2CKFB

Crystal structure of the terminal component of the pah-hydroxylating dioxygenase from sphingomonas sp chy-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
170
structure length
170
Chain Sequence
QVPVTPDVHYAVEAHYRAEVRLLQTGQYREWLHGMVAEDIHYWMPIYEQRFVRDRRPDPTPDDAAIYNDDFEELKQRVERLYSGQVWMEDPPSKIRYFVSNVEAFEAENGELDVLSNILVYRNRRQTEVTVHTLGREDKLRQDGNGFKVFRRKLILDARVTQDKNLYFFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords RING-HYDROXYLATING DIOXYGENASE ALPHA SUBUNIT
publication title The Catalytic Pocket of the Ring-Hydroxylating Dioxygenase from Sphingomonas Chy-1.
pubmed doi rcsb
source organism Sphingomonas sp.
total genus 47
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ckfB00
3I0YA 1JB5A 1ZX2A 3H51A 1OUNA 3G16A 5AEWB 5IG5A 5KP4A 3T8UA 3Q90A 3LYGA 2JQ5A 3OV4A 2INXA 3B7CA 2RFRA 2A15A 1QMAA 1GY5A 1GYBA 3RGAA 3FSDA 2HMMB 4FCJA 3EX9A 4ORLA 2RCDA 2F99A 2YFLB 1E97A 3OWUA 3F7SA 5KP1A 4H3UA 2OWPA 3FZWA 5IENA 4I4KA 5DRVA 2Z76A 3K0ZA 1NWWA 8CHOA 5CF2A 1NDOB 3NM2A 1AR0A 3G8ZA 2XSOB 3JUPA 4HM4B 4XB5A 4HM7B 1W01A 3GZBA 4K1UA 4HM1B 5EVHA 2BMRB 1JB2A 3CU3A 4R9KA 3MG1A 3UNLA 1O7GB 3UJMA 2PZVA 2CKFB 3B4PA 3HX8A 3K7CA 4PEJA 4U13A 4IIAA 3MYTA 1Q42A 1E3VA 1S5AA 3GZYB 3HK4A 1IDPA 1ASKA 3EN8A 1OHSA 1E3RA 4L7KA 3IPTA 2BMOB 3MG3A 1ISKA 1O7MB 2B24B 1W02A 2STDA 4L8PA 1NU3A 4LGQA 1JN5B 1O7HB 4STDA 3MHEA 1OHOA 1ZO2A 4HM8B 2GEXA 5CXOA 1EG9B 4HM6B 1UUWB 1OF5B 3EHCA 1O7WB 1OF5A 5CLKA 3STDA 3MSOA 3E99A 4WWUC 2CHCA 1TUHA 3CNXA 3F14A 2IMJA 3JUMA 4HM0B 5STDA 4WP5A 5CK6A 5CF1A 3NV0B 5JPPA 1VZZA 3EJVA 3NV0A 3BB9A 5D81A 3OX9A 4GB5A 1K41A 3WMDA 1STDA 5AIGA 2YFIB 1DMMA 5G2GA 3SEDA 3DXOA 4OUQA 5IG3A 3OXAA 4MJDA 1C7HA 2XR8B 3VSYA 1OH0A 1OHPA 2HMNB 4XBTA 3LZAA 3JUQA 2HMOB 3GZXB 5IG4A 4XBXA 3FLJA 3FKAA 3DM8A 4J8TA 3FH1A 5IEPA 4HM5B 5FW5A 5DREA 2BMQB 3KSPA 3F7XA 4FCMA 5AIFA 4Q53A 3SOYA 3KE7A 3KKGA 5AIHA 3GWRA 1A2KA 3JUOA 4X2HA 4R9LA 5IERA 1O7NB 3NUVA 3F8HA 1DMNA 1SJWA 3D9RA 3M8CA 3EN1B 3G0KA 3VGNA 1JB4A 2HMKB 1EA2A 4HM2B 4L8OA 4N3VA 3H3HA 1WQLB 2QIYA 3NBRA 1GY6A 1W00A 1JN5A 2BNGA 4HKVB 3CNMA 1TP6A 3NHXA 3A76A 5D83A 3ECFA 3CPOA 2GEYA 4R1KA 3JUNA 3FGYA 4LMIA 1ULIB 3NXJA 1GY7A 3EF8A 4XBYA 3F8XA 3FF0A 4CDLA 4XDVA 3MG2A 1OGXA 3S5CA 4J9AA 5IG0A 5KP3A 5BVBA 2GXFA 3EQQB 5AIIA 3RGRA 3HZPA 5JPUA 3B8LA 5D82A 1GS3A 3BLZA 4KVHA 4WYKB 1OPYA 2GBXB 4WYKA 1UUVB 1QJGA 3EBTA 4HZ9B 1JKGB 3KZTA 1JKGA 3T8NA 2YFJB 4XDWA 2K54A 2RGQA 4HJLB 1HKXA 2HMLB 1DMQA 1OGZA 3B4OA 2R4IA 2W2CA 1O7PB 6STDA 3SOAA 3OWYA 3GRDA 1U5OA 2Z7AA 1CQSA 4HM3B 5IF6A 2HMJB 1BUQA 3FF2A 2B1XB 3GZRA 1W6YA 3F40A 3ER7A 5AI1A 2F86B 1Q40B 1ULJB 5IEOA 2XSHB 1Q40A 2GBWB 2UX0A 3EBYA 3F9SA 2F98A 4XM4A 3EC9A 3OWSA 5TGNA 2I9WA 1Z1SA 3MKIA 4HVNA 2XRXB 3DUKA 4K1VA 2Z77A 3DZLA 7STDA 4HZBB 2QGUA 5AEUB 3ROBA 5BXQA 4OVMA 5HGRA 4RZMA 4LEHA 4X2OA 1OCVA 3DMCA
chains in the Genus database with same CATH superfamily
1WTHA 2YX9A 3I0YA 3WA2X 1BUJA 1RGKA 1JB5A 1JV2B 3N54B 3AGNA 1ZX2A 1L5GB 2XGLA 3H51A 4GSPA 4LZIA 3X3ZA 1OUNA 3G16A 4LSOA 1BNIA 5AEWB 4BTWA 4BIRA 1FGOA 1RLSA 1BRNL 5IG5A 5KP4A 3T8UA 1BNGA 3WOFB 3Q90A 1BNSA 3LYGA 2JQ5A 1FGRA 1R4YA 1X1XA 3OV4A 3OW22 1K9M4 2UGIA 4CJNA 1RMSA 2WOFA 1GOYA 1B2MA 2INXA 2XFSA 3B7CA 3SX1A 1UI7A 2RFRA 3BNBA 3LT9A 2A15A 4RBNA 3SLUA 3PS8A 2CX1A 1N5PA 1QMAA 5BU4A 5EEOA 1GY5A 1GYBA 3CCU3 4J5KA 3RGAA 3FSDA 2HMMB 1RSNA 1IK3A 4FCJA 1UW1A 1I0VA 1WNHA 1AV4A 2ML5A 4K61A 5EQLA 1YJN3 1EEJA 4DKIA 3LTCA 2BU4A 3CME3 3EX9A 4ORLA 2RCDA 3RDEA 1NO3A 2F99A 2YFLB 1E97A 3OWUA 1VQN3 3F7SA 5KP1A 4FCZA 1RNBA 4H3UA 1Q7Y4 2F5WA 1NNVA 1IQ8A 2OWPA 2LQVA 3DGLA 2OOVA 1FGMA 3L0RA 1BRSA 2KXGA 3FZWA 5IENA 1FGTA 3D4AA 2MF7A 4I4KA 1VQ83 2O3OA 2AADA 5DRVA 5IERA 2M7OA 1VQ63 3EB8A 5M1AA 2Z76A 1I3IA 2CX0A 3K0ZA 1NWWA 8CHOA 1VQ53 1W2ZA 1N9EA 1RGLA 4ILFA 5CF2A 1NDOB 3CCR3 3NM2A 1NB3I 1W4NA 1AR0A 1WMPA 1YIT3 3G8ZA 6GSPA 2KCDA 3D5IA 2XSOB 1WMOA 2BIRA 3JUPA 3IJEB 1RTUA 4HM4B 3BNEA 4XB5A 1FA3A 5AYRB 2FNQA 4HM7B 1M904 3VF1A 1W01A 3GZBA 3IMAB 3Q2PA 4K1UA 4HM1B 5GSPA 5EVHA 1IV9A 3EE1A 2BMRB 3NM7A 1JB2A 4G1MB 2ZA4A 1I2FA 3CU3A 2W04A 4R9KA 3MG1A 1G02A 3UNLA 4EXRA 4HAAA 1O7GB 1MNLA 1Q864 4HYZA 3UJMA 3S67A 3DGMA 1YJW3 2FXTA 2P0XA 1MGWA 1I3FA 2CKFB 2PZVA 3B4PA 3HX8A 4MMXB 2P05A 1N5HA 1IVXA 3K7CA 2IYJA 1X1UA 5RNTA 4KFFA 4PEJA 2OQEA 1GD4A 3Q3FA 1B2ZA 2CFDA 3RNTA 4U13A 2KAAA 4ZM8A 7RNTA 3CCQ3 1FUWA 1I0XA 4N6OB 4IIAA 4WHAA 1IYYA 3MYTA 1Q42A 1S5AA 1E3VA 3NQZA 1TTOA 3GZYB 3HK4A 1D6UA 1SARA 3K9MC 2H0HA 3ZG5A 1BIRA 1ASKA 1IDPA 3ALAA 1VQ73 3EN8A 1BANA 1OHSA 4EV2A 1E3RA 4L7KA 3IPTA 2BMOB 2KF5A 1I2EA 1U8CB 2P38A 3MG3A 3PXMA 8RNTA 4N6NB 3LTBA 1A67A 1SQWA 4WFOA 1ISKA 4NREA 2ZHXB 4OK0A 1O7MB 2B24B 1W02A 1IT7A 5A0OB 2GU1A 2IUKA 2STDA 1UGIA 1C54A 1UCKA 3DY5A 4L8PA 1NU3A 5LC6A 4LGQA 2W9PA 2F5MA 1PU4A 3CXC2 2GU3A 1JN5B 1O7HB 1ZS7A 2W03A 5BIRA 1GMRA 3CPW2 1OACA 3KFQC 1BAOA 4STDA 3FG3A 1K28A 2K0MA 2J8XB 3MHEA 1OHOA 2F4YA 3BIRA 6RNTA 2CC3A 3LTAA 4BL2A 1V58A 2CK3H 1ZO2A 4GL6A 5M18A 4HM8B 1B21A 3BU4A 1LOXA 1B20A 2Z6BA 4BL3A 2GEXA 5CXOA 1AVKA 1EG9B 3D3LA 4HM6B 4O8SA 1VQ43 1LQGC 1DE3A 1UUWB 2HOHA 3HOHA 3BNCA 3NBBA 1OF5B 3EHCA 1O7WB 1OF5A 1ZGXA 1IT8A 5CLKA 3STDA 3MSOA 1VQ93 2W9QA 3E99A 4WWUC 4HOHA 4GHOA 2CHCA 1BSBA 1TUHA 3SYUA 3CCV3 1D6YA 1MWRA 3CNXA 3F14A 2IMJA 4KFEA 3X42A 4AKYA 3V99A 3JUMA 1RNTA 1YVBI 2CWUA 1TJDA 1RN4A 2O9UX 5AYSC 3CCS3 1KD14 4HM0B 5STDA 1B2SA 1RHLA 4AEQA 1DETA 4WP5A 2Q07A 1IVWA 4AKZA 2PNCA 5CK6A 5LC7A 1GD3A 5CF1A 1IQXA 3U97A 1JBTA 1CEWI 3SXXA 3WR2A 3NV0B 1VQO3 5JPPA 1BGSA 1RCLA 1VZZA 1IVVA 2K3DA 3EJVA 3NV0A 1V57A 1FW7A 3BB9A 5D81A 3OX9A 4GB5A 3G6E3 1K41A 2P0MA 3WMDA 1BRIA 1RN1A 1STDA 3PZWA 5AIGA 1JRQA 1LNIA 2CW9A 1A2PA 2YFIB 4FMCA 4H61A 3J7Yd 1DMMA 3SVAA 4JRFA 5G2GA 3SEDA 3DXOA 4OUQA 3S27A 5IG3A 3OXAA 1G96A 4MJDA 1YHQ3 3O8YA 3CMA3 2C4BA 3NBJA 1DVCA 4JF8A 1C7HA 2XR8B 1YVSA 3VSYA 1OH0A 2ML6A 1BVIA 2D1WA 4R4KA 1OHPA 2HMNB 1I8VA 1RN7A 4XBTA 1QAKA 1BNEA 3LZAA 3JUQA 1B3SA 3CCM3 4FMBA 3NQYA 2BHMA 2W0QA 1BU4A 3LMLA 1Q814 2HMOB 2XEPA 3AHSA 4IT7A 4NHFA 1W5ZA 3S28A 1RCKA 3LT8A 3GZXB 2OTL3 1QVF2 1KWIA 1GOUA 1RGHA 2GSPA 3DGOA 3QRDA 5IG4A 4XBXA 3FLJA 1UDII 3FKAA 1MWSA 3DM8A 4J8TA 4LYLB 1TRQA 2P09A 1FGQA 1ROVA 3FH1A 2OOVC 4N6LA 3WODG 5IEPA 1Q824 4HM5B 5FW5A 2CFGA 5DREA 2BMQB 2Y74A 3KSPA 4EW5A 3F7XA 1A90A 1LOVA 1SIIA 1IU7A 4FCMA 3K5TA 1UCJA 1GSPA 4Q53A 3KCHA 5AIFA 2E2UA 1MGRA 3SOYA 1RRHA 3KE7A 1W7CA 3KKGA 5AIHA 1LVNA 2WO0A 3GWRA 1A2KA 3HIIA 3JUOA 4X2HA 1HYFA 4R9LA 1O7NB 3NUVA 1V74A 1DMNA 1SJWA 3D9RA 1HU9A 3F8HA 3GSPA 1Q9EA 2OCTA 4IPBA 3CC73 3M8CA 2WGQA 4EYCA 3EN1B 1HZ1A 3WOEB 1AY7A 3G0KA 3VGNA 1JB4A 3DH2A 1F8NA 2CWTA 2HMKB 3LOYA 2XFTA 1VQQA 1EUIC 5ELUA 3X40A 1VQM3 1MWUA 1EA2A 1Y4KA 4HM2B 4L8OA 2SBLA 4MMZB 4N3VA 3H3HA 2IUJA 1WQLB 3WHOA 1WMNA 1JJ22 1LXEA 1N9JA 2CWVA 2QIYA 3NBRA 3WDGB 1GY6A 1Q7HA 3NX0A 1W00A 1JN5A 1I2GA 1GMPA 1STFI 3CC43 1D6ZA 2BNGA 2RBIA 4HKVB 3ZG0A 1IVUA 3D79A 3PGBA 1A2VA 1BRKA 3CNMA 1EQKA 1VQK3 1TP6A 1UCIA 2RNTA 3NHXA 5G1KA 3FG1A 3A76A 4MMYB 5D83A 3G713 2XF3A 3ECFA 2OQEC 3CPOA 1YGWA 2GEYA 2C11A 4R1KA 3JUNA 3N9HA 4EV5A 3FGYA 2W56B 4LMIA 4R80A 3URPA 1ULIB 1S723 3NXJA 1GY7A 2W56A 4KT3B 1SIHA 1PY3A 3CC23 3EF8A 1T5YA 4XBYA 3AMOB 3V98A 1BOXA 1B27A 1PFPA 3TDGA 5M19A 1JZOA 3F8XA 2L4VA 3AMOA 4NPBA 3KN4A 3FF0A 4MEIA 1N8R4 3JVCA 3QK9A 3S29A 4XDVA 4CDLA 1KSIA 2QEX3 3MG2A 1OGXA 2IA7A 1LNHA 3S5CA 4N6UA 3CCE3 4J9AA 1IV7A 5IG0A 1W6GA 3UB1A 1GOVA 5KP3A 1T2HA 1CYVA 2V1LA 3HI7A 1BRJA 2UUGC 5BVBA 2GXFA 1K8A4 3EQQB 3DGYA 3T0UA 2W6JH 1GMQA 3MPHA 5AIIA 3RGRA 3HZPA 1TRPA 4J5GA 3X41A 5JPUA 3B8LA 2WOHA 1GS3A 5D82A 3FCSB 2D42A 3K63A 1JNQA 5ELJA 3DGNA 1BSEA 1RJOA 1K734 1PYLA 3BLZA 2F56A 1TU5A 1J2BA 3D5GA 4KVHA 4WYKB 1OPYA 2QA43 1N8QA 1BRGA 1M1K4 2GBXB 4I5QA 1YJ93 4WYKA 2XGNA 1LQMB 2JDIH 1UUVB 2MC8A 1QJGA 1TIJA 1NB5I 1JZDA 1TFKA 3ZFZA 3EBTA 4HZ9B 1YI23 1JKGB 4CPKA 2CH9A 3KZTA 1JKGA 3MWZA 1RGAA 1BNRA 1X1WA 3T8NA 2YFJB 1FUTA 1RGGA 4BTXA 5I97A 1BSCA 1CH0A 5HOHA 3CCJ3 3KSED 4XDWA 7GSPA 2L1SA 2RSXA 3U1WA 2K54A 1FZUA 2KF3A 2BT3A 2RGQA 4RNTA 4HJLB 1AVLA 4KZ1A 1HKXA 1G0TA 2CIUA 2HMLB 2AAEA 1DMQA 1OGZA 2Y73A 4RNZA 3CCL3 3I553 2KRTA 5JBSA 1FYSA 3B4OA 2R4IA 1BNJA 1DYUA 2E2VA 2H0GA 1TFOA 3X3XA 4QWTA 1BNFA 2BO9B 1US1A 2W2CA 1O7PB 6STDA 2KF4A 1FUSA 4RNYA 1KC84 3FG4A 3SOAA 3OWYA 1B2UA 1YNVX 3GRDA 1IQYA 1UGHI 1U5OA 1UI8A 2CG0A 2Z7AA 4FR9A 1CQSA 3UL5A 1RDSA 1VQL3 4HM3B 5G1LA 5IF6A 1JBRA 3BNDA 3WA3A 3UL6A 2HMJB 3GAXA 4FMDA 1BUQA 3FF2A 2B1XB 4O2HA 3GZRA 1I70A 2ZL8A 1W6YA 1RGCA 4N6MA 4N6TA 1W6CA 1CYUA 3LXUX 2CFKA 9RNTA 1RGEA 4BTYA 3F40A 2C10A 3ER7A 3A5EA 5AI1A 2F86B 2XH9A 2SARA 2KF6A 4KFDA 1DVDA 1Q40B 1B2XA 1ULJB 2R41A 2WGOA 3AGOA 5IEOA 2XSHB 1Q40A 2GBWB 3CD63 5FGOA 2UX0A 1BRHA 3I563 3V92A 3X3YA 3EBYA 4K90B 2CFLA 3G4S3 3F9SA 2F98A 1YIJ3 1SPUA 1X1YA 1M9GA 1QAFA 1QALA 2E2TA 3PCRA 1BSAA 3EC9A 4FMAA 4XM4A 1UCLA 1LRAA 4EBGA 2IY2A 3OWSA 5TGNA 2I9WA 2LYXA 1Z1SA 1T2IA 3HIGA 3MKIA 1RKYA 4HVNA 1QVG2 2ZDJA 3PCSA 1NJI4 2XRXB 1JBSA 3DUKA 3KIIA 4CCVA 5IW9A 1AQZA 4K1VA 1RGFA 1T3BA 2Z77A 3DZLA 1LOWA 1W2B2 3LTDA 1KQS2 1EKMA 4HZBB 2QGUA 4TX4A 5AEUB 7STDA 4O3VA 3ROBA 3PYJA 4EC6A 1R4CA 2H0IA 1M1XB 2CFWA 4HBRA 4BU4A 5BXQA 1MOLA 1ROAA 2CG1A 1LOYA 2FGTA 3AHWA 4OVMA 1MWTA 5HGRA 4RZMA 1VQP3 4N6V0 1YGEA 3N8BA 4LEHA 4X2OA 1OCVA 1BSDA 1RRLA 3DMCA 3Q1CA 2OTJ3 4O02B 3LH4A 1UUGB
chains in the Genus database with same CATH topology
1WTHA 2YX9A 3I0YA 3WA2X 1JB5A 1JV2B 3N54B 1ZX2A 1L5GB 2XGLA 3H51A 4LZIA 3X3ZA 1OUNA 3G16A 4LSOA 5AEWB 4BTWA 1FGOA 5IG5A 5KP4A 3T8UA 3WOFB 3Q90A 3LYGA 2JQ5A 1FGRA 3OV4A 3OW22 1K9M4 2WOFA 2INXA 2XFSA 3B7CA 3SX1A 1UI7A 2RFRA 3BNBA 3LT9A 2A15A 4RBNA 3SLUA 3PS8A 1N5PA 1QMAA 5EEOA 1GY5A 1GYBA 3CCU3 3RGAA 3FSDA 2HMMB 1IK3A 4FCJA 1UW1A 1WNHA 1AV4A 2ML5A 4K61A 5EQLA 1YJN3 3LTCA 3CME3 3EX9A 4ORLA 2RCDA 3RDEA 1NO3A 2F99A 2YFLB 1E97A 3OWUA 1VQN3 3F7SA 5KP1A 4FCZA 4H3UA 1Q7Y4 3DGLA 1IQ8A 2OWPA 2LQVA 2OOVA 1FGMA 3L0RA 2KXGA 3FZWA 5IENA 1FGTA 2MF7A 4I4KA 1VQ83 2O3OA 5DRVA 2M7OA 1VQ63 3EB8A 2Z76A 3K0ZA 1NWWA 8CHOA 1VQ53 1W2ZA 1N9EA 5CF2A 3CCR3 1NDOB 3NM2A 1NB3I 1W4NA 1AR0A 1WMPA 1YIT3 3G8ZA 2KCDA 2XSOB 1WMOA 3JUPA 3IJEB 4HM4B 3BNEA 4XB5A 1FA3A 5AYRB 2FNQA 4HM7B 1M904 3VF1A 1W01A 3GZBA 3IMAB 3Q2PA 4K1UA 4HM1B 5EVHA 1IV9A 3EE1A 2BMRB 3NM7A 1JB2A 4G1MB 3CU3A 2W04A 4R9KA 3MG1A 4EXRA 3UNLA 1O7GB 1MNLA 1Q864 4HYZA 3UJMA 3S67A 3DGMA 1YJW3 2FXTA 2P0XA 2PZVA 2CKFB 3B4PA 3HX8A 4MMXB 2P05A 1N5HA 1IVXA 3K7CA 4KFFA 4PEJA 2OQEA 1GD4A 2CFDA 4U13A 4ZM8A 3CCQ3 1FUWA 4N6OB 4IIAA 4WHAA 3MYTA 1Q42A 1S5AA 1E3VA 3NQZA 3GZYB 3HK4A 1D6UA 3K9MC 1VQ73 1IDPA 1ASKA 3ALAA 3EN8A 1OHSA 4EV2A 1E3RA 4L7KA 3IPTA 2BMOB 3MG3A 2QEX3 1U8CB 2P38A 3PXMA 1A67A 4N6NB 3LTBA 1SQWA 4WFOA 1ISKA 4NREA 4OK0A 1O7MB 2B24B 1W02A 1IT7A 5A0OB 2GU1A 2IUKA 2STDA 3DY5A 4L8PA 1NU3A 5LC6A 4LGQA 2W9PA 1PU4A 3CXC2 2GU3A 1JN5B 1O7HB 2W03A 3CPW2 1OACA 3KFQC 4STDA 3FG3A 1K28A 2K0MA 3MHEA 1OHOA 2CC3A 3LTAA 2CK3H 1ZO2A 4GL6A 4HM8B 1LOXA 2Z6BA 2GEXA 5CXOA 1AVKA 1EG9B 3D3LA 4HM6B 4O8SA 1VQ43 1UUWB 3BNCA 3NBBA 1OF5B 3EHCA 1O7WB 1OF5A 1IT8A 5CLKA 3STDA 3MSOA 1VQ93 2W9QA 3E99A 4WWUC 2CHCA 1TUHA 3CCV3 1D6YA 3CNXA 4AKYA 3F14A 2IMJA 4KFEA 3X42A 3V99A 3JUMA 1YVBI 2CWUA 5AYSC 2O9UX 3CCS3 1KD14 4HM0B 5STDA 4AEQA 4WP5A 2Q07A 1IVWA 4AKZA 2PNCA 5CK6A 5LC7A 1GD3A 5CF1A 1IQXA 3U97A 1CEWI 3SXXA 3NV0B 1VQO3 5JPPA 1VZZA 1IVVA 3EJVA 3NV0A 3BB9A 5D81A 3OX9A 4GB5A 3G6E3 1K41A 2P0MA 3WMDA 1STDA 3PZWA 5AIGA 1JRQA 2CW9A 2YFIB 4FMCA 4H61A 3J7Yd 1DMMA 3SVAA 4JRFA 5G2GA 3SEDA 3DXOA 4OUQA 3S27A 5IG3A 3OXAA 1G96A 4MJDA 1YHQ3 3O8YA 3CMA3 3NBJA 1DVCA 4JF8A 1C7HA 2XR8B 3VSYA 1OH0A 2ML6A 2D1WA 4R4KA 1OHPA 2HMNB 1RN7A 4XBTA 1QAKA 3LZAA 3JUQA 3CCM3 4FMBA 3NQYA 2BHMA 2W0QA 1Q814 3LMLA 2HMOB 2XEPA 4IT7A 4NHFA 3S28A 1W5ZA 3LT8A 3GZXB 2OTL3 1QVF2 1KWIA 5IG4A 3QRDA 3DGOA 4XBXA 3FLJA 3FKAA 3DM8A 4J8TA 3FH1A 2P09A 1FGQA 1ROVA 3WODG 2OOVC 4N6LA 5IEPA 1Q824 4HM5B 5FW5A 2CFGA 5DREA 2BMQB 2Y74A 3KSPA 3F7XA 1A90A 1SIIA 1IU7A 4FCMA 3K5TA 5AIFA 4Q53A 2E2UA 3SOYA 1RRHA 3KE7A 1W7CA 3KKGA 5AIHA 1LVNA 2WO0A 3GWRA 1A2KA 3HIIA 3JUOA 4X2HA 4R9LA 5IERA 1O7NB 3NUVA 1V74A 1DMNA 1SJWA 3D9RA 1HU9A 3F8HA 4IPBA 1KC84 2OCTA 3CC73 3M8CA 2WGQA 4EYCA 3EN1B 3WOEB 3G0KA 3VGNA 1JB4A 1F8NA 2CWTA 2HMKB 3LOYA 2XFTA 3X40A 5ELUA 1VQM3 1EA2A 1Y4KA 4HM2B 4L8OA 2SBLA 4MMZB 4N3VA 3H3HA 2IUJA 1WQLB 1WMNA 1JJ22 1LXEA 1N9JA 2CWVA 2QIYA 3NBRA 3WDGB 1GY6A 3NX0A 1W00A 1JN5A 1STFI 3CC43 1D6ZA 2BNGA 4HKVB 1IVUA 3PGBA 1A2VA 3CNMA 1EQKA 1VQK3 1TP6A 3NHXA 3FG1A 3A76A 4MMYB 5D83A 3G713 2XF3A 3ECFA 2OQEC 3CPOA 2GEYA 2C11A 4R1KA 3JUNA 3N9HA 4EV5A 3FGYA 2W56B 4LMIA 4R80A 1ULIB 1S723 3NXJA 1GY7A 2W56A 1SIHA 3CC23 3EF8A 1T5YA 4XBYA 3AMOB 3V98A 1PFPA 3TDGA 3F8XA 2L4VA 3AMOA 3KN4A 3FF0A 4MEIA 1N8R4 3JVCA 3QK9A 3S29A 4XDVA 4CDLA 1KSIA 3MG2A 1OGXA 2IA7A 1LNHA 3S5CA 4N6UA 4J9AA 1IV7A 5IG0A 1W6GA 3UB1A 5KP3A 1CYVA 2V1LA 3HI7A 5BVBA 2GXFA 1K8A4 3EQQB 3T0UA 2W6JH 3MPHA 5AIIA 3RGRA 3HZPA 3X41A 5JPUA 3CCE3 3B8LA 2WOHA 1GS3A 5D82A 3FCSB 2D42A 3K63A 1JNQA 5ELJA 3DGNA 1J2BA 1RJOA 1K734 3BLZA 1TU5A 4KVHA 4WYKB 1OPYA 2QA43 1N8QA 1M1K4 2GBXB 1YJ93 4WYKA 2XGNA 2JDIH 1UUVB 2MC8A 1QJGA 1TIJA 1NB5I 1TFKA 3EBTA 4HZ9B 1YI23 1JKGB 2CH9A 3KZTA 1JKGA 3MWZA 3T8NA 2YFJB 4BTXA 5I97A 3CCJ3 3KSED 4XDWA 2RSXA 3U1WA 2K54A 2BT3A 2RGQA 4HJLB 1AVLA 4KZ1A 1HKXA 2CIUA 2HMLB 1DMQA 1OGZA 2Y73A 4RNZA 3CCL3 3I553 2KRTA 5JBSA 3B4OA 2R4IA 1DYUA 2E2VA 1TFOA 3X3XA 4QWTA 2BO9B 1US1A 2W2CA 1O7PB 6STDA 4RNYA 3FG4A 3SOAA 3OWYA 3GRDA 1IQYA 1UI8A 1U5OA 2Z7AA 2CG0A 4FR9A 1CQSA 3UL5A 1VQL3 4HM3B 5IF6A 3BNDA 3WA3A 3UL6A 2HMJB 3GAXA 4FMDA 1BUQA 3FF2A 2B1XB 4O2HA 3GZRA 2ZL8A 1W6YA 1CYUA 4N6MA 4N6TA 1W6CA 3LXUX 2CFKA 4BTYA 3F40A 2C10A 3ER7A 5AI1A 2F86B 2XH9A 4KFDA 1DVDA 1Q40B 1ULJB 2WGOA 5IEOA 2XSHB 1Q40A 2GBWB 3CD63 5FGOA 2UX0A 3I563 3V92A 3X3YA 3EBYA 4K90B 2CFLA 3G4S3 3F9SA 2F98A 1YIJ3 1SPUA 1M9GA 1QAFA 1QALA 2E2TA 3PCRA 3EC9A 4FMAA 4XM4A 4EBGA 3OWSA 5TGNA 2I9WA 2LYXA 1Z1SA 3HIGA 1QVG2 3MKIA 1RKYA 4HVNA 2ZDJA 3PCSA 1NJI4 2XRXB 3DUKA 3KIIA 4CCVA 5IW9A 4K1VA 2Z77A 3DZLA 1W2B2 3LTDA 1KQS2 1EKMA 4HZBB 2QGUA 4TX4A 5AEUB 7STDA 4O3VA 3ROBA 3PYJA 4EC6A 1R4CA 1M1XB 2CFWA 4HBRA 5BXQA 1MOLA 1ROAA 2CG1A 2FGTA 4OVMA 5HGRA 4RZMA 1VQP3 4N6V0 1YGEA 3N8BA 4LEHA 4X2OA 1OCVA 1RRLA 3DMCA 3Q1CA 2OTJ3 4O02B 3LH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0Y A;  1JB5 A;  1ZX2 A;  3H51 A;  1OUN A;  3G16 A;  5AEW B;  5IG5 A;  5KP4 A;  3T8U A;  3Q90 A;  3LYG A;  2JQ5 A;  3OV4 A;  2INX A;  3B7C A;  2RFR A;  2A15 A;  1QMA A;  1GY5 A;  1GYB A;  3RGA A;  3FSD A;  2HMM B;  4FCJ A;  3EX9 A;  4ORL A;  2RCD A;  2F99 A;  2YFL B;  1E97 A;  3OWU A;  3F7S A;  5KP1 A;  4H3U A;  2OWP A;  3FZW A;  5IEN A;  4I4K A;  5DRV A;  2Z76 A;  3K0Z A;  1NWW A;  8CHO A;  5CF2 A;  1NDO B;  3NM2 A;  1AR0 A;  3G8Z A;  2XSO B;  3JUP A;  4HM4 B;  4XB5 A;  4HM7 B;  1W01 A;  3GZB A;  4K1U A;  4HM1 B;  5EVH A;  2BMR B;  1JB2 A;  3CU3 A;  4R9K A;  3MG1 A;  3UNL A;  1O7G B;  3UJM A;  2PZV A;  2CKF B;  3B4P A;  3HX8 A;  3K7C A;  4PEJ A;  4U13 A;  4IIA A;  3MYT A;  1Q42 A;  1E3V A;  1S5A A;  3GZY B;  3HK4 A;  1IDP A;  1ASK A;  3EN8 A;  1OHS A;  1E3R A;  4L7K A;  3IPT A;  2BMO B;  3MG3 A;  1ISK A;  1O7M B;  2B24 B;  1W02 A;  2STD A;  4L8P A;  1NU3 A;  4LGQ A;  1JN5 B;  1O7H B;  4STD A;  3MHE A;  1OHO A;  1ZO2 A;  4HM8 B;  2GEX A;  5CXO A;  1EG9 B;  4HM6 B;  1UUW B;  1OF5 B;  3EHC A;  1O7W B;  1OF5 A;  5CLK A;  3STD A;  3MSO A;  3E99 A;  4WWU C;  2CHC A;  1TUH A;  3CNX A;  3F14 A;  2IMJ A;  3JUM A;  4HM0 B;  5STD A;  4WP5 A;  5CK6 A;  5CF1 A;  3NV0 B;  5JPP A;  1VZZ A;  3EJV A;  3NV0 A;  3BB9 A;  5D81 A;  3OX9 A;  4GB5 A;  1K41 A;  3WMD A;  1STD A;  5AIG A;  2YFI B;  1DMM A;  5G2G A;  3SED A;  3DXO A;  4OUQ A;  5IG3 A;  3OXA A;  4MJD A;  1C7H A;  2XR8 B;  3VSY A;  1OH0 A;  1OHP A;  2HMN B;  4XBT A;  3LZA A;  3JUQ A;  2HMO B;  3GZX B;  5IG4 A;  4XBX A;  3FLJ A;  3FKA A;  3DM8 A;  4J8T A;  3FH1 A;  5IEP A;  4HM5 B;  5FW5 A;  5DRE A;  2BMQ B;  3KSP A;  3F7X A;  4FCM A;  5AIF A;  4Q53 A;  3SOY A;  3KE7 A;  3KKG A;  5AIH A;  3GWR A;  1A2K A;  3JUO A;  4X2H A;  4R9L A;  5IER A;  1O7N B;  3NUV A;  3F8H A;  1DMN A;  1SJW A;  3D9R A;  3M8C A;  3EN1 B;  3G0K A;  3VGN A;  1JB4 A;  2HMK B;  1EA2 A;  4HM2 B;  4L8O A;  4N3V A;  3H3H A;  1WQL B;  2QIY A;  3NBR A;  1GY6 A;  1W00 A;  1JN5 A;  2BNG A;  4HKV B;  3CNM A;  1TP6 A;  3NHX A;  3A76 A;  5D83 A;  3ECF A;  3CPO A;  2GEY A;  4R1K A;  3JUN A;  3FGY A;  4LMI A;  1ULI B;  3NXJ A;  1GY7 A;  3EF8 A;  4XBY A;  3F8X A;  3FF0 A;  4CDL A;  4XDV A;  3MG2 A;  1OGX A;  3S5C A;  4J9A A;  5IG0 A;  5KP3 A;  5BVB A;  2GXF A;  3EQQ B;  5AII A;  3RGR A;  3HZP A;  5JPU A;  3B8L A;  5D82 A;  1GS3 A;  3BLZ A;  4KVH A;  4WYK B;  1OPY A;  2GBX B;  4WYK A;  1UUV B;  1QJG A;  3EBT A;  4HZ9 B;  1JKG B;  3KZT A;  1JKG A;  3T8N A;  2YFJ B;  4XDW A;  2K54 A;  2RGQ A;  4HJL B;  1HKX A;  2HML B;  1DMQ A;  1OGZ A;  3B4O A;  2R4I A;  2W2C A;  1O7P B;  6STD A;  3SOA A;  3OWY A;  3GRD A;  1U5O A;  2Z7A A;  1CQS A;  4HM3 B;  5IF6 A;  2HMJ B;  1BUQ A;  3FF2 A;  2B1X B;  3GZR A;  1W6Y A;  3F40 A;  3ER7 A;  5AI1 A;  2F86 B;  1Q40 B;  1ULJ B;  5IEO A;  2XSH B;  1Q40 A;  2GBW B;  2UX0 A;  3EBY A;  3F9S A;  2F98 A;  4XM4 A;  3EC9 A;  3OWS A;  5TGN A;  2I9W A;  1Z1S A;  3MKI A;  4HVN A;  2XRX B;  3DUK A;  4K1V A;  2Z77 A;  3DZL A;  7STD A;  4HZB B;  2QGU A;  5AEU B;  3ROB A;  5BXQ A;  4OVM A;  5HGR A;  4RZM A;  4LEH A;  4X2O A;  1OCV A;  3DMC A; 
#chains in the Genus database with same CATH topology
 1WTH A;  2YX9 A;  3I0Y A;  3WA2 X;  1BUJ A;  1RGK A;  1JB5 A;  1JV2 B;  3N54 B;  3AGN A;  1ZX2 A;  1L5G B;  2XGL A;  3H51 A;  4GSP A;  4LZI A;  3X3Z A;  1OUN A;  3G16 A;  4LSO A;  1BNI A;  5AEW B;  4BTW A;  4BIR A;  1FGO A;  1RLS A;  1BRN L;  5IG5 A;  5KP4 A;  3T8U A;  1BNG A;  3WOF B;  3Q90 A;  1BNS A;  3LYG A;  2JQ5 A;  1FGR A;  1R4Y A;  1X1X A;  3OV4 A;  3OW2 2;  1K9M 4;  2UGI A;  4CJN A;  1RMS A;  2WOF A;  1GOY A;  1B2M A;  2INX A;  2XFS A;  3B7C A;  3SX1 A;  1UI7 A;  2RFR A;  3BNB A;  3LT9 A;  2A15 A;  4RBN A;  3SLU A;  3PS8 A;  2CX1 A;  1N5P A;  1QMA A;  5BU4 A;  5EEO A;  1GY5 A;  1GYB A;  3CCU 3;  4J5K A;  3RGA A;  3FSD A;  2HMM B;  1RSN A;  1IK3 A;  4FCJ A;  1UW1 A;  1I0V A;  1WNH A;  1AV4 A;  2ML5 A;  4K61 A;  5EQL A;  1YJN 3;  1EEJ A;  4DKI A;  3LTC A;  2BU4 A;  3CME 3;  3EX9 A;  4ORL A;  2RCD A;  3RDE A;  1NO3 A;  2F99 A;  2YFL B;  1E97 A;  3OWU A;  1VQN 3;  3F7S A;  5KP1 A;  4FCZ A;  1RNB A;  4H3U A;  1Q7Y 4;  2F5W A;  1NNV A;  1IQ8 A;  2OWP A;  2LQV A;  3DGL A;  2OOV A;  1FGM A;  3L0R A;  1BRS A;  2KXG A;  3FZW A;  5IEN A;  1FGT A;  3D4A A;  2MF7 A;  4I4K A;  1VQ8 3;  2O3O A;  2AAD A;  5DRV A;  5IER A;  2M7O A;  1VQ6 3;  3EB8 A;  5M1A A;  2Z76 A;  1I3I A;  2CX0 A;  3K0Z A;  1NWW A;  8CHO A;  1VQ5 3;  1W2Z A;  1N9E A;  1RGL A;  4ILF A;  5CF2 A;  1NDO B;  3CCR 3;  3NM2 A;  1NB3 I;  1W4N A;  1AR0 A;  1WMP A;  1YIT 3;  3G8Z A;  6GSP A;  2KCD A;  3D5I A;  2XSO B;  1WMO A;  2BIR A;  3JUP A;  3IJE B;  1RTU A;  4HM4 B;  3BNE A;  4XB5 A;  1FA3 A;  5AYR B;  2FNQ A;  4HM7 B;  1M90 4;  3VF1 A;  1W01 A;  3GZB A;  3IMA B;  3Q2P A;  4K1U A;  4HM1 B;  5GSP A;  5EVH A;  1IV9 A;  3EE1 A;  2BMR B;  3NM7 A;  1JB2 A;  4G1M B;  2ZA4 A;  1I2F A;  3CU3 A;  2W04 A;  4R9K A;  3MG1 A;  1G02 A;  3UNL A;  4EXR A;  4HAA A;  1O7G B;  1MNL A;  1Q86 4;  4HYZ A;  3UJM A;  3S67 A;  3DGM A;  1YJW 3;  2FXT A;  2P0X A;  1MGW A;  1I3F A;  2CKF B;  2PZV A;  3B4P A;  3HX8 A;  4MMX B;  2P05 A;  1N5H A;  1IVX A;  3K7C A;  2IYJ A;  1X1U A;  5RNT A;  4KFF A;  4PEJ A;  2OQE A;  1GD4 A;  3Q3F A;  1B2Z A;  2CFD A;  3RNT A;  4U13 A;  2KAA A;  4ZM8 A;  7RNT A;  3CCQ 3;  1FUW A;  1I0X A;  4N6O B;  4IIA A;  4WHA A;  1IYY A;  3MYT A;  1Q42 A;  1S5A A;  1E3V A;  3NQZ A;  1TTO A;  3GZY B;  3HK4 A;  1D6U A;  1SAR A;  3K9M C;  2H0H A;  3ZG5 A;  1BIR A;  1ASK A;  1IDP A;  3ALA A;  1VQ7 3;  3EN8 A;  1BAN A;  1OHS A;  4EV2 A;  1E3R A;  4L7K A;  3IPT A;  2BMO B;  2KF5 A;  1I2E A;  1U8C B;  2P38 A;  3MG3 A;  3PXM A;  8RNT A;  4N6N B;  3LTB A;  1A67 A;  1SQW A;  4WFO A;  1ISK A;  4NRE A;  2ZHX B;  4OK0 A;  1O7M B;  2B24 B;  1W02 A;  1IT7 A;  5A0O B;  2GU1 A;  2IUK A;  2STD A;  1UGI A;  1C54 A;  1UCK A;  3DY5 A;  4L8P A;  1NU3 A;  5LC6 A;  4LGQ A;  2W9P A;  2F5M A;  1PU4 A;  3CXC 2;  2GU3 A;  1JN5 B;  1O7H B;  1ZS7 A;  2W03 A;  5BIR A;  1GMR A;  3CPW 2;  1OAC A;  3KFQ C;  1BAO A;  4STD A;  3FG3 A;  1K28 A;  2K0M A;  2J8X B;  3MHE A;  1OHO A;  2F4Y A;  3BIR A;  6RNT A;  2CC3 A;  3LTA A;  4BL2 A;  1V58 A;  2CK3 H;  1ZO2 A;  4GL6 A;  5M18 A;  4HM8 B;  1B21 A;  3BU4 A;  1LOX A;  1B20 A;  2Z6B A;  4BL3 A;  2GEX A;  5CXO A;  1AVK A;  1EG9 B;  3D3L A;  4HM6 B;  4O8S A;  1VQ4 3;  1LQG C;  1DE3 A;  1UUW B;  2HOH A;  3HOH A;  3BNC A;  3NBB A;  1OF5 B;  3EHC A;  1O7W B;  1OF5 A;  1ZGX A;  1IT8 A;  5CLK A;  3STD A;  3MSO A;  1VQ9 3;  2W9Q A;  3E99 A;  4WWU C;  4HOH A;  4GHO A;  2CHC A;  1BSB A;  1TUH A;  3SYU A;  3CCV 3;  1D6Y A;  1MWR A;  3CNX A;  3F14 A;  2IMJ A;  4KFE A;  3X42 A;  4AKY A;  3V99 A;  3JUM A;  1RNT A;  1YVB I;  2CWU A;  1TJD A;  1RN4 A;  2O9U X;  5AYS C;  3CCS 3;  1KD1 4;  4HM0 B;  5STD A;  1B2S A;  1RHL A;  4AEQ A;  1DET A;  4WP5 A;  2Q07 A;  1IVW A;  4AKZ A;  2PNC A;  5CK6 A;  5LC7 A;  1GD3 A;  5CF1 A;  1IQX A;  3U97 A;  1JBT A;  1CEW I;  3SXX A;  3WR2 A;  3NV0 B;  1VQO 3;  5JPP A;  1BGS A;  1RCL A;  1VZZ A;  1IVV A;  2K3D A;  3EJV A;  3NV0 A;  1V57 A;  1FW7 A;  3BB9 A;  5D81 A;  3OX9 A;  4GB5 A;  3G6E 3;  1K41 A;  2P0M A;  3WMD A;  1BRI A;  1RN1 A;  1STD A;  3PZW A;  5AIG A;  1JRQ A;  1LNI A;  2CW9 A;  1A2P A;  2YFI B;  4FMC A;  4H61 A;  3J7Y d;  1DMM A;  3SVA A;  4JRF A;  5G2G A;  3SED A;  3DXO A;  4OUQ A;  3S27 A;  5IG3 A;  3OXA A;  1G96 A;  4MJD A;  1YHQ 3;  3O8Y A;  3CMA 3;  2C4B A;  3NBJ A;  1DVC A;  4JF8 A;  1C7H A;  2XR8 B;  1YVS A;  3VSY A;  1OH0 A;  2ML6 A;  1BVI A;  2D1W A;  4R4K A;  1OHP A;  2HMN B;  1I8V A;  1RN7 A;  4XBT A;  1QAK A;  1BNE A;  3LZA A;  3JUQ A;  1B3S A;  3CCM 3;  4FMB A;  3NQY A;  2BHM A;  2W0Q A;  1BU4 A;  3LML A;  1Q81 4;  2HMO B;  2XEP A;  3AHS A;  4IT7 A;  4NHF A;  1W5Z A;  3S28 A;  1RCK A;  3LT8 A;  3GZX B;  2OTL 3;  1QVF 2;  1KWI A;  1GOU A;  1RGH A;  2GSP A;  3DGO A;  3QRD A;  5IG4 A;  4XBX A;  3FLJ A;  1UDI I;  3FKA A;  1MWS A;  3DM8 A;  4J8T A;  4LYL B;  1TRQ A;  2P09 A;  1FGQ A;  1ROV A;  3FH1 A;  2OOV C;  4N6L A;  3WOD G;  5IEP A;  1Q82 4;  4HM5 B;  5FW5 A;  2CFG A;  5DRE A;  2BMQ B;  2Y74 A;  3KSP A;  4EW5 A;  3F7X A;  1A90 A;  1LOV A;  1SII A;  1IU7 A;  4FCM A;  3K5T A;  1UCJ A;  1GSP A;  4Q53 A;  3KCH A;  5AIF A;  2E2U A;  1MGR A;  3SOY A;  1RRH A;  3KE7 A;  1W7C A;  3KKG A;  5AIH A;  1LVN A;  2WO0 A;  3GWR A;  1A2K A;  3HII A;  3JUO A;  4X2H A;  1HYF A;  4R9L A;  1O7N B;  3NUV A;  1V74 A;  1DMN A;  1SJW A;  3D9R A;  1HU9 A;  3F8H A;  3GSP A;  1Q9E A;  2OCT A;  4IPB A;  3CC7 3;  3M8C A;  2WGQ A;  4EYC A;  3EN1 B;  1HZ1 A;  3WOE B;  1AY7 A;  3G0K A;  3VGN A;  1JB4 A;  3DH2 A;  1F8N A;  2CWT A;  2HMK B;  3LOY A;  2XFT A;  1VQQ A;  1EUI C;  5ELU A;  3X40 A;  1VQM 3;  1MWU A;  1EA2 A;  1Y4K A;  4HM2 B;  4L8O A;  2SBL A;  4MMZ B;  4N3V A;  3H3H A;  2IUJ A;  1WQL B;  3WHO A;  1WMN A;  1JJ2 2;  1LXE A;  1N9J A;  2CWV A;  2QIY A;  3NBR A;  3WDG B;  1GY6 A;  1Q7H A;  3NX0 A;  1W00 A;  1JN5 A;  1I2G A;  1GMP A;  1STF I;  3CC4 3;  1D6Z A;  2BNG A;  2RBI A;  4HKV B;  3ZG0 A;  1IVU A;  3D79 A;  3PGB A;  1A2V A;  1BRK A;  3CNM A;  1EQK A;  1VQK 3;  1TP6 A;  1UCI A;  2RNT A;  3NHX A;  5G1K A;  3FG1 A;  3A76 A;  4MMY B;  5D83 A;  3G71 3;  2XF3 A;  3ECF A;  2OQE C;  3CPO A;  1YGW A;  2GEY A;  2C11 A;  4R1K A;  3JUN A;  3N9H A;  4EV5 A;  3FGY A;  2W56 B;  4LMI A;  4R80 A;  3URP A;  1ULI B;  1S72 3;  3NXJ A;  1GY7 A;  2W56 A;  4KT3 B;  1SIH A;  1PY3 A;  3CC2 3;  3EF8 A;  1T5Y A;  4XBY A;  3AMO B;  3V98 A;  1BOX A;  1B27 A;  1PFP A;  3TDG A;  5M19 A;  1JZO A;  3F8X A;  2L4V A;  3AMO A;  4NPB A;  3KN4 A;  3FF0 A;  4MEI A;  1N8R 4;  3JVC A;  3QK9 A;  3S29 A;  4XDV A;  4CDL A;  1KSI A;  2QEX 3;  3MG2 A;  1OGX A;  2IA7 A;  1LNH A;  3S5C A;  4N6U A;  3CCE 3;  4J9A A;  1IV7 A;  5IG0 A;  1W6G A;  3UB1 A;  1GOV A;  5KP3 A;  1T2H A;  1CYV A;  2V1L A;  3HI7 A;  1BRJ A;  2UUG C;  5BVB A;  2GXF A;  1K8A 4;  3EQQ B;  3DGY A;  3T0U A;  2W6J H;  1GMQ A;  3MPH A;  5AII A;  3RGR A;  3HZP A;  1TRP A;  4J5G A;  3X41 A;  5JPU A;  3B8L A;  2WOH A;  1GS3 A;  5D82 A;  3FCS B;  2D42 A;  3K63 A;  1JNQ A;  5ELJ A;  3DGN A;  1BSE A;  1RJO A;  1K73 4;  1PYL A;  3BLZ A;  2F56 A;  1TU5 A;  1J2B A;  3D5G A;  4KVH A;  4WYK B;  1OPY A;  2QA4 3;  1N8Q A;  1BRG A;  1M1K 4;  2GBX B;  4I5Q A;  1YJ9 3;  4WYK A;  2XGN A;  1LQM B;  2JDI H;  1UUV B;  2MC8 A;  1QJG A;  1TIJ A;  1NB5 I;  1JZD A;  1TFK A;  3ZFZ A;  3EBT A;  4HZ9 B;  1YI2 3;  1JKG B;  4CPK A;  2CH9 A;  3KZT A;  1JKG A;  3MWZ A;  1RGA A;  1BNR A;  1X1W A;  3T8N A;  2YFJ B;  1FUT A;  1RGG A;  4BTX A;  5I97 A;  1BSC A;  1CH0 A;  5HOH A;  3CCJ 3;  3KSE D;  4XDW A;  7GSP A;  2L1S A;  2RSX A;  3U1W A;  2K54 A;  1FZU A;  2KF3 A;  2BT3 A;  2RGQ A;  4RNT A;  4HJL B;  1AVL A;  4KZ1 A;  1HKX A;  1G0T A;  2CIU A;  2HML B;  2AAE A;  1DMQ A;  1OGZ A;  2Y73 A;  4RNZ A;  3CCL 3;  3I55 3;  2KRT A;  5JBS A;  1FYS A;  3B4O A;  2R4I A;  1BNJ A;  1DYU A;  2E2V A;  2H0G A;  1TFO A;  3X3X A;  4QWT A;  1BNF A;  2BO9 B;  1US1 A;  2W2C A;  1O7P B;  6STD A;  2KF4 A;  1FUS A;  4RNY A;  1KC8 4;  3FG4 A;  3SOA A;  3OWY A;  1B2U A;  1YNV X;  3GRD A;  1IQY A;  1UGH I;  1U5O A;  1UI8 A;  2CG0 A;  2Z7A A;  4FR9 A;  1CQS A;  3UL5 A;  1RDS A;  1VQL 3;  4HM3 B;  5G1L A;  5IF6 A;  1JBR A;  3BND A;  3WA3 A;  3UL6 A;  2HMJ B;  3GAX A;  4FMD A;  1BUQ A;  3FF2 A;  2B1X B;  4O2H A;  3GZR A;  1I70 A;  2ZL8 A;  1W6Y A;  1RGC A;  4N6M A;  4N6T A;  1W6C A;  1CYU A;  3LXU X;  2CFK A;  9RNT A;  1RGE A;  4BTY A;  3F40 A;  2C10 A;  3ER7 A;  3A5E A;  5AI1 A;  2F86 B;  2XH9 A;  2SAR A;  2KF6 A;  4KFD A;  1DVD A;  1Q40 B;  1B2X A;  1ULJ B;  2R41 A;  2WGO A;  3AGO A;  5IEO A;  2XSH B;  1Q40 A;  2GBW B;  3CD6 3;  5FGO A;  2UX0 A;  1BRH A;  3I56 3;  3V92 A;  3X3Y A;  3EBY A;  4K90 B;  2CFL A;  3G4S 3;  3F9S A;  2F98 A;  1YIJ 3;  1SPU A;  1X1Y A;  1M9G A;  1QAF A;  1QAL A;  2E2T A;  3PCR A;  1BSA A;  3EC9 A;  4FMA A;  4XM4 A;  1UCL A;  1LRA A;  4EBG A;  2IY2 A;  3OWS A;  5TGN A;  2I9W A;  2LYX A;  1Z1S A;  1T2I A;  3HIG A;  3MKI A;  1RKY A;  4HVN A;  1QVG 2;  2ZDJ A;  3PCS A;  1NJI 4;  2XRX B;  1JBS A;  3DUK A;  3KII A;  4CCV A;  5IW9 A;  1AQZ A;  4K1V A;  1RGF A;  1T3B A;  2Z77 A;  3DZL A;  1LOW A;  1W2B 2;  3LTD A;  1KQS 2;  1EKM A;  4HZB B;  2QGU A;  4TX4 A;  5AEU B;  7STD A;  4O3V A;  3ROB A;  3PYJ A;  4EC6 A;  1R4C A;  2H0I A;  1M1X B;  2CFW A;  4HBR A;  4BU4 A;  5BXQ A;  1MOL A;  1ROA A;  2CG1 A;  1LOY A;  2FGT A;  3AHW A;  4OVM A;  1MWT A;  5HGR A;  4RZM A;  1VQP 3;  4N6V 0;  1YGE A;  3N8B A;  4LEH A;  4X2O A;  1OCV A;  1BSD A;  1RRL A;  3DMC A;  3Q1C A;  2OTJ 3;  4O02 B;  3LH4 A;  1UUG B; 
#chains in the Genus database with same CATH homology
 1WTH A;  2YX9 A;  3I0Y A;  3WA2 X;  1JB5 A;  1JV2 B;  3N54 B;  1ZX2 A;  1L5G B;  2XGL A;  3H51 A;  4LZI A;  3X3Z A;  1OUN A;  3G16 A;  4LSO A;  5AEW B;  4BTW A;  1FGO A;  5IG5 A;  5KP4 A;  3T8U A;  3WOF B;  3Q90 A;  3LYG A;  2JQ5 A;  1FGR A;  3OV4 A;  3OW2 2;  1K9M 4;  2WOF A;  2INX A;  2XFS A;  3B7C A;  3SX1 A;  1UI7 A;  2RFR A;  3BNB A;  3LT9 A;  2A15 A;  4RBN A;  3SLU A;  3PS8 A;  1N5P A;  1QMA A;  5EEO A;  1GY5 A;  1GYB A;  3CCU 3;  3RGA A;  3FSD A;  2HMM B;  1IK3 A;  4FCJ A;  1UW1 A;  1WNH A;  1AV4 A;  2ML5 A;  4K61 A;  5EQL A;  1YJN 3;  3LTC A;  3CME 3;  3EX9 A;  4ORL A;  2RCD A;  3RDE A;  1NO3 A;  2F99 A;  2YFL B;  1E97 A;  3OWU A;  1VQN 3;  3F7S A;  5KP1 A;  4FCZ A;  4H3U A;  1Q7Y 4;  3DGL A;  1IQ8 A;  2OWP A;  2LQV A;  2OOV A;  1FGM A;  3L0R A;  2KXG A;  3FZW A;  5IEN A;  1FGT A;  2MF7 A;  4I4K A;  1VQ8 3;  2O3O A;  5DRV A;  2M7O A;  1VQ6 3;  3EB8 A;  2Z76 A;  3K0Z A;  1NWW A;  8CHO A;  1VQ5 3;  1W2Z A;  1N9E A;  5CF2 A;  3CCR 3;  1NDO B;  3NM2 A;  1NB3 I;  1W4N A;  1AR0 A;  1WMP A;  1YIT 3;  3G8Z A;  2KCD A;  2XSO B;  1WMO A;  3JUP A;  3IJE B;  4HM4 B;  3BNE A;  4XB5 A;  1FA3 A;  5AYR B;  2FNQ A;  4HM7 B;  1M90 4;  3VF1 A;  1W01 A;  3GZB A;  3IMA B;  3Q2P A;  4K1U A;  4HM1 B;  5EVH A;  1IV9 A;  3EE1 A;  2BMR B;  3NM7 A;  1JB2 A;  4G1M B;  3CU3 A;  2W04 A;  4R9K A;  3MG1 A;  4EXR A;  3UNL A;  1O7G B;  1MNL A;  1Q86 4;  4HYZ A;  3UJM A;  3S67 A;  3DGM A;  1YJW 3;  2FXT A;  2P0X A;  2PZV A;  2CKF B;  3B4P A;  3HX8 A;  4MMX B;  2P05 A;  1N5H A;  1IVX A;  3K7C A;  4KFF A;  4PEJ A;  2OQE A;  1GD4 A;  2CFD A;  4U13 A;  4ZM8 A;  3CCQ 3;  1FUW A;  4N6O B;  4IIA A;  4WHA A;  3MYT A;  1Q42 A;  1S5A A;  1E3V A;  3NQZ A;  3GZY B;  3HK4 A;  1D6U A;  3K9M C;  1VQ7 3;  1IDP A;  1ASK A;  3ALA A;  3EN8 A;  1OHS A;  4EV2 A;  1E3R A;  4L7K A;  3IPT A;  2BMO B;  3MG3 A;  2QEX 3;  1U8C B;  2P38 A;  3PXM A;  1A67 A;  4N6N B;  3LTB A;  1SQW A;  4WFO A;  1ISK A;  4NRE A;  4OK0 A;  1O7M B;  2B24 B;  1W02 A;  1IT7 A;  5A0O B;  2GU1 A;  2IUK A;  2STD A;  3DY5 A;  4L8P A;  1NU3 A;  5LC6 A;  4LGQ A;  2W9P A;  1PU4 A;  3CXC 2;  2GU3 A;  1JN5 B;  1O7H B;  2W03 A;  3CPW 2;  1OAC A;  3KFQ C;  4STD A;  3FG3 A;  1K28 A;  2K0M A;  3MHE A;  1OHO A;  2CC3 A;  3LTA A;  2CK3 H;  1ZO2 A;  4GL6 A;  4HM8 B;  1LOX A;  2Z6B A;  2GEX A;  5CXO A;  1AVK A;  1EG9 B;  3D3L A;  4HM6 B;  4O8S A;  1VQ4 3;  1UUW B;  3BNC A;  3NBB A;  1OF5 B;  3EHC A;  1O7W B;  1OF5 A;  1IT8 A;  5CLK A;  3STD A;  3MSO A;  1VQ9 3;  2W9Q A;  3E99 A;  4WWU C;  2CHC A;  1TUH A;  3CCV 3;  1D6Y A;  3CNX A;  4AKY A;  3F14 A;  2IMJ A;  4KFE A;  3X42 A;  3V99 A;  3JUM A;  1YVB I;  2CWU A;  5AYS C;  2O9U X;  3CCS 3;  1KD1 4;  4HM0 B;  5STD A;  4AEQ A;  4WP5 A;  2Q07 A;  1IVW A;  4AKZ A;  2PNC A;  5CK6 A;  5LC7 A;  1GD3 A;  5CF1 A;  1IQX A;  3U97 A;  1CEW I;  3SXX A;  3NV0 B;  1VQO 3;  5JPP A;  1VZZ A;  1IVV A;  3EJV A;  3NV0 A;  3BB9 A;  5D81 A;  3OX9 A;  4GB5 A;  3G6E 3;  1K41 A;  2P0M A;  3WMD A;  1STD A;  3PZW A;  5AIG A;  1JRQ A;  2CW9 A;  2YFI B;  4FMC A;  4H61 A;  3J7Y d;  1DMM A;  3SVA A;  4JRF A;  5G2G A;  3SED A;  3DXO A;  4OUQ A;  3S27 A;  5IG3 A;  3OXA A;  1G96 A;  4MJD A;  1YHQ 3;  3O8Y A;  3CMA 3;  3NBJ A;  1DVC A;  4JF8 A;  1C7H A;  2XR8 B;  3VSY A;  1OH0 A;  2ML6 A;  2D1W A;  4R4K A;  1OHP A;  2HMN B;  1RN7 A;  4XBT A;  1QAK A;  3LZA A;  3JUQ A;  3CCM 3;  4FMB A;  3NQY A;  2BHM A;  2W0Q A;  1Q81 4;  3LML A;  2HMO B;  2XEP A;  4IT7 A;  4NHF A;  3S28 A;  1W5Z A;  3LT8 A;  3GZX B;  2OTL 3;  1QVF 2;  1KWI A;  5IG4 A;  3QRD A;  3DGO A;  4XBX A;  3FLJ A;  3FKA A;  3DM8 A;  4J8T A;  3FH1 A;  2P09 A;  1FGQ A;  1ROV A;  3WOD G;  2OOV C;  4N6L A;  5IEP A;  1Q82 4;  4HM5 B;  5FW5 A;  2CFG A;  5DRE A;  2BMQ B;  2Y74 A;  3KSP A;  3F7X A;  1A90 A;  1SII A;  1IU7 A;  4FCM A;  3K5T A;  5AIF A;  4Q53 A;  2E2U A;  3SOY A;  1RRH A;  3KE7 A;  1W7C A;  3KKG A;  5AIH A;  1LVN A;  2WO0 A;  3GWR A;  1A2K A;  3HII A;  3JUO A;  4X2H A;  4R9L A;  5IER A;  1O7N B;  3NUV A;  1V74 A;  1DMN A;  1SJW A;  3D9R A;  1HU9 A;  3F8H A;  4IPB A;  1KC8 4;  2OCT A;  3CC7 3;  3M8C A;  2WGQ A;  4EYC A;  3EN1 B;  3WOE B;  3G0K A;  3VGN A;  1JB4 A;  1F8N A;  2CWT A;  2HMK B;  3LOY A;  2XFT A;  3X40 A;  5ELU A;  1VQM 3;  1EA2 A;  1Y4K A;  4HM2 B;  4L8O A;  2SBL A;  4MMZ B;  4N3V A;  3H3H A;  2IUJ A;  1WQL B;  1WMN A;  1JJ2 2;  1LXE A;  1N9J A;  2CWV A;  2QIY A;  3NBR A;  3WDG B;  1GY6 A;  3NX0 A;  1W00 A;  1JN5 A;  1STF I;  3CC4 3;  1D6Z A;  2BNG A;  4HKV B;  1IVU A;  3PGB A;  1A2V A;  3CNM A;  1EQK A;  1VQK 3;  1TP6 A;  3NHX A;  3FG1 A;  3A76 A;  4MMY B;  5D83 A;  3G71 3;  2XF3 A;  3ECF A;  2OQE C;  3CPO A;  2GEY A;  2C11 A;  4R1K A;  3JUN A;  3N9H A;  4EV5 A;  3FGY A;  2W56 B;  4LMI A;  4R80 A;  1ULI B;  1S72 3;  3NXJ A;  1GY7 A;  2W56 A;  1SIH A;  3CC2 3;  3EF8 A;  1T5Y A;  4XBY A;  3AMO B;  3V98 A;  1PFP A;  3TDG A;  3F8X A;  2L4V A;  3AMO A;  3KN4 A;  3FF0 A;  4MEI A;  1N8R 4;  3JVC A;  3QK9 A;  3S29 A;  4XDV A;  4CDL A;  1KSI A;  3MG2 A;  1OGX A;  2IA7 A;  1LNH A;  3S5C A;  4N6U A;  4J9A A;  1IV7 A;  5IG0 A;  1W6G A;  3UB1 A;  5KP3 A;  1CYV A;  2V1L A;  3HI7 A;  5BVB A;  2GXF A;  1K8A 4;  3EQQ B;  3T0U A;  2W6J H;  3MPH A;  5AII A;  3RGR A;  3HZP A;  3X41 A;  5JPU A;  3CCE 3;  3B8L A;  2WOH A;  1GS3 A;  5D82 A;  3FCS B;  2D42 A;  3K63 A;  1JNQ A;  5ELJ A;  3DGN A;  1J2B A;  1RJO A;  1K73 4;  3BLZ A;  1TU5 A;  4KVH A;  4WYK B;  1OPY A;  2QA4 3;  1N8Q A;  1M1K 4;  2GBX B;  1YJ9 3;  4WYK A;  2XGN A;  2JDI H;  1UUV B;  2MC8 A;  1QJG A;  1TIJ A;  1NB5 I;  1TFK A;  3EBT A;  4HZ9 B;  1YI2 3;  1JKG B;  2CH9 A;  3KZT A;  1JKG A;  3MWZ A;  3T8N A;  2YFJ B;  4BTX A;  5I97 A;  3CCJ 3;  3KSE D;  4XDW A;  2RSX A;  3U1W A;  2K54 A;  2BT3 A;  2RGQ A;  4HJL B;  1AVL A;  4KZ1 A;  1HKX A;  2CIU A;  2HML B;  1DMQ A;  1OGZ A;  2Y73 A;  4RNZ A;  3CCL 3;  3I55 3;  2KRT A;  5JBS A;  3B4O A;  2R4I A;  1DYU A;  2E2V A;  1TFO A;  3X3X A;  4QWT A;  2BO9 B;  1US1 A;  2W2C A;  1O7P B;  6STD A;  4RNY A;  3FG4 A;  3SOA A;  3OWY A;  3GRD A;  1IQY A;  1UI8 A;  1U5O A;  2Z7A A;  2CG0 A;  4FR9 A;  1CQS A;  3UL5 A;  1VQL 3;  4HM3 B;  5IF6 A;  3BND A;  3WA3 A;  3UL6 A;  2HMJ B;  3GAX A;  4FMD A;  1BUQ A;  3FF2 A;  2B1X B;  4O2H A;  3GZR A;  2ZL8 A;  1W6Y A;  1CYU A;  4N6M A;  4N6T A;  1W6C A;  3LXU X;  2CFK A;  4BTY A;  3F40 A;  2C10 A;  3ER7 A;  5AI1 A;  2F86 B;  2XH9 A;  4KFD A;  1DVD A;  1Q40 B;  1ULJ B;  2WGO A;  5IEO A;  2XSH B;  1Q40 A;  2GBW B;  3CD6 3;  5FGO A;  2UX0 A;  3I56 3;  3V92 A;  3X3Y A;  3EBY A;  4K90 B;  2CFL A;  3G4S 3;  3F9S A;  2F98 A;  1YIJ 3;  1SPU A;  1M9G A;  1QAF A;  1QAL A;  2E2T A;  3PCR A;  3EC9 A;  4FMA A;  4XM4 A;  4EBG A;  3OWS A;  5TGN A;  2I9W A;  2LYX A;  1Z1S A;  3HIG A;  1QVG 2;  3MKI A;  1RKY A;  4HVN A;  2ZDJ A;  3PCS A;  1NJI 4;  2XRX B;  3DUK A;  3KII A;  4CCV A;  5IW9 A;  4K1V A;  2Z77 A;  3DZL A;  1W2B 2;  3LTD A;  1KQS 2;  1EKM A;  4HZB B;  2QGU A;  4TX4 A;  5AEU B;  7STD A;  4O3V A;  3ROB A;  3PYJ A;  4EC6 A;  1R4C A;  1M1X B;  2CFW A;  4HBR A;  5BXQ A;  1MOL A;  1ROA A;  2CG1 A;  2FGT A;  4OVM A;  5HGR A;  4RZM A;  1VQP 3;  4N6V 0;  1YGE A;  3N8B A;  4LEH A;  4X2O A;  1OCV A;  1RRL A;  3DMC A;  3Q1C A;  2OTJ 3;  4O02 B;  3LH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...