1LRAA

Crystallographic study of glu 58 ala rnase t1(asterisk)2'-guanosine monophosphate at 1.9 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYAWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic study of Glu58Ala RNase T1 x 2'-guanosine monophosphate at 1.9-A resolution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
total genus 27
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1lraA00
1TRQA 8RNTA 5HOHA 1FUSA 1UCLA 3D4AA 5BIRA 1BSCA 1RGGA 1RNTA 1RGKA 2HOHA 1TRPA 1FUTA 3AHWA 2AADA 1PYLA 2RNTA 1RN4A 1Q9EA 1UCKA 1RMSA 2KF5A 1BNEA 1DETA 1GSPA 1ZGXA 2F5WA 1B2SA 2F5MA 1I2GA 3URPA 1C54A 5RNTA 1GOUA 1RDSA 1YNVX 1I2EA 1CH0A 2RBIA 1BRNL 1BRKA 1BU4A 1BAOA 1FYSA 2KAAA 1I3FA 1G02A 3GSPA 3WHOA 1I3IA 4J5GA 1RGLA 1BNFA 1BNSA 1R4YA 1AY7A 1I8VA 1B2XA 1BNRA 1B27A 1SARA 1BNIA 1UCJA 7GSPA 3AHSA 1HZ1A 1BNJA 5GSPA 3AGNA 1B20A 1BIRA 2SARA 7RNTA 1X1UA 1T2HA 3BIRA 1MGRA 1LOYA 1LOWA 1RNBA 1BSEA 1T2IA 3BU4A 1BSBA 1RCKA 2F56A 2BIRA 6RNTA 1A2PA 1RTUA 1B21A 1LRAA 2ZA4A 3DGYA 2GSPA 1JBTA 3RNTA 1BVIA 1B2ZA 4HAAA 3HOHA 1JBRA 3D5IA 1YVSA 4GHOA 1B3SA 1TTOA 1RGCA 1I0XA 3Q3FA 2KF6A 6GSPA 1X1WA 4HOHA 1AQZA 1GOVA 1B2UA 1I70A 1LOVA 1I2FA 1BRGA 2BU4A 1GMQA 2F4YA 1GMPA 1JBSA 1DE3A 1BSAA 2AAEA 2KF3A 3A5EA 3KCHA 3SYUA 1BOXA 3D5GA 1BUJA 1LNIA 1RSNA 2C4BA 1BSDA 3DH2A 1BRIA 1IYYA 9RNTA 2KF4A 1RGFA 1BRHA 1BRSA 1RLSA 4BU4A 1YGWA 1RGEA 1BANA 3AGOA 1RHLA 1I0VA 4BIRA 1FZUA 1PY3A 1GMRA 4GSPA 1X1YA 1RCLA 1BGSA 1GOYA 4J5KA 1RN1A 1MGWA 3WR2A 5BU4A 1FW7A 1UCIA 1HYFA 1X1XA 1BNGA 1B2MA 1BRJA 4RNTA 1RGAA 1RGHA
chains in the Genus database with same CATH superfamily
4HM1B 1WQLB 2WO0A 3F7SA 3CCL3 3B4OA 1Q40B 3X3ZA 1A2KA 1BSCA 1FA3A 4H61A 1STDA 1QAKA 1OGXA 3L0RA 4EW5A 2PZVA 2R41A 2GBXB 1PYLA 2RNTA 3SOAA 1DVCA 1Q9EA 1F8NA 1CEWI 1RMSA 1BNEA 1DETA 1OPYA 1VQ43 3CCM3 1EEJA 1TFKA 3U1WA 4HJLB 3CD63 1VQO3 1GOUA 1KD14 1Q42A 4CJNA 1D6YA 1ULJB 2GU3A 4EC6A 3EBYA 3VF1A 3GSPA 2XR8B 3JUQA 3F14A 4GL6A 1WMPA 3X40A 1J2BA 4EV2A 1NB3I 3MPHA 1RGLA 4IT7A 4WFOA 4J8TA 3RGAA 3WODG 4JF8A 5AIFA 4HVNA 1R4YA 3SVAA 1QMAA 5EQLA 1I8VA 2WOHA 1W4NA 3MKIA 1RRHA 2E2VA 4L7KA 3EN1B 1QVF2 1D6UA 1OHOA 1SARA 4WWUC 3CPOA 1HZ1A 4K1VA 3AGNA 3BNCA 4EXRA 2SARA 3DGMA 6STDA 7RNTA 2CFLA 4R9LA 3MHEA 3BLZA 4O3VA 3N54B 4HKVB 1RCKA 2F56A 2BIRA 2STDA 6RNTA 1B21A 1W7CA 2CWVA 1JBTA 1CQSA 3Q1CA 5IG4A 1VZZA 2A15A 1LOXA 2GBWB 2ML5A 3JUPA 3LT8A 1SIIA 3QRDA 4G1MB 2B1XB 2O3OA 1JBRA 2QGUA 1SPUA 3F8XA 4LSOA 2RGQA 3VSYA 1B3SA 3HI7A 4KFEA 4HBRA 3AMOA 3GWRA 3I563 2P09A 4JRFA 6GSPA 3LTCA 1AVLA 2IUKA 5JPPA 3FF2A 3HIGA 4TX4A 2HMMB 1B2UA 1I70A 2I9WA 1I2FA 4PEJA 3DY5A 2FGTA 1JRQA 1BRGA 2CKFB 4RNZA 4Q53A 1VQM3 3FLJA 1N9JA 4OK0A 1GS3A 1IU7A 2K54A 4R1KA 1M1XB 1SJWA 2MC8A 2AAEA 3DGLA 2XFTA 4EV5A 5D81A 3KCHA 1GD4A 1DMQA 2F98A 4J9AA 5AIGA 3RDEA 2CX1A 3T8UA 5JBSA 1S723 4LZIA 1KWIA 2OWPA 2M7OA 3NXJA 4X2OA 1O7HB 1A90A 1Q7Y4 4R4KA 4WYKA 3OWYA 1TFOA 4OVMA 1BRHA 1RLSA 3EJVA 3LXUX 1BANA 2CFKA 4BIRA 4CCVA 1GMRA 1LVNA 3M8CA 5IG5A 3H51A 1E97A 1NO3A 1BGSA 1GOYA 5M18A 4H3UA 2ZL8A 4AKYA 1RN1A 5IW9A 1FW7A 2GEYA 2W56B 3PCSA 4EBGA 5I97A 2W9QA 3EC9A 4NHFA 1BUQA 1M904 1IVWA 2RBIA 1B2MA 1OH0A 2XGLA 3EB8A 2OQEC 3DZLA 3QK9A 5M19A 8RNTA 5HOHA 1FUSA 4KFDA 3D4AA 3FG1A 3RGRA 2WGQA 4ORLA 3NV0A 3Q2PA 2F99A 3I553 1S5AA 2HMJB 4CDLA 2OQEA 1FUTA 2AADA 1MWRA 2P0MA 3KE7A 1RN4A 4N6TA 3CPW2 5LC7A 3GZRA 3NUVA 5IEPA 2W6JH 1TUHA 1Q824 1TP6A 1M1K4 1E3VA 1JN5B 3CC23 1RDSA 1UGHI 1JB5A 1YNVX 1I2EA 2CX0A 2C10A 3LYGA 1YI23 1BRNL 1BU4A 2W2CA 4K90B 1VQN3 3NBJA 3UB1A 2CFWA 3FCSB 3CCJ3 5BVBA 1YJN3 2P05A 4N6MA 5IENA 1I3IA 1IDPA 4J5GA 4HM8B 5KP3A 2H0IA 2Z7AA 2IMJA 1VQK3 1IQYA 1BNSA 1W2B2 1FGOA 1KC84 1AY7A 1ULIB 3JUMA 1B2XA 3NBRA 3TDGA 1EQKA 1IVVA 4OUQA 3NM7A 3FZWA 1BNRA 3K9MC 1DVDA 1O7PB 1RJOA 1TU5A 1CYVA 3FG4A 3CCQ3 3GZYB 1SQWA 1BNIA 2CFDA 3SXXA 3K5TA 2OOVA 1NWWA 7GSPA 1EUIC 4XBTA 1BIRA 5ELJA 3S5CA 5AEUB 1T2HA 2RFRA 3KN4A 4CPKA 1L5GB 1K734 3SEDA 3X3XA 5FGOA 1RNBA 1BSEA 1KSIA 3K63A 4HM6B 3SOYA 2KCDA 3KFQC 3BU4A 1BSBA 1OF5B 3CC43 4KT3B 4GB5A 3OX9A 1LRAA 5CXOA 2OCTA 3DXOA 3GRDA 1MWUA 3X3YA 4R9KA 1VQL3 3WA2X 1BVIA 1WTHA 5CLKA 1FGRA 4STDA 1Q814 4HAAA 3WA3A 2RSXA 1LQGC 2B24B 3Q90A 4DKIA 1YVSA 2FXTA 1JB4A 2CW9A 3T8NA 1I0XA 3Q3FA 4MMXB 2BT3A 1WMOA 2QIYA 1O7WB 3STDA 3KIIA 1AQZA 1G96A 1GOVA 2W0QA 1HKXA 1RKYA 2CC3A 2D1WA 1AVKA 3I0YA 2P38A 2BU4A 2F4YA 3N9HA 4MEIA 3PS8A 2SBLA 3F9SA 3MG1A 1DE3A 4ILFA 5G1KA 2MF7A 2Q07A 4FMDA 1NB5I 1VQ53 3A5EA 4HZ9B 3S27A 2Z76A 2J8XB 3D5GA 4X2HA 3UL6A 2O9UX 3CU3A 1BUJA 1T5YA 3FSDA 3CNMA 3GAXA 1RSNA 2C4BA 2W03A 2XH9A 4KZ1A 1ROAA 3DH2A 3NX0A 1W6GA 4L8OA 1DMNA 9RNTA 3MWZA 2Z6BA 4R80A 1IV7A 1YJ93 1ZO2A 2BMRB 5DREA 1BRSA 4O8SA 1R4CA 1YGWA 4HZBB 4BU4A 3G0KA 3BNDA 3AGOA 3NQYA 5CF2A 3CCU3 5EVHA 4K1UA 1OGZA 2YFJB 1O7NB 3S67A 3MG3A 5FW5A 4N6LA 1MGWA 5BU4A 1HU9A 1UCIA 1HYFA 1EA2A 3CNXA 3D79A 3BNBA 3GZXB 4XBXA 2YX9A 1MOLA 3D9RA 1RGAA 1N5PA 1IT7A 4I4KA 1T3BA 1TRQA 4ZM8A 2KRTA 3IPTA 1UCLA 3FKAA 1VQ63 1RNTA 4IIAA 1RGKA 3LZAA 1M9GA 3G16A 3LTDA 1TRPA 1W00A 4LEHA 1WNHA 3OW22 3NV0B 1VQQA 2ZHXB 5IEOA 1UCKA 3O8YA 1GSPA 1JZDA 1UI8A 1B2SA 3EHCA 2F5MA 1I2GA 1C54A 1VQ73 5RNTA 2PNCA 3NBBA 5CK6A 1CH0A 1JZOA 1BRKA 2L1SA 1C7HA 1TJDA 5EEOA 3CCV3 1NJI4 1KQS2 2XSOB 1YGEA 4XB5A 1N8QA 2CH9A 2OOVC 3G6E3 3H3HA 3CME3 3ER7A 3JVCA 5CF1A 3PYJA 4HM7B 5JPUA 1K8A4 3D3LA 1N8R4 2C11A 3CXC2 3AMOB 5IF6A 2LYXA 5D83A 4BTXA 3OWUA 1TIJA 1B27A 4N6OB 3EQQB 3CCR3 1Q40A 1OUNA 5AI1A 2CFGA 2YFIB 1K28A 5GSPA 2CG0A 1BNJA 4AEQA 1MWSA 5G1LA 1LNHA 7STDA 3DGNA 4O02B 3U97A 1RRLA 2XGNA 3BIRA 3B8LA 1MGRA 1VQ93 1LOYA 1UDII 1Z1SA 2P0XA 3T0UA 2W04A 1US1A 1QVG2 1Q7HA 2D42A 2WGOA 1UUVB 3OXAA 2K3DA 1A2PA 2CWUA 5IERA 2HMKB 4RNYA 3DGYA 2GEXA 3S28A 3RNTA 2IA7A 4XM4A 3PXMA 5G2GA 1GD3A 2QA43 1PFPA 4HM2B 3DUKA 3D5IA 1FGQA 1IK3A 3ECFA 3IJEB 3ZFZA 1W6YA 1TTOA 2OTJ3 1RGCA 1QJGA 2GU1A 2K0MA 2HMNB 8CHOA 5KP1A 1JNQA 3PZWA 1X1WA 3JUOA 4HOHA 1IVXA 5AIIA 3G4S3 1AV4A 4IPBA 5HGRA 5IG3A 1MNLA 1ZX2A 3EX9A 1GMQA 1JKGB 3UNLA 1MWTA 3EF8A 1STFI 3F7XA 4BTYA 5AEWB 2BNGA 2UX0A 2KF3A 3N8BA 3SX1A 1W5ZA 3HZPA 3SYUA 4K61A 4O2HA 5M1AA 3V92A 1LNIA 3J7Yd 1VQP3 1IQXA 3VGNA 1D6ZA 4XDVA 2CWTA 1W02A 4KVHA 1BRIA 1V74A 2Y74A 3WDGB 1UI7A 2BMQB 2KF4A 1RGFA 2UGIA 3V99A 4N3VA 2R4IA 1E3RA 1RGEA 3LH4A 3PCRA 3MYTA 1I0VA 3GZBA 3SLUA 1OF5A 4GSPA 1X1YA 2XRXB 1RCLA 1QAFA 2XFSA 4N6V0 3CCS3 1CYUA 3WR2A 1DYUA 1W2ZA 1IVUA 3MG2A 1BNGA 2GXFA 3G8ZA 3MSOA 5DRVA 1JJ22 4HM3B 1YIJ3 2W56A 4RNTA 1ASKA 1IT8A 2IYJA 2L4VA 1RGHA 2XF3A 4WP5A 3ZG0A 3BNEA 3IMAB 5STDA 3X42A 1JB2A 1OCVA 3G713 1FGMA 3X41A 5BIRA 1A67A 4LYLB 3S29A 1RGGA 3WOFB 3JUNA 4RZMA 4FMAA 5IG0A 3E99A 2HOHA 3AHWA 3OV4A 1W01A 4AKZA 3BB9A 3A76A 4RBNA 2KF5A 1IV9A 1ZGXA 2F5WA 4FR9A 1ISKA 4WYKB 1OHSA 3URPA 1N5HA 1BAOA 4HM4B 1FYSA 2KAAA 4MJDA 1I3FA 1G02A 1EG9B 3WHOA 3UJMA 2WOFA 1V57A 2JQ5A 2CHCA 5ELUA 2XEPA 2Z77A 1VQ83 1UUGB 2V1LA 1NU3A 1K41A 1BNFA 2ML6A 1V58A 2ZDJA 2OTL3 3LTBA 1SIHA 1GYBA 1LQMB 2E2TA 3V98A 2RCDA 3LT9A 1G0TA 3CC73 3K7CA 4HM0B 1YIT3 3FH1A 3FGYA 1UCJA 3ZG5A 3AHSA 1N9EA 3EN8A 1Q864 1GY7A 2H0HA 1B20A 3HIIA 1AR0A 4FCMA 4FMCA 1X1UA 2H0GA 4KFFA 2BO9B 1FUWA 2JDIH 1LOWA 5BXQA 4LMIA 1T2IA 3EE1A 1JV2B 3EBTA 4FCJA 3OWSA 4LGQA 1UUWB 1RTUA 1GY6A 2F86B 1OACA 5KP4A 4MMZB 2ZA4A 2GSPA 2KXGA 1FGTA 1JKGA 3PGBA 1B2ZA 3ROBA 4BL2A 2QEX3 2HMLB 4FMBA 3HOHA 1DMMA 2YFLB 3FF0A 4XDWA 2E2UA 4GHOA 5LC6A 4NPBA 4HYZA 1UGIA 3KZTA 3UL5A 1RN7A 1WMNA 1UW1A 1LXEA 2KF6A 3DM8A 1U5OA 3HX8A 2IUJA 2CK3H 3KSED 4FCZA 3LMLA 1ROVA 2BHMA 3ALAA 1GY5A 3F8HA 4I5QA 1LOVA 1K9M4 1O7MB 3WOEB 5AYSC 3DGOA 1A2VA 4N6NB 3LOYA 1U8CB 2FNQA 3NQZA 1GMPA 1NDOB 4BL3A 1IQ8A 5AIHA 1JBSA 2IY2A 1NNVA 3K0ZA 1BSAA 3NM2A 1YJW3 1JN5A 2CG1A 4BTWA 2CIUA 1BOXA 2LQVA 3CCE3 2BMOB 3CMA3 3LTAA 2Y73A 3HK4A 3WMDA 1BSDA 1IYYA 2INXA 3DMCA 4HM5B 2XSHB 1W6CA 3F40A 4U13A 2W9PA 1YVBI 3B4PA 1EKMA 4NREA 1RHLA 2HMOB 1FZUA 1PY3A 1ZS7A 3KSPA 5AYRB 1PU4A 1O7GB 4XBYA 3KKGA 3B7CA 4L8PA 1Y4KA 1YHQ3 3FG3A 4J5KA 1QALA 5TGNA 2UUGC 5A0OB 5D82A 4WHAA 1X1XA 4EYCA 4QWTA 1OHPA 4N6UA 4MMYB 1BRJA 3NHXA
chains in the Genus database with same CATH topology
1TRQA 8RNTA 5HOHA 1FUSA 1UCLA 3D4AA 5BIRA 1BSCA 1RGGA 1RNTA 1RGKA 2HOHA 1TRPA 1FUTA 3AHWA 2AADA 1PYLA 2RNTA 1RN4A 1Q9EA 1UCKA 1RMSA 2KF5A 1BNEA 1DETA 1GSPA 1ZGXA 2F5WA 1B2SA 2F5MA 1I2GA 3URPA 1C54A 5RNTA 1GOUA 1RDSA 1YNVX 1I2EA 1CH0A 2RBIA 1BRNL 1BRKA 1BU4A 1BAOA 1FYSA 2KAAA 1I3FA 1G02A 3GSPA 3WHOA 1I3IA 4J5GA 1RGLA 1BNFA 1BNSA 1R4YA 1AY7A 1I8VA 1B2XA 1BNRA 1B27A 1SARA 1BNIA 1UCJA 7GSPA 3AHSA 1HZ1A 1BNJA 5GSPA 3AGNA 1B20A 1BIRA 2SARA 7RNTA 1X1UA 1T2HA 3BIRA 1MGRA 1LOYA 1LOWA 1RNBA 1BSEA 1T2IA 3BU4A 1BSBA 1RCKA 2F56A 2BIRA 6RNTA 1A2PA 1RTUA 1B21A 1LRAA 2ZA4A 3DGYA 2GSPA 1JBTA 3RNTA 1BVIA 1B2ZA 4HAAA 3HOHA 1JBRA 3D5IA 1YVSA 4GHOA 1B3SA 1TTOA 1RGCA 1I0XA 3Q3FA 2KF6A 6GSPA 1X1WA 4HOHA 1AQZA 1GOVA 1B2UA 1I70A 1LOVA 1I2FA 1BRGA 2BU4A 1GMQA 2F4YA 1GMPA 1JBSA 1DE3A 1BSAA 2AAEA 2KF3A 3A5EA 3KCHA 3SYUA 1BOXA 3D5GA 1BUJA 1LNIA 1RSNA 2C4BA 1BSDA 3DH2A 1BRIA 1IYYA 9RNTA 2KF4A 1RGFA 1BRHA 1BRSA 1RLSA 4BU4A 1YGWA 1RGEA 1BANA 3AGOA 1RHLA 1I0VA 4BIRA 1FZUA 1PY3A 1GMRA 4GSPA 1X1YA 1RCLA 1BGSA 1GOYA 4J5KA 1RN1A 1MGWA 3WR2A 5BU4A 1FW7A 1UCIA 1HYFA 1X1XA 1BNGA 1B2MA 1BRJA 4RNTA 1RGAA 1RGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TRQ A;  8RNT A;  5HOH A;  1FUS A;  1UCL A;  3D4A A;  5BIR A;  1BSC A;  1RGG A;  1RNT A;  1RGK A;  2HOH A;  1TRP A;  1FUT A;  3AHW A;  2AAD A;  1PYL A;  2RNT A;  1RN4 A;  1Q9E A;  1UCK A;  1RMS A;  2KF5 A;  1BNE A;  1DET A;  1GSP A;  1ZGX A;  2F5W A;  1B2S A;  2F5M A;  1I2G A;  3URP A;  1C54 A;  5RNT A;  1GOU A;  1RDS A;  1YNV X;  1I2E A;  1CH0 A;  2RBI A;  1BRN L;  1BRK A;  1BU4 A;  1BAO A;  1FYS A;  2KAA A;  1I3F A;  1G02 A;  3GSP A;  3WHO A;  1I3I A;  4J5G A;  1RGL A;  1BNF A;  1BNS A;  1R4Y A;  1AY7 A;  1I8V A;  1B2X A;  1BNR A;  1B27 A;  1SAR A;  1BNI A;  1UCJ A;  7GSP A;  3AHS A;  1HZ1 A;  1BNJ A;  5GSP A;  3AGN A;  1B20 A;  1BIR A;  2SAR A;  7RNT A;  1X1U A;  1T2H A;  3BIR A;  1MGR A;  1LOY A;  1LOW A;  1RNB A;  1BSE A;  1T2I A;  3BU4 A;  1BSB A;  1RCK A;  2F56 A;  2BIR A;  6RNT A;  1A2P A;  1RTU A;  1B21 A;  1LRA A;  2ZA4 A;  3DGY A;  2GSP A;  1JBT A;  3RNT A;  1BVI A;  1B2Z A;  4HAA A;  3HOH A;  1JBR A;  3D5I A;  1YVS A;  4GHO A;  1B3S A;  1TTO A;  1RGC A;  1I0X A;  3Q3F A;  2KF6 A;  6GSP A;  1X1W A;  4HOH A;  1AQZ A;  1GOV A;  1B2U A;  1I70 A;  1LOV A;  1I2F A;  1BRG A;  2BU4 A;  1GMQ A;  2F4Y A;  1GMP A;  1JBS A;  1DE3 A;  1BSA A;  2AAE A;  2KF3 A;  3A5E A;  3KCH A;  3SYU A;  1BOX A;  3D5G A;  1BUJ A;  1LNI A;  1RSN A;  2C4B A;  1BSD A;  3DH2 A;  1BRI A;  1IYY A;  9RNT A;  2KF4 A;  1RGF A;  1BRH A;  1BRS A;  1RLS A;  4BU4 A;  1YGW A;  1RGE A;  1BAN A;  3AGO A;  1RHL A;  1I0V A;  4BIR A;  1FZU A;  1PY3 A;  1GMR A;  4GSP A;  1X1Y A;  1RCL A;  1BGS A;  1GOY A;  4J5K A;  1RN1 A;  1MGW A;  3WR2 A;  5BU4 A;  1FW7 A;  1UCI A;  1HYF A;  1X1X A;  1BNG A;  1B2M A;  1BRJ A;  4RNT A;  1RGA A;  1RGH A; 
#chains in the Genus database with same CATH topology
 4HM1 B;  1WQL B;  2WO0 A;  3F7S A;  3CCL 3;  3B4O A;  1Q40 B;  3X3Z A;  1A2K A;  1BSC A;  1FA3 A;  4H61 A;  1STD A;  1QAK A;  1OGX A;  3L0R A;  4EW5 A;  2PZV A;  2R41 A;  2GBX B;  1PYL A;  2RNT A;  3SOA A;  1DVC A;  1Q9E A;  1F8N A;  1CEW I;  1RMS A;  1BNE A;  1DET A;  1OPY A;  1VQ4 3;  3CCM 3;  1EEJ A;  1TFK A;  3U1W A;  4HJL B;  3CD6 3;  1VQO 3;  1GOU A;  1KD1 4;  1Q42 A;  4CJN A;  1D6Y A;  1ULJ B;  2GU3 A;  4EC6 A;  3EBY A;  3VF1 A;  3GSP A;  2XR8 B;  3JUQ A;  3F14 A;  4GL6 A;  1WMP A;  3X40 A;  1J2B A;  4EV2 A;  1NB3 I;  3MPH A;  1RGL A;  4IT7 A;  4WFO A;  4J8T A;  3RGA A;  3WOD G;  4JF8 A;  5AIF A;  4HVN A;  1R4Y A;  3SVA A;  1QMA A;  5EQL A;  1I8V A;  2WOH A;  1W4N A;  3MKI A;  1RRH A;  2E2V A;  4L7K A;  3EN1 B;  1QVF 2;  1D6U A;  1OHO A;  1SAR A;  4WWU C;  3CPO A;  1HZ1 A;  4K1V A;  3AGN A;  3BNC A;  4EXR A;  2SAR A;  3DGM A;  6STD A;  7RNT A;  2CFL A;  4R9L A;  3MHE A;  3BLZ A;  4O3V A;  3N54 B;  4HKV B;  1RCK A;  2F56 A;  2BIR A;  2STD A;  6RNT A;  1B21 A;  1W7C A;  2CWV A;  1JBT A;  1CQS A;  3Q1C A;  5IG4 A;  1VZZ A;  2A15 A;  1LOX A;  2GBW B;  2ML5 A;  3JUP A;  3LT8 A;  1SII A;  3QRD A;  4G1M B;  2B1X B;  2O3O A;  1JBR A;  2QGU A;  1SPU A;  3F8X A;  4LSO A;  2RGQ A;  3VSY A;  1B3S A;  3HI7 A;  4KFE A;  4HBR A;  3AMO A;  3GWR A;  3I56 3;  2P09 A;  4JRF A;  6GSP A;  3LTC A;  1AVL A;  2IUK A;  5JPP A;  3FF2 A;  3HIG A;  4TX4 A;  2HMM B;  1B2U A;  1I70 A;  2I9W A;  1I2F A;  4PEJ A;  3DY5 A;  2FGT A;  1JRQ A;  1BRG A;  2CKF B;  4RNZ A;  4Q53 A;  1VQM 3;  3FLJ A;  1N9J A;  4OK0 A;  1GS3 A;  1IU7 A;  2K54 A;  4R1K A;  1M1X B;  1SJW A;  2MC8 A;  2AAE A;  3DGL A;  2XFT A;  4EV5 A;  5D81 A;  3KCH A;  1GD4 A;  1DMQ A;  2F98 A;  4J9A A;  5AIG A;  3RDE A;  2CX1 A;  3T8U A;  5JBS A;  1S72 3;  4LZI A;  1KWI A;  2OWP A;  2M7O A;  3NXJ A;  4X2O A;  1O7H B;  1A90 A;  1Q7Y 4;  4R4K A;  4WYK A;  3OWY A;  1TFO A;  4OVM A;  1BRH A;  1RLS A;  3EJV A;  3LXU X;  1BAN A;  2CFK A;  4BIR A;  4CCV A;  1GMR A;  1LVN A;  3M8C A;  5IG5 A;  3H51 A;  1E97 A;  1NO3 A;  1BGS A;  1GOY A;  5M18 A;  4H3U A;  2ZL8 A;  4AKY A;  1RN1 A;  5IW9 A;  1FW7 A;  2GEY A;  2W56 B;  3PCS A;  4EBG A;  5I97 A;  2W9Q A;  3EC9 A;  4NHF A;  1BUQ A;  1M90 4;  1IVW A;  2RBI A;  1B2M A;  1OH0 A;  2XGL A;  3EB8 A;  2OQE C;  3DZL A;  3QK9 A;  5M19 A;  8RNT A;  5HOH A;  1FUS A;  4KFD A;  3D4A A;  3FG1 A;  3RGR A;  2WGQ A;  4ORL A;  3NV0 A;  3Q2P A;  2F99 A;  3I55 3;  1S5A A;  2HMJ B;  4CDL A;  2OQE A;  1FUT A;  2AAD A;  1MWR A;  2P0M A;  3KE7 A;  1RN4 A;  4N6T A;  3CPW 2;  5LC7 A;  3GZR A;  3NUV A;  5IEP A;  2W6J H;  1TUH A;  1Q82 4;  1TP6 A;  1M1K 4;  1E3V A;  1JN5 B;  3CC2 3;  1RDS A;  1UGH I;  1JB5 A;  1YNV X;  1I2E A;  2CX0 A;  2C10 A;  3LYG A;  1YI2 3;  1BRN L;  1BU4 A;  2W2C A;  4K90 B;  1VQN 3;  3NBJ A;  3UB1 A;  2CFW A;  3FCS B;  3CCJ 3;  5BVB A;  1YJN 3;  2P05 A;  4N6M A;  5IEN A;  1I3I A;  1IDP A;  4J5G A;  4HM8 B;  5KP3 A;  2H0I A;  2Z7A A;  2IMJ A;  1VQK 3;  1IQY A;  1BNS A;  1W2B 2;  1FGO A;  1KC8 4;  1AY7 A;  1ULI B;  3JUM A;  1B2X A;  3NBR A;  3TDG A;  1EQK A;  1IVV A;  4OUQ A;  3NM7 A;  3FZW A;  1BNR A;  3K9M C;  1DVD A;  1O7P B;  1RJO A;  1TU5 A;  1CYV A;  3FG4 A;  3CCQ 3;  3GZY B;  1SQW A;  1BNI A;  2CFD A;  3SXX A;  3K5T A;  2OOV A;  1NWW A;  7GSP A;  1EUI C;  4XBT A;  1BIR A;  5ELJ A;  3S5C A;  5AEU B;  1T2H A;  2RFR A;  3KN4 A;  4CPK A;  1L5G B;  1K73 4;  3SED A;  3X3X A;  5FGO A;  1RNB A;  1BSE A;  1KSI A;  3K63 A;  4HM6 B;  3SOY A;  2KCD A;  3KFQ C;  3BU4 A;  1BSB A;  1OF5 B;  3CC4 3;  4KT3 B;  4GB5 A;  3OX9 A;  1LRA A;  5CXO A;  2OCT A;  3DXO A;  3GRD A;  1MWU A;  3X3Y A;  4R9K A;  1VQL 3;  3WA2 X;  1BVI A;  1WTH A;  5CLK A;  1FGR A;  4STD A;  1Q81 4;  4HAA A;  3WA3 A;  2RSX A;  1LQG C;  2B24 B;  3Q90 A;  4DKI A;  1YVS A;  2FXT A;  1JB4 A;  2CW9 A;  3T8N A;  1I0X A;  3Q3F A;  4MMX B;  2BT3 A;  1WMO A;  2QIY A;  1O7W B;  3STD A;  3KII A;  1AQZ A;  1G96 A;  1GOV A;  2W0Q A;  1HKX A;  1RKY A;  2CC3 A;  2D1W A;  1AVK A;  3I0Y A;  2P38 A;  2BU4 A;  2F4Y A;  3N9H A;  4MEI A;  3PS8 A;  2SBL A;  3F9S A;  3MG1 A;  1DE3 A;  4ILF A;  5G1K A;  2MF7 A;  2Q07 A;  4FMD A;  1NB5 I;  1VQ5 3;  3A5E A;  4HZ9 B;  3S27 A;  2Z76 A;  2J8X B;  3D5G A;  4X2H A;  3UL6 A;  2O9U X;  3CU3 A;  1BUJ A;  1T5Y A;  3FSD A;  3CNM A;  3GAX A;  1RSN A;  2C4B A;  2W03 A;  2XH9 A;  4KZ1 A;  1ROA A;  3DH2 A;  3NX0 A;  1W6G A;  4L8O A;  1DMN A;  9RNT A;  3MWZ A;  2Z6B A;  4R80 A;  1IV7 A;  1YJ9 3;  1ZO2 A;  2BMR B;  5DRE A;  1BRS A;  4O8S A;  1R4C A;  1YGW A;  4HZB B;  4BU4 A;  3G0K A;  3BND A;  3AGO A;  3NQY A;  5CF2 A;  3CCU 3;  5EVH A;  4K1U A;  1OGZ A;  2YFJ B;  1O7N B;  3S67 A;  3MG3 A;  5FW5 A;  4N6L A;  1MGW A;  5BU4 A;  1HU9 A;  1UCI A;  1HYF A;  1EA2 A;  3CNX A;  3D79 A;  3BNB A;  3GZX B;  4XBX A;  2YX9 A;  1MOL A;  3D9R A;  1RGA A;  1N5P A;  1IT7 A;  4I4K A;  1T3B A;  1TRQ A;  4ZM8 A;  2KRT A;  3IPT A;  1UCL A;  3FKA A;  1VQ6 3;  1RNT A;  4IIA A;  1RGK A;  3LZA A;  1M9G A;  3G16 A;  3LTD A;  1TRP A;  1W00 A;  4LEH A;  1WNH A;  3OW2 2;  3NV0 B;  1VQQ A;  2ZHX B;  5IEO A;  1UCK A;  3O8Y A;  1GSP A;  1JZD A;  1UI8 A;  1B2S A;  3EHC A;  2F5M A;  1I2G A;  1C54 A;  1VQ7 3;  5RNT A;  2PNC A;  3NBB A;  5CK6 A;  1CH0 A;  1JZO A;  1BRK A;  2L1S A;  1C7H A;  1TJD A;  5EEO A;  3CCV 3;  1NJI 4;  1KQS 2;  2XSO B;  1YGE A;  4XB5 A;  1N8Q A;  2CH9 A;  2OOV C;  3G6E 3;  3H3H A;  3CME 3;  3ER7 A;  3JVC A;  5CF1 A;  3PYJ A;  4HM7 B;  5JPU A;  1K8A 4;  3D3L A;  1N8R 4;  2C11 A;  3CXC 2;  3AMO B;  5IF6 A;  2LYX A;  5D83 A;  4BTX A;  3OWU A;  1TIJ A;  1B27 A;  4N6O B;  3EQQ B;  3CCR 3;  1Q40 A;  1OUN A;  5AI1 A;  2CFG A;  2YFI B;  1K28 A;  5GSP A;  2CG0 A;  1BNJ A;  4AEQ A;  1MWS A;  5G1L A;  1LNH A;  7STD A;  3DGN A;  4O02 B;  3U97 A;  1RRL A;  2XGN A;  3BIR A;  3B8L A;  1MGR A;  1VQ9 3;  1LOY A;  1UDI I;  1Z1S A;  2P0X A;  3T0U A;  2W04 A;  1US1 A;  1QVG 2;  1Q7H A;  2D42 A;  2WGO A;  1UUV B;  3OXA A;  2K3D A;  1A2P A;  2CWU A;  5IER A;  2HMK B;  4RNY A;  3DGY A;  2GEX A;  3S28 A;  3RNT A;  2IA7 A;  4XM4 A;  3PXM A;  5G2G A;  1GD3 A;  2QA4 3;  1PFP A;  4HM2 B;  3DUK A;  3D5I A;  1FGQ A;  1IK3 A;  3ECF A;  3IJE B;  3ZFZ A;  1W6Y A;  1TTO A;  2OTJ 3;  1RGC A;  1QJG A;  2GU1 A;  2K0M A;  2HMN B;  8CHO A;  5KP1 A;  1JNQ A;  3PZW A;  1X1W A;  3JUO A;  4HOH A;  1IVX A;  5AII A;  3G4S 3;  1AV4 A;  4IPB A;  5HGR A;  5IG3 A;  1MNL A;  1ZX2 A;  3EX9 A;  1GMQ A;  1JKG B;  3UNL A;  1MWT A;  3EF8 A;  1STF I;  3F7X A;  4BTY A;  5AEW B;  2BNG A;  2UX0 A;  2KF3 A;  3N8B A;  3SX1 A;  1W5Z A;  3HZP A;  3SYU A;  4K61 A;  4O2H A;  5M1A A;  3V92 A;  1LNI A;  3J7Y d;  1VQP 3;  1IQX A;  3VGN A;  1D6Z A;  4XDV A;  2CWT A;  1W02 A;  4KVH A;  1BRI A;  1V74 A;  2Y74 A;  3WDG B;  1UI7 A;  2BMQ B;  2KF4 A;  1RGF A;  2UGI A;  3V99 A;  4N3V A;  2R4I A;  1E3R A;  1RGE A;  3LH4 A;  3PCR A;  3MYT A;  1I0V A;  3GZB A;  3SLU A;  1OF5 A;  4GSP A;  1X1Y A;  2XRX B;  1RCL A;  1QAF A;  2XFS A;  4N6V 0;  3CCS 3;  1CYU A;  3WR2 A;  1DYU A;  1W2Z A;  1IVU A;  3MG2 A;  1BNG A;  2GXF A;  3G8Z A;  3MSO A;  5DRV A;  1JJ2 2;  4HM3 B;  1YIJ 3;  2W56 A;  4RNT A;  1ASK A;  1IT8 A;  2IYJ A;  2L4V A;  1RGH A;  2XF3 A;  4WP5 A;  3ZG0 A;  3BNE A;  3IMA B;  5STD A;  3X42 A;  1JB2 A;  1OCV A;  3G71 3;  1FGM A;  3X41 A;  5BIR A;  1A67 A;  4LYL B;  3S29 A;  1RGG A;  3WOF B;  3JUN A;  4RZM A;  4FMA A;  5IG0 A;  3E99 A;  2HOH A;  3AHW A;  3OV4 A;  1W01 A;  4AKZ A;  3BB9 A;  3A76 A;  4RBN A;  2KF5 A;  1IV9 A;  1ZGX A;  2F5W A;  4FR9 A;  1ISK A;  4WYK B;  1OHS A;  3URP A;  1N5H A;  1BAO A;  4HM4 B;  1FYS A;  2KAA A;  4MJD A;  1I3F A;  1G02 A;  1EG9 B;  3WHO A;  3UJM A;  2WOF A;  1V57 A;  2JQ5 A;  2CHC A;  5ELU A;  2XEP A;  2Z77 A;  1VQ8 3;  1UUG B;  2V1L A;  1NU3 A;  1K41 A;  1BNF A;  2ML6 A;  1V58 A;  2ZDJ A;  2OTL 3;  3LTB A;  1SIH A;  1GYB A;  1LQM B;  2E2T A;  3V98 A;  2RCD A;  3LT9 A;  1G0T A;  3CC7 3;  3K7C A;  4HM0 B;  1YIT 3;  3FH1 A;  3FGY A;  1UCJ A;  3ZG5 A;  3AHS A;  1N9E A;  3EN8 A;  1Q86 4;  1GY7 A;  2H0H A;  1B20 A;  3HII A;  1AR0 A;  4FCM A;  4FMC A;  1X1U A;  2H0G A;  4KFF A;  2BO9 B;  1FUW A;  2JDI H;  1LOW A;  5BXQ A;  4LMI A;  1T2I A;  3EE1 A;  1JV2 B;  3EBT A;  4FCJ A;  3OWS A;  4LGQ A;  1UUW B;  1RTU A;  1GY6 A;  2F86 B;  1OAC A;  5KP4 A;  4MMZ B;  2ZA4 A;  2GSP A;  2KXG A;  1FGT A;  1JKG A;  3PGB A;  1B2Z A;  3ROB A;  4BL2 A;  2QEX 3;  2HML B;  4FMB A;  3HOH A;  1DMM A;  2YFL B;  3FF0 A;  4XDW A;  2E2U A;  4GHO A;  5LC6 A;  4NPB A;  4HYZ A;  1UGI A;  3KZT A;  3UL5 A;  1RN7 A;  1WMN A;  1UW1 A;  1LXE A;  2KF6 A;  3DM8 A;  1U5O A;  3HX8 A;  2IUJ A;  2CK3 H;  3KSE D;  4FCZ A;  3LML A;  1ROV A;  2BHM A;  3ALA A;  1GY5 A;  3F8H A;  4I5Q A;  1LOV A;  1K9M 4;  1O7M B;  3WOE B;  5AYS C;  3DGO A;  1A2V A;  4N6N B;  3LOY A;  1U8C B;  2FNQ A;  3NQZ A;  1GMP A;  1NDO B;  4BL3 A;  1IQ8 A;  5AIH A;  1JBS A;  2IY2 A;  1NNV A;  3K0Z A;  1BSA A;  3NM2 A;  1YJW 3;  1JN5 A;  2CG1 A;  4BTW A;  2CIU A;  1BOX A;  2LQV A;  3CCE 3;  2BMO B;  3CMA 3;  3LTA A;  2Y73 A;  3HK4 A;  3WMD A;  1BSD A;  1IYY A;  2INX A;  3DMC A;  4HM5 B;  2XSH B;  1W6C A;  3F40 A;  4U13 A;  2W9P A;  1YVB I;  3B4P A;  1EKM A;  4NRE A;  1RHL A;  2HMO B;  1FZU A;  1PY3 A;  1ZS7 A;  3KSP A;  5AYR B;  1PU4 A;  1O7G B;  4XBY A;  3KKG A;  3B7C A;  4L8P A;  1Y4K A;  1YHQ 3;  3FG3 A;  4J5K A;  1QAL A;  5TGN A;  2UUG C;  5A0O B;  5D82 A;  4WHA A;  1X1X A;  4EYC A;  4QWT A;  1OHP A;  4N6U A;  4MMY B;  1BRJ A;  3NHX A; 
#chains in the Genus database with same CATH homology
 1TRQ A;  8RNT A;  5HOH A;  1FUS A;  1UCL A;  3D4A A;  5BIR A;  1BSC A;  1RGG A;  1RNT A;  1RGK A;  2HOH A;  1TRP A;  1FUT A;  3AHW A;  2AAD A;  1PYL A;  2RNT A;  1RN4 A;  1Q9E A;  1UCK A;  1RMS A;  2KF5 A;  1BNE A;  1DET A;  1GSP A;  1ZGX A;  2F5W A;  1B2S A;  2F5M A;  1I2G A;  3URP A;  1C54 A;  5RNT A;  1GOU A;  1RDS A;  1YNV X;  1I2E A;  1CH0 A;  2RBI A;  1BRN L;  1BRK A;  1BU4 A;  1BAO A;  1FYS A;  2KAA A;  1I3F A;  1G02 A;  3GSP A;  3WHO A;  1I3I A;  4J5G A;  1RGL A;  1BNF A;  1BNS A;  1R4Y A;  1AY7 A;  1I8V A;  1B2X A;  1BNR A;  1B27 A;  1SAR A;  1BNI A;  1UCJ A;  7GSP A;  3AHS A;  1HZ1 A;  1BNJ A;  5GSP A;  3AGN A;  1B20 A;  1BIR A;  2SAR A;  7RNT A;  1X1U A;  1T2H A;  3BIR A;  1MGR A;  1LOY A;  1LOW A;  1RNB A;  1BSE A;  1T2I A;  3BU4 A;  1BSB A;  1RCK A;  2F56 A;  2BIR A;  6RNT A;  1A2P A;  1RTU A;  1B21 A;  1LRA A;  2ZA4 A;  3DGY A;  2GSP A;  1JBT A;  3RNT A;  1BVI A;  1B2Z A;  4HAA A;  3HOH A;  1JBR A;  3D5I A;  1YVS A;  4GHO A;  1B3S A;  1TTO A;  1RGC A;  1I0X A;  3Q3F A;  2KF6 A;  6GSP A;  1X1W A;  4HOH A;  1AQZ A;  1GOV A;  1B2U A;  1I70 A;  1LOV A;  1I2F A;  1BRG A;  2BU4 A;  1GMQ A;  2F4Y A;  1GMP A;  1JBS A;  1DE3 A;  1BSA A;  2AAE A;  2KF3 A;  3A5E A;  3KCH A;  3SYU A;  1BOX A;  3D5G A;  1BUJ A;  1LNI A;  1RSN A;  2C4B A;  1BSD A;  3DH2 A;  1BRI A;  1IYY A;  9RNT A;  2KF4 A;  1RGF A;  1BRH A;  1BRS A;  1RLS A;  4BU4 A;  1YGW A;  1RGE A;  1BAN A;  3AGO A;  1RHL A;  1I0V A;  4BIR A;  1FZU A;  1PY3 A;  1GMR A;  4GSP A;  1X1Y A;  1RCL A;  1BGS A;  1GOY A;  4J5K A;  1RN1 A;  1MGW A;  3WR2 A;  5BU4 A;  1FW7 A;  1UCI A;  1HYF A;  1X1X A;  1BNG A;  1B2M A;  1BRJ A;  4RNT A;  1RGA A;  1RGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...