2RCDA

Crystal structure of a protein with unknown function from duf3225 family (eca3500) from pectobacterium atrosepticum scri1043 at 2.32 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
GMLPDDVNQADVLADVTAAFYRYEKALTGNDVAVLDELFWHDEKTVRYGAGENLYGIEEIRAFRLARPSAGLDRALRNTVITTYGHDMAVASTEFTRTGSTKIGRQMQTWVKMPEGWRIVAAHVSLMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein conserved in bacteria with a cystatin-like fold (YP_051588.1) from Erwinia carotovora subsp. atroseptica SCRI1043 at 2.32 A resolution
rcsb
source organism Pectobacterium atrosepticum scri1043
molecule tags Unknown function
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11533 DUF3225 Protein of unknown function (DUF3225)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2rcdA00
4K1VA 3S5CA 3STDA 4HM0B 4WYKA 2RGQA 3FH1A 5IERA 3B4PA 3B7CA 1JB4A 2STDA 4K1UA 4HM1B 1TP6A 1A2KA 3OX9A 1OHSA 1IDPA 2QIYA 3MG1A 1DMQA 5G2GA 4U13A 3EN1B 5BXQA 4HM6B 3E99A 4HZBB 5EVHA 3LYGA 1EA2A 3Q90A 3OWUA 2I9WA 3G8ZA 4J8TA 3EHCA 1O7PB 2XR8B 3WMDA 2XRXB 1ASKA 2HMLB 2F86B 3OV4A 3F7SA 2F98A 3F8HA 4HM7B 5BVBA 3NM2A 3DXOA 5CF1A 5IENA 4Q53A 2R4IA 2YFIB 3DUKA 3A76A 4HZ9B 1OUNA 1SJWA 5HGRA 2GBWB 2YFLB 3EQQB 1GYBA 1O7HB 5DREA 1JN5B 1Z1SA 3HX8A 1NDOB 4J9AA 1OF5A 6STDA 2HMKB 3HK4A 3K0ZA 3CNXA 4XBXA 3EJVA 4HKVB 2BMQB 1UUVB 2Z76A 3B4OA 3CPOA 1E3RA 5FW5A 3EBTA 1HKXA 3JUPA 1Q40A 5AIIA 7STDA 1Q40B 5KP4A 1JKGA 2HMOB 3FGYA 5AEUB 1DMMA 4R1KA 4CDLA 3BB9A 1E3VA 3ROBA 1Q42A 2RCDA 3K7CA 3CNMA 4XB5A 5TGNA 5IG3A 4XM4A 3OWSA 4XDVA 5DRVA 1ZO2A 4XBTA 4I4KA 3JUQA 5AEWB 4WYKB 1O7MB 3RGRA 3D9RA 2QGUA 5KP3A 2GXFA 3KKGA 3EN8A 3GZBA 3ER7A 4HM2B 2GEYA 3SEDA 1W6YA 4IIAA 3G16A 2XSOB 3FSDA 1VZZA 5CLKA 3JUOA 5D81A 4XBYA 1GS3A 3UNLA 5IG5A 4HVNA 1K41A 1W01A 3NBRA 1NWWA 2INXA 3KSPA 3KZTA 1OPYA 3CU3A 4ORLA 1OHPA 5IF6A 4WWUC 3FF2A 2CKFB 5CF2A 4R9LA 2W2CA 2HMMB 1OHOA 3H3HA 3DM8A 1OCVA 4OVMA 4FCJA 4HM3B 4STDA 5IG4A 3JUNA 1O7NB 3MG3A 3MG2A 1OF5B 2CHCA 1ZX2A 3HZPA 3NXJA 2K54A 3NUVA 2GBXB 3H51A 3F7XA 1W00A 3B8LA 4LMIA 1GY5A 2B1XB 3MSOA 2RFRA 2OWPA 2BNGA 1JB2A 3IPTA 1JKGB 3ECFA 5IEPA 2BMOB 3RGAA 4X2HA 1O7GB 3MKIA 1GY7A 5AIHA 5CXOA 2A15A 3DZLA 5AI1A 1WQLB 1QJGA 1BUQA 3FF0A 4HM5B 3T8NA 3SOAA 5KP1A 4LGQA 2HMJB 2BMRB 3FZWA 3GZYB 1O7WB 3BLZA 3T8UA 3KE7A 3EC9A 5AIGA 3SOYA 4GB5A 3NHXA 3OXAA 5CK6A 5JPPA 5JPUA 1S5AA 3VSYA 1JB5A 1OH0A 3FKAA 2Z7AA 3F14A 4PEJA 2B24B 1STDA 3F8XA 3FLJA 2GEXA 3LZAA 1NU3A 3MYTA 4HJLB 4LEHA 4KVHA 2YFJB 2IMJA 3MHEA 3I0YA 3EF8A 4R9KA 1UUWB 2HMNB 1ULJB 4L8OA 5IEOA 1QMAA 2JQ5A 1ISKA 3GRDA 3JUMA 3M8CA 2Z77A 4WP5A 4N3VA 2XSHB 3GZXB 3F9SA 3GWRA 5D82A 3UJMA 5D83A 3DMCA 1OGZA 3EBYA 3GZRA 4RZMA 1OGXA 4HM4B 1JN5A 5AIFA 1CQSA 1ULIB 1DMNA 2UX0A 8CHOA 1U5OA 4FCMA 3EX9A 4OUQA 4MJDA 4XDWA 1E97A 1EG9B 3F40A 4H3UA 4L7KA 1TUHA 2F99A 4X2OA 3VGNA 3G0KA 1C7HA 2PZVA 5STDA 3NV0A 1W02A 4HM8B 5IG0A 4L8PA 3NV0B 1AR0A 1GY6A 3OWYA
chains in the Genus database with same CATH superfamily
4K1VA 1IV9A 3S5CA 2OTL3 3N9HA 3NX0A 4KFEA 2W9QA 2WOFA 3STDA 3LTBA 4HM0B 1DE3A 4O02B 1QVG2 3D79A 2BIRA 3O8YA 4WYKA 2RGQA 1GOUA 3FH1A 3CCR3 4N6V0 5IERA 3X42A 3B4PA 3B7CA 1JB4A 1RRHA 2STDA 3BU4A 4K1UA 1TU5A 4HM1B 2ZDJA 1SARA 4N6OB 1TP6A 3AHSA 1A2KA 1G96A 3SLUA 3CCL3 1I2GA 3OX9A 1YJN3 2P09A 1OHSA 3KIIA 3KCHA 3KN4A 4N6NB 1IDPA 2H0IA 2QIYA 1ROAA 3MG1A 1KD14 2IY2A 1QAKA 1DMQA 1RCLA 1VQ93 1D6UA 3RNTA 2FXTA 5G2GA 1CYVA 1Q814 3ZFZA 4U13A 1B2MA 1IT8A 3EN1B 5BXQA 1EQKA 3Q3FA 4HM6B 3E99A 4HZBB 5EVHA 4O3VA 3LYGA 3PXMA 1EA2A 3Q90A 4GHOA 1BNGA 2BT3A 1DVDA 1A90A 1B2XA 1B3SA 3OWUA 4AKZA 2IA7A 1K734 2I9WA 3D5IA 1CH0A 3G8ZA 2Y73A 4J8TA 3NQZA 2KF3A 3EHCA 1TRPA 1RGLA 1R4YA 2E2VA 3IMAB 1O7PB 3KFQC 5EQLA 1IK3A 1BSEA 2XR8B 4EXRA 1X1XA 3WMDA 1M1XB 3GSPA 1BNFA 1WMNA 2XRXB 1ASKA 4HYZA 3S28A 3CCM3 2HMLB 3CC73 1RGCA 3PCSA 4OK0A 2F86B 2FNQA 3OV4A 1SIIA 1UUGB 1QAFA 1V74A 1VQN3 3F7SA 3JVCA 2F98A 4N6TA 3DGYA 2KF5A 1I8VA 1GMRA 1UGIA 3F8HA 2LYXA 1WMPA 5LC6A 2L4VA 4HM7B 5BVBA 3NM2A 3HIGA 3DXOA 1KQS2 1T5YA 2C10A 2Z6BA 5CF1A 5IENA 1M9GA 1GMPA 1RN1A 1BGSA 3Q1CA 4BTYA 3LXUX 1W2B2 1FGMA 1NB3I 4Q53A 5ELUA 8RNTA 1S723 3X40A 1JV2B 1N9EA 1RJOA 1T2IA 3DY5A 7GSPA 3L0RA 2KXGA 3I553 5I97A 2J8XB 3U97A 2XFTA 1JBRA 2R4IA 1Q9EA 4HOHA 1MWUA 1A2PA 2YFIB 3A76A 3DUKA 4HZ9B 1OUNA 2OQEA 1SJWA 5HGRA 1B20A 3CME3 2GBWB 5EEOA 3PCRA 3BNDA 2YFLB 3EQQB 1BIRA 4FMDA 1Y4KA 1GYBA 1O7HB 1V57A 1JN5B 1Z1SA 2GSPA 4IT7A 2MF7A 3HX8A 5DREA 1M904 1NDOB 4J9AA 1OF5A 6STDA 1FA3A 3AGOA 1T3BA 2HMKB 3FG1A 3HK4A 1VQM3 1BSDA 3K0ZA 1I0VA 1GMQA 3CNXA 1ROVA 1FGQA 4FR9A 4XBXA 7RNTA 3EJVA 4HKVB 4EC6A 1PY3A 1RCKA 2BMQB 3CCV3 1I3IA 1R4CA 1UUVB 2O9UX 1RGGA 2Z76A 1JBSA 2XGLA 3B4OA 1GOVA 4GSPA 4LYLB 1FGTA 3CCU3 3CPOA 1E3RA 3SX1A 1BSAA 2WO0A 4JF8A 5FW5A 3EBTA 1HKXA 4HAAA 3JUPA 1Q864 1Q40A 5AIIA 4KZ1A 3PZWA 7STDA 1Q40B 5KP4A 2KAAA 3D3LA 1JKGA 3LH4A 4KFDA 5HOHA 3ZG0A 2FGTA 2HMOB 3FGYA 4HBRA 5AEUB 1SQWA 1DMMA 1B21A 2P0MA 4FMCA 4R1KA 1NJI4 4CDLA 1UCJA 3BB9A 4RNZA 1D6ZA 1W7CA 1E3VA 3X3YA 3ROBA 2QEX3 1Q42A 1BRNL 2RCDA 3K7CA 3CNMA 4XB5A 5TGNA 5IG3A 4XM4A 4FMBA 2XGNA 3OWSA 2OTJ3 1W2ZA 3SXXA 1IYYA 4XDVA 3S27A 1LVNA 3WA2X 2V1LA 5DRVA 2CX0A 1WMOA 1ZO2A 1FGRA 4R4KA 4XBTA 4I4KA 3JUQA 2XH9A 1I3FA 1B2ZA 1US1A 1YVSA 1CEWI 2CFDA 4FMAA 4JRFA 4WYKB 2F5WA 4TX4A 3K5TA 2BHMA 4R80A 2CH9A 2O3OA 1V58A 3CCS3 2WGQA 1O7MB 4LZIA 4CCVA 3G6E3 3CPW2 1VQ53 2UUGC 1RGAA 1BANA 2W56A 3RGRA 5AEWB 1N5HA 2W56B 3D9RA 3DGMA 1SPUA 3LTAA 4AKYA 2QGUA 5KP3A 3OW22 2GXFA 2OCTA 3KKGA 1QALA 3EN8A 3U1WA 3GZBA 4DKIA 4N6LA 3ER7A 1L5GB 1BSCA 4HM2B 2ZA4A 2GEYA 3SEDA 1W6YA 1TFOA 2IUJA 4IIAA 2BO9B 2GU1A 2IYJA 1T2HA 3G16A 2XSOB 1FUTA 1I2FA 4FCZA 1X1YA 1UI8A 2CFLA 4N6MA 3WHOA 3DGNA 3MPHA 2IUKA 3WOEB 1IU7A 2CWTA 3FSDA 4NHFA 1VZZA 3AGNA 3JUOA 5CLKA 1YGEA 1TTOA 1IQYA 5D81A 4XBYA 4MMYB 1JZDA 1BVIA 5FGOA 1N8QA 2P05A 1GS3A 5BU4A 2LQVA 1IVXA 3S67A 2MC8A 2CC3A 1AVKA 3UNLA 3WR2A 3FG3A 3CC23 4BU4A 5IG5A 2CK3H 4HVNA 1LOVA 5G1LA 1RGHA 3CCJ3 1K41A 1W01A 2W03A 3NBRA 3RDEA 1YI23 1NWWA 2INXA 3KSPA 1RHLA 3HI7A 3KZTA 1Q7HA 3T0UA 2CWVA 3CC43 1OPYA 4BTXA 3CU3A 4ORLA 1FUWA 1B2UA 3X3XA 1LOYA 1OHPA 4J5GA 5IF6A 4N6UA 4WWUC 1G0TA 3FF2A 4RBNA 2CKFB 4BL3A 5CF2A 1G02A 1GD3A 2WGOA 1EKMA 4I5QA 3G713 4R9LA 2W2CA 2Q07A 2CX1A 2HMMB 4RNYA 1OHOA 3A5EA 5M19A 1RTUA 2XEPA 3H3HA 3DM8A 1OCVA 2D42A 3LT8A 5A0OB 4OVMA 3HOHA 4FCJA 4HM3B 4ILFA 3FCSB 3K9MC 4STDA 1UGHI 5IG4A 3KSED 3WDGB 3TDGA 1W6GA 3JUNA 1O7NB 3QRDA 3ZG5A 1VQ63 3MG3A 3AMOA 5BIRA 1BU4A 3MG2A 3AMOB 2BU4A 2RBIA 3BNEA 6RNTA 2Y74A 1OF5B 2CHCA 1ZX2A 1TJDA 3BNBA 1OACA 3HZPA 2P0XA 1WNHA 1YHQ3 2WOHA 1HU9A 3NXJA 2K54A 1MGRA 3PS8A 3EE1A 2K3DA 2GBXB 3FG4A 3NUVA 3N8BA 3H51A 3F7XA 4EV2A 1DYUA 1EUIC 1W00A 4KT3B 4O8SA 1VQP3 1GOYA 5AYSC 3B8LA 4LMIA 1DVCA 2H0GA 3NBBA 1GY5A 1IQ8A 4AEQA 1LQGC 1RDSA 2B1XB 3MSOA 1BAOA 3EB8A 2CFGA 1LOWA 2RFRA 1F8NA 1K28A 2BNGA 1YGWA 2OWPA 3LOYA 1BRKA 1JB2A 1HZ1A 1HYFA 1N5PA 1JKGB 3IPTA 5IW9A 1YIJ3 3ECFA 1LQMB 1YVBI 5IEPA 4O2HA 1BNSA 1FUSA 1UCLA 2BMOB 1BRJA 2L1SA 5GSPA 1Q824 3RGAA 1AQZA 1LOXA 1IT7A 4X2HA 1O7GB 4K90B 3MKIA 1GY7A 1RLSA 2F56A 5AIHA 1LXEA 4CPKA 1B27A 1MGWA 1MWSA 2W6JH 2A15A 1AY7A 3LMLA 5CXOA 4MMXB 1DETA 1ZGXA 3DZLA 2CWUA 2CFWA 2KF6A 2PNCA 5AI1A 1I0XA 3VF1A 1UCKA 4NPBA 4LSOA 3CD63 4IPBA 5JBSA 3BIRA 1WQLB 3Q2PA 1QJGA 1SIHA 1STFI 3FF0A 3X3ZA 1BUQA 1J2BA 2SARA 1RN4A 1IVUA 1W6CA 4HM5B 1B2SA 3T8NA 3MWZA 3SOAA 5KP1A 2UGIA 1CYUA 3DGOA 4LGQA 5M18A 2HMJB 1YJW3 1EEJA 2BMRB 3FZWA 4EV5A 2K0MA 3SYUA 1AVLA 1NNVA 1YNVX 3GZYB 3X41A 1VQO3 1A67A 1O7WB 2OOVC 4ZM8A 5ELJA 1I70A 4EW5A 1U8CB 3BLZA 3WODG 1M1K4 3T8UA 3KE7A 1BOXA 3EC9A 5AIGA 3SOYA 1RKYA 3LTCA 4GB5A 1RGFA 3NHXA 3OXAA 1RN7A 5CK6A 5JPPA 1LNHA 1BRGA 1RSNA 3K63A 2CFKA 3V98A 5JPUA 1S5AA 2W9PA 2RNTA 4KFFA 3VSYA 3CCE3 2F4YA 1JNQA 1JB5A 3D5GA 1OH0A 3FKAA 1WTHA 3UL6A 1RNBA 1X1WA 4J5KA 2Z7AA 3F14A 1RGEA 2B24B 1NO3A 4PEJA 3S29A 1IQXA 1STDA 3PYJA 1JZOA 1W5ZA 3D4AA 3F8XA 3FLJA 3LTDA 5AYRB 2CG1A 4EYCA 1MOLA 1RMSA 1MNLA 2GEXA 3LZAA 3ALAA 1BRIA 1JJ22 1NU3A 3MYTA 1AV4A 2F5MA 3CCQ3 3I563 4HJLB 1BNIA 3HIIA 4LEHA 4MEIA 1YJ93 4KVHA 1TIJA 2YFJB 1PFPA 2AADA 2SBLA 2IMJA 3UL5A 4NREA 4GL6A 1PYLA 1N9JA 3MHEA 3I0YA 1KC84 2E2TA 3AHWA 2KF4A 3UB1A 1D6YA 1KSIA 3EF8A 5LC7A 2ML6A 1I2EA 4R9KA 2H0HA 1VQ73 1UUWB 2HMNB 4H61A 1RNTA 1ULJB 4L8OA 3V92A 3WOFB 3BNCA 1LNIA 5IEOA 5RNTA 4EBGA 2C4BA 1X1UA 1QMAA 4WHAA 2JQ5A 2ML5A 3GRDA 1ISKA 3JUMA 3QK9A 1K8A4 3M8CA 1C54A 2Z77A 2W0QA 1Q7Y4 2CW9A 2P38A 3CXC2 3GAXA 4WP5A 1VQQA 2AAEA 4N3VA 4BIRA 2XSHB 1UW1A 3GZXB 1JBTA 1W4NA 3F9SA 3GWRA 2RSXA 4QWTA 4RNTA 2W04A 1FGOA 5D82A 1IVVA 3UJMA 4G1MB 1VQK3 1LRAA 5D83A 3DMCA 1MWRA 1OGZA 4K61A 3EBYA 1ZS7A 3GZRA 1FW7A 1IVWA 4RZMA 1OGXA 4HM4B 2XFSA 6GSPA 1RGKA 3NQYA 3URPA 2KCDA 2KRTA 3G4S3 3NM7A 1A2VA 3N54B 1VQL3 1JN5A 1VQ83 2E2UA 2YX9A 1UDII 5AIFA 4WFOA 1BRHA 3SVAA 1CQSA 1ULIB 5G1KA 1NB5I 1BNEA 2CG0A 4BL2A 3WA3A 1DMNA 3PGBA 3LT9A 1TFKA 2UX0A 8CHOA 2C11A 1FYSA 2D1WA 1U5OA 2HOHA 4CJNA 3J7Yd 1BNJA 4FCMA 1YIT3 1K9M4 1BRSA 3EX9A 4OUQA 2JDIH 3DH2A 2R41A 4MJDA 1UCIA 2OQEC 4XDWA 2CIUA 1JRQA 1BNRA 1IV7A 2QA43 3CMA3 1BUJA 1TRQA 2ZHXB 1E97A 1EG9B 3F40A 1N8R4 4H3UA 1QVF2 4MMZB 2GU3A 1MWTA 1TUHA 4L7KA 2OOVA 2F99A 3IJEB 4X2OA 1UI7A 3VGNA 1PU4A 4BTWA 1RRLA 3G0KA 5M1AA 1C7HA 2PZVA 1FZUA 2M7OA 5STDA 1KWIA 1GSPA 1W02A 3NV0A 1BSBA 4HM8B 5IG0A 3V99A 4L8PA 3NV0B 3NBJA 3DGLA 1AR0A 1GY6A 9RNTA 2XF3A 3OWYA 1GD4A 2ZL8A 1VQ43
chains in the Genus database with same CATH topology
4K1VA 1IV9A 3S5CA 2OTL3 3N9HA 3NX0A 4KFEA 2W9QA 2WOFA 3STDA 3LTBA 4HM0B 4O02B 1QVG2 3O8YA 4WYKA 2RGQA 3FH1A 3CCR3 4N6V0 5IERA 3X42A 3B4PA 3B7CA 1JB4A 1RRHA 2STDA 4K1UA 1TU5A 4HM1B 2ZDJA 4N6OB 1TP6A 1A2KA 1G96A 3SLUA 3CCL3 3OX9A 1YJN3 2P09A 1OHSA 3KIIA 3KN4A 4N6NB 1IDPA 2QIYA 1KD14 1ROAA 3MG1A 1QAKA 1DMQA 1VQ93 1D6UA 2FXTA 5G2GA 1CYVA 1Q814 4U13A 1IT8A 3EN1B 5BXQA 1EQKA 4HM6B 3E99A 4HZBB 5EVHA 4O3VA 3LYGA 3PXMA 1EA2A 3Q90A 2BT3A 1A90A 3OWUA 4AKZA 1K734 2IA7A 2I9WA 3G8ZA 2Y73A 4J8TA 3NQZA 3EHCA 3KFQC 2E2VA 3IMAB 1O7PB 5EQLA 1IK3A 2XR8B 4EXRA 3WMDA 1M1XB 1WMNA 2XRXB 1ASKA 4HYZA 3S28A 3CCM3 2HMLB 3CC73 4OK0A 3PCSA 2F86B 2FNQA 3OV4A 1SIIA 1QAFA 1V74A 1VQN3 3F7SA 3JVCA 2F98A 4N6TA 3F8HA 2LYXA 1WMPA 5LC6A 2L4VA 4HM7B 5BVBA 3NM2A 3HIGA 3DXOA 1KQS2 1T5YA 2C10A 2Z6BA 5CF1A 5IENA 1M9GA 3Q1CA 1W2B2 4BTYA 3LXUX 1FGMA 1NB3I 4Q53A 5ELUA 1S723 3X40A 1JV2B 1N9EA 1RJOA 3DY5A 3L0RA 2KXGA 3I553 5I97A 3U97A 2XFTA 2R4IA 2YFIB 3DUKA 3A76A 4HZ9B 1OUNA 2OQEA 1SJWA 5HGRA 3CME3 2GBWB 5EEOA 3PCRA 3BNDA 2YFLB 3EQQB 4FMDA 1Y4KA 1GYBA 1O7HB 4IT7A 1JN5B 1Z1SA 5DREA 2MF7A 3HX8A 1M904 1NDOB 4J9AA 1OF5A 6STDA 1FA3A 2HMKB 3FG1A 3HK4A 1VQM3 3K0ZA 3CNXA 1ROVA 1FGQA 4FR9A 4XBXA 3EJVA 4HKVB 4EC6A 2BMQB 3CCV3 2O9UX 1R4CA 1UUVB 2Z76A 2XGLA 3B4OA 1FGTA 3CCU3 3CPOA 1E3RA 3SX1A 2WO0A 4JF8A 5FW5A 3EBTA 1HKXA 3JUPA 1Q864 1Q40A 5AIIA 4KZ1A 3PZWA 7STDA 1Q40B 5KP4A 3LH4A 3D3LA 1JKGA 4KFDA 2FGTA 2HMOB 3FGYA 4HBRA 5AEUB 1SQWA 1DMMA 4R1KA 2P0MA 4FMCA 1NJI4 4CDLA 3BB9A 4RNZA 1D6ZA 1W7CA 1E3VA 3X3YA 3ROBA 2QEX3 1Q42A 2RCDA 3K7CA 3CNMA 4XB5A 5TGNA 5IG3A 4XM4A 4FMBA 2XGNA 3OWSA 2OTJ3 1W2ZA 3SXXA 4XDVA 3S27A 1LVNA 3WA2X 2V1LA 5DRVA 1WMOA 1ZO2A 1FGRA 4R4KA 4XBTA 4I4KA 3JUQA 2XH9A 1US1A 5AEWB 2CFDA 1CEWI 4FMAA 4JRFA 4WYKB 4TX4A 3K5TA 2BHMA 4R80A 2CH9A 2O3OA 3CCS3 2WGQA 1O7MB 4LZIA 4CCVA 3G6E3 3CPW2 1VQ53 2W56A 3RGRA 1N5HA 2W56B 3D9RA 3DGMA 1SPUA 3LTAA 4AKYA 2QGUA 5KP3A 3OW22 2GXFA 2OCTA 3KKGA 1QALA 3EN8A 3U1WA 3GZBA 4N6LA 3ER7A 1L5GB 4HM2B 2GEYA 3SEDA 1W6YA 1TFOA 2IUJA 4IIAA 2BO9B 2GU1A 3G16A 2XSOB 4FCZA 1UI8A 2CFLA 4N6MA 3DGNA 3MPHA 2IUKA 3WOEB 1IU7A 2CWTA 3FSDA 4NHFA 1VZZA 5CLKA 3JUOA 1YGEA 5D81A 1IQYA 4XBYA 4MMYB 5FGOA 1N8QA 2P05A 1GS3A 2LQVA 1IVXA 3S67A 2MC8A 2CC3A 1AVKA 3UNLA 3FG3A 3CC23 5IG5A 2CK3H 4HVNA 3CCJ3 1K41A 1W01A 2W03A 3NBRA 3RDEA 1YI23 1NWWA 2INXA 3KSPA 3HI7A 3KZTA 3T0UA 2CWVA 3CC43 1OPYA 4BTXA 3CU3A 4ORLA 1FUWA 3X3XA 1OHPA 5IF6A 4N6UA 4WWUC 3FF2A 4RBNA 2CKFB 5CF2A 1GD3A 2WGOA 1EKMA 3G713 4R9LA 2W2CA 2Q07A 2HMMB 4RNYA 1OHOA 2XEPA 3H3HA 3DM8A 1OCVA 2D42A 3LT8A 5A0OB 4OVMA 4FCJA 4HM3B 4STDA 3FCSB 3K9MC 5IG4A 3KSED 3WDGB 3TDGA 1W6GA 3JUNA 1O7NB 3QRDA 1VQ63 3MG3A 3AMOA 3MG2A 3AMOB 3BNEA 2Y74A 1OF5B 2CHCA 1ZX2A 3BNBA 1OACA 3HZPA 2P0XA 1WNHA 1YHQ3 2WOHA 1HU9A 3NXJA 2K54A 3PS8A 3EE1A 3FG4A 2GBXB 3NUVA 3N8BA 3H51A 3F7XA 4EV2A 1DYUA 1W00A 4O8SA 1VQP3 5AYSC 3B8LA 4LMIA 1DVCA 3NBBA 1GY5A 1IQ8A 4AEQA 2B1XB 3MSOA 3EB8A 2CFGA 2RFRA 1F8NA 1K28A 2BNGA 2OWPA 1DVDA 3LOYA 1JB2A 1N5PA 3IPTA 1JKGB 5IW9A 1YIJ3 3ECFA 1YVBI 5IEPA 4O2HA 2BMOB 1Q824 3RGAA 1LOXA 1IT7A 4X2HA 1O7GB 4K90B 3MKIA 1GY7A 5AIHA 1LXEA 2W6JH 5CXOA 2A15A 3LMLA 4MMXB 3DZLA 2CWUA 2CFWA 2PNCA 5AI1A 3VF1A 4LSOA 3CD63 4IPBA 5JBSA 1WQLB 3Q2PA 1QJGA 1SIHA 1STFI 3FF0A 3X3ZA 1BUQA 1J2BA 1IVUA 1W6CA 4HM5B 3T8NA 3MWZA 3SOAA 5KP1A 1CYUA 3DGOA 4LGQA 2HMJB 1YJW3 2BMRB 4EV5A 3FZWA 2K0MA 1AVLA 1VQO3 3GZYB 3X41A 1A67A 1O7WB 2OOVC 4ZM8A 5ELJA 1U8CB 3BLZA 3WODG 1M1K4 3T8UA 3KE7A 3EC9A 5AIGA 3SOYA 1RKYA 3LTCA 4GB5A 3NHXA 3OXAA 1RN7A 5CK6A 5JPPA 1LNHA 3K63A 3V98A 5JPUA 2CFKA 1S5AA 2W9PA 4KFFA 3VSYA 3CCE3 1JNQA 1JB5A 1OH0A 3FKAA 1WTHA 3UL6A 2Z7AA 3F14A 4PEJA 2B24B 1NO3A 3S29A 1IQXA 1STDA 3PYJA 1W5ZA 3F8XA 3FLJA 3LTDA 5AYRB 2CG1A 4EYCA 1MOLA 1MNLA 2GEXA 3LZAA 3ALAA 1JJ22 1NU3A 3MYTA 1AV4A 3CCQ3 3I563 4HJLB 3HIIA 4LEHA 4MEIA 1YJ93 4KVHA 1TIJA 2YFJB 1PFPA 2SBLA 2IMJA 3UL5A 4NREA 4GL6A 3MHEA 1N9JA 1KC84 3I0YA 2E2TA 3UB1A 1KSIA 1D6YA 3EF8A 5LC7A 2ML6A 4R9KA 1VQ73 1UUWB 2HMNB 4H61A 1ULJB 4L8OA 3V92A 3WOFB 3BNCA 5IEOA 4EBGA 1QMAA 4WHAA 2JQ5A 2ML5A 3GRDA 1ISKA 3JUMA 3QK9A 1K8A4 3M8CA 2Z77A 2W0QA 1Q7Y4 2CW9A 2P38A 3CXC2 3GAXA 4WP5A 4N3VA 2XSHB 1UW1A 3GZXB 1W4NA 3F9SA 3GWRA 2RSXA 4QWTA 2W04A 1FGOA 5D82A 1IVVA 3UJMA 4G1MB 1VQK3 5D83A 3DMCA 1OGZA 4K61A 3EBYA 3GZRA 1IVWA 4RZMA 1OGXA 4HM4B 2XFSA 3NQYA 2KCDA 2KRTA 3G4S3 3NM7A 1A2VA 3N54B 1VQL3 1JN5A 1VQ83 2E2UA 2YX9A 5AIFA 3SVAA 4WFOA 1CQSA 1ULIB 1NB5I 2CG0A 3WA3A 1DMNA 3PGBA 3LT9A 2UX0A 1TFKA 8CHOA 2C11A 2D1WA 1U5OA 3J7Yd 4FCMA 1YIT3 1K9M4 3EX9A 4OUQA 2JDIH 4MJDA 4XDWA 2OQEC 2CIUA 1JRQA 1IV7A 2QA43 3CMA3 1E97A 1EG9B 3F40A 1N8R4 4H3UA 1QVF2 4MMZB 2GU3A 4L7KA 1TUHA 2OOVA 2F99A 3IJEB 4X2OA 1UI7A 3VGNA 1PU4A 4BTWA 1RRLA 3G0KA 1C7HA 2PZVA 2M7OA 5STDA 1KWIA 3NV0A 1W02A 4HM8B 5IG0A 3V99A 4L8PA 3NV0B 3NBJA 3DGLA 1AR0A 1GY6A 2XF3A 3OWYA 1GD4A 2ZL8A 1VQ43
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1V A;  3S5C A;  3STD A;  4HM0 B;  4WYK A;  2RGQ A;  3FH1 A;  5IER A;  3B4P A;  3B7C A;  1JB4 A;  2STD A;  4K1U A;  4HM1 B;  1TP6 A;  1A2K A;  3OX9 A;  1OHS A;  1IDP A;  2QIY A;  3MG1 A;  1DMQ A;  5G2G A;  4U13 A;  3EN1 B;  5BXQ A;  4HM6 B;  3E99 A;  4HZB B;  5EVH A;  3LYG A;  1EA2 A;  3Q90 A;  3OWU A;  2I9W A;  3G8Z A;  4J8T A;  3EHC A;  1O7P B;  2XR8 B;  3WMD A;  2XRX B;  1ASK A;  2HML B;  2F86 B;  3OV4 A;  3F7S A;  2F98 A;  3F8H A;  4HM7 B;  5BVB A;  3NM2 A;  3DXO A;  5CF1 A;  5IEN A;  4Q53 A;  2R4I A;  2YFI B;  3DUK A;  3A76 A;  4HZ9 B;  1OUN A;  1SJW A;  5HGR A;  2GBW B;  2YFL B;  3EQQ B;  1GYB A;  1O7H B;  5DRE A;  1JN5 B;  1Z1S A;  3HX8 A;  1NDO B;  4J9A A;  1OF5 A;  6STD A;  2HMK B;  3HK4 A;  3K0Z A;  3CNX A;  4XBX A;  3EJV A;  4HKV B;  2BMQ B;  1UUV B;  2Z76 A;  3B4O A;  3CPO A;  1E3R A;  5FW5 A;  3EBT A;  1HKX A;  3JUP A;  1Q40 A;  5AII A;  7STD A;  1Q40 B;  5KP4 A;  1JKG A;  2HMO B;  3FGY A;  5AEU B;  1DMM A;  4R1K A;  4CDL A;  3BB9 A;  1E3V A;  3ROB A;  1Q42 A;  2RCD A;  3K7C A;  3CNM A;  4XB5 A;  5TGN A;  5IG3 A;  4XM4 A;  3OWS A;  4XDV A;  5DRV A;  1ZO2 A;  4XBT A;  4I4K A;  3JUQ A;  5AEW B;  4WYK B;  1O7M B;  3RGR A;  3D9R A;  2QGU A;  5KP3 A;  2GXF A;  3KKG A;  3EN8 A;  3GZB A;  3ER7 A;  4HM2 B;  2GEY A;  3SED A;  1W6Y A;  4IIA A;  3G16 A;  2XSO B;  3FSD A;  1VZZ A;  5CLK A;  3JUO A;  5D81 A;  4XBY A;  1GS3 A;  3UNL A;  5IG5 A;  4HVN A;  1K41 A;  1W01 A;  3NBR A;  1NWW A;  2INX A;  3KSP A;  3KZT A;  1OPY A;  3CU3 A;  4ORL A;  1OHP A;  5IF6 A;  4WWU C;  3FF2 A;  2CKF B;  5CF2 A;  4R9L A;  2W2C A;  2HMM B;  1OHO A;  3H3H A;  3DM8 A;  1OCV A;  4OVM A;  4FCJ A;  4HM3 B;  4STD A;  5IG4 A;  3JUN A;  1O7N B;  3MG3 A;  3MG2 A;  1OF5 B;  2CHC A;  1ZX2 A;  3HZP A;  3NXJ A;  2K54 A;  3NUV A;  2GBX B;  3H51 A;  3F7X A;  1W00 A;  3B8L A;  4LMI A;  1GY5 A;  2B1X B;  3MSO A;  2RFR A;  2OWP A;  2BNG A;  1JB2 A;  3IPT A;  1JKG B;  3ECF A;  5IEP A;  2BMO B;  3RGA A;  4X2H A;  1O7G B;  3MKI A;  1GY7 A;  5AIH A;  5CXO A;  2A15 A;  3DZL A;  5AI1 A;  1WQL B;  1QJG A;  1BUQ A;  3FF0 A;  4HM5 B;  3T8N A;  3SOA A;  5KP1 A;  4LGQ A;  2HMJ B;  2BMR B;  3FZW A;  3GZY B;  1O7W B;  3BLZ A;  3T8U A;  3KE7 A;  3EC9 A;  5AIG A;  3SOY A;  4GB5 A;  3NHX A;  3OXA A;  5CK6 A;  5JPP A;  5JPU A;  1S5A A;  3VSY A;  1JB5 A;  1OH0 A;  3FKA A;  2Z7A A;  3F14 A;  4PEJ A;  2B24 B;  1STD A;  3F8X A;  3FLJ A;  2GEX A;  3LZA A;  1NU3 A;  3MYT A;  4HJL B;  4LEH A;  4KVH A;  2YFJ B;  2IMJ A;  3MHE A;  3I0Y A;  3EF8 A;  4R9K A;  1UUW B;  2HMN B;  1ULJ B;  4L8O A;  5IEO A;  1QMA A;  2JQ5 A;  1ISK A;  3GRD A;  3JUM A;  3M8C A;  2Z77 A;  4WP5 A;  4N3V A;  2XSH B;  3GZX B;  3F9S A;  3GWR A;  5D82 A;  3UJM A;  5D83 A;  3DMC A;  1OGZ A;  3EBY A;  3GZR A;  4RZM A;  1OGX A;  4HM4 B;  1JN5 A;  5AIF A;  1CQS A;  1ULI B;  1DMN A;  2UX0 A;  8CHO A;  1U5O A;  4FCM A;  3EX9 A;  4OUQ A;  4MJD A;  4XDW A;  1E97 A;  1EG9 B;  3F40 A;  4H3U A;  4L7K A;  1TUH A;  2F99 A;  4X2O A;  3VGN A;  3G0K A;  1C7H A;  2PZV A;  5STD A;  3NV0 A;  1W02 A;  4HM8 B;  5IG0 A;  4L8P A;  3NV0 B;  1AR0 A;  1GY6 A;  3OWY A; 
#chains in the Genus database with same CATH topology
 4K1V A;  1IV9 A;  3S5C A;  2OTL 3;  3N9H A;  3NX0 A;  4KFE A;  2W9Q A;  2WOF A;  3STD A;  3LTB A;  4HM0 B;  1DE3 A;  4O02 B;  1QVG 2;  3D79 A;  2BIR A;  3O8Y A;  4WYK A;  2RGQ A;  1GOU A;  3FH1 A;  3CCR 3;  4N6V 0;  5IER A;  3X42 A;  3B4P A;  3B7C A;  1JB4 A;  1RRH A;  2STD A;  3BU4 A;  4K1U A;  1TU5 A;  4HM1 B;  2ZDJ A;  1SAR A;  4N6O B;  1TP6 A;  3AHS A;  1A2K A;  1G96 A;  3SLU A;  3CCL 3;  1I2G A;  3OX9 A;  1YJN 3;  2P09 A;  1OHS A;  3KII A;  3KCH A;  3KN4 A;  4N6N B;  1IDP A;  2H0I A;  2QIY A;  1ROA A;  3MG1 A;  1KD1 4;  2IY2 A;  1QAK A;  1DMQ A;  1RCL A;  1VQ9 3;  1D6U A;  3RNT A;  2FXT A;  5G2G A;  1CYV A;  1Q81 4;  3ZFZ A;  4U13 A;  1B2M A;  1IT8 A;  3EN1 B;  5BXQ A;  1EQK A;  3Q3F A;  4HM6 B;  3E99 A;  4HZB B;  5EVH A;  4O3V A;  3LYG A;  3PXM A;  1EA2 A;  3Q90 A;  4GHO A;  1BNG A;  2BT3 A;  1DVD A;  1A90 A;  1B2X A;  1B3S A;  3OWU A;  4AKZ A;  2IA7 A;  1K73 4;  2I9W A;  3D5I A;  1CH0 A;  3G8Z A;  2Y73 A;  4J8T A;  3NQZ A;  2KF3 A;  3EHC A;  1TRP A;  1RGL A;  1R4Y A;  2E2V A;  3IMA B;  1O7P B;  3KFQ C;  5EQL A;  1IK3 A;  1BSE A;  2XR8 B;  4EXR A;  1X1X A;  3WMD A;  1M1X B;  3GSP A;  1BNF A;  1WMN A;  2XRX B;  1ASK A;  4HYZ A;  3S28 A;  3CCM 3;  2HML B;  3CC7 3;  1RGC A;  3PCS A;  4OK0 A;  2F86 B;  2FNQ A;  3OV4 A;  1SII A;  1UUG B;  1QAF A;  1V74 A;  1VQN 3;  3F7S A;  3JVC A;  2F98 A;  4N6T A;  3DGY A;  2KF5 A;  1I8V A;  1GMR A;  1UGI A;  3F8H A;  2LYX A;  1WMP A;  5LC6 A;  2L4V A;  4HM7 B;  5BVB A;  3NM2 A;  3HIG A;  3DXO A;  1KQS 2;  1T5Y A;  2C10 A;  2Z6B A;  5CF1 A;  5IEN A;  1M9G A;  1GMP A;  1RN1 A;  1BGS A;  3Q1C A;  4BTY A;  3LXU X;  1W2B 2;  1FGM A;  1NB3 I;  4Q53 A;  5ELU A;  8RNT A;  1S72 3;  3X40 A;  1JV2 B;  1N9E A;  1RJO A;  1T2I A;  3DY5 A;  7GSP A;  3L0R A;  2KXG A;  3I55 3;  5I97 A;  2J8X B;  3U97 A;  2XFT A;  1JBR A;  2R4I A;  1Q9E A;  4HOH A;  1MWU A;  1A2P A;  2YFI B;  3A76 A;  3DUK A;  4HZ9 B;  1OUN A;  2OQE A;  1SJW A;  5HGR A;  1B20 A;  3CME 3;  2GBW B;  5EEO A;  3PCR A;  3BND A;  2YFL B;  3EQQ B;  1BIR A;  4FMD A;  1Y4K A;  1GYB A;  1O7H B;  1V57 A;  1JN5 B;  1Z1S A;  2GSP A;  4IT7 A;  2MF7 A;  3HX8 A;  5DRE A;  1M90 4;  1NDO B;  4J9A A;  1OF5 A;  6STD A;  1FA3 A;  3AGO A;  1T3B A;  2HMK B;  3FG1 A;  3HK4 A;  1VQM 3;  1BSD A;  3K0Z A;  1I0V A;  1GMQ A;  3CNX A;  1ROV A;  1FGQ A;  4FR9 A;  4XBX A;  7RNT A;  3EJV A;  4HKV B;  4EC6 A;  1PY3 A;  1RCK A;  2BMQ B;  3CCV 3;  1I3I A;  1R4C A;  1UUV B;  2O9U X;  1RGG A;  2Z76 A;  1JBS A;  2XGL A;  3B4O A;  1GOV A;  4GSP A;  4LYL B;  1FGT A;  3CCU 3;  3CPO A;  1E3R A;  3SX1 A;  1BSA A;  2WO0 A;  4JF8 A;  5FW5 A;  3EBT A;  1HKX A;  4HAA A;  3JUP A;  1Q86 4;  1Q40 A;  5AII A;  4KZ1 A;  3PZW A;  7STD A;  1Q40 B;  5KP4 A;  2KAA A;  3D3L A;  1JKG A;  3LH4 A;  4KFD A;  5HOH A;  3ZG0 A;  2FGT A;  2HMO B;  3FGY A;  4HBR A;  5AEU B;  1SQW A;  1DMM A;  1B21 A;  2P0M A;  4FMC A;  4R1K A;  1NJI 4;  4CDL A;  1UCJ A;  3BB9 A;  4RNZ A;  1D6Z A;  1W7C A;  1E3V A;  3X3Y A;  3ROB A;  2QEX 3;  1Q42 A;  1BRN L;  2RCD A;  3K7C A;  3CNM A;  4XB5 A;  5TGN A;  5IG3 A;  4XM4 A;  4FMB A;  2XGN A;  3OWS A;  2OTJ 3;  1W2Z A;  3SXX A;  1IYY A;  4XDV A;  3S27 A;  1LVN A;  3WA2 X;  2V1L A;  5DRV A;  2CX0 A;  1WMO A;  1ZO2 A;  1FGR A;  4R4K A;  4XBT A;  4I4K A;  3JUQ A;  2XH9 A;  1I3F A;  1B2Z A;  1US1 A;  1YVS A;  1CEW I;  2CFD A;  4FMA A;  4JRF A;  4WYK B;  2F5W A;  4TX4 A;  3K5T A;  2BHM A;  4R80 A;  2CH9 A;  2O3O A;  1V58 A;  3CCS 3;  2WGQ A;  1O7M B;  4LZI A;  4CCV A;  3G6E 3;  3CPW 2;  1VQ5 3;  2UUG C;  1RGA A;  1BAN A;  2W56 A;  3RGR A;  5AEW B;  1N5H A;  2W56 B;  3D9R A;  3DGM A;  1SPU A;  3LTA A;  4AKY A;  2QGU A;  5KP3 A;  3OW2 2;  2GXF A;  2OCT A;  3KKG A;  1QAL A;  3EN8 A;  3U1W A;  3GZB A;  4DKI A;  4N6L A;  3ER7 A;  1L5G B;  1BSC A;  4HM2 B;  2ZA4 A;  2GEY A;  3SED A;  1W6Y A;  1TFO A;  2IUJ A;  4IIA A;  2BO9 B;  2GU1 A;  2IYJ A;  1T2H A;  3G16 A;  2XSO B;  1FUT A;  1I2F A;  4FCZ A;  1X1Y A;  1UI8 A;  2CFL A;  4N6M A;  3WHO A;  3DGN A;  3MPH A;  2IUK A;  3WOE B;  1IU7 A;  2CWT A;  3FSD A;  4NHF A;  1VZZ A;  3AGN A;  3JUO A;  5CLK A;  1YGE A;  1TTO A;  1IQY A;  5D81 A;  4XBY A;  4MMY B;  1JZD A;  1BVI A;  5FGO A;  1N8Q A;  2P05 A;  1GS3 A;  5BU4 A;  2LQV A;  1IVX A;  3S67 A;  2MC8 A;  2CC3 A;  1AVK A;  3UNL A;  3WR2 A;  3FG3 A;  3CC2 3;  4BU4 A;  5IG5 A;  2CK3 H;  4HVN A;  1LOV A;  5G1L A;  1RGH A;  3CCJ 3;  1K41 A;  1W01 A;  2W03 A;  3NBR A;  3RDE A;  1YI2 3;  1NWW A;  2INX A;  3KSP A;  1RHL A;  3HI7 A;  3KZT A;  1Q7H A;  3T0U A;  2CWV A;  3CC4 3;  1OPY A;  4BTX A;  3CU3 A;  4ORL A;  1FUW A;  1B2U A;  3X3X A;  1LOY A;  1OHP A;  4J5G A;  5IF6 A;  4N6U A;  4WWU C;  1G0T A;  3FF2 A;  4RBN A;  2CKF B;  4BL3 A;  5CF2 A;  1G02 A;  1GD3 A;  2WGO A;  1EKM A;  4I5Q A;  3G71 3;  4R9L A;  2W2C A;  2Q07 A;  2CX1 A;  2HMM B;  4RNY A;  1OHO A;  3A5E A;  5M19 A;  1RTU A;  2XEP A;  3H3H A;  3DM8 A;  1OCV A;  2D42 A;  3LT8 A;  5A0O B;  4OVM A;  3HOH A;  4FCJ A;  4HM3 B;  4ILF A;  3FCS B;  3K9M C;  4STD A;  1UGH I;  5IG4 A;  3KSE D;  3WDG B;  3TDG A;  1W6G A;  3JUN A;  1O7N B;  3QRD A;  3ZG5 A;  1VQ6 3;  3MG3 A;  3AMO A;  5BIR A;  1BU4 A;  3MG2 A;  3AMO B;  2BU4 A;  2RBI A;  3BNE A;  6RNT A;  2Y74 A;  1OF5 B;  2CHC A;  1ZX2 A;  1TJD A;  3BNB A;  1OAC A;  3HZP A;  2P0X A;  1WNH A;  1YHQ 3;  2WOH A;  1HU9 A;  3NXJ A;  2K54 A;  1MGR A;  3PS8 A;  3EE1 A;  2K3D A;  2GBX B;  3FG4 A;  3NUV A;  3N8B A;  3H51 A;  3F7X A;  4EV2 A;  1DYU A;  1EUI C;  1W00 A;  4KT3 B;  4O8S A;  1VQP 3;  1GOY A;  5AYS C;  3B8L A;  4LMI A;  1DVC A;  2H0G A;  3NBB A;  1GY5 A;  1IQ8 A;  4AEQ A;  1LQG C;  1RDS A;  2B1X B;  3MSO A;  1BAO A;  3EB8 A;  2CFG A;  1LOW A;  2RFR A;  1F8N A;  1K28 A;  2BNG A;  1YGW A;  2OWP A;  3LOY A;  1BRK A;  1JB2 A;  1HZ1 A;  1HYF A;  1N5P A;  1JKG B;  3IPT A;  5IW9 A;  1YIJ 3;  3ECF A;  1LQM B;  1YVB I;  5IEP A;  4O2H A;  1BNS A;  1FUS A;  1UCL A;  2BMO B;  1BRJ A;  2L1S A;  5GSP A;  1Q82 4;  3RGA A;  1AQZ A;  1LOX A;  1IT7 A;  4X2H A;  1O7G B;  4K90 B;  3MKI A;  1GY7 A;  1RLS A;  2F56 A;  5AIH A;  1LXE A;  4CPK A;  1B27 A;  1MGW A;  1MWS A;  2W6J H;  2A15 A;  1AY7 A;  3LML A;  5CXO A;  4MMX B;  1DET A;  1ZGX A;  3DZL A;  2CWU A;  2CFW A;  2KF6 A;  2PNC A;  5AI1 A;  1I0X A;  3VF1 A;  1UCK A;  4NPB A;  4LSO A;  3CD6 3;  4IPB A;  5JBS A;  3BIR A;  1WQL B;  3Q2P A;  1QJG A;  1SIH A;  1STF I;  3FF0 A;  3X3Z A;  1BUQ A;  1J2B A;  2SAR A;  1RN4 A;  1IVU A;  1W6C A;  4HM5 B;  1B2S A;  3T8N A;  3MWZ A;  3SOA A;  5KP1 A;  2UGI A;  1CYU A;  3DGO A;  4LGQ A;  5M18 A;  2HMJ B;  1YJW 3;  1EEJ A;  2BMR B;  3FZW A;  4EV5 A;  2K0M A;  3SYU A;  1AVL A;  1NNV A;  1YNV X;  3GZY B;  3X41 A;  1VQO 3;  1A67 A;  1O7W B;  2OOV C;  4ZM8 A;  5ELJ A;  1I70 A;  4EW5 A;  1U8C B;  3BLZ A;  3WOD G;  1M1K 4;  3T8U A;  3KE7 A;  1BOX A;  3EC9 A;  5AIG A;  3SOY A;  1RKY A;  3LTC A;  4GB5 A;  1RGF A;  3NHX A;  3OXA A;  1RN7 A;  5CK6 A;  5JPP A;  1LNH A;  1BRG A;  1RSN A;  3K63 A;  2CFK A;  3V98 A;  5JPU A;  1S5A A;  2W9P A;  2RNT A;  4KFF A;  3VSY A;  3CCE 3;  2F4Y A;  1JNQ A;  1JB5 A;  3D5G A;  1OH0 A;  3FKA A;  1WTH A;  3UL6 A;  1RNB A;  1X1W A;  4J5K A;  2Z7A A;  3F14 A;  1RGE A;  2B24 B;  1NO3 A;  4PEJ A;  3S29 A;  1IQX A;  1STD A;  3PYJ A;  1JZO A;  1W5Z A;  3D4A A;  3F8X A;  3FLJ A;  3LTD A;  5AYR B;  2CG1 A;  4EYC A;  1MOL A;  1RMS A;  1MNL A;  2GEX A;  3LZA A;  3ALA A;  1BRI A;  1JJ2 2;  1NU3 A;  3MYT A;  1AV4 A;  2F5M A;  3CCQ 3;  3I56 3;  4HJL B;  1BNI A;  3HII A;  4LEH A;  4MEI A;  1YJ9 3;  4KVH A;  1TIJ A;  2YFJ B;  1PFP A;  2AAD A;  2SBL A;  2IMJ A;  3UL5 A;  4NRE A;  4GL6 A;  1PYL A;  1N9J A;  3MHE A;  3I0Y A;  1KC8 4;  2E2T A;  3AHW A;  2KF4 A;  3UB1 A;  1D6Y A;  1KSI A;  3EF8 A;  5LC7 A;  2ML6 A;  1I2E A;  4R9K A;  2H0H A;  1VQ7 3;  1UUW B;  2HMN B;  4H61 A;  1RNT A;  1ULJ B;  4L8O A;  3V92 A;  3WOF B;  3BNC A;  1LNI A;  5IEO A;  5RNT A;  4EBG A;  2C4B A;  1X1U A;  1QMA A;  4WHA A;  2JQ5 A;  2ML5 A;  3GRD A;  1ISK A;  3JUM A;  3QK9 A;  1K8A 4;  3M8C A;  1C54 A;  2Z77 A;  2W0Q A;  1Q7Y 4;  2CW9 A;  2P38 A;  3CXC 2;  3GAX A;  4WP5 A;  1VQQ A;  2AAE A;  4N3V A;  4BIR A;  2XSH B;  1UW1 A;  3GZX B;  1JBT A;  1W4N A;  3F9S A;  3GWR A;  2RSX A;  4QWT A;  4RNT A;  2W04 A;  1FGO A;  5D82 A;  1IVV A;  3UJM A;  4G1M B;  1VQK 3;  1LRA A;  5D83 A;  3DMC A;  1MWR A;  1OGZ A;  4K61 A;  3EBY A;  1ZS7 A;  3GZR A;  1FW7 A;  1IVW A;  4RZM A;  1OGX A;  4HM4 B;  2XFS A;  6GSP A;  1RGK A;  3NQY A;  3URP A;  2KCD A;  2KRT A;  3G4S 3;  3NM7 A;  1A2V A;  3N54 B;  1VQL 3;  1JN5 A;  1VQ8 3;  2E2U A;  2YX9 A;  1UDI I;  5AIF A;  4WFO A;  1BRH A;  3SVA A;  1CQS A;  1ULI B;  5G1K A;  1NB5 I;  1BNE A;  2CG0 A;  4BL2 A;  3WA3 A;  1DMN A;  3PGB A;  3LT9 A;  1TFK A;  2UX0 A;  8CHO A;  2C11 A;  1FYS A;  2D1W A;  1U5O A;  2HOH A;  4CJN A;  3J7Y d;  1BNJ A;  4FCM A;  1YIT 3;  1K9M 4;  1BRS A;  3EX9 A;  4OUQ A;  2JDI H;  3DH2 A;  2R41 A;  4MJD A;  1UCI A;  2OQE C;  4XDW A;  2CIU A;  1JRQ A;  1BNR A;  1IV7 A;  2QA4 3;  3CMA 3;  1BUJ A;  1TRQ A;  2ZHX B;  1E97 A;  1EG9 B;  3F40 A;  1N8R 4;  4H3U A;  1QVF 2;  4MMZ B;  2GU3 A;  1MWT A;  1TUH A;  4L7K A;  2OOV A;  2F99 A;  3IJE B;  4X2O A;  1UI7 A;  3VGN A;  1PU4 A;  4BTW A;  1RRL A;  3G0K A;  5M1A A;  1C7H A;  2PZV A;  1FZU A;  2M7O A;  5STD A;  1KWI A;  1GSP A;  1W02 A;  3NV0 A;  1BSB A;  4HM8 B;  5IG0 A;  3V99 A;  4L8P A;  3NV0 B;  3NBJ A;  3DGL A;  1AR0 A;  1GY6 A;  9RNT A;  2XF3 A;  3OWY A;  1GD4 A;  2ZL8 A;  1VQ4 3; 
#chains in the Genus database with same CATH homology
 4K1V A;  1IV9 A;  3S5C A;  2OTL 3;  3N9H A;  3NX0 A;  4KFE A;  2W9Q A;  2WOF A;  3STD A;  3LTB A;  4HM0 B;  4O02 B;  1QVG 2;  3O8Y A;  4WYK A;  2RGQ A;  3FH1 A;  3CCR 3;  4N6V 0;  5IER A;  3X42 A;  3B4P A;  3B7C A;  1JB4 A;  1RRH A;  2STD A;  4K1U A;  1TU5 A;  4HM1 B;  2ZDJ A;  4N6O B;  1TP6 A;  1A2K A;  1G96 A;  3SLU A;  3CCL 3;  3OX9 A;  1YJN 3;  2P09 A;  1OHS A;  3KII A;  3KN4 A;  4N6N B;  1IDP A;  2QIY A;  1KD1 4;  1ROA A;  3MG1 A;  1QAK A;  1DMQ A;  1VQ9 3;  1D6U A;  2FXT A;  5G2G A;  1CYV A;  1Q81 4;  4U13 A;  1IT8 A;  3EN1 B;  5BXQ A;  1EQK A;  4HM6 B;  3E99 A;  4HZB B;  5EVH A;  4O3V A;  3LYG A;  3PXM A;  1EA2 A;  3Q90 A;  2BT3 A;  1A90 A;  3OWU A;  4AKZ A;  1K73 4;  2IA7 A;  2I9W A;  3G8Z A;  2Y73 A;  4J8T A;  3NQZ A;  3EHC A;  3KFQ C;  2E2V A;  3IMA B;  1O7P B;  5EQL A;  1IK3 A;  2XR8 B;  4EXR A;  3WMD A;  1M1X B;  1WMN A;  2XRX B;  1ASK A;  4HYZ A;  3S28 A;  3CCM 3;  2HML B;  3CC7 3;  4OK0 A;  3PCS A;  2F86 B;  2FNQ A;  3OV4 A;  1SII A;  1QAF A;  1V74 A;  1VQN 3;  3F7S A;  3JVC A;  2F98 A;  4N6T A;  3F8H A;  2LYX A;  1WMP A;  5LC6 A;  2L4V A;  4HM7 B;  5BVB A;  3NM2 A;  3HIG A;  3DXO A;  1KQS 2;  1T5Y A;  2C10 A;  2Z6B A;  5CF1 A;  5IEN A;  1M9G A;  3Q1C A;  1W2B 2;  4BTY A;  3LXU X;  1FGM A;  1NB3 I;  4Q53 A;  5ELU A;  1S72 3;  3X40 A;  1JV2 B;  1N9E A;  1RJO A;  3DY5 A;  3L0R A;  2KXG A;  3I55 3;  5I97 A;  3U97 A;  2XFT A;  2R4I A;  2YFI B;  3DUK A;  3A76 A;  4HZ9 B;  1OUN A;  2OQE A;  1SJW A;  5HGR A;  3CME 3;  2GBW B;  5EEO A;  3PCR A;  3BND A;  2YFL B;  3EQQ B;  4FMD A;  1Y4K A;  1GYB A;  1O7H B;  4IT7 A;  1JN5 B;  1Z1S A;  5DRE A;  2MF7 A;  3HX8 A;  1M90 4;  1NDO B;  4J9A A;  1OF5 A;  6STD A;  1FA3 A;  2HMK B;  3FG1 A;  3HK4 A;  1VQM 3;  3K0Z A;  3CNX A;  1ROV A;  1FGQ A;  4FR9 A;  4XBX A;  3EJV A;  4HKV B;  4EC6 A;  2BMQ B;  3CCV 3;  2O9U X;  1R4C A;  1UUV B;  2Z76 A;  2XGL A;  3B4O A;  1FGT A;  3CCU 3;  3CPO A;  1E3R A;  3SX1 A;  2WO0 A;  4JF8 A;  5FW5 A;  3EBT A;  1HKX A;  3JUP A;  1Q86 4;  1Q40 A;  5AII A;  4KZ1 A;  3PZW A;  7STD A;  1Q40 B;  5KP4 A;  3LH4 A;  3D3L A;  1JKG A;  4KFD A;  2FGT A;  2HMO B;  3FGY A;  4HBR A;  5AEU B;  1SQW A;  1DMM A;  4R1K A;  2P0M A;  4FMC A;  1NJI 4;  4CDL A;  3BB9 A;  4RNZ A;  1D6Z A;  1W7C A;  1E3V A;  3X3Y A;  3ROB A;  2QEX 3;  1Q42 A;  2RCD A;  3K7C A;  3CNM A;  4XB5 A;  5TGN A;  5IG3 A;  4XM4 A;  4FMB A;  2XGN A;  3OWS A;  2OTJ 3;  1W2Z A;  3SXX A;  4XDV A;  3S27 A;  1LVN A;  3WA2 X;  2V1L A;  5DRV A;  1WMO A;  1ZO2 A;  1FGR A;  4R4K A;  4XBT A;  4I4K A;  3JUQ A;  2XH9 A;  1US1 A;  5AEW B;  2CFD A;  1CEW I;  4FMA A;  4JRF A;  4WYK B;  4TX4 A;  3K5T A;  2BHM A;  4R80 A;  2CH9 A;  2O3O A;  3CCS 3;  2WGQ A;  1O7M B;  4LZI A;  4CCV A;  3G6E 3;  3CPW 2;  1VQ5 3;  2W56 A;  3RGR A;  1N5H A;  2W56 B;  3D9R A;  3DGM A;  1SPU A;  3LTA A;  4AKY A;  2QGU A;  5KP3 A;  3OW2 2;  2GXF A;  2OCT A;  3KKG A;  1QAL A;  3EN8 A;  3U1W A;  3GZB A;  4N6L A;  3ER7 A;  1L5G B;  4HM2 B;  2GEY A;  3SED A;  1W6Y A;  1TFO A;  2IUJ A;  4IIA A;  2BO9 B;  2GU1 A;  3G16 A;  2XSO B;  4FCZ A;  1UI8 A;  2CFL A;  4N6M A;  3DGN A;  3MPH A;  2IUK A;  3WOE B;  1IU7 A;  2CWT A;  3FSD A;  4NHF A;  1VZZ A;  5CLK A;  3JUO A;  1YGE A;  5D81 A;  1IQY A;  4XBY A;  4MMY B;  5FGO A;  1N8Q A;  2P05 A;  1GS3 A;  2LQV A;  1IVX A;  3S67 A;  2MC8 A;  2CC3 A;  1AVK A;  3UNL A;  3FG3 A;  3CC2 3;  5IG5 A;  2CK3 H;  4HVN A;  3CCJ 3;  1K41 A;  1W01 A;  2W03 A;  3NBR A;  3RDE A;  1YI2 3;  1NWW A;  2INX A;  3KSP A;  3HI7 A;  3KZT A;  3T0U A;  2CWV A;  3CC4 3;  1OPY A;  4BTX A;  3CU3 A;  4ORL A;  1FUW A;  3X3X A;  1OHP A;  5IF6 A;  4N6U A;  4WWU C;  3FF2 A;  4RBN A;  2CKF B;  5CF2 A;  1GD3 A;  2WGO A;  1EKM A;  3G71 3;  4R9L A;  2W2C A;  2Q07 A;  2HMM B;  4RNY A;  1OHO A;  2XEP A;  3H3H A;  3DM8 A;  1OCV A;  2D42 A;  3LT8 A;  5A0O B;  4OVM A;  4FCJ A;  4HM3 B;  4STD A;  3FCS B;  3K9M C;  5IG4 A;  3KSE D;  3WDG B;  3TDG A;  1W6G A;  3JUN A;  1O7N B;  3QRD A;  1VQ6 3;  3MG3 A;  3AMO A;  3MG2 A;  3AMO B;  3BNE A;  2Y74 A;  1OF5 B;  2CHC A;  1ZX2 A;  3BNB A;  1OAC A;  3HZP A;  2P0X A;  1WNH A;  1YHQ 3;  2WOH A;  1HU9 A;  3NXJ A;  2K54 A;  3PS8 A;  3EE1 A;  3FG4 A;  2GBX B;  3NUV A;  3N8B A;  3H51 A;  3F7X A;  4EV2 A;  1DYU A;  1W00 A;  4O8S A;  1VQP 3;  5AYS C;  3B8L A;  4LMI A;  1DVC A;  3NBB A;  1GY5 A;  1IQ8 A;  4AEQ A;  2B1X B;  3MSO A;  3EB8 A;  2CFG A;  2RFR A;  1F8N A;  1K28 A;  2BNG A;  2OWP A;  1DVD A;  3LOY A;  1JB2 A;  1N5P A;  3IPT A;  1JKG B;  5IW9 A;  1YIJ 3;  3ECF A;  1YVB I;  5IEP A;  4O2H A;  2BMO B;  1Q82 4;  3RGA A;  1LOX A;  1IT7 A;  4X2H A;  1O7G B;  4K90 B;  3MKI A;  1GY7 A;  5AIH A;  1LXE A;  2W6J H;  5CXO A;  2A15 A;  3LML A;  4MMX B;  3DZL A;  2CWU A;  2CFW A;  2PNC A;  5AI1 A;  3VF1 A;  4LSO A;  3CD6 3;  4IPB A;  5JBS A;  1WQL B;  3Q2P A;  1QJG A;  1SIH A;  1STF I;  3FF0 A;  3X3Z A;  1BUQ A;  1J2B A;  1IVU A;  1W6C A;  4HM5 B;  3T8N A;  3MWZ A;  3SOA A;  5KP1 A;  1CYU A;  3DGO A;  4LGQ A;  2HMJ B;  1YJW 3;  2BMR B;  4EV5 A;  3FZW A;  2K0M A;  1AVL A;  1VQO 3;  3GZY B;  3X41 A;  1A67 A;  1O7W B;  2OOV C;  4ZM8 A;  5ELJ A;  1U8C B;  3BLZ A;  3WOD G;  1M1K 4;  3T8U A;  3KE7 A;  3EC9 A;  5AIG A;  3SOY A;  1RKY A;  3LTC A;  4GB5 A;  3NHX A;  3OXA A;  1RN7 A;  5CK6 A;  5JPP A;  1LNH A;  3K63 A;  3V98 A;  5JPU A;  2CFK A;  1S5A A;  2W9P A;  4KFF A;  3VSY A;  3CCE 3;  1JNQ A;  1JB5 A;  1OH0 A;  3FKA A;  1WTH A;  3UL6 A;  2Z7A A;  3F14 A;  4PEJ A;  2B24 B;  1NO3 A;  3S29 A;  1IQX A;  1STD A;  3PYJ A;  1W5Z A;  3F8X A;  3FLJ A;  3LTD A;  5AYR B;  2CG1 A;  4EYC A;  1MOL A;  1MNL A;  2GEX A;  3LZA A;  3ALA A;  1JJ2 2;  1NU3 A;  3MYT A;  1AV4 A;  3CCQ 3;  3I56 3;  4HJL B;  3HII A;  4LEH A;  4MEI A;  1YJ9 3;  4KVH A;  1TIJ A;  2YFJ B;  1PFP A;  2SBL A;  2IMJ A;  3UL5 A;  4NRE A;  4GL6 A;  3MHE A;  1N9J A;  1KC8 4;  3I0Y A;  2E2T A;  3UB1 A;  1KSI A;  1D6Y A;  3EF8 A;  5LC7 A;  2ML6 A;  4R9K A;  1VQ7 3;  1UUW B;  2HMN B;  4H61 A;  1ULJ B;  4L8O A;  3V92 A;  3WOF B;  3BNC A;  5IEO A;  4EBG A;  1QMA A;  4WHA A;  2JQ5 A;  2ML5 A;  3GRD A;  1ISK A;  3JUM A;  3QK9 A;  1K8A 4;  3M8C A;  2Z77 A;  2W0Q A;  1Q7Y 4;  2CW9 A;  2P38 A;  3CXC 2;  3GAX A;  4WP5 A;  4N3V A;  2XSH B;  1UW1 A;  3GZX B;  1W4N A;  3F9S A;  3GWR A;  2RSX A;  4QWT A;  2W04 A;  1FGO A;  5D82 A;  1IVV A;  3UJM A;  4G1M B;  1VQK 3;  5D83 A;  3DMC A;  1OGZ A;  4K61 A;  3EBY A;  3GZR A;  1IVW A;  4RZM A;  1OGX A;  4HM4 B;  2XFS A;  3NQY A;  2KCD A;  2KRT A;  3G4S 3;  3NM7 A;  1A2V A;  3N54 B;  1VQL 3;  1JN5 A;  1VQ8 3;  2E2U A;  2YX9 A;  5AIF A;  3SVA A;  4WFO A;  1CQS A;  1ULI B;  1NB5 I;  2CG0 A;  3WA3 A;  1DMN A;  3PGB A;  3LT9 A;  2UX0 A;  1TFK A;  8CHO A;  2C11 A;  2D1W A;  1U5O A;  3J7Y d;  4FCM A;  1YIT 3;  1K9M 4;  3EX9 A;  4OUQ A;  2JDI H;  4MJD A;  4XDW A;  2OQE C;  2CIU A;  1JRQ A;  1IV7 A;  2QA4 3;  3CMA 3;  1E97 A;  1EG9 B;  3F40 A;  1N8R 4;  4H3U A;  1QVF 2;  4MMZ B;  2GU3 A;  4L7K A;  1TUH A;  2OOV A;  2F99 A;  3IJE B;  4X2O A;  1UI7 A;  3VGN A;  1PU4 A;  4BTW A;  1RRL A;  3G0K A;  1C7H A;  2PZV A;  2M7O A;  5STD A;  1KWI A;  3NV0 A;  1W02 A;  4HM8 B;  5IG0 A;  3V99 A;  4L8P A;  3NV0 B;  3NBJ A;  3DGL A;  1AR0 A;  1GY6 A;  2XF3 A;  3OWY A;  1GD4 A;  2ZL8 A;  1VQ4 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...