 A;  2SAR A;  1OHS A;  2RNT A;  4HM6 B;  2KAA A;  1JKG A;  1HU9 A;  1A90 A;  4IPB A;  3GWR A;  1O7H B;  3O8Y A;  1BUQ A;  2GXF A;  3JUP A;  2E2U A;  2F4Y A;  1W6Y A;  4R9L A;  1BNJ A;  1NB5 I;  3E99 A;  4O8S A;  3PYJ A;  1UCI A;  3F7S A;  3NXJ A;  3OX9 A;  2UGI A;  3QK9 A;  5EVH A;  1TIJ A;  2W04 A;  2W03 A;  1JZO A;  3K9M C;  4WFO A;  4J5K A;  1SAR A;  1B3S A;  2CFK A;  3CNM A;  4K61 A;  1OAC A;  2INX A;  4PEJ A;  4HKV B;  2JDI H;  3PCS A;  3J7Y d;  2IA7 A;  4GB5 A;  4RNZ A;  5KP4 A;  1SIH A;  3D9R A;  1N9J A;  3NHX A;  3SYU A;  3HOH A;  4HM4 B;  2W2C A;  3DH2 A;  1X1U A;  1E3V A;  2JQ5 A;  3A76 A;  4LMI A;  5CLK A;  1Q86 4;  4CCV A;  1B2S A;  3KSE D;  1MWU A;  2CFG A;  2CIU A;  3IMA B;  4IT7 A;  4FR9 A;  2CWU A;  3OW2 2;  1MGW A;  4FMA A;  4BL3 A;  1S5A A;  1T2H A;  2CHC A;  1D6Z A;  1IV7 A;  1I2G A;  2CFW A;  2XSH B;  1UUW B;  1RNB A;  5I97 A;  1UDI I;  2GU3 A;  1VQ6 3;  3BB9 A;  3CC4 3;  3WOE B;  1IT7 A;  1IVW A;  4H61 A;  3LML A;  1YVB I;  8CHO A;  3WHO A;  3AMO A;  3D3L A;  1I3I A;  2WGQ A;  2Y73 A;  3S5C A;  1WMN A;  1B2Z A;  3SOA A;  2ZHX B;  3CME 3;  4NHF A;  3EB8 A;  2P0X A;  1VQ9 3;  1RCL A;  3LTD A;  1US1 A;  4AKY A;  1YHQ 3;  1FA3 A;  3LTC A;  1RMS A;  4RNY A;  3FG4 A;  1RGH A;  1RGC A;  3EHC A;  1ROA A;  2KXG A;  3MG3 A;  2WOF A;  3T8N A;  4R80 A;  1A2V A;  1B21 A;  1UI7 A;  5AI1 A;  1LOX A;  1BNE A;  1FW7 A;  1BRJ A;  1JB2 A;  4OK0 A;  5A0O B;  4WWU C;  1BNF A;  2W56 A;  1J2B A;  1VQ4 3;  2R41 A;  4HM8 B;  4LEH A;  1MNL A;  3NV0 B;  3RDE A;  2WO0 A;  1W01 A;  1WNH A;  4HYZ A;  5IEP A;  1W00 A;  3GAX A;  1LRA A;  1QVG 2;  1YGE A;  1QAK A;  3F8H A;  1I3F A;  2CC3 A;  2W6J H;  2YX9 A;  2RCD A;  3ZFZ A;  4WYK B;  3KFQ C;  4HZB B;  1YVS A;  3ER7 A;  4XBT A;  1STD A;  3WR2 A;  1LQM B;  3Q3F A;  3BNB A;  1BNS A;  1D6U A;  2BO9 B;  5FGO A;  5G2G A;  4ZM8 A;  4QWT A;  1JB4 A;  4GHO A;  3G71 3;  1JRQ A;  3RGR A;  1W2B 2;  3FF0 A;  4EV2 A;  4HVN A;  2AAE A;  1W2Z A;  1UCK A;  2P09 A;  1M1K 4;  1S72 3;  4KVH A;  1FGQ A;  1GYB A;  1VQK 3;  3FG1 A;  3EN8 A;  1BSA A;  3CCE 3;  4MMZ B;  4XDV A;  2BT3 A;  2RSX A;  1BGS A;  3F9S A;  1W5Z A;  1ZGX A;  3HK4 A;  1IQ8 A;  1CH0 A;  1I8V A;  3CCL 3;  2F86 B;  1AQZ A;  3S67 A;  1V74 A;  2R4I A;  1RGE A;  3K5T A;  1RGF A;  1LNI A;  1U5O A;  2Z7A A;  3FG3 A;  1A2K A;  4BTX A;  3X3X A;  1KSI A;  2IYJ A;  2LQV A;  4HM7 B;  3G0K A;  4KFD A;  5AIF A;  2K0M A;  1QVF 2;  1GD4 A;  4IIA A;  3KII A;  3SXX A;  3DGM A;  5GSP A;  3VSY A;  5AYS C;  5M18 A;  1YGW A;  1Q7Y 4;  1LOV A;  1TTO A;  1R4Y A;  1JKG B;  1BRI A;  2QEX 3;  1FUW A;  3FKA A;  2BMQ B;  1GY5 A;  4MJD A;  1BAO A;  5D83 A;  1E3R A;  1K73 4;  2WOH A;  3CD6 3;  2CH9 A;  5STD A;  1FUT A;  1M90 4;  1GD3 A;  1OGZ A;  3RGA A;  5AIH A;  1PU4 A;  1IYY A;  3EQQ B;  2BMR B;  3BIR A;  9RNT A;  3GZR A;  2OQE C;  1LOY A;  3MSO A;  1X1Y A;  2Q07 A;  3F14 A;  3NQZ A;  4I5Q A;  3S28 A;  3V92 A;  4AEQ A;  3CXC 2;  2XRX B;  4XM4 A;  1GY7 A;  3VF1 A;  3PGB A;  1IQY A;  4X2O A;  1JNQ A;  1RTU A;  3Q1C A;  3CCQ 3;  1W02 A;  3EN1 B;  3U1W A;  6GSP A;  5HOH A;  3HZP A;  1DE3 A;  3ZG0 A;  2UUG C;  3EC9 A;  3NX0 A;  1VQN 3;  1JN5 A;  1BIR A;  3UB1 A;  5CF2 A;  5ELJ A;  5DRV A;  1YIT 3;  4DKI A;  1UCJ A;  5IW9 A;  3DGY A;  5CF1 A;  3ROB A;  1OHO A;  3EF8 A;  2QIY A;  2CG0 A;  2XH9 A;  1PYL A;  3QRD A;  4FCM A;  5G1L A;  1DVC A;  1BSE A;  4NRE A;  4KFF A;  4RBN A;  1QAL A;  1LOW A;  3S29 A;  3K7C A;  3AMO B;  4K1V A;  2GEX A;  4K90 B;  1BRG A;  1EEJ A;  4N6U A;  2AAD A;  4HZ9 B;  1NO3 A;  3SED A;  4HJL B;  1I2F A;  3LXU X;  1FUS A;  1VQ7 3;  3B7C A;  1KWI A;  1BSB A;  3D79 A;  1BU4 A;  1TFK A;  1FZU A;  1TRP A;  1WQL B;  2CFL A;  4XBY A;  1BRN L;  1RHL A;  1BSC A;  1M1X B;  1OF5 A;  3MKI A;  5IG4 A;  1GS3 A;  2ZL8 A;  1GOY A;  1K28 A;  3NBR A;  5IEO A;  4MMX B;  2Z6B A;  3GSP A;  1YJW 3;  2XFS A;  1E97 A;  2LYX A;  4FMC A;  3GZX B;  3AHW A;  3H51 A;  1JV2 B;  1GMQ A;  1DMQ A;  4HM1 B;  4Q53 A;  5LC7 A;  4XB5 A;  5CXO A;  1Q81 4;  1C54 A;  5BVB A;  3CU3 A;  2W56 B;  3GZY B;  3VGN A;  1BNI A;  3SX1 A;  1RGA A;  4EW5 A;  1YNV X;  1AY7 A;  7STD A;  1Q82 4;  1TRQ A;  3DMC A;  1TJD A;  1IV9 A;  4KFE A;  4WHA A;  2H0H A;  4I4K A;  3EBY A;  3GRD A;  1T5Y A;  4LGQ A;  3FCS B;  4EXR A;  6RNT A;  1DET A;  2RFR A;  3L0R A;  1YJ9 3;  5LC6 A;  2O9U X;  5IG3 A;  3JUQ A;  3LTB A;  1LVN A;  4MEI A;  3B8L A;  3ECF A;  1ZS7 A;  3SOY A;  2XF3 A;  1K9M 4;  1Q9E A;  3N9H A;  1T2I A; 
#chains in the Genus database with same CATH homology
 2B1X B;  1Q40 A;  4HM2 B;  3DY5 A;  4CDL A;  3X40 A;  1C7H A;  5IER A;  4J9A A;  5HGR A;  3G4S 3;  1CEW I;  2GBX B;  3JUM A;  3OWS A;  4X2H A;  3BNC A;  1WMO A;  3DUK A;  2OQE A;  1EA2 A;  1YIJ 3;  2GU1 A;  2HMN B;  2ML5 A;  2CWT A;  2QA4 3;  3M8C A;  4EC6 A;  1AR0 A;  3TDG A;  1O7W B;  3NM7 A;  2P0M A;  1WMP A;  2L4V A;  1SJW A;  3CMA 3;  2B24 B;  1ZX2 A;  4EV5 A;  3CCS 3;  3KSP A;  1ASK A;  3NBB A;  3EE1 A;  3N54 B;  3NQY A;  3F8X A;  3MG2 A;  3X3Y A;  4AKZ A;  1QMA A;  4KZ1 A;  5BXQ A;  5D81 A;  3FZW A;  2SBL A;  2IUK A;  4FMD A;  1AV4 A;  3PZW A;  2W9Q A;  1UW1 A;  3WOD G;  2OTJ 3;  1NB3 I;  1DMN A;  1U8C B;  2XEP A;  4HM0 B;  3N8B A;  1EKM A;  4STD A;  1TUH A;  2CKF B;  2XSO B;  3PS8 A;  4JF8 A;  2F98 A;  4O02 B;  5TGN A;  2KRT A;  3WMD A;  3MPH A;  2CG1 A;  2FNQ A;  4FCZ A;  3DGL A;  3OXA A;  5IF6 A;  1RKY A;  4LSO A;  5FW5 A;  3UL6 A;  1N5H A;  3SLU A;  3X42 A;  2PNC A;  1FGO A;  1AVL A;  3MYT A;  1KQS 2;  1N5P A;  5KP3 A;  3HX8 A;  2ML6 A;  3G8Z A;  1K8A 4;  4HBR A;  5JPU A;  3BNE A;  1UUV B;  1OH0 A;  4N6L A;  4N6N B;  2ZDJ A;  4J8T A;  5IG5 A;  3WOF B;  1FGR A;  2OOV C;  5EEO A;  1JN5 B;  1VQL 3;  4WP5 A;  5IG0 A;  4TX4 A;  2CFD A;  1O7M B;  3STD A;  3I56 3;  1FGM A;  4L8P A;  2UX0 A;  3CC2 3;  4N6O B;  1HKX A;  1TFO A;  2K54 A;  3B4P A;  3MHE A;  2D1W A;  5JPP A;  1OCV A;  3FF2 A;  3UJM A;  1D6Y A;  2V1L A;  1IVV A;  3BLZ A;  6STD A;  1Q42 A;  3EBT A;  2OTL 3;  2MF7 A;  3Q90 A;  3CCR 3;  1ULI B;  2P38 A;  3WA2 X;  4FMB A;  3CCV 3;  2FXT A;  2F99 A;  1L5G B;  2I9W A;  2BNG A;  2OCT A;  4ORL A;  1NWW A;  1QJG A;  3HII A;  2M7O A;  3LT9 A;  4U13 A;  3KKG A;  5IEN A;  1OF5 B;  2XGL A;  3OWY A;  1ULJ B;  1VQP 3;  1IVU A;  1F8N A;  3CPO A;  3DM8 A;  2QGU A;  2C11 A;  3JUN A;  1EQK A;  3UNL A;  4BTW A;  5JBS A;  1NDO B;  2HMO B;  2YFL B;  1WTH A;  2RGQ A;  1N8R 4;  2BHM A;  3LH4 A;  2XFT A;  3WA3 A;  3OWU A;  2BMO B;  4O3V A;  4HM3 B;  1LXE A;  1DVD A;  3FLJ A;  1W6C A;  2GBW B;  1JJ2 2;  2W0Q A;  5AII A;  1AVK A;  1TP6 A;  1W7C A;  2Y74 A;  4OVM A;  1STF I;  1ZO2 A;  1VQM 3;  1PFP A;  3WDG B;  1O7P B;  1OGX A;  1OUN A;  2XR8 B;  1KD1 4;  4GL6 A;  4RZM A;  4MMY B;  5AEW B;  2YFI B;  1N8Q A;  4N6T A;  3LOY A;  5AIG A;  1Q40 B;  1VQO 3;  1KC8 4;  3H3H A;  3HIG A;  2CW9 A;  1VQ8 3;  3FH1 A;  2W9P A;  4R9K A;  1YJN 3;  1IDP A;  2HML B;  4N6M A;  1IQX A;  3DGN A;  3JVC A;  3U97 A;  1IVX A;  3V98 A;  1EG9 B;  2IUJ A;  1DYU A;  1W6G A;  4BTY A;  3CNX A;  1SII A;  1OPY A;  3T0U A;  2HMK B;  1M9G A;  1RRH A;  3EX9 A;  3ALA A;  4R1K A;  5DRE A;  4G1M B;  1VZZ A;  3I55 3;  3GZB A;  2STD A;  1O7G B;  3FGY A;  2OOV A;  3KE7 A;  1G96 A;  3NM2 A;  3IJE B;  1OHP A;  4H3U A;  1IT8 A;  1NU3 A;  1CQS A;  2Z76 A;  4HM5 B;  4OUQ A;  4XDW A;  2D42 A;  1Z1S A;  3SVA A;  2FGT A;  1Y4K A;  3BND A;  3FSD A;  2XGN A;  4L8O A;  5ELU A;  1TU5 A;  1R4C A;  4FCJ A;  1LNH A;  4R4K A;  2OWP A;  3K0Z A;  2A15 A;  3CC7 3;  3NBJ A;  3LZA A;  5CK6 A;  1N9E A;  5AEU B;  2O3O A;  1SQW A;  3JUO A;  5KP1 A;  3IPT A;  3KZT A;  1JB5 A;  3NUV A;  1RRL A;  3NV0 A;  4JRF A;  3MWZ A;  4N6V 0;  3G16 A;  3K63 A;  3PCR A;  1IU7 A;  5D82 A;  2KCD A;  2YFJ B;  3MG1 A;  1RJO A;  2E2V A;  4WYK A;  1IK3 A;  3X41 A;  1SPU A;  1O7N B;  1RN7 A;  3T8U A;  3CCM 3;  2P05 A;  1DMM A;  1W4N A;  3LYG A;  3CPW 2;  4LZI A;  3S27 A;  1MOL A;  2WGO A;  3CCU 3;  2HMJ B;  1QAF A;  3UL5 A;  1UI8 A;  1GY6 A;  3DZL A;  2CWV A;  2GEY A;  2Z77 A;  2HMM B;  1CYV A;  3Q2P A;  1A67 A;  3X3Z A;  3DXO A;  3G6E 3;  4N3V A;  1FGT A;  3CCJ 3;  4L7K A;  3LT8 A;  3KN4 A;  3LTA A;  3EJV A;  1ROV A;  3B4O A;  3OV4 A;  1VQ5 3;  2PZV A;  4K1U A;  3V99 A;  3I0Y A;  2E2T A;  5EQL A;  2IMJ A;  3DGO A;  4XBX A;  4EBG A;  1CYU A;  1K41 A;  2MC8 A;  3F40 A;  4EYC A;  2CK3 H;  1YI2 3;  1ISK A;  5AYR B;  3PXM A;  3HI7 A;  3F7X A;  4O2H A;  2C10 A;  1OHS A;  4HM6 B;  1JKG A;  1HU9 A;  1A90 A;  4IPB A;  3GWR A;  1O7H B;  3O8Y A;  1BUQ A;  2GXF A;  3JUP A;  2E2U A;  4R9L A;  1W6Y A;  1NB5 I;  3E99 A;  4O8S A;  3PYJ A;  3F7S A;  3NXJ A;  3OX9 A;  3QK9 A;  5EVH A;  1TIJ A;  2W04 A;  2W03 A;  3K9M C;  4WFO A;  2CFK A;  3CNM A;  4K61 A;  1OAC A;  2INX A;  4PEJ A;  4HKV B;  2JDI H;  3PCS A;  3J7Y d;  2IA7 A;  4GB5 A;  4RNZ A;  5KP4 A;  1SIH A;  3D9R A;  1N9J A;  3NHX A;  4HM4 B;  2W2C A;  1E3V A;  2JQ5 A;  3A76 A;  4LMI A;  5CLK A;  1Q86 4;  4CCV A;  3KSE D;  2CFG A;  3IMA B;  2CIU A;  4IT7 A;  4FR9 A;  2CWU A;  3OW2 2;  4FMA A;  1S5A A;  2CHC A;  1D6Z A;  1IV7 A;  2CFW A;  2XSH B;  1UUW B;  5I97 A;  2GU3 A;  1VQ6 3;  3BB9 A;  3CC4 3;  3WOE B;  1IT7 A;  1IVW A;  4H61 A;  3LML A;  1YVB I;  8CHO A;  3AMO A;  3D3L A;  2WGQ A;  2Y73 A;  3S5C A;  1WMN A;  3SOA A;  3CME 3;  4NHF A;  3EB8 A;  2P0X A;  1VQ9 3;  3LTD A;  1US1 A;  4AKY A;  1YHQ 3;  1FA3 A;  3LTC A;  4RNY A;  3FG4 A;  3EHC A;  1ROA A;  2KXG A;  3MG3 A;  2WOF A;  3T8N A;  4R80 A;  1A2V A;  1UI7 A;  5AI1 A;  1LOX A;  1JB2 A;  4OK0 A;  5A0O B;  4WWU C;  2W56 A;  1J2B A;  1VQ4 3;  4HM8 B;  4LEH A;  1MNL A;  3NV0 B;  3RDE A;  2WO0 A;  1W01 A;  1WNH A;  4HYZ A;  5IEP A;  1W00 A;  3GAX A;  1QVG 2;  1YGE A;  1QAK A;  3F8H A;  2CC3 A;  2W6J H;  2YX9 A;  2RCD A;  4WYK B;  3KFQ C;  4HZB B;  3ER7 A;  4XBT A;  1STD A;  3BNB A;  2BO9 B;  1D6U A;  5FGO A;  5G2G A;  4ZM8 A;  4QWT A;  1JB4 A;  3G71 3;  1JRQ A;  3RGR A;  1W2B 2;  3FF0 A;  4EV2 A;  4HVN A;  1W2Z A;  2P09 A;  1M1K 4;  1S72 3;  4KVH A;  1FGQ A;  1GYB A;  1VQK 3;  3FG1 A;  3EN8 A;  3CCE 3;  4MMZ B;  4XDV A;  2BT3 A;  2RSX A;  3F9S A;  1W5Z A;  3HK4 A;  3CCL 3;  1IQ8 A;  2F86 B;  3S67 A;  1V74 A;  2R4I A;  3K5T A;  1U5O A;  2Z7A A;  3FG3 A;  1A2K A;  4BTX A;  3X3X A;  1KSI A;  4KFD A;  2LQV A;  4HM7 B;  3G0K A;  5AIF A;  2K0M A;  1QVF 2;  1GD4 A;  4IIA A;  3KII A;  3SXX A;  3DGM A;  3VSY A;  5AYS C;  1Q7Y 4;  1JKG B;  2QEX 3;  1FUW A;  3FKA A;  2BMQ B;  1GY5 A;  4MJD A;  5D83 A;  1E3R A;  1K73 4;  2WOH A;  3CD6 3;  2CH9 A;  5STD A;  1M90 4;  1GD3 A;  1OGZ A;  3RGA A;  5AIH A;  1PU4 A;  3EQQ B;  2BMR B;  3GZR A;  2OQE C;  4AEQ A;  3MSO A;  3S28 A;  2Q07 A;  3F14 A;  3NQZ A;  1NJI 4;  3CXC 2;  3V92 A;  2XRX B;  4XM4 A;  1GY7 A;  3VF1 A;  3PGB A;  1IQY A;  4X2O A;  1JNQ A;  3Q1C A;  3CCQ 3;  1W02 A;  3EN1 B;  3U1W A;  3HZP A;  3EC9 A;  3NX0 A;  1VQN 3;  1JN5 A;  3UB1 A;  5CF2 A;  5ELJ A;  5DRV A;  1YIT 3;  5IW9 A;  5CF1 A;  3ROB A;  1OHO A;  3EF8 A;  2QIY A;  2CG0 A;  2XH9 A;  3QRD A;  4FCM A;  1DVC A;  4NRE A;  4KFF A;  4RBN A;  1QAL A;  3S29 A;  3K7C A;  3AMO B;  4K1V A;  2GEX A;  4K90 B;  4N6U A;  4HZ9 B;  1NO3 A;  3SED A;  4HJL B;  3LXU X;  1VQ7 3;  1KWI A;  1TFK A;  1WQL B;  2CFL A;  4XBY A;  3MKI A;  1M1X B;  1OF5 A;  5IG4 A;  1GS3 A;  2ZL8 A;  1K28 A;  3NBR A;  5IEO A;  4MMX B;  2Z6B A;  1YJW 3;  2XFS A;  1E97 A;  2LYX A;  4FMC A;  3GZX B;  3H51 A;  1JV2 B;  1DMQ A;  4HM1 B;  4Q53 A;  5LC7 A;  4XB5 A;  5CXO A;  1Q81 4;  5BVB A;  3CU3 A;  2W56 B;  3GZY B;  3VGN A;  3SX1 A;  7STD A;  1Q82 4;  3DMC A;  1IV9 A;  4KFE A;  4WHA A;  4I4K A;  3EBY A;  3GRD A;  1T5Y A;  4LGQ A;  3FCS B;  4EXR A;  2RFR A;  3L0R A;  1YJ9 3;  5LC6 A;  2O9U X;  5IG3 A;  3JUQ A;  3LTB A;  1LVN A;  4MEI A;  3B8L A;  3ECF A;  3SOY A;  2XF3 A;  1K9M 4;  3B7C A;  3N9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...