2CKFB

Crystal structure of the terminal component of the pah-hydroxylating dioxygenase from sphingomonas sp chy-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
170
structure length
170
Chain Sequence
QVPVTPDVHYAVEAHYRAEVRLLQTGQYREWLHGMVAEDIHYWMPIYEQRFVRDRRPDPTPDDAAIYNDDFEELKQRVERLYSGQVWMEDPPSKIRYFVSNVEAFEAENGELDVLSNILVYRNRRQTEVTVHTLGREDKLRQDGNGFKVFRRKLILDARVTQDKNLYFFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RING-HYDROXYLATING DIOXYGENASE ALPHA SUBUNIT
publication title The Catalytic Pocket of the Ring-Hydroxylating Dioxygenase from Sphingomonas Chy-1.
pubmed doi rcsb
source organism Sphingomonas sp.
molecule tags Oxidoreductase
total genus 47
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ckfB00
3MSOA 1O7PB 1W6YA 3FH1A 3EBTA 1VZZA 1GY5A 3JUQA 1Z1SA 1JN5B 4GB5A 3F40A 4XBTA 2QIYA 3NXJA 2RCDA 4FCMA 3T8NA 3ER7A 3GZYB 3LYGA 3MG1A 3FZWA 3K0ZA 1O7MB 3B8LA 1CQSA 5G2GA 4RZMA 1IDPA 2Z7AA 5CXOA 3OWSA 3KE7A 5AEUB 4HM5B 5IEOA 3GZBA 5IG4A 3JUMA 3SOYA 1ISKA 3VSYA 1O7HB 1JN5A 3FF0A 1HKXA 4MJDA 3EHCA 1O7WB 3MYTA 3OWYA 1OHSA 1SJWA 5AIGA 1QMAA 4L7KA 1O7NB 4HZ9B 1U5OA 3NBRA 5IERA 4HM2B 1E3RA 5CF1A 1AR0A 5D83A 1W02A 1TP6A 2B24B 2XSHB 4FCJA 4HM1B 4R9KA 3CNXA 1OH0A 1STDA 4LEHA 2I9WA 4R1KA 4HZBB 4Q53A 4WWUC 4STDA 3NM2A 5AI1A 2XR8B 3MHEA 2QGUA 1E3VA 3H51A 3HX8A 2INXA 4WYKA 1OUNA 3F8XA 1QJGA 5IEPA 2HMLB 1OCVA 3UJMA 1GY6A 3MG3A 2HMNB 5JPPA 1NWWA 2GBWB 5HGRA 3EBYA 3H3HA 4LGQA 3F7SA 4XBXA 3GZRA 1Q40A 3EJVA 5BXQA 3M8CA 2Z77A 1DMMA 3F9SA 3ECFA 3F14A 4X2HA 4OUQA 2HMOB 3STDA 4XBYA 1O7GB 4K1VA 1Q42A 3GWRA 3HK4A 4J8TA 1GY7A 5CLKA 5AIFA 3T8UA 4XDVA 1OHPA 2CHCA 5AEWB 5BVBA 1GYBA 3HZPA 1W01A 3DM8A 5AIHA 3VGNA 1EA2A 1S5AA 4HKVB 3SEDA 3JUNA 3RGAA 1EG9B 3LZAA 4ORLA 1K41A 3BLZA 1A2KA 4CDLA 3GRDA 3K7CA 3D9RA 4HM4B 5KP4A 3OXAA 4WYKB 3GZXB 2HMJB 3DZLA 1DMQA 2YFIB 4OVMA 1NDOB 2K54A 3EN1B 2B1XB 1WQLB 5DRVA 3DMCA 1C7HA 2STDA 2W2CA 2GBXB 1JKGA 3FSDA 3UNLA 2BMRB 3CU3A 4HJLB 3EX9A 4U13A 3WMDA 3FGYA 3EC9A 2GEYA 3Q90A 5IG5A 1TUHA 2RFRA 3G0KA 2Z76A 3G16A 3JUOA 5FW5A 2GXFA 2IMJA 3BB9A 1ASKA 4R9LA 1ZO2A 3F7XA 1OF5A 1Q40B 2YFJB 2XSOB 1OPYA 2HMMB 2R4IA 3FKAA 3OX9A 1BUQA 3G8ZA 2A15A 5STDA 5D81A 4KVHA 3MG2A 3A76A 3NV0A 4HVNA 3B4OA 4L8PA 4N3VA 5KP3A 1ULJB 5IF6A 3B4PA 3NHXA 1GS3A 5CK6A 4I4KA 3I0YA 2UX0A 1OGXA 4HM8B 4XDWA 3OV4A 3ROBA 2BMOB 3KZTA 4LMIA 1JB5A 5IG3A 3OWUA 2F86B 2CKFB 3FF2A 5D82A 3EF8A 2BMQB 1JKGB 5TGNA 2XRXB 4HM7B 1ULIB 6STDA 3DUKA 1OGZA 3SOAA 3KKGA 4HM6B 1UUVB 5IG0A 2F99A 1JB2A 3KSPA 5KP1A 1DMNA 3RGRA 1OF5B 3EQQB 3FLJA 2OWPA 1W00A 3E99A 1NU3A 2YFLB 1JB4A 4XB5A 2BNGA 2RGQA 3NUVA 3NV0B 5DREA 4L8OA 5EVHA 3JUPA 4XM4A 4K1UA 2GEXA 3S5CA 5IENA 3CNMA 2PZVA 4WP5A 8CHOA 1ZX2A 3B7CA 4PEJA 1UUWB 4HM3B 4X2OA 5AIIA 5JPUA 7STDA 1OHOA 3DXOA 3EN8A 4J9AA 4IIAA 4HM0B 2JQ5A 5CF2A 1E97A 3MKIA 2F98A 2HMKB 3IPTA 3CPOA 4H3UA 3F8HA
chains in the Genus database with same CATH superfamily
3MSOA 1UCJA 1O7PB 1X1UA 1AVLA 1W6YA 1K8A4 1RN4A 3N9HA 1SIHA 2W6JH 3FH1A 1RGHA 3CPW2 3EBTA 2GSPA 1BNJA 1VZZA 1GY5A 3AGNA 1EKMA 1OACA 1RJOA 3JUQA 4R80A 1Q824 1Z1SA 3WR2A 2KF5A 1JN5B 2ZHXB 4GB5A 5GSPA 1T5YA 2KF6A 2CW9A 3F40A 4XBTA 1BNFA 1YNVX 2QIYA 1I0XA 3KIIA 3NXJA 2RCDA 1QAKA 1IQYA 4FCMA 1YJW3 3T8NA 1JZDA 2PNCA 1D6ZA 1JNQA 1YJN3 1BNGA 2K3DA 3ER7A 1LOYA 2OQEA 3GZYB 5BU4A 3LYGA 3MG1A 4MMYB 1PU4A 3CCU3 3FZWA 5M19A 3QRDA 1UGIA 3K0ZA 1JV2B 1O7MB 3RDEA 1YIJ3 1ROVA 1YI23 2FGTA 1I2GA 3B8LA 4ILFA 1CQSA 5G2GA 4RZMA 1IDPA 2Z7AA 3QK9A 1T2HA 5CXOA 1BSCA 2WOHA 3OWSA 3KE7A 5AEUB 2F5MA 2P0MA 4HM5B 5IEOA 4I5QA 3DGOA 2Z6BA 1QAFA 2M7OA 1MOLA 3CCE3 1IVXA 5ELJA 3GZBA 5AYSC 5IG4A 1LOXA 2QA43 5ELUA 1AV4A 3CME3 3JUMA 3SOYA 1X1XA 3CC43 3VSYA 1O7HB 1JN5A 1ISKA 1HYFA 3FF0A 1JBTA 1HKXA 1RN7A 3LT8A 4MJDA 3EHCA 1O7WB 2XH9A 3X40A 2FXTA 4EXRA 1BRHA 3MYTA 3OWYA 4EC6A 1OHSA 2CIUA 3CCV3 1ZGXA 3CC73 1NJI4 2KXGA 1SJWA 1US1A 5AIGA 1QMAA 2WO0A 4O02B 3LTDA 1JBSA 4L7KA 1O7NB 3PS8A 2SARA 1SIIA 4HZ9B 5JBSA 2CWTA 3IJEB 1U5OA 4RNZA 2CX0A 3HIGA 3NBRA 4EW5A 5IERA 1JRQA 3WOFB 1QVF2 4HM2B 1IVVA 2KRTA 3K9MC 1E3RA 1V58A 4BL2A 5BIRA 4J5KA 1RTUA 1UCIA 3S67A 5CF1A 1CYVA 1AR0A 1BIRA 3BU4A 5D83A 1W02A 4R4KA 1UGHI 1RKYA 1TP6A 3WA3A 2B24B 2XSHB 3I563 4FCJA 4HM1B 2OOVC 4R9KA 2CH9A 3CNXA 3FG3A 1OH0A 1STDA 3CD63 1G96A 2UUGC 4LEHA 2I9WA 4N6V0 4R1KA 1KD14 1BSAA 3UB1A 4HZBB 1UCLA 3DGMA 1GOVA 2KCDA 2BO9B 2BU4A 5M1AA 3NBJA 3SYUA 1WMPA 1FGMA 6GSPA 3SLUA 2RNTA 3DGLA 4Q53A 2IY2A 4WWUC 1VQ93 3V92A 3AGOA 1DVDA 1B27A 4STDA 3CCL3 3NQZA 2KF3A 1W5ZA 3NM2A 5RNTA 4HAAA 4TX4A 1BNSA 5AI1A 3UL5A 2XR8B 3MHEA 2QGUA 1E3VA 4N6OB 3H51A 3CCR3 1TTOA 1W4NA 3HX8A 2INXA 5IW9A 3V98A 1D6YA 1W6CA 2C4BA 1ZS7A 4DKIA 1RGAA 1UI8A 4WYKA 1VQ83 2AAEA 5IF6A 2O3OA 1OUNA 3D79A 2O9UX 1HU9A 3F8XA 3K63A 1FGOA 4BU4A 3UL6A 1R4CA 1KSIA 2V1LA 4N6UA 1BU4A 1LVNA 4RBNA 1QJGA 4ZM8A 1DYUA 3DH2A 5IEPA 1PY3A 1Y4KA 2HMLB 1OCVA 2H0IA 2W03A 3UJMA 1Q814 1YHQ3 1M904 1GY6A 1B2SA 1RGKA 4RNTA 1KQS2 1C54A 3WDGB 3MG3A 2XFSA 1I3FA 1RGCA 4K61A 4CJNA 1LQGC 1IV7A 5LC6A 1JBRA 3X3ZA 1WNHA 2CG1A 2KF4A 2HMNB 2XF3A 1RSNA 4HBRA 5JPPA 1YGWA 3S28A 1NWWA 2GBWB 4WFOA 1G0TA 2ZA4A 5HGRA 1TFKA 3ZG0A 1YVBI 3EBYA 5AYRB 3H3HA 4LGQA 3CCJ3 3F7SA 4XBXA 1IQ8A 2H0GA 3GZRA 1IT7A 1IV9A 1NNVA 1UCKA 3LH4A 1Q40A 1LOWA 1RDSA 1EUIC 3EJVA 4FMBA 3U1WA 3M8CA 2XFTA 5BXQA 3OW22 3FG4A 1A67A 2Z77A 1DMMA 3F9SA 1PFPA 3ECFA 1BSEA 3F14A 3HOHA 4X2HA 4OUQA 1FUWA 2Y74A 1RHLA 3WA2X 3DGYA 1N9EA 2HMOB 3STDA 1B3SA 1VQQA 4XBYA 1BVIA 1N5HA 1O7GB 3PGBA 3MWZA 4K1VA 3KSED 1Q42A 3GWRA 2SBLA 3HK4A 1FUTA 4LYLB 4J8TA 1GY7A 1B2MA 3D5GA 5CLKA 1RCLA 5AIFA 1WMNA 3T8UA 4XDVA 1CEWI 1OHPA 1D6UA 2CHCA 3WHOA 3TDGA 5AEWB 4IPBA 1CYUA 1UW1A 1J2BA 1S723 5BVBA 3ZFZA 1GYBA 3DY5A 1RGGA 3CMA3 3HZPA 1STFI 1W01A 4OK0A 3DM8A 1GMPA 3GAXA 2JDIH 5AIHA 3VGNA 1EA2A 2CWVA 1N9JA 1S5AA 1BRKA 3FG1A 4HKVB 1R4YA 2IUJA 3SEDA 1BUJA 1LQMB 1RN1A 1BRIA 3JUNA 3WODG 3RGAA 1EG9B 3LZAA 2W0QA 1BANA 1GMQA 4ORLA 1K41A 4WHAA 3SXXA 3BLZA 1A2KA 1RLSA 4KFDA 4CDLA 3Q3FA 1LXEA 4CCVA 3GRDA 2F5WA 2QEX3 1UI7A 2CFGA 1DE3A 4N6LA 3K7CA 2E2VA 2P09A 2R41A 1N8QA 3D9RA 1DVCA 3L0RA 4HM4B 1IT8A 3GSPA 5KP4A 3OXAA 4WYKB 4BTWA 4IT7A 3GZXB 1M9GA 2H0HA 2HMJB 3DZLA 4MEIA 4LZIA 2ZDJA 1IK3A 1Q9EA 1DMQA 2YFIB 4JF8A 3X42A 3AHWA 3BIRA 4OVMA 1VQM3 1NB5I 1GD3A 1FGTA 1NDOB 3VF1A 3BNCA 5M18A 1A90A 2K54A 3EN1B 4FCZA 2B1XB 2LQVA 3D3LA 3X3YA 2CX1A 1MGWA 2KAAA 2XGLA 1WQLB 2P0XA 5DRVA 3DMCA 1C7HA 2STDA 2W2CA 1MWRA 2GBXB 1IQXA 1JKGA 3WOEB 3DGNA 3CCQ3 1QVG2 2IA7A 1VQ53 3FSDA 7GSPA 1K734 1BOXA 2CFKA 3UNLA 2BMRB 3CU3A 3LTAA 2J8XB 4HJLB 3G6E3 3EX9A 1EEJA 2OCTA 4U13A 4LSOA 1BRSA 2RSXA 2ZL8A 1LNIA 4KFFA 1IU7A 3EE1A 3BNEA 3WMDA 3FGYA 1TJDA 3MPHA 3AMOA 1LNHA 3EC9A 1SPUA 4NPBA 2GEYA 1RGEA 3Q90A 1TUHA 5EQLA 1X1WA 2RFRA 5HOHA 5IG5A 1SARA 1IVUA 3X3XA 4N6TA 3G0KA 2Z76A 3G16A 3JUOA 5FW5A 2F4YA 2GXFA 3URPA 2IMJA 3BB9A 1K9M4 1ASKA 4R9LA 4EBGA 1ZO2A 1VQ73 1A2VA 3F7XA 2W56A 1OF5A 3KN4A 1BRGA 1Q40B 3G4S3 1EQKA 2YFJB 1WMOA 1MNLA 1W2ZA 4HOHA 2OQEC 2GU1A 3ALAA 3ZG5A 4RNYA 2XSOB 1N5PA 1Q7Y4 2WGQA 1B21A 3D4AA 1IYYA 4AEQA 3KFQC 1OPYA 2HMMB 2R4IA 3FKAA 3OX9A 1BUQA 1RMSA 1JJ22 3G8ZA 8RNTA 2A15A 3Q2PA 1RGFA 7RNTA 5STDA 5D81A 1FA3A 1FYSA 4KVHA 1RNBA 1MWTA 3A76A 3MG2A 1YVSA 3NV0A 3RNTA 3CCM3 1GOYA 4GHOA 1TRPA 2RBIA 4BTXA 3NBBA 1I8VA 1VQL3 1V74A 1NB3I 1WTHA 3HI7A 4HVNA 1FZUA 2XEPA 2CFLA 3B4OA 1BNRA 4L8PA 3X41A 4N3VA 5KP3A 1GSPA 1ULJB 3B4PA 3Q1CA 1B2UA 4K90B 4O2HA 1IVWA 3V99A 1F8NA 2F56A 2FNQA 3NHXA 3PCSA 4FMCA 4KT3B 1GS3A 2IUKA 5G1KA 5LC7A 2CG0A 4EV2A 5CK6A 1W7CA 4NHFA 3CC23 1GD4A 2E2TA 4I4KA 4J5GA 3N54B 1BRJA 3I0YA 2UX0A 1A2PA 3LT9A 1OGXA 3LTCA 4HM8B 3J7Yd 3S27A 1GMRA 1HZ1A 4XDWA 5EEOA 2P38A 3LXUX 3PZWA 3OV4A 4GSPA 3S29A 1UUGB 9RNTA 5I97A 1FGRA 3ROBA 1ROAA 1UDII 2BMOB 1BNEA 2E2UA 1RGLA 3KZTA 4QWTA 4LMIA 1I70A 1JB5A 3PYJA 5IG3A 4JRFA 1VQ63 1VQP3 3OWUA 2MC8A 2F86B 2CKFB 4O3VA 4H61A 3LTBA 4FR9A 1LOVA 1I2FA 3FF2A 3T0UA 5D82A 3CXC2 1RRHA 1RNTA 2HOHA 3EF8A 2BMQB 3LOYA 5FGOA 1JKGB 4G1MB 1NO3A 2XGNA 5TGNA 3IMAB 1RCKA 2WGOA 2XRXB 4HM7B 1DETA 4N6MA 2W9PA 2LYXA 1ULIB 4BTYA 2OTL3 1QALA 2IYJA 3G713 1I3IA 1VQO3 6STDA 3DUKA 1OGZA 3SOAA 3HIIA 1PYLA 1W2B2 3K5TA 1B2XA 1MWUA 3AMOB 1FW7A 3KKGA 4HM6B 4MMXB 1YIT3 4EV5A 1T2IA 1UUVB 1VQN3 5IG0A 1TIJA 4NREA 2F99A 2CFWA 4EYCA 2CK3H 3SVAA 4N6NB 3A5EA 1SQWA 2AADA 4FMAA 1JB2A 2L1SA 3KSPA 5KP1A 1DMNA 2W56B 2WOFA 1OF5B 3RGRA 3EQQB 4AKYA 3FLJA 2ML5A 1Q7HA 2OWPA 2C11A 1BNIA 1FGQA 1W00A 1GOUA 3E99A 4FMDA 2BHMA 1NU3A 1KC84 3NM7A 1L5GB 1Q864 2YFLB 1JB4A 4XB5A 1AY7A 1YGEA 1CH0A 2C10A 4CPKA 1G02A 2BNGA 1K28A 2RGQA 3BNBA 3EB8A 3NUVA 3I553 1MWSA 4BL3A 2CC3A 1M1K4 3CCS3 4BIRA 3NV0B 3SX1A 3N8BA 2K0MA 2Y73A 1M1XB 4L8OA 5DREA 5EVHA 3O8YA 3PXMA 1TFOA 3U97A 2W04A 2CWUA 1TRQA 3JUPA 1YJ93 1I2EA 3BNDA 3KCHA 1B2ZA 4XM4A 4K1UA 1BGSA 2GEXA 2Q07A 3D5IA 2GU3A 4HYZA 3S5CA 1LRAA 1X1YA 5IENA 3CNMA 2PZVA 2BIRA 2D1WA 4KZ1A 4WP5A 8CHOA 1ZX2A 2L4VA 1BAOA 3B7CA 4PEJA 3FCSB 1UUWB 4AKZA 1AVKA 1BSDA 1AQZA 4KFEA 4HM3B 1U8CB 4MMZB 1W6GA 4X2OA 3AHSA 1FUSA 3PCRA 1VQK3 2YX9A 5AIIA 4GL6A 5JPUA 7STDA 1OHOA 3DXOA 3EN8A 4J9AA 1I0VA 3JVCA 4IIAA 1T3BA 4HM0B 4O8SA 2CFDA 2ML6A 2JQ5A 2UGIA 5G1LA 5CF2A 1E97A 2W9QA 1JZOA 1BSBA 1TU5A 3MKIA 1BRNL 2F98A 1RRLA 1N8R4 1V57A 3LMLA 2OTJ3 2BT3A 2HMKB 1VQ43 3IPTA 2P05A 3CPOA 1B20A 3NQYA 4H3UA 1MGRA 2OOVA 5A0OB 1KWIA 2MF7A 6RNTA 3F8HA 2D42A 3NX0A
chains in the Genus database with same CATH topology
3MSOA 1O7PB 1AVLA 1W6YA 1K8A4 3N9HA 1SIHA 2W6JH 3FH1A 3CPW2 3EBTA 1VZZA 1GY5A 1EKMA 1OACA 1RJOA 3JUQA 4R80A 1Q824 1Z1SA 1JN5B 4GB5A 1T5YA 2CW9A 3F40A 4XBTA 2QIYA 3KIIA 3NXJA 2RCDA 1QAKA 1IQYA 4FCMA 1YJW3 3T8NA 2PNCA 1D6ZA 1JNQA 1YJN3 3ER7A 2OQEA 3GZYB 3LYGA 3MG1A 4MMYB 1PU4A 3CCU3 3FZWA 3QRDA 3K0ZA 1JV2B 1O7MB 3RDEA 1YIJ3 1ROVA 1YI23 2FGTA 3B8LA 1CQSA 5G2GA 4RZMA 1IDPA 2Z7AA 3QK9A 5CXOA 2WOHA 3OWSA 3KE7A 5AEUB 2P0MA 4HM5B 5IEOA 3DGOA 2Z6BA 1QAFA 2M7OA 1MOLA 3CCE3 1IVXA 5ELJA 3GZBA 5AYSC 5IG4A 1LOXA 2QA43 5ELUA 1AV4A 3CME3 3JUMA 3SOYA 3CC43 1ISKA 3VSYA 1O7HB 1JN5A 3FF0A 1HKXA 1RN7A 3LT8A 4MJDA 3EHCA 1O7WB 2XH9A 3X40A 2FXTA 4EXRA 3MYTA 3OWYA 4EC6A 1OHSA 2CIUA 3CCV3 1NJI4 2KXGA 1SJWA 1US1A 5AIGA 1QMAA 2WO0A 4O02B 3LTDA 4L7KA 1O7NB 3PS8A 1SIIA 4HZ9B 5JBSA 2CWTA 3IJEB 1U5OA 4RNZA 3HIGA 3NBRA 5IERA 1JRQA 3WOFB 1QVF2 4HM2B 1IVVA 2KRTA 3K9MC 1E3RA 3S67A 5CF1A 1CYVA 1AR0A 5D83A 1W02A 4R4KA 1RKYA 1TP6A 3WA3A 2B24B 2XSHB 3I563 4FCJA 4HM1B 2OOVC 4R9KA 2CH9A 3CNXA 3FG3A 1OH0A 1STDA 3CD63 1G96A 4LEHA 2I9WA 4N6V0 4R1KA 1KD14 3UB1A 4HZBB 3DGMA 2KCDA 2BO9B 3NBJA 1WMPA 1FGMA 3SLUA 3DGLA 4Q53A 4WWUC 1VQ93 3V92A 1DVDA 4STDA 3CCL3 3NQZA 1W5ZA 3NM2A 3UL5A 4TX4A 5AI1A 2XR8B 3MHEA 2QGUA 1E3VA 4N6OB 3H51A 3CCR3 1W4NA 3HX8A 2INXA 5IW9A 3V98A 1D6YA 1W6CA 1UI8A 4WYKA 1VQ83 2O3OA 1OUNA 3K63A 2O9UX 1HU9A 3F8XA 1FGOA 3UL6A 1R4CA 1KSIA 2V1LA 4N6UA 1LVNA 4RBNA 1QJGA 4ZM8A 1DYUA 5IEPA 2HMLB 1Y4KA 1OCVA 2W03A 3UJMA 1Q814 1YHQ3 1M904 1GY6A 1KQS2 3WDGB 3MG3A 2XFSA 4K61A 1IV7A 5LC6A 3X3ZA 1WNHA 2CG1A 2HMNB 2XF3A 4HBRA 5JPPA 3S28A 1NWWA 2GBWB 4WFOA 5HGRA 1TFKA 1YVBI 3EBYA 5AYRB 3H3HA 4LGQA 3CCJ3 3F7SA 4XBXA 1IQ8A 3GZRA 1IT7A 1IV9A 3LH4A 1Q40A 3EJVA 4FMBA 3U1WA 3M8CA 2XFTA 5BXQA 3OW22 3FG4A 1A67A 2Z77A 1DMMA 3F9SA 1PFPA 3ECFA 3F14A 4X2HA 4OUQA 1FUWA 2Y74A 3WA2X 1N9EA 2HMOB 3STDA 4XBYA 1N5HA 1O7GB 3PGBA 4K1VA 3MWZA 3KSED 1Q42A 3GWRA 2SBLA 3HK4A 4J8TA 1GY7A 5CLKA 5AIFA 1WMNA 3T8UA 4XDVA 1CEWI 1OHPA 1D6UA 2CHCA 3TDGA 5AEWB 4IPBA 1CYUA 1UW1A 1J2BA 1S723 5BVBA 1GYBA 3DY5A 3CMA3 3HZPA 1STFI 1W01A 4OK0A 3DM8A 3GAXA 2JDIH 5AIHA 3VGNA 1EA2A 2CWVA 1N9JA 1S5AA 3FG1A 4HKVB 2IUJA 3SEDA 3JUNA 3WODG 3RGAA 1EG9B 3LZAA 2W0QA 4WHAA 4ORLA 3SXXA 1K41A 3BLZA 1A2KA 4KFDA 4CDLA 1LXEA 4CCVA 3GRDA 2QEX3 1UI7A 2CFGA 4N6LA 3K7CA 2E2VA 2P09A 1N8QA 3D9RA 1DVCA 3L0RA 4HM4B 1IT8A 5KP4A 3OXAA 4WYKB 4BTWA 4IT7A 3GZXB 1M9GA 4MEIA 2HMJB 3DZLA 1IK3A 4LZIA 2ZDJA 1DMQA 2YFIB 4JF8A 3X42A 1VQM3 4OVMA 1NB5I 1GD3A 1FGTA 1NDOB 3VF1A 3BNCA 1A90A 2K54A 3EN1B 4FCZA 2B1XB 2LQVA 3D3LA 3X3YA 3CC73 2XGLA 1WQLB 2P0XA 5DRVA 3DMCA 1C7HA 2STDA 2W2CA 2GBXB 3WOEB 1IQXA 1JKGA 3CCQ3 3DGNA 1QVG2 2IA7A 1VQ53 3FSDA 1K734 2CFKA 3UNLA 2BMRB 3CU3A 3LTAA 4HJLB 3G6E3 3EX9A 2OCTA 4U13A 4LSOA 2RSXA 2ZL8A 4KFFA 1IU7A 3EE1A 3BNEA 3WMDA 3FGYA 3MPHA 3AMOA 1LNHA 3EC9A 1SPUA 2GEYA 3Q90A 5IG5A 1TUHA 5EQLA 2RFRA 1IVUA 3X3XA 4N6TA 3G0KA 2Z76A 3G16A 3JUOA 5FW5A 2GXFA 2IMJA 3BB9A 1K9M4 1ASKA 4R9LA 4EBGA 1ZO2A 1VQ73 1A2VA 3F7XA 2W56A 1OF5A 3KN4A 1Q40B 3G4S3 1EQKA 2YFJB 1WMOA 1MNLA 1W2ZA 2OQEC 2GU1A 3ALAA 4RNYA 2XSOB 1N5PA 1Q7Y4 2WGQA 4AEQA 3KFQC 1OPYA 2HMMB 2R4IA 3FKAA 3OX9A 1BUQA 1JJ22 3G8ZA 2A15A 3Q2PA 5STDA 5D81A 1FA3A 4KVHA 3MG2A 3A76A 3NV0A 3CCM3 4BTXA 3NBBA 1VQL3 1V74A 1NB3I 1WTHA 3HI7A 4HVNA 2XEPA 2CFLA 3B4OA 4L8PA 3X41A 4N3VA 5KP3A 1ULJB 5IF6A 3B4PA 3Q1CA 4K90B 4O2HA 3V99A 1IVWA 1F8NA 2FNQA 3NHXA 4FMCA 3PCSA 4EV2A 1GS3A 2IUKA 5LC7A 2CG0A 5CK6A 1W7CA 4NHFA 3CC23 1GD4A 2E2TA 4I4KA 3N54B 3I0YA 2UX0A 3LT9A 1OGXA 3LTCA 4HM8B 3J7Yd 3S27A 4XDWA 5EEOA 2P38A 3LXUX 3PZWA 3OV4A 3S29A 5I97A 1FGRA 3ROBA 1ROAA 2E2UA 2BMOB 3KZTA 4QWTA 4LMIA 1JB5A 3PYJA 5IG3A 4JRFA 1VQ63 1VQP3 3OWUA 2MC8A 2F86B 2CKFB 4O3VA 4H61A 3LTBA 4FR9A 3T0UA 3FF2A 5D82A 3CXC2 1RRHA 3EF8A 2BMQB 3LOYA 5FGOA 1JKGB 4G1MB 1NO3A 2XGNA 5TGNA 3IMAB 2WGOA 2XRXB 4HM7B 4N6MA 2W9PA 2LYXA 1ULIB 4BTYA 2OTL3 1QALA 3G713 1VQO3 6STDA 3DUKA 1OGZA 3SOAA 3HIIA 1W2B2 3K5TA 3AMOB 3KKGA 4HM6B 4MMXB 1YIT3 4EV5A 1UUVB 1VQN3 5IG0A 1TIJA 4NREA 2F99A 2CFWA 4EYCA 2CK3H 3SVAA 4N6NB 1SQWA 4FMAA 1JB2A 3KSPA 5KP1A 1DMNA 2W56B 2WOFA 1OF5B 3RGRA 3EQQB 4AKYA 3FLJA 2ML5A 2OWPA 2C11A 1FGQA 1W00A 3E99A 4FMDA 2BHMA 1NU3A 1KC84 3NM7A 1L5GB 1Q864 2YFLB 1JB4A 4XB5A 1YGEA 2C10A 2BNGA 1K28A 2RGQA 3BNBA 3EB8A 3NUVA 3I553 1M1K4 2CC3A 3CCS3 3NV0B 3SX1A 3N8BA 2K0MA 2Y73A 1M1XB 4L8OA 5DREA 5EVHA 3O8YA 3PXMA 1TFOA 3U97A 2W04A 2CWUA 1YJ93 3JUPA 3BNDA 4XM4A 4K1UA 2GEXA 2Q07A 2GU3A 4HYZA 3S5CA 5IENA 3CNMA 2PZVA 2D1WA 4KZ1A 4WP5A 8CHOA 1ZX2A 2L4VA 3B7CA 4PEJA 3FCSB 1UUWB 4AKZA 1AVKA 4KFEA 4HM3B 1U8CB 4MMZB 1W6GA 4X2OA 3PCRA 1VQK3 2YX9A 5AIIA 4GL6A 5JPUA 7STDA 1OHOA 3DXOA 3EN8A 4J9AA 3JVCA 4IIAA 4HM0B 4O8SA 2CFDA 2ML6A 2JQ5A 5CF2A 1E97A 2W9QA 1TU5A 3MKIA 2F98A 1RRLA 1N8R4 2OTJ3 3LMLA 2BT3A 2HMKB 1VQ43 3IPTA 2P05A 3CPOA 3NQYA 4H3UA 5A0OB 2OOVA 1KWIA 2MF7A 3F8HA 2D42A 3NX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSO A;  1O7P B;  1W6Y A;  3FH1 A;  3EBT A;  1VZZ A;  1GY5 A;  3JUQ A;  1Z1S A;  1JN5 B;  4GB5 A;  3F40 A;  4XBT A;  2QIY A;  3NXJ A;  2RCD A;  4FCM A;  3T8N A;  3ER7 A;  3GZY B;  3LYG A;  3MG1 A;  3FZW A;  3K0Z A;  1O7M B;  3B8L A;  1CQS A;  5G2G A;  4RZM A;  1IDP A;  2Z7A A;  5CXO A;  3OWS A;  3KE7 A;  5AEU B;  4HM5 B;  5IEO A;  3GZB A;  5IG4 A;  3JUM A;  3SOY A;  1ISK A;  3VSY A;  1O7H B;  1JN5 A;  3FF0 A;  1HKX A;  4MJD A;  3EHC A;  1O7W B;  3MYT A;  3OWY A;  1OHS A;  1SJW A;  5AIG A;  1QMA A;  4L7K A;  1O7N B;  4HZ9 B;  1U5O A;  3NBR A;  5IER A;  4HM2 B;  1E3R A;  5CF1 A;  1AR0 A;  5D83 A;  1W02 A;  1TP6 A;  2B24 B;  2XSH B;  4FCJ A;  4HM1 B;  4R9K A;  3CNX A;  1OH0 A;  1STD A;  4LEH A;  2I9W A;  4R1K A;  4HZB B;  4Q53 A;  4WWU C;  4STD A;  3NM2 A;  5AI1 A;  2XR8 B;  3MHE A;  2QGU A;  1E3V A;  3H51 A;  3HX8 A;  2INX A;  4WYK A;  1OUN A;  3F8X A;  1QJG A;  5IEP A;  2HML B;  1OCV A;  3UJM A;  1GY6 A;  3MG3 A;  2HMN B;  5JPP A;  1NWW A;  2GBW B;  5HGR A;  3EBY A;  3H3H A;  4LGQ A;  3F7S A;  4XBX A;  3GZR A;  1Q40 A;  3EJV A;  5BXQ A;  3M8C A;  2Z77 A;  1DMM A;  3F9S A;  3ECF A;  3F14 A;  4X2H A;  4OUQ A;  2HMO B;  3STD A;  4XBY A;  1O7G B;  4K1V A;  1Q42 A;  3GWR A;  3HK4 A;  4J8T A;  1GY7 A;  5CLK A;  5AIF A;  3T8U A;  4XDV A;  1OHP A;  2CHC A;  5AEW B;  5BVB A;  1GYB A;  3HZP A;  1W01 A;  3DM8 A;  5AIH A;  3VGN A;  1EA2 A;  1S5A A;  4HKV B;  3SED A;  3JUN A;  3RGA A;  1EG9 B;  3LZA A;  4ORL A;  1K41 A;  3BLZ A;  1A2K A;  4CDL A;  3GRD A;  3K7C A;  3D9R A;  4HM4 B;  5KP4 A;  3OXA A;  4WYK B;  3GZX B;  2HMJ B;  3DZL A;  1DMQ A;  2YFI B;  4OVM A;  1NDO B;  2K54 A;  3EN1 B;  2B1X B;  1WQL B;  5DRV A;  3DMC A;  1C7H A;  2STD A;  2W2C A;  2GBX B;  1JKG A;  3FSD A;  3UNL A;  2BMR B;  3CU3 A;  4HJL B;  3EX9 A;  4U13 A;  3WMD A;  3FGY A;  3EC9 A;  2GEY A;  3Q90 A;  5IG5 A;  1TUH A;  2RFR A;  3G0K A;  2Z76 A;  3G16 A;  3JUO A;  5FW5 A;  2GXF A;  2IMJ A;  3BB9 A;  1ASK A;  4R9L A;  1ZO2 A;  3F7X A;  1OF5 A;  1Q40 B;  2YFJ B;  2XSO B;  1OPY A;  2HMM B;  2R4I A;  3FKA A;  3OX9 A;  1BUQ A;  3G8Z A;  2A15 A;  5STD A;  5D81 A;  4KVH A;  3MG2 A;  3A76 A;  3NV0 A;  4HVN A;  3B4O A;  4L8P A;  4N3V A;  5KP3 A;  1ULJ B;  5IF6 A;  3B4P A;  3NHX A;  1GS3 A;  5CK6 A;  4I4K A;  3I0Y A;  2UX0 A;  1OGX A;  4HM8 B;  4XDW A;  3OV4 A;  3ROB A;  2BMO B;  3KZT A;  4LMI A;  1JB5 A;  5IG3 A;  3OWU A;  2F86 B;  2CKF B;  3FF2 A;  5D82 A;  3EF8 A;  2BMQ B;  1JKG B;  5TGN A;  2XRX B;  4HM7 B;  1ULI B;  6STD A;  3DUK A;  1OGZ A;  3SOA A;  3KKG A;  4HM6 B;  1UUV B;  5IG0 A;  2F99 A;  1JB2 A;  3KSP A;  5KP1 A;  1DMN A;  3RGR A;  1OF5 B;  3EQQ B;  3FLJ A;  2OWP A;  1W00 A;  3E99 A;  1NU3 A;  2YFL B;  1JB4 A;  4XB5 A;  2BNG A;  2RGQ A;  3NUV A;  3NV0 B;  5DRE A;  4L8O A;  5EVH A;  3JUP A;  4XM4 A;  4K1U A;  2GEX A;  3S5C A;  5IEN A;  3CNM A;  2PZV A;  4WP5 A;  8CHO A;  1ZX2 A;  3B7C A;  4PEJ A;  1UUW B;  4HM3 B;  4X2O A;  5AII A;  5JPU A;  7STD A;  1OHO A;  3DXO A;  3EN8 A;  4J9A A;  4IIA A;  4HM0 B;  2JQ5 A;  5CF2 A;  1E97 A;  3MKI A;  2F98 A;  2HMK B;  3IPT A;  3CPO A;  4H3U A;  3F8H A; 
#chains in the Genus database with same CATH topology
 3MSO A;  1UCJ A;  1O7P B;  1X1U A;  1AVL A;  1W6Y A;  1K8A 4;  1RN4 A;  3N9H A;  1SIH A;  2W6J H;  3FH1 A;  1RGH A;  3CPW 2;  3EBT A;  2GSP A;  1BNJ A;  1VZZ A;  1GY5 A;  3AGN A;  1EKM A;  1OAC A;  1RJO A;  3JUQ A;  4R80 A;  1Q82 4;  1Z1S A;  3WR2 A;  2KF5 A;  1JN5 B;  2ZHX B;  4GB5 A;  5GSP A;  1T5Y A;  2KF6 A;  2CW9 A;  3F40 A;  4XBT A;  1BNF A;  1YNV X;  2QIY A;  1I0X A;  3KII A;  3NXJ A;  2RCD A;  1QAK A;  1IQY A;  4FCM A;  1YJW 3;  3T8N A;  1JZD A;  2PNC A;  1D6Z A;  1JNQ A;  1YJN 3;  1BNG A;  2K3D A;  3ER7 A;  1LOY A;  2OQE A;  3GZY B;  5BU4 A;  3LYG A;  3MG1 A;  4MMY B;  1PU4 A;  3CCU 3;  3FZW A;  5M19 A;  3QRD A;  1UGI A;  3K0Z A;  1JV2 B;  1O7M B;  3RDE A;  1YIJ 3;  1ROV A;  1YI2 3;  2FGT A;  1I2G A;  3B8L A;  4ILF A;  1CQS A;  5G2G A;  4RZM A;  1IDP A;  2Z7A A;  3QK9 A;  1T2H A;  5CXO A;  1BSC A;  2WOH A;  3OWS A;  3KE7 A;  5AEU B;  2F5M A;  2P0M A;  4HM5 B;  5IEO A;  4I5Q A;  3DGO A;  2Z6B A;  1QAF A;  2M7O A;  1MOL A;  3CCE 3;  1IVX A;  5ELJ A;  3GZB A;  5AYS C;  5IG4 A;  1LOX A;  2QA4 3;  5ELU A;  1AV4 A;  3CME 3;  3JUM A;  3SOY A;  1X1X A;  3CC4 3;  3VSY A;  1O7H B;  1JN5 A;  1ISK A;  1HYF A;  3FF0 A;  1JBT A;  1HKX A;  1RN7 A;  3LT8 A;  4MJD A;  3EHC A;  1O7W B;  2XH9 A;  3X40 A;  2FXT A;  4EXR A;  1BRH A;  3MYT A;  3OWY A;  4EC6 A;  1OHS A;  2CIU A;  3CCV 3;  1ZGX A;  3CC7 3;  1NJI 4;  2KXG A;  1SJW A;  1US1 A;  5AIG A;  1QMA A;  2WO0 A;  4O02 B;  3LTD A;  1JBS A;  4L7K A;  1O7N B;  3PS8 A;  2SAR A;  1SII A;  4HZ9 B;  5JBS A;  2CWT A;  3IJE B;  1U5O A;  4RNZ A;  2CX0 A;  3HIG A;  3NBR A;  4EW5 A;  5IER A;  1JRQ A;  3WOF B;  1QVF 2;  4HM2 B;  1IVV A;  2KRT A;  3K9M C;  1E3R A;  1V58 A;  4BL2 A;  5BIR A;  4J5K A;  1RTU A;  1UCI A;  3S67 A;  5CF1 A;  1CYV A;  1AR0 A;  1BIR A;  3BU4 A;  5D83 A;  1W02 A;  4R4K A;  1UGH I;  1RKY A;  1TP6 A;  3WA3 A;  2B24 B;  2XSH B;  3I56 3;  4FCJ A;  4HM1 B;  2OOV C;  4R9K A;  2CH9 A;  3CNX A;  3FG3 A;  1OH0 A;  1STD A;  3CD6 3;  1G96 A;  2UUG C;  4LEH A;  2I9W A;  4N6V 0;  4R1K A;  1KD1 4;  1BSA A;  3UB1 A;  4HZB B;  1UCL A;  3DGM A;  1GOV A;  2KCD A;  2BO9 B;  2BU4 A;  5M1A A;  3NBJ A;  3SYU A;  1WMP A;  1FGM A;  6GSP A;  3SLU A;  2RNT A;  3DGL A;  4Q53 A;  2IY2 A;  4WWU C;  1VQ9 3;  3V92 A;  3AGO A;  1DVD A;  1B27 A;  4STD A;  3CCL 3;  3NQZ A;  2KF3 A;  1W5Z A;  3NM2 A;  5RNT A;  4HAA A;  4TX4 A;  1BNS A;  5AI1 A;  3UL5 A;  2XR8 B;  3MHE A;  2QGU A;  1E3V A;  4N6O B;  3H51 A;  3CCR 3;  1TTO A;  1W4N A;  3HX8 A;  2INX A;  5IW9 A;  3V98 A;  1D6Y A;  1W6C A;  2C4B A;  1ZS7 A;  4DKI A;  1RGA A;  1UI8 A;  4WYK A;  1VQ8 3;  2AAE A;  5IF6 A;  2O3O A;  1OUN A;  3D79 A;  2O9U X;  1HU9 A;  3F8X A;  3K63 A;  1FGO A;  4BU4 A;  3UL6 A;  1R4C A;  1KSI A;  2V1L A;  4N6U A;  1BU4 A;  1LVN A;  4RBN A;  1QJG A;  4ZM8 A;  1DYU A;  3DH2 A;  5IEP A;  1PY3 A;  1Y4K A;  2HML B;  1OCV A;  2H0I A;  2W03 A;  3UJM A;  1Q81 4;  1YHQ 3;  1M90 4;  1GY6 A;  1B2S A;  1RGK A;  4RNT A;  1KQS 2;  1C54 A;  3WDG B;  3MG3 A;  2XFS A;  1I3F A;  1RGC A;  4K61 A;  4CJN A;  1LQG C;  1IV7 A;  5LC6 A;  1JBR A;  3X3Z A;  1WNH A;  2CG1 A;  2KF4 A;  2HMN B;  2XF3 A;  1RSN A;  4HBR A;  5JPP A;  1YGW A;  3S28 A;  1NWW A;  2GBW B;  4WFO A;  1G0T A;  2ZA4 A;  5HGR A;  1TFK A;  3ZG0 A;  1YVB I;  3EBY A;  5AYR B;  3H3H A;  4LGQ A;  3CCJ 3;  3F7S A;  4XBX A;  1IQ8 A;  2H0G A;  3GZR A;  1IT7 A;  1IV9 A;  1NNV A;  1UCK A;  3LH4 A;  1Q40 A;  1LOW A;  1RDS A;  1EUI C;  3EJV A;  4FMB A;  3U1W A;  3M8C A;  2XFT A;  5BXQ A;  3OW2 2;  3FG4 A;  1A67 A;  2Z77 A;  1DMM A;  3F9S A;  1PFP A;  3ECF A;  1BSE A;  3F14 A;  3HOH A;  4X2H A;  4OUQ A;  1FUW A;  2Y74 A;  1RHL A;  3WA2 X;  3DGY A;  1N9E A;  2HMO B;  3STD A;  1B3S A;  1VQQ A;  4XBY A;  1BVI A;  1N5H A;  1O7G B;  3PGB A;  3MWZ A;  4K1V A;  3KSE D;  1Q42 A;  3GWR A;  2SBL A;  3HK4 A;  1FUT A;  4LYL B;  4J8T A;  1GY7 A;  1B2M A;  3D5G A;  5CLK A;  1RCL A;  5AIF A;  1WMN A;  3T8U A;  4XDV A;  1CEW I;  1OHP A;  1D6U A;  2CHC A;  3WHO A;  3TDG A;  5AEW B;  4IPB A;  1CYU A;  1UW1 A;  1J2B A;  1S72 3;  5BVB A;  3ZFZ A;  1GYB A;  3DY5 A;  1RGG A;  3CMA 3;  3HZP A;  1STF I;  1W01 A;  4OK0 A;  3DM8 A;  1GMP A;  3GAX A;  2JDI H;  5AIH A;  3VGN A;  1EA2 A;  2CWV A;  1N9J A;  1S5A A;  1BRK A;  3FG1 A;  4HKV B;  1R4Y A;  2IUJ A;  3SED A;  1BUJ A;  1LQM B;  1RN1 A;  1BRI A;  3JUN A;  3WOD G;  3RGA A;  1EG9 B;  3LZA A;  2W0Q A;  1BAN A;  1GMQ A;  4ORL A;  1K41 A;  4WHA A;  3SXX A;  3BLZ A;  1A2K A;  1RLS A;  4KFD A;  4CDL A;  3Q3F A;  1LXE A;  4CCV A;  3GRD A;  2F5W A;  2QEX 3;  1UI7 A;  2CFG A;  1DE3 A;  4N6L A;  3K7C A;  2E2V A;  2P09 A;  2R41 A;  1N8Q A;  3D9R A;  1DVC A;  3L0R A;  4HM4 B;  1IT8 A;  3GSP A;  5KP4 A;  3OXA A;  4WYK B;  4BTW A;  4IT7 A;  3GZX B;  1M9G A;  2H0H A;  2HMJ B;  3DZL A;  4MEI A;  4LZI A;  2ZDJ A;  1IK3 A;  1Q9E A;  1DMQ A;  2YFI B;  4JF8 A;  3X42 A;  3AHW A;  3BIR A;  4OVM A;  1VQM 3;  1NB5 I;  1GD3 A;  1FGT A;  1NDO B;  3VF1 A;  3BNC A;  5M18 A;  1A90 A;  2K54 A;  3EN1 B;  4FCZ A;  2B1X B;  2LQV A;  3D3L A;  3X3Y A;  2CX1 A;  1MGW A;  2KAA A;  2XGL A;  1WQL B;  2P0X A;  5DRV A;  3DMC A;  1C7H A;  2STD A;  2W2C A;  1MWR A;  2GBX B;  1IQX A;  1JKG A;  3WOE B;  3DGN A;  3CCQ 3;  1QVG 2;  2IA7 A;  1VQ5 3;  3FSD A;  7GSP A;  1K73 4;  1BOX A;  2CFK A;  3UNL A;  2BMR B;  3CU3 A;  3LTA A;  2J8X B;  4HJL B;  3G6E 3;  3EX9 A;  1EEJ A;  2OCT A;  4U13 A;  4LSO A;  1BRS A;  2RSX A;  2ZL8 A;  1LNI A;  4KFF A;  1IU7 A;  3EE1 A;  3BNE A;  3WMD A;  3FGY A;  1TJD A;  3MPH A;  3AMO A;  1LNH A;  3EC9 A;  1SPU A;  4NPB A;  2GEY A;  1RGE A;  3Q90 A;  1TUH A;  5EQL A;  1X1W A;  2RFR A;  5HOH A;  5IG5 A;  1SAR A;  1IVU A;  3X3X A;  4N6T A;  3G0K A;  2Z76 A;  3G16 A;  3JUO A;  5FW5 A;  2F4Y A;  2GXF A;  3URP A;  2IMJ A;  3BB9 A;  1K9M 4;  1ASK A;  4R9L A;  4EBG A;  1ZO2 A;  1VQ7 3;  1A2V A;  3F7X A;  2W56 A;  1OF5 A;  3KN4 A;  1BRG A;  1Q40 B;  3G4S 3;  1EQK A;  2YFJ B;  1WMO A;  1MNL A;  1W2Z A;  4HOH A;  2OQE C;  2GU1 A;  3ALA A;  3ZG5 A;  4RNY A;  2XSO B;  1N5P A;  1Q7Y 4;  2WGQ A;  1B21 A;  3D4A A;  1IYY A;  4AEQ A;  3KFQ C;  1OPY A;  2HMM B;  2R4I A;  3FKA A;  3OX9 A;  1BUQ A;  1RMS A;  1JJ2 2;  3G8Z A;  8RNT A;  2A15 A;  3Q2P A;  1RGF A;  7RNT A;  5STD A;  5D81 A;  1FA3 A;  1FYS A;  4KVH A;  1RNB A;  1MWT A;  3A76 A;  3MG2 A;  1YVS A;  3NV0 A;  3RNT A;  3CCM 3;  1GOY A;  4GHO A;  1TRP A;  2RBI A;  4BTX A;  3NBB A;  1I8V A;  1VQL 3;  1V74 A;  1NB3 I;  1WTH A;  3HI7 A;  4HVN A;  1FZU A;  2XEP A;  2CFL A;  3B4O A;  1BNR A;  4L8P A;  3X41 A;  4N3V A;  5KP3 A;  1GSP A;  1ULJ B;  3B4P A;  3Q1C A;  1B2U A;  4K90 B;  4O2H A;  1IVW A;  3V99 A;  1F8N A;  2F56 A;  2FNQ A;  3NHX A;  3PCS A;  4FMC A;  4KT3 B;  1GS3 A;  2IUK A;  5G1K A;  5LC7 A;  2CG0 A;  4EV2 A;  5CK6 A;  1W7C A;  4NHF A;  3CC2 3;  1GD4 A;  2E2T A;  4I4K A;  4J5G A;  3N54 B;  1BRJ A;  3I0Y A;  2UX0 A;  1A2P A;  3LT9 A;  1OGX A;  3LTC A;  4HM8 B;  3J7Y d;  3S27 A;  1GMR A;  1HZ1 A;  4XDW A;  5EEO A;  2P38 A;  3LXU X;  3PZW A;  3OV4 A;  4GSP A;  3S29 A;  1UUG B;  9RNT A;  5I97 A;  1FGR A;  3ROB A;  1ROA A;  1UDI I;  2BMO B;  1BNE A;  2E2U A;  1RGL A;  3KZT A;  4QWT A;  4LMI A;  1I70 A;  1JB5 A;  3PYJ A;  5IG3 A;  4JRF A;  1VQ6 3;  1VQP 3;  3OWU A;  2MC8 A;  2F86 B;  2CKF B;  4O3V A;  4H61 A;  3LTB A;  4FR9 A;  1LOV A;  1I2F A;  3FF2 A;  3T0U A;  5D82 A;  3CXC 2;  1RRH A;  1RNT A;  2HOH A;  3EF8 A;  2BMQ B;  3LOY A;  5FGO A;  1JKG B;  4G1M B;  1NO3 A;  2XGN A;  5TGN A;  3IMA B;  1RCK A;  2WGO A;  2XRX B;  4HM7 B;  1DET A;  4N6M A;  2W9P A;  2LYX A;  1ULI B;  4BTY A;  2OTL 3;  1QAL A;  2IYJ A;  3G71 3;  1I3I A;  1VQO 3;  6STD A;  3DUK A;  1OGZ A;  3SOA A;  3HII A;  1PYL A;  1W2B 2;  3K5T A;  1B2X A;  1MWU A;  3AMO B;  1FW7 A;  3KKG A;  4HM6 B;  4MMX B;  1YIT 3;  4EV5 A;  1T2I A;  1UUV B;  1VQN 3;  5IG0 A;  1TIJ A;  4NRE A;  2F99 A;  2CFW A;  4EYC A;  2CK3 H;  3SVA A;  4N6N B;  3A5E A;  1SQW A;  2AAD A;  4FMA A;  1JB2 A;  2L1S A;  3KSP A;  5KP1 A;  1DMN A;  2W56 B;  2WOF A;  1OF5 B;  3RGR A;  3EQQ B;  4AKY A;  3FLJ A;  2ML5 A;  1Q7H A;  2OWP A;  2C11 A;  1BNI A;  1FGQ A;  1W00 A;  1GOU A;  3E99 A;  4FMD A;  2BHM A;  1NU3 A;  1KC8 4;  3NM7 A;  1L5G B;  1Q86 4;  2YFL B;  1JB4 A;  4XB5 A;  1AY7 A;  1YGE A;  1CH0 A;  2C10 A;  4CPK A;  1G02 A;  2BNG A;  1K28 A;  2RGQ A;  3BNB A;  3EB8 A;  3NUV A;  3I55 3;  1MWS A;  4BL3 A;  2CC3 A;  1M1K 4;  3CCS 3;  4BIR A;  3NV0 B;  3SX1 A;  3N8B A;  2K0M A;  2Y73 A;  1M1X B;  4L8O A;  5DRE A;  5EVH A;  3O8Y A;  3PXM A;  1TFO A;  3U97 A;  2W04 A;  2CWU A;  1TRQ A;  3JUP A;  1YJ9 3;  1I2E A;  3BND A;  3KCH A;  1B2Z A;  4XM4 A;  4K1U A;  1BGS A;  2GEX A;  2Q07 A;  3D5I A;  2GU3 A;  4HYZ A;  3S5C A;  1LRA A;  1X1Y A;  5IEN A;  3CNM A;  2PZV A;  2BIR A;  2D1W A;  4KZ1 A;  4WP5 A;  8CHO A;  1ZX2 A;  2L4V A;  1BAO A;  3B7C A;  4PEJ A;  3FCS B;  1UUW B;  4AKZ A;  1AVK A;  1BSD A;  1AQZ A;  4KFE A;  4HM3 B;  1U8C B;  4MMZ B;  1W6G A;  4X2O A;  3AHS A;  1FUS A;  3PCR A;  1VQK 3;  2YX9 A;  5AII A;  4GL6 A;  5JPU A;  7STD A;  1OHO A;  3DXO A;  3EN8 A;  4J9A A;  1I0V A;  3JVC A;  4IIA A;  1T3B A;  4HM0 B;  4O8S A;  2CFD A;  2ML6 A;  2JQ5 A;  2UGI A;  5G1L A;  5CF2 A;  1E97 A;  2W9Q A;  1JZO A;  1BSB A;  1TU5 A;  3MKI A;  1BRN L;  2F98 A;  1RRL A;  1N8R 4;  1V57 A;  3LML A;  2OTJ 3;  2BT3 A;  2HMK B;  1VQ4 3;  3IPT A;  2P05 A;  3CPO A;  1B20 A;  3NQY A;  4H3U A;  1MGR A;  2OOV A;  5A0O B;  1KWI A;  2MF7 A;  6RNT A;  3F8H A;  2D42 A;  3NX0 A; 
#chains in the Genus database with same CATH homology
 3MSO A;  1O7P B;  1AVL A;  1W6Y A;  1K8A 4;  3N9H A;  1SIH A;  2W6J H;  3FH1 A;  3CPW 2;  3EBT A;  1VZZ A;  1GY5 A;  1EKM A;  1OAC A;  1RJO A;  3JUQ A;  4R80 A;  1Q82 4;  1Z1S A;  1JN5 B;  4GB5 A;  1T5Y A;  2CW9 A;  3F40 A;  4XBT A;  2QIY A;  3KII A;  3NXJ A;  2RCD A;  1QAK A;  1IQY A;  4FCM A;  1YJW 3;  3T8N A;  2PNC A;  1D6Z A;  1JNQ A;  1YJN 3;  3ER7 A;  2OQE A;  3GZY B;  3LYG A;  3MG1 A;  4MMY B;  1PU4 A;  3CCU 3;  3FZW A;  3QRD A;  3K0Z A;  1JV2 B;  1O7M B;  3RDE A;  1YIJ 3;  1ROV A;  1YI2 3;  2FGT A;  3B8L A;  1CQS A;  5G2G A;  4RZM A;  1IDP A;  2Z7A A;  3QK9 A;  5CXO A;  2WOH A;  3OWS A;  3KE7 A;  5AEU B;  2P0M A;  4HM5 B;  5IEO A;  3DGO A;  2Z6B A;  1QAF A;  2M7O A;  1MOL A;  3CCE 3;  1IVX A;  5ELJ A;  3GZB A;  5AYS C;  5IG4 A;  1LOX A;  2QA4 3;  5ELU A;  1AV4 A;  3CME 3;  3JUM A;  3SOY A;  3CC4 3;  1ISK A;  3VSY A;  1O7H B;  1JN5 A;  3FF0 A;  1HKX A;  1RN7 A;  3LT8 A;  4MJD A;  3EHC A;  1O7W B;  2XH9 A;  3X40 A;  2FXT A;  4EXR A;  3MYT A;  3OWY A;  4EC6 A;  1OHS A;  2CIU A;  3CCV 3;  1NJI 4;  2KXG A;  1SJW A;  1US1 A;  5AIG A;  1QMA A;  2WO0 A;  4O02 B;  3LTD A;  4L7K A;  1O7N B;  3PS8 A;  1SII A;  4HZ9 B;  5JBS A;  2CWT A;  3IJE B;  1U5O A;  4RNZ A;  3HIG A;  3NBR A;  5IER A;  1JRQ A;  3WOF B;  1QVF 2;  4HM2 B;  1IVV A;  2KRT A;  3K9M C;  1E3R A;  3S67 A;  5CF1 A;  1CYV A;  1AR0 A;  5D83 A;  1W02 A;  4R4K A;  1RKY A;  1TP6 A;  3WA3 A;  2B24 B;  2XSH B;  3I56 3;  4FCJ A;  4HM1 B;  2OOV C;  4R9K A;  2CH9 A;  3CNX A;  3FG3 A;  1OH0 A;  1STD A;  3CD6 3;  1G96 A;  4LEH A;  2I9W A;  4N6V 0;  4R1K A;  1KD1 4;  3UB1 A;  4HZB B;  3DGM A;  2KCD A;  2BO9 B;  3NBJ A;  1WMP A;  1FGM A;  3SLU A;  3DGL A;  4Q53 A;  4WWU C;  1VQ9 3;  3V92 A;  1DVD A;  4STD A;  3CCL 3;  3NQZ A;  1W5Z A;  3NM2 A;  3UL5 A;  4TX4 A;  5AI1 A;  2XR8 B;  3MHE A;  2QGU A;  1E3V A;  4N6O B;  3H51 A;  3CCR 3;  1W4N A;  3HX8 A;  2INX A;  5IW9 A;  3V98 A;  1D6Y A;  1W6C A;  1UI8 A;  4WYK A;  1VQ8 3;  2O3O A;  1OUN A;  3K63 A;  2O9U X;  1HU9 A;  3F8X A;  1FGO A;  3UL6 A;  1R4C A;  1KSI A;  2V1L A;  4N6U A;  1LVN A;  4RBN A;  1QJG A;  4ZM8 A;  1DYU A;  5IEP A;  2HML B;  1Y4K A;  1OCV A;  2W03 A;  3UJM A;  1Q81 4;  1YHQ 3;  1M90 4;  1GY6 A;  1KQS 2;  3WDG B;  3MG3 A;  2XFS A;  4K61 A;  1IV7 A;  5LC6 A;  3X3Z A;  1WNH A;  2CG1 A;  2HMN B;  2XF3 A;  4HBR A;  5JPP A;  3S28 A;  1NWW A;  2GBW B;  4WFO A;  5HGR A;  1TFK A;  1YVB I;  3EBY A;  5AYR B;  3H3H A;  4LGQ A;  3CCJ 3;  3F7S A;  4XBX A;  1IQ8 A;  3GZR A;  1IT7 A;  1IV9 A;  3LH4 A;  1Q40 A;  3EJV A;  4FMB A;  3U1W A;  3M8C A;  2XFT A;  5BXQ A;  3OW2 2;  3FG4 A;  1A67 A;  2Z77 A;  1DMM A;  3F9S A;  1PFP A;  3ECF A;  3F14 A;  4X2H A;  4OUQ A;  1FUW A;  2Y74 A;  3WA2 X;  1N9E A;  2HMO B;  3STD A;  4XBY A;  1N5H A;  1O7G B;  3PGB A;  4K1V A;  3MWZ A;  3KSE D;  1Q42 A;  3GWR A;  2SBL A;  3HK4 A;  4J8T A;  1GY7 A;  5CLK A;  5AIF A;  1WMN A;  3T8U A;  4XDV A;  1CEW I;  1OHP A;  1D6U A;  2CHC A;  3TDG A;  5AEW B;  4IPB A;  1CYU A;  1UW1 A;  1J2B A;  1S72 3;  5BVB A;  1GYB A;  3DY5 A;  3CMA 3;  3HZP A;  1STF I;  1W01 A;  4OK0 A;  3DM8 A;  3GAX A;  2JDI H;  5AIH A;  3VGN A;  1EA2 A;  2CWV A;  1N9J A;  1S5A A;  3FG1 A;  4HKV B;  2IUJ A;  3SED A;  3JUN A;  3WOD G;  3RGA A;  1EG9 B;  3LZA A;  2W0Q A;  4WHA A;  4ORL A;  3SXX A;  1K41 A;  3BLZ A;  1A2K A;  4KFD A;  4CDL A;  1LXE A;  4CCV A;  3GRD A;  2QEX 3;  1UI7 A;  2CFG A;  4N6L A;  3K7C A;  2E2V A;  2P09 A;  1N8Q A;  3D9R A;  1DVC A;  3L0R A;  4HM4 B;  1IT8 A;  5KP4 A;  3OXA A;  4WYK B;  4BTW A;  4IT7 A;  3GZX B;  1M9G A;  4MEI A;  2HMJ B;  3DZL A;  1IK3 A;  4LZI A;  2ZDJ A;  1DMQ A;  2YFI B;  4JF8 A;  3X42 A;  1VQM 3;  4OVM A;  1NB5 I;  1GD3 A;  1FGT A;  1NDO B;  3VF1 A;  3BNC A;  1A90 A;  2K54 A;  3EN1 B;  4FCZ A;  2B1X B;  2LQV A;  3D3L A;  3X3Y A;  3CC7 3;  2XGL A;  1WQL B;  2P0X A;  5DRV A;  3DMC A;  1C7H A;  2STD A;  2W2C A;  2GBX B;  3WOE B;  1IQX A;  1JKG A;  3CCQ 3;  3DGN A;  1QVG 2;  2IA7 A;  1VQ5 3;  3FSD A;  1K73 4;  2CFK A;  3UNL A;  2BMR B;  3CU3 A;  3LTA A;  4HJL B;  3G6E 3;  3EX9 A;  2OCT A;  4U13 A;  4LSO A;  2RSX A;  2ZL8 A;  4KFF A;  1IU7 A;  3EE1 A;  3BNE A;  3WMD A;  3FGY A;  3MPH A;  3AMO A;  1LNH A;  3EC9 A;  1SPU A;  2GEY A;  3Q90 A;  5IG5 A;  1TUH A;  5EQL A;  2RFR A;  1IVU A;  3X3X A;  4N6T A;  3G0K A;  2Z76 A;  3G16 A;  3JUO A;  5FW5 A;  2GXF A;  2IMJ A;  3BB9 A;  1K9M 4;  1ASK A;  4R9L A;  4EBG A;  1ZO2 A;  1VQ7 3;  1A2V A;  3F7X A;  2W56 A;  1OF5 A;  3KN4 A;  1Q40 B;  3G4S 3;  1EQK A;  2YFJ B;  1WMO A;  1MNL A;  1W2Z A;  2OQE C;  2GU1 A;  3ALA A;  4RNY A;  2XSO B;  1N5P A;  1Q7Y 4;  2WGQ A;  4AEQ A;  3KFQ C;  1OPY A;  2HMM B;  2R4I A;  3FKA A;  3OX9 A;  1BUQ A;  1JJ2 2;  3G8Z A;  2A15 A;  3Q2P A;  5STD A;  5D81 A;  1FA3 A;  4KVH A;  3MG2 A;  3A76 A;  3NV0 A;  3CCM 3;  4BTX A;  3NBB A;  1VQL 3;  1V74 A;  1NB3 I;  1WTH A;  3HI7 A;  4HVN A;  2XEP A;  2CFL A;  3B4O A;  4L8P A;  3X41 A;  4N3V A;  5KP3 A;  1ULJ B;  5IF6 A;  3B4P A;  3Q1C A;  4K90 B;  4O2H A;  3V99 A;  1IVW A;  1F8N A;  2FNQ A;  3NHX A;  4FMC A;  3PCS A;  4EV2 A;  1GS3 A;  2IUK A;  5LC7 A;  2CG0 A;  5CK6 A;  1W7C A;  4NHF A;  3CC2 3;  1GD4 A;  2E2T A;  4I4K A;  3N54 B;  3I0Y A;  2UX0 A;  3LT9 A;  1OGX A;  3LTC A;  4HM8 B;  3J7Y d;  3S27 A;  4XDW A;  5EEO A;  2P38 A;  3LXU X;  3PZW A;  3OV4 A;  3S29 A;  5I97 A;  1FGR A;  3ROB A;  1ROA A;  2E2U A;  2BMO B;  3KZT A;  4QWT A;  4LMI A;  1JB5 A;  3PYJ A;  5IG3 A;  4JRF A;  1VQ6 3;  1VQP 3;  3OWU A;  2MC8 A;  2F86 B;  2CKF B;  4O3V A;  4H61 A;  3LTB A;  4FR9 A;  3T0U A;  3FF2 A;  5D82 A;  3CXC 2;  1RRH A;  3EF8 A;  2BMQ B;  3LOY A;  5FGO A;  1JKG B;  4G1M B;  1NO3 A;  2XGN A;  5TGN A;  3IMA B;  2WGO A;  2XRX B;  4HM7 B;  4N6M A;  2W9P A;  2LYX A;  1ULI B;  4BTY A;  2OTL 3;  1QAL A;  3G71 3;  1VQO 3;  6STD A;  3DUK A;  1OGZ A;  3SOA A;  3HII A;  1W2B 2;  3K5T A;  3AMO B;  3KKG A;  4HM6 B;  4MMX B;  1YIT 3;  4EV5 A;  1UUV B;  1VQN 3;  5IG0 A;  1TIJ A;  4NRE A;  2F99 A;  2CFW A;  4EYC A;  2CK3 H;  3SVA A;  4N6N B;  1SQW A;  4FMA A;  1JB2 A;  3KSP A;  5KP1 A;  1DMN A;  2W56 B;  2WOF A;  1OF5 B;  3RGR A;  3EQQ B;  4AKY A;  3FLJ A;  2ML5 A;  2OWP A;  2C11 A;  1FGQ A;  1W00 A;  3E99 A;  4FMD A;  2BHM A;  1NU3 A;  1KC8 4;  3NM7 A;  1L5G B;  1Q86 4;  2YFL B;  1JB4 A;  4XB5 A;  1YGE A;  2C10 A;  2BNG A;  1K28 A;  2RGQ A;  3BNB A;  3EB8 A;  3NUV A;  3I55 3;  1M1K 4;  2CC3 A;  3CCS 3;  3NV0 B;  3SX1 A;  3N8B A;  2K0M A;  2Y73 A;  1M1X B;  4L8O A;  5DRE A;  5EVH A;  3O8Y A;  3PXM A;  1TFO A;  3U97 A;  2W04 A;  2CWU A;  1YJ9 3;  3JUP A;  3BND A;  4XM4 A;  4K1U A;  2GEX A;  2Q07 A;  2GU3 A;  4HYZ A;  3S5C A;  5IEN A;  3CNM A;  2PZV A;  2D1W A;  4KZ1 A;  4WP5 A;  8CHO A;  1ZX2 A;  2L4V A;  3B7C A;  4PEJ A;  3FCS B;  1UUW B;  4AKZ A;  1AVK A;  4KFE A;  4HM3 B;  1U8C B;  4MMZ B;  1W6G A;  4X2O A;  3PCR A;  1VQK 3;  2YX9 A;  5AII A;  4GL6 A;  5JPU A;  7STD A;  1OHO A;  3DXO A;  3EN8 A;  4J9A A;  3JVC A;  4IIA A;  4HM0 B;  4O8S A;  2CFD A;  2ML6 A;  2JQ5 A;  5CF2 A;  1E97 A;  2W9Q A;  1TU5 A;  3MKI A;  2F98 A;  1RRL A;  1N8R 4;  2OTJ 3;  3LML A;  2BT3 A;  2HMK B;  1VQ4 3;  3IPT A;  2P05 A;  3CPO A;  3NQY A;  4H3U A;  5A0O B;  2OOV A;  1KWI A;  2MF7 A;  3F8H A;  2D42 A;  3NX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...