1LRAA

Crystallographic study of glu 58 ala rnase t1(asterisk)2'-guanosine monophosphate at 1.9 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYAWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title Crystallographic study of Glu58Ala RNase T1 x 2'-guanosine monophosphate at 1.9-A resolution.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 27
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1lraA00
1HZ1A 2BU4A 1B3SA 1FUSA 1PY3A 1RGLA 1RGCA 3GSPA 1B21A 1LOVA 2C4BA 1RCLA 1RGHA 1GMRA 1I0XA 1YGWA 1BIRA 2BIRA 1BNEA 1RLSA 1X1WA 1RN1A 1T2IA 4HOHA 3AGNA 1DE3A 1RGAA 4BU4A 1SARA 1I2FA 1BUJA 3RNTA 1B2UA 4J5GA 3DGYA 2F56A 4GHOA 1MGWA 1IYYA 1ZGXA 1B2XA 1LRAA 1BRSA 5HOHA 2KF3A 1BRJA 1JBTA 1BNIA 4BIRA 1GOVA 3AGOA 2F5MA 1GOYA 3D5GA 6RNTA 2KF6A 1BAOA 1FZUA 3URPA 2GSPA 5BIRA 1B2MA 1TTOA 7GSPA 1BNGA 1GSPA 6GSPA 1R4YA 3AHSA 1A2PA 1I8VA 1FW7A 3DH2A 1AY7A 1PYLA 4J5KA 1BRIA 3WHOA 1RNBA 5BU4A 1RGEA 1I3IA 3SYUA 1JBRA 1UCKA 1BNJA 1UCIA 2SARA 3AHWA 1YVSA 1BNFA 5RNTA 1BSDA 1RSNA 2RNTA 1BRNL 3D5IA 1G02A 1FYSA 1RCKA 1I2GA 1RN4A 1BNRA 1RTUA 1AQZA 1RDSA 1B27A 1BNSA 2KAAA 2KF4A 1BSEA 1X1XA 1MGRA 2ZA4A 1TRQA 2KF5A 2AAEA 7RNTA 1B20A 1BU4A 1LNIA 1BRKA 1Q9EA 2HOHA 1I3FA 1BRGA 1I0VA 1T2HA 3KCHA 1TRPA 1I2EA 4RNTA 1CH0A 1RGGA 1BSAA 1GMPA 3D4AA 1BRHA 1DETA 1LOYA 1X1UA 4GSPA 1LOWA 1BSBA 3HOHA 2AADA 8RNTA 1JBSA 1BVIA 3A5EA 1RGKA 1BGSA 1B2SA 3BIRA 5GSPA 1B2ZA 9RNTA 1X1YA 2F4YA 1FUTA 1RGFA 1GOUA 1BANA 1RHLA 1UCLA 2F5WA 4HAAA 3BU4A 1YNVX 1BSCA 2RBIA 1BOXA 3WR2A 1GMQA 1HYFA 1C54A 1I70A 3Q3FA 1UCJA 1RNTA 1RMSA
chains in the Genus database with same CATH superfamily
1HZ1A 3N8BA 1BUQA 1G0TA 2CFLA 1O7NB 2OTJ3 2PZVA 3KIIA 1B21A 2B1XB 2MF7A 1MNLA 2F86B 3CU3A 3FSDA 4R4KA 4EV2A 3GAXA 3LOYA 3FLJA 4N6LA 3JUQA 4GL6A 2OTL3 3E99A 3NUVA 1BIRA 1VQP3 1OACA 1YHQ3 3AMOA 3NBJA 1K8A4 2WOFA 4HOHA 1EEJA 3X3XA 3QK9A 3WA2X 3WA3A 3GZXB 3BNCA 1RGAA 3LT8A 3CME3 1K28A 4BU4A 1IU7A 1A2VA 2D42A 1LOXA 1S723 1IT7A 3OW22 5IG0A 1M9GA 3MHEA 5AIIA 3AMOB 4J5GA 4GHOA 4XBYA 4XBTA 4FMBA 3ZG0A 1Q864 5CLKA 1BRSA 1JN5A 1BNIA 3AGOA 3RGRA 1QMAA 3HX8A 2HMNB 6RNTA 1VQ93 4HM3B 1BAOA 1DYUA 1D6YA 1N5PA 2GSPA 2H0GA 3URPA 1TTOA 3PS8A 1BNGA 3VSYA 5M19A 1B2MA 1WTHA 4CDLA 4EYCA 4RNZA 4LGQA 1JN5B 3WOFB 4ZM8A 5KP1A 1DMQA 1TUHA 2W03A 3NBBA 3MG1A 3CC23 1YIT3 3H3HA 3CCM3 2F98A 1HKXA 2CWVA 3BNBA 1UCKA 3T8UA 5BXQA 1YVSA 4HZ9B 1BSDA 2W6JH 4LYLB 4WYKA 2RNTA 3IPTA 4O8SA 4ILFA 3K0ZA 4R80A 1UUVB 2KF4A 1B27A 1BNSA 5AI1A 3ZFZA 4BTXA 2ZA4A 1IV7A 4HM4B 3UJMA 3SX1A 4XM4A 1BU4A 1IVVA 1JRQA 3DM8A 1OF5A 1M1XB 3OX9A 3EBTA 4LEHA 1CYUA 2JDIH 3GZYB 1I3FA 1BRGA 1T2HA 5AEWB 1W02A 3GRDA 1W00A 4FMDA 1IVUA 4HM1B 1ASKA 1RGGA 3MYTA 1R4CA 2QGUA 1SQWA 1OF5B 2LQVA 3FG1A 2CG0A 3WODG 1JB2A 4K61A 2CFGA 5FW5A 1EG9B 1RJOA 1NB5I 5AIHA 4BL3A 4EBGA 1IT8A 2AADA 1JBSA 1BVIA 1N8QA 1RN7A 4LMIA 3CMA3 1U8CB 1J2BA 1W01A 3PGBA 2CHCA 4KFDA 1C7HA 1V74A 2L1SA 5LC7A 4MMZB 3S29A 5IERA 4L7KA 3OWYA 3V99A 9RNTA 3KN4A 1FUTA 1YGEA 2CX0A 3BLZA 1RGFA 1YJW3 1BANA 1GY7A 1RHLA 1SIIA 5A0OB 3CNXA 2XFTA 3CCU3 3LTDA 2CC3A 3BB9A 1N5HA 4HM5B 5DRVA 2OOVA 4FCZA 3LTCA 1C54A 1HYFA 2CFWA 1M1K4 1OH0A 3B8LA 5CF2A 1RMSA 3HK4A 2STDA 1B3SA 1FUSA 1VQ73 1RGCA 4FMAA 2QIYA 2O3OA 4K1VA 2C4BA 2O9UX 3V92A 3G6E3 3CNMA 1RGHA 3PZWA 1M904 1JB5A 1OCVA 2HMKB 4NPBA 1RRHA 2MC8A 4H61A 1NO3A 3SOAA 4IIAA 3DMCA 3NM7A 1ZS7A 4QWTA 1HU9A 1W2ZA 1Y4KA 1GY6A 4JF8A 5IG4A 3AGNA 3ALAA 4O02B 1DE3A 4IPBA 4HM6B 1OUNA 1BUJA 3G0KA 2I9WA 4R9LA 1B2UA 3K9MC 4RBNA 3MG2A 3B7CA 3DGNA 1Q7HA 1MGWA 4LZIA 4N6NB 1BRJA 1JBTA 2QA43 4BIRA 1GOVA 1T3BA 1WQLB 4NREA 2F5MA 3G713 2C11A 3D5GA 2ML6A 2W56A 1US1A 1EA2A 4R9KA 1NB3I 2OOVC 2P09A 2UUGC 1Q814 3VGNA 3MWZA 3EX9A 1OGXA 3F14A 2XSOB 5STDA 3TDGA 4EC6A 2XF3A 2IYJA 3Q2PA 1FGQA 3D79A 4N6UA 5AIFA 3CCJ3 1FW7A 4J5KA 5FGOA 1SIHA 2SBLA 3QRDA 1O7MB 2FNQA 2OQEC 3KFQC 3G4S3 1PFPA 1AR0A 1RNBA 1VQN3 2IMJA 4I5QA 3CCQ3 4FMCA 4KVHA 1BNJA 3AHWA 2YFIB 5RNTA 1RSNA 4LSOA 1YJ93 2QEX3 1G02A 1I2GA 3JUNA 3X42A 1GY5A 4HYZA 1TRQA 2KF5A 1QAKA 3N9HA 4EV5A 5IG3A 2CX1A 1JB4A 3NV0A 1Q9EA 1IDPA 1TIJA 3CPOA 1FGOA 4H3UA 4KZ1A 4N6OB 5DREA 3RDEA 2W9PA 1I0VA 4X2HA 1UGIA 3LXUX 2XFSA 2Y73A 3JUMA 1I2EA 3LMLA 4RNTA 1CYVA 3NV0B 2W2CA 3GZRA 3KZTA 5I97A 2GBWB 4GSPA 4KFEA 1JNQA 2CFDA 3LTAA 4HBRA 1BSBA 1OGZA 6STDA 3CC43 2GXFA 1ZX2A 2HMOB 1YJN3 3FH1A 1VQQA 5IEOA 1UDII 2A15A 3KKGA 1MWTA 4AEQA 4MEIA 3S28A 4OUQA 2E2UA 3K63A 4WYKB 5CXOA 2F4YA 2Z77A 3X41A 3NX0A 1VQM3 1QALA 2GU3A 1W4NA 3WMDA 3F8XA 1K41A 1IVWA 1GD3A 3MPHA 4HAAA 5G2GA 1DVDA 3B4PA 1W5ZA 3BU4A 1NNVA 2M7OA 4HZBB 3KE7A 2OCTA 5HGRA 3U1WA 2J8XB 3LH4A 2RBIA 1BOXA 3X3YA 1MWSA 1EQKA 3EE1A 4FR9A 2E2TA 2BIRA 2Z76A 1O7HB 1RNTA 2ML5A 2RSXA 1PY3A 1S5AA 1RGLA 3GWRA 4KT3B 1UW1A 3DZLA 3CXC2 1A67A 2CK3H 1VZZA 1AVKA 2W9QA 2CG1A 4HVNA 1GD4A 1ZO2A 4MJDA 2FGTA 4ORLA 1X1WA 2CW9A 2Q07A 3UB1A 3ER7A 4XDWA 1N8R4 3EN8A 3N54B 3EHCA 7STDA 1Q40A 2WGOA 1QJGA 1JJ22 3JUPA 3F9SA 3F7SA 1NJI4 3Q1CA 1O7PB 3ZG5A 4KFFA 2HMJB 4MMYB 4O2HA 3FKAA 3DGMA 2P38A 2UGIA 3FF2A 4HM7B 4EW5A 4WP5A 1IYYA 1ZGXA 1LRAA 2CFKA 4Q53A 3PCSA 2KF3A 1Q40B 2K0MA 2XR8B 2HMLB 2BO9B 1EKMA 4X2OA 1WMNA 1LVNA 1ULIB 1UI8A 3L0RA 1FZUA 5BIRA 1TFOA 7GSPA 1GSPA 1UUWB 1LXEA 6GSPA 3IJEB 4XBXA 3M8CA 1WMOA 3HZPA 1KD14 1E97A 4BTYA 4HM8B 3CCL3 1R4YA 1I8VA 3DH2A 2RFRA 2YFLB 1DVCA 1RRLA 2LYXA 3B4OA 1TJDA 2XRXB 3NQZA 3D3LA 3WHOA 3CCE3 1RGEA 1WNHA 4N6TA 5ELUA 2CKFB 3SYUA 3WOEB 1K9M4 1JBRA 1W6GA 1STDA 1LNHA 1VQK3 1LQGC 2RGQA 3DGLA 3EJVA 3GZBA 1UI7A 3JUOA 4L8PA 4XDVA 5AYSC 3NXJA 1RN4A 1STFI 3BNEA 3LYGA 1BNRA 2WGQA 3EBYA 1W7CA 1AQZA 1RDSA 2XEPA 1V58A 2KAAA 1E3RA 5CF1A 1BSEA 3IMAB 5IG5A 3CPW2 1JZOA 1MGRA 2CH9A 2PNCA 1W2B2 1FUWA 3K7CA 7RNTA 1PU4A 1B20A 3FCSB 1O7WB 1LNIA 3FF0A 2XGLA 1BRKA 2WO0A 4U13A 4HKVB 1NWWA 1SJWA 2HOHA 3OXAA 2V1LA 3KCHA 4XB5A 2ZDJA 1VQO3 1CH0A 3BNDA 1BSAA 3NM2A 2P05A 2W56B 4N3VA 3F8HA 1GMPA 3Q90A 3D4AA 3WDGB 2OWPA 4N6MA 1X1UA 1OHSA 1LQMB 1T5YA 4AKZA 3K5TA 4OK0A 4STDA 4I4KA 3LTBA 3LT9A 1ULJB 2YX9A 3HOHA 3X40A 2W0QA 2H0HA 4CPKA 1VQL3 4J8TA 1TU5A 3HIGA 3NHXA 1YIJ3 3A5EA 1RGKA 3SOYA 2WOHA 3A76A 5D83A 5LC6A 3S27A 1W6YA 3D9RA 4TX4A 3CCR3 3BIRA 5GSPA 4WWUC 1B2ZA 4GB5A 1VQ63 1N9JA 3F40A 3EN1B 5G1KA 3HIIA 3T0UA 1ISKA 1GYBA 1GOUA 1WMPA 4FCMA 5D82A 5AYRB 1D6UA 3FG3A 1UCLA 1ROAA 2F5WA 2UX0A 3NQYA 4HM2B 4J9AA 4NHFA 1AV4A 1TP6A 1OPYA 4WHAA 1ROVA 3SXXA 1GMQA 3OWSA 5JPPA 3PCRA 2BMRB 1CQSA 1N9EA 2K3DA 3OWUA 1AVLA 4FCJA 4K90B 1CEWI 2BU4A 2Z6BA 5KP4A 1UGHI 3MKIA 2IUKA 2INXA 4R1KA 5D81A 3UL5A 3GSPA 1JV2B 1A90A 3ECFA 1LOVA 2KRTA 4AKYA 1RCLA 2JQ5A 1GMRA 1I0XA 2CWUA 3T8NA 1EUIC 1YGWA 1GS3A 1QAFA 1KQS2 2F99A 4WFOA 3DUKA 1KSIA 1MWUA 1BNEA 1RLSA 1U5OA 1RN1A 1T2IA 2IA7A 2ZHXB 3HI7A 2XGNA 3LZAA 5M18A 3DY5A 3UL6A 1F8NA 2E2VA 4O3VA 1JZDA 5EVHA 1K734 3S67A 1NU3A 1QVF2 3SLUA 1YVBI 1SARA 3FG4A 1I2FA 5KP3A 2Y74A 1JKGA 2KXGA 1A2KA 3JVCA 3RNTA 1FA3A 3DGYA 2B24B 2F56A 3PXMA 1B2XA 1W6CA 1MWRA 3F7XA 3NBRA 5HOHA 3SVAA 3SEDA 3CC73 2P0MA 1IQYA 3UNLA 1GOYA 1E3VA 2IY2A 5EEOA 2KF6A 1JKGB 3MSOA 4OVMA 4JRFA 2BT3A 2CWTA 3DGOA 3O8YA 2GBXB 5ELJA 2HMMB 1FGMA 2P0XA 2YFJB 2L4VA 3OV4A 5G1LA 3AHSA 1A2PA 3G16A 3V98A 1VQ53 1AY7A 1PYLA 1V57A 1BRIA 1DMMA 1Q42A 4CCVA 4L8OA 1FGRA 5BU4A 1I3IA 2GEYA 4K1UA 3J7Yd 3STDA 2SARA 1UCIA 3CD63 5AEUB 3DXOA 1BNFA 1VQ43 1IVXA 3EC9A 3CCV3 2GU1A 1BRNL 3D5IA 3VF1A 2BMOB 1FYSA 1RCKA 4EXRA 1RTUA 1UUGB 2XSHB 4IT7A 3KSPA 3ROBA 1X1XA 1FGTA 3S5CA 1IQ8A 2AAEA 5M1AA 3MG3A 3U97A 8CHOA 2ZL8A 2D1WA 4RNYA 3I553 2KCDA 4PEJA 3EB8A 1TRPA 1RKYA 5IENA 1KWIA 2BHMA 1Q7Y4 2BMQB 3I0YA 1BRHA 3PYJA 5TGNA 1DETA 1LOYA 3RGAA 4BL2A 2R4IA 1LOWA 2CIUA 1OHPA 4DKIA 2R41A 2BNGA 2OQEA 1IV9A 3CCS3 3KSED 8RNTA 1QVG2 4MMXB 4HM0B 4BTWA 1BGSA 5JPUA 1Q824 1DMNA 1KC84 1D6ZA 1Z1SA 1B2SA 5IEPA 1L5GB 1YI23 1IK3A 1X1YA 1G96A 2K54A 3H51A 1VQ83 2GEXA 2C10A 5EQLA 5BVBA 5JBSA 1O7GB 3X3ZA 4CJNA 4HJLB 1IQXA 2IUJA 1NDOB 3EF8A 2Z7AA 1MOLA 4N6V0 5IW9A 1SPUA 2XH9A 3G8ZA 3I563 2FXTA 5CK6A 2H0IA 5IF6A 2RCDA 1YNVX 1BSCA 4RZMA 3WR2A 1OHOA 2W04A 1TFKA 1I70A 3EQQB 3FZWA 3Q3FA 5AIGA 1UCJA 3FGYA 4G1MB
chains in the Genus database with same CATH topology
1HZ1A 2BU4A 1B3SA 1FUSA 1PY3A 1RGLA 1RGCA 3GSPA 1B21A 1LOVA 2C4BA 1RCLA 1RGHA 1GMRA 1I0XA 1YGWA 1BIRA 2BIRA 1BNEA 1RLSA 1X1WA 1RN1A 1T2IA 4HOHA 3AGNA 1DE3A 1RGAA 4BU4A 1SARA 1I2FA 1BUJA 3RNTA 1B2UA 4J5GA 3DGYA 2F56A 4GHOA 1MGWA 1IYYA 1ZGXA 1B2XA 1LRAA 1BRSA 5HOHA 2KF3A 1BRJA 1JBTA 1BNIA 4BIRA 1GOVA 3AGOA 2F5MA 1GOYA 3D5GA 6RNTA 2KF6A 1BAOA 1FZUA 3URPA 2GSPA 5BIRA 1B2MA 1TTOA 7GSPA 1BNGA 1GSPA 6GSPA 1R4YA 3AHSA 1A2PA 1I8VA 1FW7A 3DH2A 1AY7A 1PYLA 4J5KA 1BRIA 3WHOA 1RNBA 5BU4A 1RGEA 1I3IA 3SYUA 1JBRA 1UCKA 1BNJA 1UCIA 2SARA 3AHWA 1YVSA 1BNFA 5RNTA 1BSDA 1RSNA 2RNTA 1BRNL 3D5IA 1G02A 1FYSA 1RCKA 1I2GA 1RN4A 1BNRA 1RTUA 1AQZA 1RDSA 1B27A 1BNSA 2KAAA 2KF4A 1BSEA 1X1XA 1MGRA 2ZA4A 1TRQA 2KF5A 2AAEA 7RNTA 1B20A 1BU4A 1LNIA 1BRKA 1Q9EA 2HOHA 1I3FA 1BRGA 1I0VA 1T2HA 3KCHA 1TRPA 1I2EA 4RNTA 1CH0A 1RGGA 1BSAA 1GMPA 3D4AA 1BRHA 1DETA 1LOYA 1X1UA 4GSPA 1LOWA 1BSBA 3HOHA 2AADA 8RNTA 1JBSA 1BVIA 3A5EA 1RGKA 1BGSA 1B2SA 3BIRA 5GSPA 1B2ZA 9RNTA 1X1YA 2F4YA 1FUTA 1RGFA 1GOUA 1BANA 1RHLA 1UCLA 2F5WA 4HAAA 3BU4A 1YNVX 1BSCA 2RBIA 1BOXA 3WR2A 1GMQA 1HYFA 1C54A 1I70A 3Q3FA 1UCJA 1RNTA 1RMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZ1 A;  2BU4 A;  1B3S A;  1FUS A;  1PY3 A;  1RGL A;  1RGC A;  3GSP A;  1B21 A;  1LOV A;  2C4B A;  1RCL A;  1RGH A;  1GMR A;  1I0X A;  1YGW A;  1BIR A;  2BIR A;  1BNE A;  1RLS A;  1X1W A;  1RN1 A;  1T2I A;  4HOH A;  3AGN A;  1DE3 A;  1RGA A;  4BU4 A;  1SAR A;  1I2F A;  1BUJ A;  3RNT A;  1B2U A;  4J5G A;  3DGY A;  2F56 A;  4GHO A;  1MGW A;  1IYY A;  1ZGX A;  1B2X A;  1LRA A;  1BRS A;  5HOH A;  2KF3 A;  1BRJ A;  1JBT A;  1BNI A;  4BIR A;  1GOV A;  3AGO A;  2F5M A;  1GOY A;  3D5G A;  6RNT A;  2KF6 A;  1BAO A;  1FZU A;  3URP A;  2GSP A;  5BIR A;  1B2M A;  1TTO A;  7GSP A;  1BNG A;  1GSP A;  6GSP A;  1R4Y A;  3AHS A;  1A2P A;  1I8V A;  1FW7 A;  3DH2 A;  1AY7 A;  1PYL A;  4J5K A;  1BRI A;  3WHO A;  1RNB A;  5BU4 A;  1RGE A;  1I3I A;  3SYU A;  1JBR A;  1UCK A;  1BNJ A;  1UCI A;  2SAR A;  3AHW A;  1YVS A;  1BNF A;  5RNT A;  1BSD A;  1RSN A;  2RNT A;  1BRN L;  3D5I A;  1G02 A;  1FYS A;  1RCK A;  1I2G A;  1RN4 A;  1BNR A;  1RTU A;  1AQZ A;  1RDS A;  1B27 A;  1BNS A;  2KAA A;  2KF4 A;  1BSE A;  1X1X A;  1MGR A;  2ZA4 A;  1TRQ A;  2KF5 A;  2AAE A;  7RNT A;  1B20 A;  1BU4 A;  1LNI A;  1BRK A;  1Q9E A;  2HOH A;  1I3F A;  1BRG A;  1I0V A;  1T2H A;  3KCH A;  1TRP A;  1I2E A;  4RNT A;  1CH0 A;  1RGG A;  1BSA A;  1GMP A;  3D4A A;  1BRH A;  1DET A;  1LOY A;  1X1U A;  4GSP A;  1LOW A;  1BSB A;  3HOH A;  2AAD A;  8RNT A;  1JBS A;  1BVI A;  3A5E A;  1RGK A;  1BGS A;  1B2S A;  3BIR A;  5GSP A;  1B2Z A;  9RNT A;  1X1Y A;  2F4Y A;  1FUT A;  1RGF A;  1GOU A;  1BAN A;  1RHL A;  1UCL A;  2F5W A;  4HAA A;  3BU4 A;  1YNV X;  1BSC A;  2RBI A;  1BOX A;  3WR2 A;  1GMQ A;  1HYF A;  1C54 A;  1I70 A;  3Q3F A;  1UCJ A;  1RNT A;  1RMS A; 
#chains in the Genus database with same CATH topology
 1HZ1 A;  3N8B A;  1BUQ A;  1G0T A;  2CFL A;  1O7N B;  2OTJ 3;  2PZV A;  3KII A;  1B21 A;  2B1X B;  2MF7 A;  1MNL A;  2F86 B;  3CU3 A;  3FSD A;  4R4K A;  4EV2 A;  3GAX A;  3LOY A;  3FLJ A;  4N6L A;  3JUQ A;  4GL6 A;  2OTL 3;  3E99 A;  3NUV A;  1BIR A;  1VQP 3;  1OAC A;  1YHQ 3;  3AMO A;  3NBJ A;  1K8A 4;  2WOF A;  4HOH A;  1EEJ A;  3X3X A;  3QK9 A;  3WA2 X;  3WA3 A;  3GZX B;  3BNC A;  1RGA A;  3LT8 A;  3CME 3;  1K28 A;  4BU4 A;  1IU7 A;  1A2V A;  2D42 A;  1LOX A;  1S72 3;  1IT7 A;  3OW2 2;  5IG0 A;  1M9G A;  3MHE A;  5AII A;  3AMO B;  4J5G A;  4GHO A;  4XBY A;  4XBT A;  4FMB A;  3ZG0 A;  1Q86 4;  5CLK A;  1BRS A;  1JN5 A;  1BNI A;  3AGO A;  3RGR A;  1QMA A;  3HX8 A;  2HMN B;  6RNT A;  1VQ9 3;  4HM3 B;  1BAO A;  1DYU A;  1D6Y A;  1N5P A;  2GSP A;  2H0G A;  3URP A;  1TTO A;  3PS8 A;  1BNG A;  3VSY A;  5M19 A;  1B2M A;  1WTH A;  4CDL A;  4EYC A;  4RNZ A;  4LGQ A;  1JN5 B;  3WOF B;  4ZM8 A;  5KP1 A;  1DMQ A;  1TUH A;  2W03 A;  3NBB A;  3MG1 A;  3CC2 3;  1YIT 3;  3H3H A;  3CCM 3;  2F98 A;  1HKX A;  2CWV A;  3BNB A;  1UCK A;  3T8U A;  5BXQ A;  1YVS A;  4HZ9 B;  1BSD A;  2W6J H;  4LYL B;  4WYK A;  2RNT A;  3IPT A;  4O8S A;  4ILF A;  3K0Z A;  4R80 A;  1UUV B;  2KF4 A;  1B27 A;  1BNS A;  5AI1 A;  3ZFZ A;  4BTX A;  2ZA4 A;  1IV7 A;  4HM4 B;  3UJM A;  3SX1 A;  4XM4 A;  1BU4 A;  1IVV A;  1JRQ A;  3DM8 A;  1OF5 A;  1M1X B;  3OX9 A;  3EBT A;  4LEH A;  1CYU A;  2JDI H;  3GZY B;  1I3F A;  1BRG A;  1T2H A;  5AEW B;  1W02 A;  3GRD A;  1W00 A;  4FMD A;  1IVU A;  4HM1 B;  1ASK A;  1RGG A;  3MYT A;  1R4C A;  2QGU A;  1SQW A;  1OF5 B;  2LQV A;  3FG1 A;  2CG0 A;  3WOD G;  1JB2 A;  4K61 A;  2CFG A;  5FW5 A;  1EG9 B;  1RJO A;  1NB5 I;  5AIH A;  4BL3 A;  4EBG A;  1IT8 A;  2AAD A;  1JBS A;  1BVI A;  1N8Q A;  1RN7 A;  4LMI A;  3CMA 3;  1U8C B;  1J2B A;  1W01 A;  3PGB A;  2CHC A;  4KFD A;  1C7H A;  1V74 A;  2L1S A;  5LC7 A;  4MMZ B;  3S29 A;  5IER A;  4L7K A;  3OWY A;  3V99 A;  9RNT A;  3KN4 A;  1FUT A;  1YGE A;  2CX0 A;  3BLZ A;  1RGF A;  1YJW 3;  1BAN A;  1GY7 A;  1RHL A;  1SII A;  5A0O B;  3CNX A;  2XFT A;  3CCU 3;  3LTD A;  2CC3 A;  3BB9 A;  1N5H A;  4HM5 B;  5DRV A;  2OOV A;  4FCZ A;  3LTC A;  1C54 A;  1HYF A;  2CFW A;  1M1K 4;  1OH0 A;  3B8L A;  5CF2 A;  1RMS A;  3HK4 A;  2STD A;  1B3S A;  1FUS A;  1VQ7 3;  1RGC A;  4FMA A;  2QIY A;  2O3O A;  4K1V A;  2C4B A;  2O9U X;  3V92 A;  3G6E 3;  3CNM A;  1RGH A;  3PZW A;  1M90 4;  1JB5 A;  1OCV A;  2HMK B;  4NPB A;  1RRH A;  2MC8 A;  4H61 A;  1NO3 A;  3SOA A;  4IIA A;  3DMC A;  3NM7 A;  1ZS7 A;  4QWT A;  1HU9 A;  1W2Z A;  1Y4K A;  1GY6 A;  4JF8 A;  5IG4 A;  3AGN A;  3ALA A;  4O02 B;  1DE3 A;  4IPB A;  4HM6 B;  1OUN A;  1BUJ A;  3G0K A;  2I9W A;  4R9L A;  1B2U A;  3K9M C;  4RBN A;  3MG2 A;  3B7C A;  3DGN A;  1Q7H A;  1MGW A;  4LZI A;  4N6N B;  1BRJ A;  1JBT A;  2QA4 3;  4BIR A;  1GOV A;  1T3B A;  1WQL B;  4NRE A;  2F5M A;  3G71 3;  2C11 A;  3D5G A;  2ML6 A;  2W56 A;  1US1 A;  1EA2 A;  4R9K A;  1NB3 I;  2OOV C;  2P09 A;  2UUG C;  1Q81 4;  3VGN A;  3MWZ A;  3EX9 A;  1OGX A;  3F14 A;  2XSO B;  5STD A;  3TDG A;  4EC6 A;  2XF3 A;  2IYJ A;  3Q2P A;  1FGQ A;  3D79 A;  4N6U A;  5AIF A;  3CCJ 3;  1FW7 A;  4J5K A;  5FGO A;  1SIH A;  2SBL A;  3QRD A;  1O7M B;  2FNQ A;  2OQE C;  3KFQ C;  3G4S 3;  1PFP A;  1AR0 A;  1RNB A;  1VQN 3;  2IMJ A;  4I5Q A;  3CCQ 3;  4FMC A;  4KVH A;  1BNJ A;  3AHW A;  2YFI B;  5RNT A;  1RSN A;  4LSO A;  1YJ9 3;  2QEX 3;  1G02 A;  1I2G A;  3JUN A;  3X42 A;  1GY5 A;  4HYZ A;  1TRQ A;  2KF5 A;  1QAK A;  3N9H A;  4EV5 A;  5IG3 A;  2CX1 A;  1JB4 A;  3NV0 A;  1Q9E A;  1IDP A;  1TIJ A;  3CPO A;  1FGO A;  4H3U A;  4KZ1 A;  4N6O B;  5DRE A;  3RDE A;  2W9P A;  1I0V A;  4X2H A;  1UGI A;  3LXU X;  2XFS A;  2Y73 A;  3JUM A;  1I2E A;  3LML A;  4RNT A;  1CYV A;  3NV0 B;  2W2C A;  3GZR A;  3KZT A;  5I97 A;  2GBW B;  4GSP A;  4KFE A;  1JNQ A;  2CFD A;  3LTA A;  4HBR A;  1BSB A;  1OGZ A;  6STD A;  3CC4 3;  2GXF A;  1ZX2 A;  2HMO B;  1YJN 3;  3FH1 A;  1VQQ A;  5IEO A;  1UDI I;  2A15 A;  3KKG A;  1MWT A;  4AEQ A;  4MEI A;  3S28 A;  4OUQ A;  2E2U A;  3K63 A;  4WYK B;  5CXO A;  2F4Y A;  2Z77 A;  3X41 A;  3NX0 A;  1VQM 3;  1QAL A;  2GU3 A;  1W4N A;  3WMD A;  3F8X A;  1K41 A;  1IVW A;  1GD3 A;  3MPH A;  4HAA A;  5G2G A;  1DVD A;  3B4P A;  1W5Z A;  3BU4 A;  1NNV A;  2M7O A;  4HZB B;  3KE7 A;  2OCT A;  5HGR A;  3U1W A;  2J8X B;  3LH4 A;  2RBI A;  1BOX A;  3X3Y A;  1MWS A;  1EQK A;  3EE1 A;  4FR9 A;  2E2T A;  2BIR A;  2Z76 A;  1O7H B;  1RNT A;  2ML5 A;  2RSX A;  1PY3 A;  1S5A A;  1RGL A;  3GWR A;  4KT3 B;  1UW1 A;  3DZL A;  3CXC 2;  1A67 A;  2CK3 H;  1VZZ A;  1AVK A;  2W9Q A;  2CG1 A;  4HVN A;  1GD4 A;  1ZO2 A;  4MJD A;  2FGT A;  4ORL A;  1X1W A;  2CW9 A;  2Q07 A;  3UB1 A;  3ER7 A;  4XDW A;  1N8R 4;  3EN8 A;  3N54 B;  3EHC A;  7STD A;  1Q40 A;  2WGO A;  1QJG A;  1JJ2 2;  3JUP A;  3F9S A;  3F7S A;  1NJI 4;  3Q1C A;  1O7P B;  3ZG5 A;  4KFF A;  2HMJ B;  4MMY B;  4O2H A;  3FKA A;  3DGM A;  2P38 A;  2UGI A;  3FF2 A;  4HM7 B;  4EW5 A;  4WP5 A;  1IYY A;  1ZGX A;  1LRA A;  2CFK A;  4Q53 A;  3PCS A;  2KF3 A;  1Q40 B;  2K0M A;  2XR8 B;  2HML B;  2BO9 B;  1EKM A;  4X2O A;  1WMN A;  1LVN A;  1ULI B;  1UI8 A;  3L0R A;  1FZU A;  5BIR A;  1TFO A;  7GSP A;  1GSP A;  1UUW B;  1LXE A;  6GSP A;  3IJE B;  4XBX A;  3M8C A;  1WMO A;  3HZP A;  1KD1 4;  1E97 A;  4BTY A;  4HM8 B;  3CCL 3;  1R4Y A;  1I8V A;  3DH2 A;  2RFR A;  2YFL B;  1DVC A;  1RRL A;  2LYX A;  3B4O A;  1TJD A;  2XRX B;  3NQZ A;  3D3L A;  3WHO A;  3CCE 3;  1RGE A;  1WNH A;  4N6T A;  5ELU A;  2CKF B;  3SYU A;  3WOE B;  1K9M 4;  1JBR A;  1W6G A;  1STD A;  1LNH A;  1VQK 3;  1LQG C;  2RGQ A;  3DGL A;  3EJV A;  3GZB A;  1UI7 A;  3JUO A;  4L8P A;  4XDV A;  5AYS C;  3NXJ A;  1RN4 A;  1STF I;  3BNE A;  3LYG A;  1BNR A;  2WGQ A;  3EBY A;  1W7C A;  1AQZ A;  1RDS A;  2XEP A;  1V58 A;  2KAA A;  1E3R A;  5CF1 A;  1BSE A;  3IMA B;  5IG5 A;  3CPW 2;  1JZO A;  1MGR A;  2CH9 A;  2PNC A;  1W2B 2;  1FUW A;  3K7C A;  7RNT A;  1PU4 A;  1B20 A;  3FCS B;  1O7W B;  1LNI A;  3FF0 A;  2XGL A;  1BRK A;  2WO0 A;  4U13 A;  4HKV B;  1NWW A;  1SJW A;  2HOH A;  3OXA A;  2V1L A;  3KCH A;  4XB5 A;  2ZDJ A;  1VQO 3;  1CH0 A;  3BND A;  1BSA A;  3NM2 A;  2P05 A;  2W56 B;  4N3V A;  3F8H A;  1GMP A;  3Q90 A;  3D4A A;  3WDG B;  2OWP A;  4N6M A;  1X1U A;  1OHS A;  1LQM B;  1T5Y A;  4AKZ A;  3K5T A;  4OK0 A;  4STD A;  4I4K A;  3LTB A;  3LT9 A;  1ULJ B;  2YX9 A;  3HOH A;  3X40 A;  2W0Q A;  2H0H A;  4CPK A;  1VQL 3;  4J8T A;  1TU5 A;  3HIG A;  3NHX A;  1YIJ 3;  3A5E A;  1RGK A;  3SOY A;  2WOH A;  3A76 A;  5D83 A;  5LC6 A;  3S27 A;  1W6Y A;  3D9R A;  4TX4 A;  3CCR 3;  3BIR A;  5GSP A;  4WWU C;  1B2Z A;  4GB5 A;  1VQ6 3;  1N9J A;  3F40 A;  3EN1 B;  5G1K A;  3HII A;  3T0U A;  1ISK A;  1GYB A;  1GOU A;  1WMP A;  4FCM A;  5D82 A;  5AYR B;  1D6U A;  3FG3 A;  1UCL A;  1ROA A;  2F5W A;  2UX0 A;  3NQY A;  4HM2 B;  4J9A A;  4NHF A;  1AV4 A;  1TP6 A;  1OPY A;  4WHA A;  1ROV A;  3SXX A;  1GMQ A;  3OWS A;  5JPP A;  3PCR A;  2BMR B;  1CQS A;  1N9E A;  2K3D A;  3OWU A;  1AVL A;  4FCJ A;  4K90 B;  1CEW I;  2BU4 A;  2Z6B A;  5KP4 A;  1UGH I;  3MKI A;  2IUK A;  2INX A;  4R1K A;  5D81 A;  3UL5 A;  3GSP A;  1JV2 B;  1A90 A;  3ECF A;  1LOV A;  2KRT A;  4AKY A;  1RCL A;  2JQ5 A;  1GMR A;  1I0X A;  2CWU A;  3T8N A;  1EUI C;  1YGW A;  1GS3 A;  1QAF A;  1KQS 2;  2F99 A;  4WFO A;  3DUK A;  1KSI A;  1MWU A;  1BNE A;  1RLS A;  1U5O A;  1RN1 A;  1T2I A;  2IA7 A;  2ZHX B;  3HI7 A;  2XGN A;  3LZA A;  5M18 A;  3DY5 A;  3UL6 A;  1F8N A;  2E2V A;  4O3V A;  1JZD A;  5EVH A;  1K73 4;  3S67 A;  1NU3 A;  1QVF 2;  3SLU A;  1YVB I;  1SAR A;  3FG4 A;  1I2F A;  5KP3 A;  2Y74 A;  1JKG A;  2KXG A;  1A2K A;  3JVC A;  3RNT A;  1FA3 A;  3DGY A;  2B24 B;  2F56 A;  3PXM A;  1B2X A;  1W6C A;  1MWR A;  3F7X A;  3NBR A;  5HOH A;  3SVA A;  3SED A;  3CC7 3;  2P0M A;  1IQY A;  3UNL A;  1GOY A;  1E3V A;  2IY2 A;  5EEO A;  2KF6 A;  1JKG B;  3MSO A;  4OVM A;  4JRF A;  2BT3 A;  2CWT A;  3DGO A;  3O8Y A;  2GBX B;  5ELJ A;  2HMM B;  1FGM A;  2P0X A;  2YFJ B;  2L4V A;  3OV4 A;  5G1L A;  3AHS A;  1A2P A;  3G16 A;  3V98 A;  1VQ5 3;  1AY7 A;  1PYL A;  1V57 A;  1BRI A;  1DMM A;  1Q42 A;  4CCV A;  4L8O A;  1FGR A;  5BU4 A;  1I3I A;  2GEY A;  4K1U A;  3J7Y d;  3STD A;  2SAR A;  1UCI A;  3CD6 3;  5AEU B;  3DXO A;  1BNF A;  1VQ4 3;  1IVX A;  3EC9 A;  3CCV 3;  2GU1 A;  1BRN L;  3D5I A;  3VF1 A;  2BMO B;  1FYS A;  1RCK A;  4EXR A;  1RTU A;  1UUG B;  2XSH B;  4IT7 A;  3KSP A;  3ROB A;  1X1X A;  1FGT A;  3S5C A;  1IQ8 A;  2AAE A;  5M1A A;  3MG3 A;  3U97 A;  8CHO A;  2ZL8 A;  2D1W A;  4RNY A;  3I55 3;  2KCD A;  4PEJ A;  3EB8 A;  1TRP A;  1RKY A;  5IEN A;  1KWI A;  2BHM A;  1Q7Y 4;  2BMQ B;  3I0Y A;  1BRH A;  3PYJ A;  5TGN A;  1DET A;  1LOY A;  3RGA A;  4BL2 A;  2R4I A;  1LOW A;  2CIU A;  1OHP A;  4DKI A;  2R41 A;  2BNG A;  2OQE A;  1IV9 A;  3CCS 3;  3KSE D;  8RNT A;  1QVG 2;  4MMX B;  4HM0 B;  4BTW A;  1BGS A;  5JPU A;  1Q82 4;  1DMN A;  1KC8 4;  1D6Z A;  1Z1S A;  1B2S A;  5IEP A;  1L5G B;  1YI2 3;  1IK3 A;  1X1Y A;  1G96 A;  2K54 A;  3H51 A;  1VQ8 3;  2GEX A;  2C10 A;  5EQL A;  5BVB A;  5JBS A;  1O7G B;  3X3Z A;  4CJN A;  4HJL B;  1IQX A;  2IUJ A;  1NDO B;  3EF8 A;  2Z7A A;  1MOL A;  4N6V 0;  5IW9 A;  1SPU A;  2XH9 A;  3G8Z A;  3I56 3;  2FXT A;  5CK6 A;  2H0I A;  5IF6 A;  2RCD A;  1YNV X;  1BSC A;  4RZM A;  3WR2 A;  1OHO A;  2W04 A;  1TFK A;  1I70 A;  3EQQ B;  3FZW A;  3Q3F A;  5AIG A;  1UCJ A;  3FGY A;  4G1M B; 
#chains in the Genus database with same CATH homology
 1HZ1 A;  2BU4 A;  1B3S A;  1FUS A;  1PY3 A;  1RGL A;  1RGC A;  3GSP A;  1B21 A;  1LOV A;  2C4B A;  1RCL A;  1RGH A;  1GMR A;  1I0X A;  1YGW A;  1BIR A;  2BIR A;  1BNE A;  1RLS A;  1X1W A;  1RN1 A;  1T2I A;  4HOH A;  3AGN A;  1DE3 A;  1RGA A;  4BU4 A;  1SAR A;  1I2F A;  1BUJ A;  3RNT A;  1B2U A;  4J5G A;  3DGY A;  2F56 A;  4GHO A;  1MGW A;  1IYY A;  1ZGX A;  1B2X A;  1LRA A;  1BRS A;  5HOH A;  2KF3 A;  1BRJ A;  1JBT A;  1BNI A;  4BIR A;  1GOV A;  3AGO A;  2F5M A;  1GOY A;  3D5G A;  6RNT A;  2KF6 A;  1BAO A;  1FZU A;  3URP A;  2GSP A;  5BIR A;  1B2M A;  1TTO A;  7GSP A;  1BNG A;  1GSP A;  6GSP A;  1R4Y A;  3AHS A;  1A2P A;  1I8V A;  1FW7 A;  3DH2 A;  1AY7 A;  1PYL A;  4J5K A;  1BRI A;  3WHO A;  1RNB A;  5BU4 A;  1RGE A;  1I3I A;  3SYU A;  1JBR A;  1UCK A;  1BNJ A;  1UCI A;  2SAR A;  3AHW A;  1YVS A;  1BNF A;  5RNT A;  1BSD A;  1RSN A;  2RNT A;  1BRN L;  3D5I A;  1G02 A;  1FYS A;  1RCK A;  1I2G A;  1RN4 A;  1BNR A;  1RTU A;  1AQZ A;  1RDS A;  1B27 A;  1BNS A;  2KAA A;  2KF4 A;  1BSE A;  1X1X A;  1MGR A;  2ZA4 A;  1TRQ A;  2KF5 A;  2AAE A;  7RNT A;  1B20 A;  1BU4 A;  1LNI A;  1BRK A;  1Q9E A;  2HOH A;  1I3F A;  1BRG A;  1I0V A;  1T2H A;  3KCH A;  1TRP A;  1I2E A;  4RNT A;  1CH0 A;  1RGG A;  1BSA A;  1GMP A;  3D4A A;  1BRH A;  1DET A;  1LOY A;  1X1U A;  4GSP A;  1LOW A;  1BSB A;  3HOH A;  2AAD A;  8RNT A;  1JBS A;  1BVI A;  3A5E A;  1RGK A;  1BGS A;  1B2S A;  3BIR A;  5GSP A;  1B2Z A;  9RNT A;  1X1Y A;  2F4Y A;  1FUT A;  1RGF A;  1GOU A;  1BAN A;  1RHL A;  1UCL A;  2F5W A;  4HAA A;  3BU4 A;  1YNV X;  1BSC A;  2RBI A;  1BOX A;  3WR2 A;  1GMQ A;  1HYF A;  1C54 A;  1I70 A;  3Q3F A;  1UCJ A;  1RNT A;  1RMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...