1OHOA

Crystal structure of ketosteroid isomerase y16f/d40n mutant complexed with equilenin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARFIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title Crystal Structure of Ketosteroid Isomerase Y16F/D40N Mutant Complexed with Equilenin
rcsb
source organism Pseudomonas putida
total genus 30
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ohoA00
3IPTA 2STDA 3B4OA 1OF5A 3EX9A 5CK6A 4HM1B 4FCMA 3RGAA 4CDLA 4HM5B 5BVBA 2JQ5A 4LEHA 2OWPA 1ISKA 4PEJA 2CKFB 3E99A 1GY5A 3ROBA 1JB5A 3HK4A 4ORLA 5AEUB 2I9WA 4J8TA 5IG5A 5IEPA 4KVHA 2YFLB 3CNXA 2YFIB 4R9LA 2XSHB 1JN5B 1ULIB 3EBTA 5AEWB 4H3UA 3NM2A 2F86B 1JB4A 4U13A 1O7HB 5CF2A 3OX9A 3FLJA 3DUKA 2HMOB 5CF1A 4WYKB 1E3RA 3DMCA 3M8CA 4HM8B 3H3HA 2RGQA 4HJLB 3MG1A 4R9KA 2QIYA 3KZTA 1OHOA 3T8UA 3KKGA 3MYTA 4LMIA 3FF0A 4I4KA 4HM2B 2B1XB 2HMJB 3OWSA 1CQSA 3EN8A 3BB9A 2F98A 2F99A 1QJGA 3FF2A 1EA2A 3MKIA 3A76A 6STDA 1K41A 2HMLB 2GBWB 1JKGB 3EHCA 3JUNA 2XSOB 5AIFA 1DMNA 3OV4A 3MHEA 3SOAA 3KE7A 2QGUA 3CNMA 2HMKB 1Q42A 2BMOB 3OWUA 1Q40A 1AR0A 4FCJA 5DRVA 3KSPA 1O7WB 4L8PA 2HMMB 1E97A 1OF5B 8CHOA 5KP1A 2XR8B 1GY7A 2PZVA 1OGZA 2UX0A 3RGRA 3DXOA 3T8NA 5DREA 1U5OA 2GXFA 3FH1A 4XDWA 2B24B 2GEYA 2RCDA 5D83A 1BUQA 3DM8A 1ULJB 5AI1A 1OHPA 3H51A 5IEOA 4HM4B 3MG2A 4HZ9B 3GZXB 4J9AA 4OUQA 5STDA 5IG4A 3OWYA 3JUQA 3EN1B 3GWRA 3G16A 3VGNA 1QMAA 4IIAA 3GZRA 1W01A 3SOYA 3I0YA 4HZBB 4HVNA 4X2OA 3UJMA 7STDA 3F8HA 4WWUC 5JPPA 5TGNA 1W02A 4RZMA 3UNLA 1GY6A 3K0ZA 3CU3A 3F40A 1O7GB 3B7CA 4LGQA 1W6YA 2CHCA 3NBRA 5G2GA 1W00A 5IG0A 2GBXB 5IG3A 3D9RA 1HKXA 5AIHA 5IF6A 3JUOA 1IDPA 3MSOA 3JUPA 4HM3B 2W2CA 5CXOA 4XBTA 4X2HA 4OVMA 1NDOB 1DMQA 5JPUA 1ASKA 1UUVB 3B8LA 4Q53A 3NV0A 4HM7B 2R4IA 4N3VA 1UUWB 3K7CA 3GZBA 1DMMA 3F8XA 1GYBA 4K1VA 1OPYA 1EG9B 1STDA 3JUMA 1Q40B 3F7XA 3MG3A 5AIGA 2K54A 5FW5A 5KP4A 4HM6B 3F7SA 4R1KA 3FGYA 1WQLB 4XBXA 1OH0A 2Z76A 5IENA 1NU3A 5EVHA 2IMJA 1A2KA 1JN5A 2BMQB 3NUVA 1O7NB 3HZPA 3GRDA 2RFRA 3EC9A 3EQQB 2BMRB 2A15A 2YFJB 1TP6A 1SJWA 1GS3A 4HKVB 4XBYA 4HM0B 4WYKA 1NWWA 3DZLA 4GB5A 1VZZA 3Q90A 1O7MB 4XM4A 1OUNA 1JB2A 1O7PB 3G0KA 3SEDA 3F14A 3VSYA 3WMDA 4STDA 2HMNB 3LYGA 3EBYA 1ZX2A 2XRXB 2GEXA 3STDA 4MJDA 3EJVA 3F9SA 5CLKA 1TUHA 1Z1SA 3HX8A 4K1UA 4XB5A 1C7HA 5BXQA 4WP5A 5D82A 3FSDA 5IERA 3BLZA 5HGRA 1ZO2A 3ECFA 3B4PA 2BNGA 3S5CA 2Z77A 3FZWA 1JKGA 1OCVA 3NXJA 3NHXA 4L8OA 3G8ZA 5D81A 1OHSA 3EF8A 3FKAA 3GZYB 1E3VA 1OGXA 1S5AA 5AIIA 5KP3A 3ER7A 4XDVA 3CPOA 3OXAA 3NV0B 2Z7AA 2INXA 3LZAA 4L7KA
chains in the Genus database with same CATH superfamily
3IPTA 2STDA 3B4OA 1OF5A 1RNBA 3EX9A 1A90A 4JRFA 5CK6A 4HM1B 4FCMA 3RGAA 5IW9A 3MWZA 1UI8A 1V74A 2L4VA 4HM5B 4AKZA 2JQ5A 2FNQA 4CDLA 1EUIC 1I70A 3ZG5A 5BVBA 2CFKA 1SIHA 4LEHA 1ROVA 2P09A 1B21A 2OWPA 4PEJA 2CKFB 3E99A 4CCVA 3CCM3 1VQ93 3X40A 1ISKA 1GY5A 3ROBA 5HOHA 1JB5A 3HK4A 4ORLA 4TX4A 5AEUB 2I9WA 3DGLA 4J8TA 1WMNA 1DETA 2F56A 3N54B 5IG5A 2Z6BA 3CCL3 5IEPA 1VQL3 1IYYA 2OOVA 4FCZA 1WMOA 3V99A 4O3VA 1QVG2 4KVHA 1LQMB 5M18A 2P05A 2YFLB 1QALA 3CNXA 1FUSA 1W5ZA 4RNTA 1B2ZA 2K0MA 1LOXA 2E2VA 1RDSA 2YFIB 4R9LA 2CG0A 2XSHB 1JN5B 1ULIB 2CIUA 1VQM3 1MWUA 2AADA 3S28A 1VQ43 2AAEA 2CFWA 1LNIA 1W7CA 4HOHA 4H61A 1M904 4EV2A 1RNTA 3AGOA 1N5HA 3EBTA 1VQP3 1MNLA 1ZGXA 4GHOA 3KSED 1FW7A 3LT8A 1YVSA 3X3XA 1D6ZA 1I3FA 1F8NA 2RNTA 1BAOA 7RNTA 5M19A 5AEWB 1PYLA 4FMBA 5ELUA 4NREA 3Q2PA 4H3UA 4EW5A 3NM2A 3SVAA 2F86B 1BRIA 1GSPA 1JB4A 3EE1A 1O7HB 4U13A 3OX9A 2P0XA 4AKYA 5CF2A 3FLJA 3DUKA 4BTYA 1SARA 2SBLA 5GSPA 3LTDA 1RKYA 2CG1A 2QA43 1JZDA 2W03A 2HMOB 5CF1A 4WYKB 3U97A 1LRAA 1IT8A 4ILFA 2KCDA 1X1YA 1I2FA 1E3RA 3DMCA 3M8CA 4HM8B 2CX1A 3D5GA 4MMYB 1X1WA 1BNIA 2IY2A 2RGQA 3H3HA 3HIIA 4HJLB 2BHMA 1VQN3 3MG1A 1M1K4 1AVKA 1KC84 2WOHA 3D79A 4R9KA 1K734 3DGYA 2QIYA 1Q864 3KZTA 1JBTA 1EEJA 3S67A 1A2PA 2PNCA 1OHOA 3T8UA 3KKGA 3MYTA 1BNEA 2W0QA 3CC23 3WA2X 1UCIA 1MOLA 4LMIA 1LNHA 1B2XA 2E2TA 4O8SA 1A67A 1HU9A 2ML5A 2CK3H 1RCKA 3FF0A 4I4KA 4OK0A 4HM2B 4NHFA 2B1XB 4RNZA 2HMJB 1JNQA 2IYJA 3O8YA 4HYZA 4K90B 2UGIA 3CCQ3 3CCV3 1B3SA 1FGOA 1FZUA 3OWSA 1IQ8A 4KT3B 1CQSA 1W4NA 3EN8A 4N6UA 4RBNA 3BB9A 3LT9A 2F98A 2F99A 1QJGA 2KF4A 3FF2A 5BU4A 1EA2A 1R4YA 3MKIA 4AEQA 1UUGB 3UL6A 3CCU3 3PXMA 5EEOA 1YJ93 3RDEA 1BVIA 1FUTA 3A76A 6STDA 1K41A 2HMLB 1BNGA 1SIIA 2GBWB 4EXRA 1UDII 1JKGB 1RGAA 3EHCA 3KCHA 1JBSA 3JUNA 2XSOB 5AYRB 1VQO3 2GU3A 4N6MA 5AIFA 1DMNA 1GD4A 1BSAA 3OV4A 4BU4A 5JBSA 1RJOA 3I553 3MHEA 3SOAA 3KE7A 2QGUA 1FGMA 3CNMA 1L5GB 1I0VA 2HMKB 3KFQC 4LZIA 1Q42A 2M7OA 3I563 2BMOB 3OWUA 1NJI4 1KSIA 4R80A 1Q40A 3ZFZA 3KN4A 2OQEA 1IVUA 1AR0A 4FCJA 2Y73A 5DRVA 2KF5A 3DGOA 4KFEA 3KSPA 1YI23 1JJ22 3AMOB 1O7WB 4L8PA 4MEIA 3D4AA 2HMMB 1E97A 1OF5B 1TTOA 2H0IA 4WFOA 2XFSA 4FMAA 3U1WA 8CHOA 1GOVA 4BL2A 5KP1A 2XR8B 1SQWA 3DGMA 3CD63 1GY7A 1NB5I 2PZVA 1GMRA 4N6NB 1OGZA 2OTJ3 2UX0A 1HZ1A 4ZM8A 3LTBA 2E2UA 3S27A 3RGRA 2RBIA 4EC6A 3DXOA 3T8NA 2YX9A 5DREA 1FUWA 1PU4A 1U5OA 1YJN3 3V92A 3NBJA 1WTHA 1QVF2 2W04A 1YGEA 2CFGA 1LOVA 2GXFA 3FH1A 4XDWA 5ELJA 2K3DA 1Q824 1K9M4 2B24B 3NQZA 3RNTA 2GEYA 2RCDA 1MWSA 5D83A 1BUQA 1BIRA 3DM8A 1US1A 1DVDA 1QAFA 1ULJB 2FXTA 1OHPA 3H51A 5AI1A 2KRTA 3K5TA 1YVBI 5IEOA 1AY7A 3TDGA 2J8XB 4HM4B 1UI7A 1G96A 3MG2A 4HZ9B 1TJDA 1PFPA 4KZ1A 1IVVA 1UGHI 4FMDA 3GZXB 4LYLB 4K61A 4J9AA 4OUQA 5STDA 2GU1A 5IG4A 3OWYA 5AYSC 1BU4A 3JUQA 2CX0A 1MGWA 3WODG 2OCTA 4EYCA 1RGKA 4FR9A 3CXC2 1BNRA 3CCE3 1RN7A 1M9GA 1D6UA 1X1XA 3EN1B 3GWRA 1B2MA 2F5MA 3G16A 3HI7A 4N6V0 4NPBA 1GD3A 3FG4A 1DYUA 1BNJA 2ZA4A 3LOYA 3VGNA 2CW9A 4IPBA 1LVNA 1LQGC 3K63A 1BANA 1QMAA 2BT3A 4IIAA 3GZRA 3L0RA 1TU5A 1W01A 4KFDA 3SOYA 3I0YA 4HZBB 4G1MB 4HVNA 1Q814 1LXEA 4X2OA 1BRJA 3UJMA 7STDA 3IJEB 1IV9A 1RGGA 3F8HA 3LMLA 4WWUC 5JPPA 3T0UA 1UCLA 3N9HA 3G6E3 4O2HA 5TGNA 1BNFA 1STFI 1W02A 4RZMA 1HYFA 3UNLA 1LOWA 3AHSA 3A5EA 2IA7A 3BNEA 4N6LA 1MGRA 1GY6A 8RNTA 1B2UA 4J5GA 1GOYA 3K0ZA 3LH4A 3CU3A 3F40A 3URPA 3FG1A 2XGLA 1O7GB 1BRGA 3B7CA 3NBBA 1IT7A 1FA3A 4WHAA 4LGQA 1W6YA 1RGEA 1T2HA 2ML6A 2CHCA 3NBRA 3AGNA 5G2GA 1IV7A 1W00A 3IMAB 4I5QA 4GL6A 5IG0A 1CYUA 1FGTA 1K8A4 2CH9A 2GBXB 3AHWA 5IG3A 3QRDA 3WOFB 4DKIA 1T5YA 3PCSA 1TFOA 1CYVA 3WR2A 4BL3A 1BSCA 1HKXA 2O9UX 2C4BA 1NO3A 2W56A 2XF3A 3D9RA 3X3ZA 1TRQA 5AIHA 2XGNA 3G4S3 5IF6A 2F4YA 3MPHA 2D42A 1IDPA 3JUOA 3MSOA 1YIJ3 1JRQA 2W9PA 4MMZB 1RLSA 3Q3FA 3JUPA 1BRHA 3KIIA 4HM3B 2CFLA 2W2CA 2W9QA 3LTCA 1YJW3 4GSPA 5CXOA 1N8R4 1G0TA 2SARA 2XH9A 4XBTA 2ZDJA 4X2HA 3SYUA 4OVMA 1JV2B 1NDOB 1GMPA 1WNHA 2CWUA 3CCS3 3PCRA 1DMQA 1Y4KA 2OTL3 5JPUA 2XFTA 1ASKA 2CWVA 1CH0A 1TRPA 1IVXA 1UUVB 3B8LA 4Q53A 2CC3A 1X1UA 6RNTA 1EKMA 3NV0A 2QEX3 1LOYA 1KWIA 3PYJA 2OOVC 3G713 2KAAA 4HM7B 4BIRA 2R4IA 4N3VA 3CMA3 3BNCA 1UUWB 2IUKA 3K7CA 3GZBA 4J5KA 1UCKA 1W2ZA 1U8CB 3DH2A 1DMMA 1I2GA 1BRSA 3F8XA 1GYBA 1RN4A 4K1VA 1ZS7A 5I97A 3DY5A 1JZOA 1VQ73 1CEWI 1B20A 1RHLA 1OPYA 1RTUA 2BU4A 1EG9B 2HOHA 1STDA 3NQYA 1FYSA 3QK9A 1UW1A 3D3LA 4HBRA 3BIRA 3JUMA 3N8BA 1Q40B 3F7XA 1QAKA 3MG3A 5EQLA 5AIGA 3HIGA 2K54A 5FW5A 2IUJA 1N8QA 1BSEA 1AV4A 1Q7HA 1BRNL 5KP4A 4FMCA 4HM6B 1GMQA 3FG3A 3F7SA 3GAXA 2LYXA 3FGYA 4R1KA 2F5WA 1VQ63 3SX1A 2P0MA 1NNVA 1WQLB 5FGOA 3S29A 4CJNA 1Q7Y4 4XBXA 2GSPA 1OH0A 2Z76A 3CPW2 1M1XB 5IENA 1NU3A 5EVHA 4MMXB 2IMJA 1AQZA 1N5PA 1A2KA 1JN5A 2ZL8A 4CPKA 1WMPA 2BMQB 2C10A 2Q07A 1NB3I 3NUVA 4QWTA 1RGHA 3ALAA 1RCLA 2BO9B 1BUJA 1O7NB 1T2IA 5BIRA 3PGBA 4R4KA 3ZG0A 1N9JA 6GSPA 2LQVA 3HZPA 3X41A 4N6TA 3GRDA 2RFRA 1OACA 1J2BA 2CFDA 2Y74A 3EC9A 5G1KA 1ROAA 4EV5A 1RMSA 1MWRA 3EQQB 1IQXA 2C11A 3WDGB 3WA3A 1MWTA 3PZWA 1UGIA 2BMRB 1RGCA 3BNDA 1BRKA 2MC8A 2A15A 4O02B 3SXXA 1B27A 3PS8A 5RNTA 3CCJ3 4BTWA 1BGSA 2WGQA 1I8VA 1V58A 2YFJB 1DVCA 1RSNA 1TP6A 1RGLA 1TIJA 1SJWA 1TFKA 1IK3A 1GS3A 3LTAA 7GSPA 2V1LA 3WOEB 2UUGC 2O3OA 1C54A 2H0HA 2W6JH 4HKVB 4XBYA 1Q9EA 2L1SA 4HM0B 1VQ53 3CC73 3Q1CA 4WYKA 1NWWA 3DZLA 4GB5A 3SLUA 3V98A 1VZZA 3Q90A 3UL5A 1O7MB 4XM4A 1OUNA 1KD14 4LSOA 1JB2A 1O7PB 3G0KA 3SEDA 1BSDA 1RN1A 1I2EA 3F14A 1V57A 3VSYA 1I3IA 4STDA 3WMDA 1RRHA 2HMNB 1IQYA 2RSXA 3LYGA 1W2B2 1T3BA 3EBYA 1ZX2A 1VQQA 1D6YA 2XRXB 1VQK3 2GEXA 2CWTA 3STDA 3CC43 4MJDA 2KXGA 2WGOA 2D1WA 3EJVA 3X42A 4HAAA 1AVLA 3F9SA 2JDIH 1IVWA 3K9MC 5CLKA 1TUHA 1YNVX 2BIRA 1Z1SA 3HX8A 4IT7A 4K1UA 1PY3A 4KFFA 1IU7A 2KF6A 4XB5A 9RNTA 1KQS2 3X3YA 1I0XA 3DGNA 1YHQ3 3D5IA 3BU4A 2R41A 1C7HA 3NM7A 5M1AA 1R4CA 5BXQA 1EQKA 3CCR3 2FGTA 3BNBA 1W6GA 1BNSA 4WP5A 3HOHA 2XEPA 1FGRA 3FSDA 5D82A 3BLZA 3JVCA 5G1LA 5IERA 1N9EA 2OQEC 2W56B 1W6CA 5HGRA 3OW22 1ZO2A 3ECFA 3B4PA 1DE3A 2P38A 2BNGA 3J7Yd 2WOFA 1B2SA 3UB1A 3S5CA 2Z77A 4N6OB 3FZWA 1JKGA 2H0GA 1OCVA 1FGQA 3NXJA 1BSBA 3NHXA 4L8OA 3G8ZA 5A0OB 1YGWA 2WO0A 1S723 1GOUA 5D81A 1JBRA 1OHSA 3EF8A 4BTXA 3FKAA 3GZYB 1E3VA 3LXUX 1OGXA 1K28A 1A2VA 3FCSB 4JF8A 1VQ83 1S5AA 5AIIA 1RGFA 3EB8A 1G02A 3ER7A 2ZHXB 4RNYA 5KP3A 1YIT3 4XDVA 1RRLA 3CPOA 3GSPA 2KF3A 3OXAA 3CME3 3VF1A 3NV0B 3NX0A 2Z7AA 2INXA 3AMOA 1BOXA 3LZAA 4L7KA 5LC6A 4EBGA 3WHOA 1UCJA 2MF7A 1SPUA 5LC7A
chains in the Genus database with same CATH topology
3IPTA 2STDA 3B4OA 1OF5A 3EX9A 1A90A 4JRFA 5CK6A 4HM1B 4FCMA 3RGAA 5IW9A 3MWZA 1UI8A 1V74A 2L4VA 4HM5B 4AKZA 2JQ5A 2FNQA 4CDLA 5BVBA 2CFKA 1SIHA 4LEHA 1ROVA 2P09A 2OWPA 1ISKA 4PEJA 2CKFB 3E99A 4CCVA 3CCM3 1VQ93 3X40A 1GY5A 3ROBA 1JB5A 3HK4A 4ORLA 4TX4A 5AEUB 2I9WA 3DGLA 4J8TA 1WMNA 3N54B 5IG5A 2Z6BA 3CCL3 5IEPA 1VQL3 2OOVA 4FCZA 1WMOA 3V99A 4O3VA 1QVG2 4KVHA 2P05A 2YFLB 1QALA 3CNXA 1W5ZA 2K0MA 1LOXA 2E2VA 2YFIB 4R9LA 2CG0A 2XSHB 1JN5B 1ULIB 2CIUA 1VQM3 3S28A 1VQ43 2CFWA 1W7CA 4H61A 1M904 4EV2A 1N5HA 3EBTA 1VQP3 1MNLA 3KSED 3LT8A 3X3XA 1D6ZA 1F8NA 5AEWB 4FMBA 5ELUA 4NREA 3Q2PA 4H3UA 3NM2A 3SVAA 2F86B 1JB4A 3EE1A 1O7HB 4U13A 3OX9A 2P0XA 4AKYA 5CF2A 3FLJA 3DUKA 4BTYA 2SBLA 3CME3 3LTDA 1RKYA 2CG1A 2QA43 2W03A 2HMOB 5CF1A 4WYKB 3U97A 1IT8A 2KCDA 1E3RA 3DMCA 3M8CA 4HM8B 4MMYB 3H3HA 2RGQA 3HIIA 4HJLB 2BHMA 1VQN3 3MG1A 1M1K4 1AVKA 1KC84 2WOHA 4R9KA 1K734 2QIYA 1Q864 3KZTA 3S67A 2PNCA 1OHOA 3T8UA 3KKGA 3MYTA 2W0QA 3CC23 3WA2X 1MOLA 4LMIA 1LNHA 2E2TA 4O8SA 1A67A 1HU9A 2ML5A 2CK3H 3FF0A 4I4KA 4OK0A 1DVDA 4HM2B 4NHFA 2B1XB 4RNZA 2HMJB 1JNQA 3CCQ3 3O8YA 4HYZA 4K90B 3CCV3 1FGOA 3OWSA 1IQ8A 1CQSA 1W4NA 3EN8A 4N6UA 4RBNA 3BB9A 3LT9A 2F98A 2F99A 1QJGA 3FF2A 1EA2A 3MKIA 4AEQA 3UL6A 3CCU3 3PXMA 5EEOA 1YJ93 3RDEA 3A76A 6STDA 1K41A 2HMLB 1SIIA 2GBWB 4EXRA 1JKGB 3EHCA 3JUNA 2XSOB 5AYRB 1VQO3 2GU3A 4N6MA 5AIFA 1DMNA 1GD4A 3OV4A 5JBSA 1RJOA 3I553 3MHEA 3SOAA 3KE7A 2QGUA 1FGMA 3CNMA 1L5GB 2HMKB 3KFQC 4LZIA 1Q42A 2M7OA 3I563 2BMOB 3OWUA 1NJI4 1KSIA 4R80A 1Q40A 3KN4A 2OQEA 1IVUA 1AR0A 4FCJA 2Y73A 5DRVA 3DGOA 4KFEA 3KSPA 1YI23 1JJ22 3AMOB 1O7WB 4L8PA 4MEIA 2HMMB 1E97A 1OF5B 4WFOA 2XFSA 4FMAA 3U1WA 8CHOA 5KP1A 2XR8B 1SQWA 3DGMA 3CD63 1GY7A 1NB5I 2PZVA 4N6NB 1OGZA 2OTJ3 2UX0A 4ZM8A 3LTBA 2E2UA 3S27A 3RGRA 4EC6A 3DXOA 3T8NA 2YX9A 5DREA 1FUWA 1PU4A 1U5OA 1YJN3 3V92A 3NBJA 1WTHA 1QVF2 2W04A 1YGEA 2CFGA 2GXFA 3FH1A 4XDWA 5ELJA 1Q824 1K9M4 2B24B 3NQZA 2GEYA 2RCDA 5D83A 1BUQA 3DM8A 1US1A 1QAFA 1ULJB 2FXTA 1OHPA 3H51A 5AI1A 2KRTA 3K5TA 1YVBI 5IEOA 3TDGA 4HM4B 1UI7A 1G96A 3MG2A 4HZ9B 1PFPA 4KZ1A 1IVVA 4FMDA 3GZXB 4K61A 4J9AA 4OUQA 5STDA 2GU1A 5IG4A 3OWYA 5AYSC 3WODG 3JUQA 4EYCA 2OCTA 4FR9A 3CXC2 3CCE3 1RN7A 1M9GA 1D6UA 3EN1B 3GWRA 3G16A 3HI7A 4N6V0 1GD3A 3FG4A 1DYUA 3LOYA 3VGNA 2CW9A 4IPBA 1LVNA 3K63A 1QMAA 2BT3A 4IIAA 3GZRA 3L0RA 1TU5A 1W01A 4KFDA 3SOYA 3I0YA 4HZBB 4G1MB 4HVNA 1Q814 1LXEA 4X2OA 3UJMA 7STDA 3IJEB 1IV9A 3F8HA 3LMLA 4WWUC 5JPPA 3T0UA 3N9HA 3G6E3 4O2HA 5TGNA 1STFI 1W02A 4RZMA 3UNLA 2IA7A 3BNEA 4N6LA 1GY6A 3K0ZA 3LH4A 3CU3A 3F40A 3FG1A 2XGLA 1O7GB 3NBBA 3B7CA 1IT7A 1FA3A 4WHAA 4LGQA 1W6YA 2ML6A 2CHCA 3NBRA 5G2GA 1IV7A 1W00A 3IMAB 5IG0A 4GL6A 1CYUA 1FGTA 1K8A4 2CH9A 2GBXB 5IG3A 3QRDA 3WOFB 1T5YA 3PCSA 1TFOA 1CYVA 2O9UX 1HKXA 3D9RA 2W56A 1NO3A 3X3ZA 2XF3A 5AIHA 2XGNA 3G4S3 5IF6A 3MPHA 2D42A 1IDPA 3JUOA 3MSOA 1YIJ3 1JRQA 2W9PA 4MMZB 3JUPA 3KIIA 4HM3B 2CFLA 2W2CA 2W9QA 3LTCA 1YJW3 5CXOA 1N8R4 4XBTA 2XH9A 2ZDJA 4X2HA 4OVMA 1JV2B 1NDOB 2CWUA 1WNHA 3CCS3 3PCRA 1DMQA 1Y4KA 2OTL3 5JPUA 2XFTA 1ASKA 2CWVA 1UUVB 1IVXA 3B8LA 4Q53A 2CC3A 1EKMA 3NV0A 2QEX3 1KWIA 3PYJA 2OOVC 3G713 4HM7B 2R4IA 4N3VA 3CMA3 3BNCA 1UUWB 2IUKA 3K7CA 3GZBA 1W2ZA 1U8CB 1DMMA 3F8XA 1GYBA 4K1VA 5I97A 3DY5A 1VQ73 1CEWI 3NQYA 1OPYA 1EG9B 4HBRA 1STDA 3QK9A 1UW1A 3D3LA 3JUMA 3N8BA 1Q40B 3F7XA 1QAKA 3MG3A 5EQLA 5AIGA 3HIGA 2K54A 5FW5A 2IUJA 1N8QA 1AV4A 5KP4A 4FMCA 4HM6B 3FG3A 3F7SA 3GAXA 2LYXA 3FGYA 4R1KA 1VQ63 3SX1A 2P0MA 1WQLB 5FGOA 3S29A 1Q7Y4 4XBXA 1OH0A 2Z76A 3CPW2 1M1XB 5IENA 1NU3A 5EVHA 4MMXB 2IMJA 1N5PA 1A2KA 1JN5A 2ZL8A 1WMPA 2BMQB 2Q07A 3NUVA 1NB3I 4QWTA 3ALAA 2BO9B 1O7NB 3PGBA 4R4KA 1N9JA 2LQVA 3HZPA 3X41A 4N6TA 3GRDA 2RFRA 1OACA 1J2BA 2Y74A 2CFDA 3EC9A 1ROAA 4EV5A 3EQQB 3WDGB 1IQXA 2C11A 3WA3A 3PZWA 2BMRB 3BNDA 2MC8A 3SXXA 2A15A 4O02B 3PS8A 3CCJ3 4BTWA 2WGQA 2YFJB 1DVCA 1TP6A 1TIJA 1SJWA 1TFKA 1IK3A 1GS3A 3LTAA 2V1LA 3WOEB 2O3OA 2W6JH 4HKVB 4XBYA 4HM0B 1VQ53 3CC73 3Q1CA 4WYKA 1NWWA 3DZLA 4GB5A 3SLUA 3V98A 1VZZA 3Q90A 3UL5A 1O7MB 4XM4A 1OUNA 1KD14 4LSOA 1JB2A 1O7PB 3G0KA 3SEDA 3F14A 3VSYA 3WMDA 4STDA 1RRHA 2HMNB 1IQYA 2RSXA 3LYGA 1W2B2 3EBYA 1ZX2A 1D6YA 2XRXB 1VQK3 2GEXA 2CWTA 3STDA 3CC43 4MJDA 2KXGA 2WGOA 2D1WA 3EJVA 3X42A 1AVLA 3F9SA 2JDIH 1IVWA 3K9MC 5CLKA 1TUHA 1Z1SA 3HX8A 4IT7A 4K1UA 4KFFA 1IU7A 4XB5A 1KQS2 3X3YA 3DGNA 1YHQ3 1C7HA 3NM7A 1R4CA 5BXQA 1EQKA 3CCR3 2FGTA 3BNBA 1W6GA 4WP5A 5D82A 2XEPA 1FGRA 3FSDA 5IERA 3BLZA 3JVCA 1N9EA 2OQEC 2W56B 1W6CA 5HGRA 3OW22 1ZO2A 3ECFA 3B4PA 2P38A 2BNGA 3J7Yd 2WOFA 3UB1A 3S5CA 2Z77A 4N6OB 3FZWA 1JKGA 1OCVA 1FGQA 3NXJA 3NHXA 4L8OA 3G8ZA 5A0OB 2WO0A 1S723 5D81A 1OHSA 3EF8A 4BTXA 3FKAA 3GZYB 1E3VA 3LXUX 1OGXA 1K28A 1A2VA 3FCSB 4JF8A 1VQ83 1S5AA 5AIIA 3EB8A 5KP3A 3ER7A 4RNYA 1YIT3 4XDVA 1RRLA 3CPOA 3OXAA 3VF1A 3NV0B 3NX0A 2Z7AA 2INXA 3AMOA 5LC6A 3LZAA 4L7KA 4EBGA 2C10A 2MF7A 1SPUA 5LC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPT A;  2STD A;  3B4O A;  1OF5 A;  3EX9 A;  5CK6 A;  4HM1 B;  4FCM A;  3RGA A;  4CDL A;  4HM5 B;  5BVB A;  2JQ5 A;  4LEH A;  2OWP A;  1ISK A;  4PEJ A;  2CKF B;  3E99 A;  1GY5 A;  3ROB A;  1JB5 A;  3HK4 A;  4ORL A;  5AEU B;  2I9W A;  4J8T A;  5IG5 A;  5IEP A;  4KVH A;  2YFL B;  3CNX A;  2YFI B;  4R9L A;  2XSH B;  1JN5 B;  1ULI B;  3EBT A;  5AEW B;  4H3U A;  3NM2 A;  2F86 B;  1JB4 A;  4U13 A;  1O7H B;  5CF2 A;  3OX9 A;  3FLJ A;  3DUK A;  2HMO B;  5CF1 A;  4WYK B;  1E3R A;  3DMC A;  3M8C A;  4HM8 B;  3H3H A;  2RGQ A;  4HJL B;  3MG1 A;  4R9K A;  2QIY A;  3KZT A;  1OHO A;  3T8U A;  3KKG A;  3MYT A;  4LMI A;  3FF0 A;  4I4K A;  4HM2 B;  2B1X B;  2HMJ B;  3OWS A;  1CQS A;  3EN8 A;  3BB9 A;  2F98 A;  2F99 A;  1QJG A;  3FF2 A;  1EA2 A;  3MKI A;  3A76 A;  6STD A;  1K41 A;  2HML B;  2GBW B;  1JKG B;  3EHC A;  3JUN A;  2XSO B;  5AIF A;  1DMN A;  3OV4 A;  3MHE A;  3SOA A;  3KE7 A;  2QGU A;  3CNM A;  2HMK B;  1Q42 A;  2BMO B;  3OWU A;  1Q40 A;  1AR0 A;  4FCJ A;  5DRV A;  3KSP A;  1O7W B;  4L8P A;  2HMM B;  1E97 A;  1OF5 B;  8CHO A;  5KP1 A;  2XR8 B;  1GY7 A;  2PZV A;  1OGZ A;  2UX0 A;  3RGR A;  3DXO A;  3T8N A;  5DRE A;  1U5O A;  2GXF A;  3FH1 A;  4XDW A;  2B24 B;  2GEY A;  2RCD A;  5D83 A;  1BUQ A;  3DM8 A;  1ULJ B;  5AI1 A;  1OHP A;  3H51 A;  5IEO A;  4HM4 B;  3MG2 A;  4HZ9 B;  3GZX B;  4J9A A;  4OUQ A;  5STD A;  5IG4 A;  3OWY A;  3JUQ A;  3EN1 B;  3GWR A;  3G16 A;  3VGN A;  1QMA A;  4IIA A;  3GZR A;  1W01 A;  3SOY A;  3I0Y A;  4HZB B;  4HVN A;  4X2O A;  3UJM A;  7STD A;  3F8H A;  4WWU C;  5JPP A;  5TGN A;  1W02 A;  4RZM A;  3UNL A;  1GY6 A;  3K0Z A;  3CU3 A;  3F40 A;  1O7G B;  3B7C A;  4LGQ A;  1W6Y A;  2CHC A;  3NBR A;  5G2G A;  1W00 A;  5IG0 A;  2GBX B;  5IG3 A;  3D9R A;  1HKX A;  5AIH A;  5IF6 A;  3JUO A;  1IDP A;  3MSO A;  3JUP A;  4HM3 B;  2W2C A;  5CXO A;  4XBT A;  4X2H A;  4OVM A;  1NDO B;  1DMQ A;  5JPU A;  1ASK A;  1UUV B;  3B8L A;  4Q53 A;  3NV0 A;  4HM7 B;  2R4I A;  4N3V A;  1UUW B;  3K7C A;  3GZB A;  1DMM A;  3F8X A;  1GYB A;  4K1V A;  1OPY A;  1EG9 B;  1STD A;  3JUM A;  1Q40 B;  3F7X A;  3MG3 A;  5AIG A;  2K54 A;  5FW5 A;  5KP4 A;  4HM6 B;  3F7S A;  4R1K A;  3FGY A;  1WQL B;  4XBX A;  1OH0 A;  2Z76 A;  5IEN A;  1NU3 A;  5EVH A;  2IMJ A;  1A2K A;  1JN5 A;  2BMQ B;  3NUV A;  1O7N B;  3HZP A;  3GRD A;  2RFR A;  3EC9 A;  3EQQ B;  2BMR B;  2A15 A;  2YFJ B;  1TP6 A;  1SJW A;  1GS3 A;  4HKV B;  4XBY A;  4HM0 B;  4WYK A;  1NWW A;  3DZL A;  4GB5 A;  1VZZ A;  3Q90 A;  1O7M B;  4XM4 A;  1OUN A;  1JB2 A;  1O7P B;  3G0K A;  3SED A;  3F14 A;  3VSY A;  3WMD A;  4STD A;  2HMN B;  3LYG A;  3EBY A;  1ZX2 A;  2XRX B;  2GEX A;  3STD A;  4MJD A;  3EJV A;  3F9S A;  5CLK A;  1TUH A;  1Z1S A;  3HX8 A;  4K1U A;  4XB5 A;  1C7H A;  5BXQ A;  4WP5 A;  5D82 A;  3FSD A;  5IER A;  3BLZ A;  5HGR A;  1ZO2 A;  3ECF A;  3B4P A;  2BNG A;  3S5C A;  2Z77 A;  3FZW A;  1JKG A;  1OCV A;  3NXJ A;  3NHX A;  4L8O A;  3G8Z A;  5D81 A;  1OHS A;  3EF8 A;  3FKA A;  3GZY B;  1E3V A;  1OGX A;  1S5A A;  5AII A;  5KP3 A;  3ER7 A;  4XDV A;  3CPO A;  3OXA A;  3NV0 B;  2Z7A A;  2INX A;  3LZA A;  4L7K A; 
#chains in the Genus database with same CATH topology
 3IPT A;  2STD A;  3B4O A;  1OF5 A;  1RNB A;  3EX9 A;  1A90 A;  4JRF A;  5CK6 A;  4HM1 B;  4FCM A;  3RGA A;  5IW9 A;  3MWZ A;  1UI8 A;  1V74 A;  2L4V A;  4HM5 B;  4AKZ A;  2JQ5 A;  2FNQ A;  4CDL A;  1EUI C;  1I70 A;  3ZG5 A;  5BVB A;  2CFK A;  1SIH A;  4LEH A;  1ROV A;  2P09 A;  1B21 A;  2OWP A;  4PEJ A;  2CKF B;  3E99 A;  4CCV A;  3CCM 3;  1VQ9 3;  3X40 A;  1ISK A;  1GY5 A;  3ROB A;  5HOH A;  1JB5 A;  3HK4 A;  4ORL A;  4TX4 A;  5AEU B;  2I9W A;  3DGL A;  4J8T A;  1WMN A;  1DET A;  2F56 A;  3N54 B;  5IG5 A;  2Z6B A;  3CCL 3;  5IEP A;  1VQL 3;  1IYY A;  2OOV A;  4FCZ A;  1WMO A;  3V99 A;  4O3V A;  1QVG 2;  4KVH A;  1LQM B;  5M18 A;  2P05 A;  2YFL B;  1QAL A;  3CNX A;  1FUS A;  1W5Z A;  4RNT A;  1B2Z A;  2K0M A;  1LOX A;  2E2V A;  1RDS A;  2YFI B;  4R9L A;  2CG0 A;  2XSH B;  1JN5 B;  1ULI B;  2CIU A;  1VQM 3;  1MWU A;  2AAD A;  3S28 A;  1VQ4 3;  2AAE A;  2CFW A;  1LNI A;  1W7C A;  4HOH A;  4H61 A;  1M90 4;  4EV2 A;  1RNT A;  3AGO A;  1N5H A;  3EBT A;  1VQP 3;  1MNL A;  1ZGX A;  4GHO A;  3KSE D;  1FW7 A;  3LT8 A;  1YVS A;  3X3X A;  1D6Z A;  1I3F A;  1F8N A;  2RNT A;  1BAO A;  7RNT A;  5M19 A;  5AEW B;  1PYL A;  4FMB A;  5ELU A;  4NRE A;  3Q2P A;  4H3U A;  4EW5 A;  3NM2 A;  3SVA A;  2F86 B;  1BRI A;  1GSP A;  1JB4 A;  3EE1 A;  1O7H B;  4U13 A;  3OX9 A;  2P0X A;  4AKY A;  5CF2 A;  3FLJ A;  3DUK A;  4BTY A;  1SAR A;  2SBL A;  5GSP A;  3LTD A;  1RKY A;  2CG1 A;  2QA4 3;  1JZD A;  2W03 A;  2HMO B;  5CF1 A;  4WYK B;  3U97 A;  1LRA A;  1IT8 A;  4ILF A;  2KCD A;  1X1Y A;  1I2F A;  1E3R A;  3DMC A;  3M8C A;  4HM8 B;  2CX1 A;  3D5G A;  4MMY B;  1X1W A;  1BNI A;  2IY2 A;  2RGQ A;  3H3H A;  3HII A;  4HJL B;  2BHM A;  1VQN 3;  3MG1 A;  1M1K 4;  1AVK A;  1KC8 4;  2WOH A;  3D79 A;  4R9K A;  1K73 4;  3DGY A;  2QIY A;  1Q86 4;  3KZT A;  1JBT A;  1EEJ A;  3S67 A;  1A2P A;  2PNC A;  1OHO A;  3T8U A;  3KKG A;  3MYT A;  1BNE A;  2W0Q A;  3CC2 3;  3WA2 X;  1UCI A;  1MOL A;  4LMI A;  1LNH A;  1B2X A;  2E2T A;  4O8S A;  1A67 A;  1HU9 A;  2ML5 A;  2CK3 H;  1RCK A;  3FF0 A;  4I4K A;  4OK0 A;  4HM2 B;  4NHF A;  2B1X B;  4RNZ A;  2HMJ B;  1JNQ A;  2IYJ A;  3O8Y A;  4HYZ A;  4K90 B;  2UGI A;  3CCQ 3;  3CCV 3;  1B3S A;  1FGO A;  1FZU A;  3OWS A;  1IQ8 A;  4KT3 B;  1CQS A;  1W4N A;  3EN8 A;  4N6U A;  4RBN A;  3BB9 A;  3LT9 A;  2F98 A;  2F99 A;  1QJG A;  2KF4 A;  3FF2 A;  5BU4 A;  1EA2 A;  1R4Y A;  3MKI A;  4AEQ A;  1UUG B;  3UL6 A;  3CCU 3;  3PXM A;  5EEO A;  1YJ9 3;  3RDE A;  1BVI A;  1FUT A;  3A76 A;  6STD A;  1K41 A;  2HML B;  1BNG A;  1SII A;  2GBW B;  4EXR A;  1UDI I;  1JKG B;  1RGA A;  3EHC A;  3KCH A;  1JBS A;  3JUN A;  2XSO B;  5AYR B;  1VQO 3;  2GU3 A;  4N6M A;  5AIF A;  1DMN A;  1GD4 A;  1BSA A;  3OV4 A;  4BU4 A;  5JBS A;  1RJO A;  3I55 3;  3MHE A;  3SOA A;  3KE7 A;  2QGU A;  1FGM A;  3CNM A;  1L5G B;  1I0V A;  2HMK B;  3KFQ C;  4LZI A;  1Q42 A;  2M7O A;  3I56 3;  2BMO B;  3OWU A;  1NJI 4;  1KSI A;  4R80 A;  1Q40 A;  3ZFZ A;  3KN4 A;  2OQE A;  1IVU A;  1AR0 A;  4FCJ A;  2Y73 A;  5DRV A;  2KF5 A;  3DGO A;  4KFE A;  3KSP A;  1YI2 3;  1JJ2 2;  3AMO B;  1O7W B;  4L8P A;  4MEI A;  3D4A A;  2HMM B;  1E97 A;  1OF5 B;  1TTO A;  2H0I A;  4WFO A;  2XFS A;  4FMA A;  3U1W A;  8CHO A;  1GOV A;  4BL2 A;  5KP1 A;  2XR8 B;  1SQW A;  3DGM A;  3CD6 3;  1GY7 A;  1NB5 I;  2PZV A;  1GMR A;  4N6N B;  1OGZ A;  2OTJ 3;  2UX0 A;  1HZ1 A;  4ZM8 A;  3LTB A;  2E2U A;  3S27 A;  3RGR A;  2RBI A;  4EC6 A;  3DXO A;  3T8N A;  2YX9 A;  5DRE A;  1FUW A;  1PU4 A;  1U5O A;  1YJN 3;  3V92 A;  3NBJ A;  1WTH A;  1QVF 2;  2W04 A;  1YGE A;  2CFG A;  1LOV A;  2GXF A;  3FH1 A;  4XDW A;  5ELJ A;  2K3D A;  1Q82 4;  1K9M 4;  2B24 B;  3NQZ A;  3RNT A;  2GEY A;  2RCD A;  1MWS A;  5D83 A;  1BUQ A;  1BIR A;  3DM8 A;  1US1 A;  1DVD A;  1QAF A;  1ULJ B;  2FXT A;  1OHP A;  3H51 A;  5AI1 A;  2KRT A;  3K5T A;  1YVB I;  5IEO A;  1AY7 A;  3TDG A;  2J8X B;  4HM4 B;  1UI7 A;  1G96 A;  3MG2 A;  4HZ9 B;  1TJD A;  1PFP A;  4KZ1 A;  1IVV A;  1UGH I;  4FMD A;  3GZX B;  4LYL B;  4K61 A;  4J9A A;  4OUQ A;  5STD A;  2GU1 A;  5IG4 A;  3OWY A;  5AYS C;  1BU4 A;  3JUQ A;  2CX0 A;  1MGW A;  3WOD G;  2OCT A;  4EYC A;  1RGK A;  4FR9 A;  3CXC 2;  1BNR A;  3CCE 3;  1RN7 A;  1M9G A;  1D6U A;  1X1X A;  3EN1 B;  3GWR A;  1B2M A;  2F5M A;  3G16 A;  3HI7 A;  4N6V 0;  4NPB A;  1GD3 A;  3FG4 A;  1DYU A;  1BNJ A;  2ZA4 A;  3LOY A;  3VGN A;  2CW9 A;  4IPB A;  1LVN A;  1LQG C;  3K63 A;  1BAN A;  1QMA A;  2BT3 A;  4IIA A;  3GZR A;  3L0R A;  1TU5 A;  1W01 A;  4KFD A;  3SOY A;  3I0Y A;  4HZB B;  4G1M B;  4HVN A;  1Q81 4;  1LXE A;  4X2O A;  1BRJ A;  3UJM A;  7STD A;  3IJE B;  1IV9 A;  1RGG A;  3F8H A;  3LML A;  4WWU C;  5JPP A;  3T0U A;  1UCL A;  3N9H A;  3G6E 3;  4O2H A;  5TGN A;  1BNF A;  1STF I;  1W02 A;  4RZM A;  1HYF A;  3UNL A;  1LOW A;  3AHS A;  3A5E A;  2IA7 A;  3BNE A;  4N6L A;  1MGR A;  1GY6 A;  8RNT A;  1B2U A;  4J5G A;  1GOY A;  3K0Z A;  3LH4 A;  3CU3 A;  3F40 A;  3URP A;  3FG1 A;  2XGL A;  1O7G B;  1BRG A;  3B7C A;  3NBB A;  1IT7 A;  1FA3 A;  4WHA A;  4LGQ A;  1W6Y A;  1RGE A;  1T2H A;  2ML6 A;  2CHC A;  3NBR A;  3AGN A;  5G2G A;  1IV7 A;  1W00 A;  3IMA B;  4I5Q A;  4GL6 A;  5IG0 A;  1CYU A;  1FGT A;  1K8A 4;  2CH9 A;  2GBX B;  3AHW A;  5IG3 A;  3QRD A;  3WOF B;  4DKI A;  1T5Y A;  3PCS A;  1TFO A;  1CYV A;  3WR2 A;  4BL3 A;  1BSC A;  1HKX A;  2O9U X;  2C4B A;  1NO3 A;  2W56 A;  2XF3 A;  3D9R A;  3X3Z A;  1TRQ A;  5AIH A;  2XGN A;  3G4S 3;  5IF6 A;  2F4Y A;  3MPH A;  2D42 A;  1IDP A;  3JUO A;  3MSO A;  1YIJ 3;  1JRQ A;  2W9P A;  4MMZ B;  1RLS A;  3Q3F A;  3JUP A;  1BRH A;  3KII A;  4HM3 B;  2CFL A;  2W2C A;  2W9Q A;  3LTC A;  1YJW 3;  4GSP A;  5CXO A;  1N8R 4;  1G0T A;  2SAR A;  2XH9 A;  4XBT A;  2ZDJ A;  4X2H A;  3SYU A;  4OVM A;  1JV2 B;  1NDO B;  1GMP A;  1WNH A;  2CWU A;  3CCS 3;  3PCR A;  1DMQ A;  1Y4K A;  2OTL 3;  5JPU A;  2XFT A;  1ASK A;  2CWV A;  1CH0 A;  1TRP A;  1IVX A;  1UUV B;  3B8L A;  4Q53 A;  2CC3 A;  1X1U A;  6RNT A;  1EKM A;  3NV0 A;  2QEX 3;  1LOY A;  1KWI A;  3PYJ A;  2OOV C;  3G71 3;  2KAA A;  4HM7 B;  4BIR A;  2R4I A;  4N3V A;  3CMA 3;  3BNC A;  1UUW B;  2IUK A;  3K7C A;  3GZB A;  4J5K A;  1UCK A;  1W2Z A;  1U8C B;  3DH2 A;  1DMM A;  1I2G A;  1BRS A;  3F8X A;  1GYB A;  1RN4 A;  4K1V A;  1ZS7 A;  5I97 A;  3DY5 A;  1JZO A;  1VQ7 3;  1CEW I;  1B20 A;  1RHL A;  1OPY A;  1RTU A;  2BU4 A;  1EG9 B;  2HOH A;  1STD A;  3NQY A;  1FYS A;  3QK9 A;  1UW1 A;  3D3L A;  4HBR A;  3BIR A;  3JUM A;  3N8B A;  1Q40 B;  3F7X A;  1QAK A;  3MG3 A;  5EQL A;  5AIG A;  3HIG A;  2K54 A;  5FW5 A;  2IUJ A;  1N8Q A;  1BSE A;  1AV4 A;  1Q7H A;  1BRN L;  5KP4 A;  4FMC A;  4HM6 B;  1GMQ A;  3FG3 A;  3F7S A;  3GAX A;  2LYX A;  3FGY A;  4R1K A;  2F5W A;  1VQ6 3;  3SX1 A;  2P0M A;  1NNV A;  1WQL B;  5FGO A;  3S29 A;  4CJN A;  1Q7Y 4;  4XBX A;  2GSP A;  1OH0 A;  2Z76 A;  3CPW 2;  1M1X B;  5IEN A;  1NU3 A;  5EVH A;  4MMX B;  2IMJ A;  1AQZ A;  1N5P A;  1A2K A;  1JN5 A;  2ZL8 A;  4CPK A;  1WMP A;  2BMQ B;  2C10 A;  2Q07 A;  1NB3 I;  3NUV A;  4QWT A;  1RGH A;  3ALA A;  1RCL A;  2BO9 B;  1BUJ A;  1O7N B;  1T2I A;  5BIR A;  3PGB A;  4R4K A;  3ZG0 A;  1N9J A;  6GSP A;  2LQV A;  3HZP A;  3X41 A;  4N6T A;  3GRD A;  2RFR A;  1OAC A;  1J2B A;  2CFD A;  2Y74 A;  3EC9 A;  5G1K A;  1ROA A;  4EV5 A;  1RMS A;  1MWR A;  3EQQ B;  1IQX A;  2C11 A;  3WDG B;  3WA3 A;  1MWT A;  3PZW A;  1UGI A;  2BMR B;  1RGC A;  3BND A;  1BRK A;  2MC8 A;  2A15 A;  4O02 B;  3SXX A;  1B27 A;  3PS8 A;  5RNT A;  3CCJ 3;  4BTW A;  1BGS A;  2WGQ A;  1I8V A;  1V58 A;  2YFJ B;  1DVC A;  1RSN A;  1TP6 A;  1RGL A;  1TIJ A;  1SJW A;  1TFK A;  1IK3 A;  1GS3 A;  3LTA A;  7GSP A;  2V1L A;  3WOE B;  2UUG C;  2O3O A;  1C54 A;  2H0H A;  2W6J H;  4HKV B;  4XBY A;  1Q9E A;  2L1S A;  4HM0 B;  1VQ5 3;  3CC7 3;  3Q1C A;  4WYK A;  1NWW A;  3DZL A;  4GB5 A;  3SLU A;  3V98 A;  1VZZ A;  3Q90 A;  3UL5 A;  1O7M B;  4XM4 A;  1OUN A;  1KD1 4;  4LSO A;  1JB2 A;  1O7P B;  3G0K A;  3SED A;  1BSD A;  1RN1 A;  1I2E A;  3F14 A;  1V57 A;  3VSY A;  1I3I A;  4STD A;  3WMD A;  1RRH A;  2HMN B;  1IQY A;  2RSX A;  3LYG A;  1W2B 2;  1T3B A;  3EBY A;  1ZX2 A;  1VQQ A;  1D6Y A;  2XRX B;  1VQK 3;  2GEX A;  2CWT A;  3STD A;  3CC4 3;  4MJD A;  2KXG A;  2WGO A;  2D1W A;  3EJV A;  3X42 A;  4HAA A;  1AVL A;  3F9S A;  2JDI H;  1IVW A;  3K9M C;  5CLK A;  1TUH A;  1YNV X;  2BIR A;  1Z1S A;  3HX8 A;  4IT7 A;  4K1U A;  1PY3 A;  4KFF A;  1IU7 A;  2KF6 A;  4XB5 A;  9RNT A;  1KQS 2;  3X3Y A;  1I0X A;  3DGN A;  1YHQ 3;  3D5I A;  3BU4 A;  2R41 A;  1C7H A;  3NM7 A;  5M1A A;  1R4C A;  5BXQ A;  1EQK A;  3CCR 3;  2FGT A;  3BNB A;  1W6G A;  1BNS A;  4WP5 A;  3HOH A;  2XEP A;  1FGR A;  3FSD A;  5D82 A;  3BLZ A;  3JVC A;  5G1L A;  5IER A;  1N9E A;  2OQE C;  2W56 B;  1W6C A;  5HGR A;  3OW2 2;  1ZO2 A;  3ECF A;  3B4P A;  1DE3 A;  2P38 A;  2BNG A;  3J7Y d;  2WOF A;  1B2S A;  3UB1 A;  3S5C A;  2Z77 A;  4N6O B;  3FZW A;  1JKG A;  2H0G A;  1OCV A;  1FGQ A;  3NXJ A;  1BSB A;  3NHX A;  4L8O A;  3G8Z A;  5A0O B;  1YGW A;  2WO0 A;  1S72 3;  1GOU A;  5D81 A;  1JBR A;  1OHS A;  3EF8 A;  4BTX A;  3FKA A;  3GZY B;  1E3V A;  3LXU X;  1OGX A;  1K28 A;  1A2V A;  3FCS B;  4JF8 A;  1VQ8 3;  1S5A A;  5AII A;  1RGF A;  3EB8 A;  1G02 A;  3ER7 A;  2ZHX B;  4RNY A;  5KP3 A;  1YIT 3;  4XDV A;  1RRL A;  3CPO A;  3GSP A;  2KF3 A;  3OXA A;  3CME 3;  3VF1 A;  3NV0 B;  3NX0 A;  2Z7A A;  2INX A;  3AMO A;  1BOX A;  3LZA A;  4L7K A;  5LC6 A;  4EBG A;  3WHO A;  1UCJ A;  2MF7 A;  1SPU A;  5LC7 A; 
#chains in the Genus database with same CATH homology
 3IPT A;  2STD A;  3B4O A;  1OF5 A;  3EX9 A;  1A90 A;  4JRF A;  5CK6 A;  4HM1 B;  4FCM A;  3RGA A;  5IW9 A;  3MWZ A;  1UI8 A;  1V74 A;  2L4V A;  4HM5 B;  4AKZ A;  2JQ5 A;  2FNQ A;  4CDL A;  5BVB A;  2CFK A;  1SIH A;  4LEH A;  1ROV A;  2P09 A;  2OWP A;  1ISK A;  4PEJ A;  2CKF B;  3E99 A;  4CCV A;  3CCM 3;  1VQ9 3;  3X40 A;  1GY5 A;  3ROB A;  1JB5 A;  3HK4 A;  4ORL A;  4TX4 A;  5AEU B;  2I9W A;  3DGL A;  4J8T A;  1WMN A;  3N54 B;  5IG5 A;  2Z6B A;  3CCL 3;  5IEP A;  1VQL 3;  2OOV A;  4FCZ A;  1WMO A;  3V99 A;  4O3V A;  1QVG 2;  4KVH A;  2P05 A;  2YFL B;  1QAL A;  3CNX A;  1W5Z A;  2K0M A;  1LOX A;  2E2V A;  2YFI B;  4R9L A;  2CG0 A;  2XSH B;  1JN5 B;  1ULI B;  2CIU A;  1VQM 3;  3S28 A;  1VQ4 3;  2CFW A;  1W7C A;  4H61 A;  1M90 4;  4EV2 A;  1N5H A;  3EBT A;  1VQP 3;  1MNL A;  3KSE D;  3LT8 A;  3X3X A;  1D6Z A;  1F8N A;  5AEW B;  4FMB A;  5ELU A;  4NRE A;  3Q2P A;  4H3U A;  3NM2 A;  3SVA A;  2F86 B;  1JB4 A;  3EE1 A;  1O7H B;  4U13 A;  3OX9 A;  2P0X A;  4AKY A;  5CF2 A;  3FLJ A;  3DUK A;  4BTY A;  2SBL A;  3CME 3;  3LTD A;  1RKY A;  2CG1 A;  2QA4 3;  2W03 A;  2HMO B;  5CF1 A;  4WYK B;  3U97 A;  1IT8 A;  2KCD A;  1E3R A;  3DMC A;  3M8C A;  4HM8 B;  4MMY B;  3H3H A;  2RGQ A;  3HII A;  4HJL B;  2BHM A;  1VQN 3;  3MG1 A;  1M1K 4;  1AVK A;  1KC8 4;  2WOH A;  4R9K A;  1K73 4;  2QIY A;  1Q86 4;  3KZT A;  3S67 A;  2PNC A;  1OHO A;  3T8U A;  3KKG A;  3MYT A;  2W0Q A;  3CC2 3;  3WA2 X;  1MOL A;  4LMI A;  1LNH A;  2E2T A;  4O8S A;  1A67 A;  1HU9 A;  2ML5 A;  2CK3 H;  3FF0 A;  4I4K A;  4OK0 A;  1DVD A;  4HM2 B;  4NHF A;  2B1X B;  4RNZ A;  2HMJ B;  1JNQ A;  3CCQ 3;  3O8Y A;  4HYZ A;  4K90 B;  3CCV 3;  1FGO A;  3OWS A;  1IQ8 A;  1CQS A;  1W4N A;  3EN8 A;  4N6U A;  4RBN A;  3BB9 A;  3LT9 A;  2F98 A;  2F99 A;  1QJG A;  3FF2 A;  1EA2 A;  3MKI A;  4AEQ A;  3UL6 A;  3CCU 3;  3PXM A;  5EEO A;  1YJ9 3;  3RDE A;  3A76 A;  6STD A;  1K41 A;  2HML B;  1SII A;  2GBW B;  4EXR A;  1JKG B;  3EHC A;  3JUN A;  2XSO B;  5AYR B;  1VQO 3;  2GU3 A;  4N6M A;  5AIF A;  1DMN A;  1GD4 A;  3OV4 A;  5JBS A;  1RJO A;  3I55 3;  3MHE A;  3SOA A;  3KE7 A;  2QGU A;  1FGM A;  3CNM A;  1L5G B;  2HMK B;  3KFQ C;  4LZI A;  1Q42 A;  2M7O A;  3I56 3;  2BMO B;  3OWU A;  1NJI 4;  1KSI A;  4R80 A;  1Q40 A;  3KN4 A;  2OQE A;  1IVU A;  1AR0 A;  4FCJ A;  2Y73 A;  5DRV A;  3DGO A;  4KFE A;  3KSP A;  1YI2 3;  1JJ2 2;  3AMO B;  1O7W B;  4L8P A;  4MEI A;  2HMM B;  1E97 A;  1OF5 B;  4WFO A;  2XFS A;  4FMA A;  3U1W A;  8CHO A;  5KP1 A;  2XR8 B;  1SQW A;  3DGM A;  3CD6 3;  1GY7 A;  1NB5 I;  2PZV A;  4N6N B;  1OGZ A;  2OTJ 3;  2UX0 A;  4ZM8 A;  3LTB A;  2E2U A;  3S27 A;  3RGR A;  4EC6 A;  3DXO A;  3T8N A;  2YX9 A;  5DRE A;  1FUW A;  1PU4 A;  1U5O A;  1YJN 3;  3V92 A;  3NBJ A;  1WTH A;  1QVF 2;  2W04 A;  1YGE A;  2CFG A;  2GXF A;  3FH1 A;  4XDW A;  5ELJ A;  1Q82 4;  1K9M 4;  2B24 B;  3NQZ A;  2GEY A;  2RCD A;  5D83 A;  1BUQ A;  3DM8 A;  1US1 A;  1QAF A;  1ULJ B;  2FXT A;  1OHP A;  3H51 A;  5AI1 A;  2KRT A;  3K5T A;  1YVB I;  5IEO A;  3TDG A;  4HM4 B;  1UI7 A;  1G96 A;  3MG2 A;  4HZ9 B;  1PFP A;  4KZ1 A;  1IVV A;  4FMD A;  3GZX B;  4K61 A;  4J9A A;  4OUQ A;  5STD A;  2GU1 A;  5IG4 A;  3OWY A;  5AYS C;  3WOD G;  3JUQ A;  4EYC A;  2OCT A;  4FR9 A;  3CXC 2;  3CCE 3;  1RN7 A;  1M9G A;  1D6U A;  3EN1 B;  3GWR A;  3G16 A;  3HI7 A;  4N6V 0;  1GD3 A;  3FG4 A;  1DYU A;  3LOY A;  3VGN A;  2CW9 A;  4IPB A;  1LVN A;  3K63 A;  1QMA A;  2BT3 A;  4IIA A;  3GZR A;  3L0R A;  1TU5 A;  1W01 A;  4KFD A;  3SOY A;  3I0Y A;  4HZB B;  4G1M B;  4HVN A;  1Q81 4;  1LXE A;  4X2O A;  3UJM A;  7STD A;  3IJE B;  1IV9 A;  3F8H A;  3LML A;  4WWU C;  5JPP A;  3T0U A;  3N9H A;  3G6E 3;  4O2H A;  5TGN A;  1STF I;  1W02 A;  4RZM A;  3UNL A;  2IA7 A;  3BNE A;  4N6L A;  1GY6 A;  3K0Z A;  3LH4 A;  3CU3 A;  3F40 A;  3FG1 A;  2XGL A;  1O7G B;  3NBB A;  3B7C A;  1IT7 A;  1FA3 A;  4WHA A;  4LGQ A;  1W6Y A;  2ML6 A;  2CHC A;  3NBR A;  5G2G A;  1IV7 A;  1W00 A;  3IMA B;  5IG0 A;  4GL6 A;  1CYU A;  1FGT A;  1K8A 4;  2CH9 A;  2GBX B;  5IG3 A;  3QRD A;  3WOF B;  1T5Y A;  3PCS A;  1TFO A;  1CYV A;  2O9U X;  1HKX A;  3D9R A;  2W56 A;  1NO3 A;  3X3Z A;  2XF3 A;  5AIH A;  2XGN A;  3G4S 3;  5IF6 A;  3MPH A;  2D42 A;  1IDP A;  3JUO A;  3MSO A;  1YIJ 3;  1JRQ A;  2W9P A;  4MMZ B;  3JUP A;  3KII A;  4HM3 B;  2CFL A;  2W2C A;  2W9Q A;  3LTC A;  1YJW 3;  5CXO A;  1N8R 4;  4XBT A;  2XH9 A;  2ZDJ A;  4X2H A;  4OVM A;  1JV2 B;  1NDO B;  2CWU A;  1WNH A;  3CCS 3;  3PCR A;  1DMQ A;  1Y4K A;  2OTL 3;  5JPU A;  2XFT A;  1ASK A;  2CWV A;  1UUV B;  1IVX A;  3B8L A;  4Q53 A;  2CC3 A;  1EKM A;  3NV0 A;  2QEX 3;  1KWI A;  3PYJ A;  2OOV C;  3G71 3;  4HM7 B;  2R4I A;  4N3V A;  3CMA 3;  3BNC A;  1UUW B;  2IUK A;  3K7C A;  3GZB A;  1W2Z A;  1U8C B;  1DMM A;  3F8X A;  1GYB A;  4K1V A;  5I97 A;  3DY5 A;  1VQ7 3;  1CEW I;  3NQY A;  1OPY A;  1EG9 B;  4HBR A;  1STD A;  3QK9 A;  1UW1 A;  3D3L A;  3JUM A;  3N8B A;  1Q40 B;  3F7X A;  1QAK A;  3MG3 A;  5EQL A;  5AIG A;  3HIG A;  2K54 A;  5FW5 A;  2IUJ A;  1N8Q A;  1AV4 A;  5KP4 A;  4FMC A;  4HM6 B;  3FG3 A;  3F7S A;  3GAX A;  2LYX A;  3FGY A;  4R1K A;  1VQ6 3;  3SX1 A;  2P0M A;  1WQL B;  5FGO A;  3S29 A;  1Q7Y 4;  4XBX A;  1OH0 A;  2Z76 A;  3CPW 2;  1M1X B;  5IEN A;  1NU3 A;  5EVH A;  4MMX B;  2IMJ A;  1N5P A;  1A2K A;  1JN5 A;  2ZL8 A;  1WMP A;  2BMQ B;  2Q07 A;  3NUV A;  1NB3 I;  4QWT A;  3ALA A;  2BO9 B;  1O7N B;  3PGB A;  4R4K A;  1N9J A;  2LQV A;  3HZP A;  3X41 A;  4N6T A;  3GRD A;  2RFR A;  1OAC A;  1J2B A;  2Y74 A;  2CFD A;  3EC9 A;  1ROA A;  4EV5 A;  3EQQ B;  3WDG B;  1IQX A;  2C11 A;  3WA3 A;  3PZW A;  2BMR B;  3BND A;  2MC8 A;  3SXX A;  2A15 A;  4O02 B;  3PS8 A;  3CCJ 3;  4BTW A;  2WGQ A;  2YFJ B;  1DVC A;  1TP6 A;  1TIJ A;  1SJW A;  1TFK A;  1IK3 A;  1GS3 A;  3LTA A;  2V1L A;  3WOE B;  2O3O A;  2W6J H;  4HKV B;  4XBY A;  4HM0 B;  1VQ5 3;  3CC7 3;  3Q1C A;  4WYK A;  1NWW A;  3DZL A;  4GB5 A;  3SLU A;  3V98 A;  1VZZ A;  3Q90 A;  3UL5 A;  1O7M B;  4XM4 A;  1OUN A;  1KD1 4;  4LSO A;  1JB2 A;  1O7P B;  3G0K A;  3SED A;  3F14 A;  3VSY A;  3WMD A;  4STD A;  1RRH A;  2HMN B;  1IQY A;  2RSX A;  3LYG A;  1W2B 2;  3EBY A;  1ZX2 A;  1D6Y A;  2XRX B;  1VQK 3;  2GEX A;  2CWT A;  3STD A;  3CC4 3;  4MJD A;  2KXG A;  2WGO A;  2D1W A;  3EJV A;  3X42 A;  1AVL A;  3F9S A;  2JDI H;  1IVW A;  3K9M C;  5CLK A;  1TUH A;  1Z1S A;  3HX8 A;  4IT7 A;  4K1U A;  4KFF A;  1IU7 A;  4XB5 A;  1KQS 2;  3X3Y A;  3DGN A;  1YHQ 3;  1C7H A;  3NM7 A;  1R4C A;  5BXQ A;  1EQK A;  3CCR 3;  2FGT A;  3BNB A;  1W6G A;  4WP5 A;  5D82 A;  2XEP A;  1FGR A;  3FSD A;  5IER A;  3BLZ A;  3JVC A;  1N9E A;  2OQE C;  2W56 B;  1W6C A;  5HGR A;  3OW2 2;  1ZO2 A;  3ECF A;  3B4P A;  2P38 A;  2BNG A;  3J7Y d;  2WOF A;  3UB1 A;  3S5C A;  2Z77 A;  4N6O B;  3FZW A;  1JKG A;  1OCV A;  1FGQ A;  3NXJ A;  3NHX A;  4L8O A;  3G8Z A;  5A0O B;  2WO0 A;  1S72 3;  5D81 A;  1OHS A;  3EF8 A;  4BTX A;  3FKA A;  3GZY B;  1E3V A;  3LXU X;  1OGX A;  1K28 A;  1A2V A;  3FCS B;  4JF8 A;  1VQ8 3;  1S5A A;  5AII A;  3EB8 A;  5KP3 A;  3ER7 A;  4RNY A;  1YIT 3;  4XDV A;  1RRL A;  3CPO A;  3OXA A;  3VF1 A;  3NV0 B;  3NX0 A;  2Z7A A;  2INX A;  3AMO A;  5LC6 A;  3LZA A;  4L7K A;  4EBG A;  2C10 A;  2MF7 A;  1SPU A;  5LC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...