2RCDA

Crystal structure of a protein with unknown function from duf3225 family (eca3500) from pectobacterium atrosepticum scri1043 at 2.32 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
GMLPDDVNQADVLADVTAAFYRYEKALTGNDVAVLDELFWHDEKTVRYGAGENLYGIEEIRAFRLARPSAGLDRALRNTVITTYGHDMAVASTEFTRTGSTKIGRQMQTWVKMPEGWRIVAAHVSLMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein conserved in bacteria with a cystatin-like fold (YP_051588.1) from Erwinia carotovora subsp. atroseptica SCRI1043 at 2.32 A resolution
rcsb
source organism Pectobacterium atrosepticum scri1043
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11533 DUF3225 Protein of unknown function (DUF3225)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2rcdA00
3F40A 3BB9A 2R4IA 3MG3A 1OHPA 1VZZA 3F14A 4FCJA 3LZAA 3NHXA 1BUQA 1OHSA 3A76A 4U13A 4N3VA 1EA2A 3MG1A 6STDA 3G8ZA 3G16A 1WQLB 4HM2B 1E3RA 1OF5B 4STDA 2UX0A 5DREA 5CF1A 2A15A 1UUWB 2K54A 3OX9A 4I4KA 3EN8A 2XR8B 1IDPA 1W6YA 3H3HA 3NUVA 4HM8B 2JQ5A 5STDA 1STDA 4LEHA 4XB5A 1Q42A 4HM5B 5FW5A 5CK6A 1TUHA 3T8NA 1AR0A 2HMLB 1O7WB 5G2GA 5JPUA 4J9AA 5IG5A 3HX8A 3EF8A 3T8UA 2YFLB 3DUKA 3EBYA 2B1XB 2XRXB 3DXOA 3KSPA 1DMQA 4LGQA 5KP1A 1E3VA 1JB5A 2HMJB 4X2HA 2RFRA 4OVMA 3GWRA 5KP4A 3NV0B 4K1VA 4J8TA 3GZXB 3FF2A 1QJGA 2I9WA 2BMRB 4FCMA 1NWWA 3OXAA 5TGNA 2GXFA 4WYKB 1ULIB 4R9KA 1ASKA 2GEYA 1O7PB 5IERA 1JKGB 1GS3A 4L7KA 3SOYA 5IG0A 1O7HB 4R9LA 3FSDA 4HKVB 5BVBA 3JUPA 3HK4A 3ROBA 4Q53A 5EVHA 1Z1SA 2Z7AA 4LMIA 4OUQA 3ER7A 1DMMA 3MHEA 1OH0A 3S5CA 3OWYA 3MG2A 1O7NB 2YFJB 4ORLA 4H3UA 3EC9A 4WWUC 1W02A 2QIYA 1OF5A 3M8CA 3F8XA 5AIHA 3G0KA 3KZTA 5D81A 3FKAA 3SOAA 1W01A 4HVNA 4XDVA 4CDLA 3CPOA 3MYTA 3STDA 4HM4B 1GY5A 2GEXA 7STDA 3FH1A 4PEJA 2F98A 2B24B 4HZBB 5IEOA 3F8HA 5CXOA 3KKGA 5BXQA 3NM2A 3BLZA 1EG9B 3NXJA 1JN5B 3B8LA 2BNGA 1ULJB 1GY7A 3FF0A 2QGUA 3JUQA 4KVHA 1OGZA 1HKXA 3OWUA 1Q40B 5CF2A 3FLJA 4RZMA 2HMNB 4XBYA 1GYBA 1O7MB 5AIFA 4MJDA 3DZLA 3NV0A 3FZWA 5DRVA 4HJLB 5AIGA 3F7SA 5D82A 1C7HA 3K0ZA 3WMDA 1U5OA 3K7CA 5IENA 5JPPA 4IIAA 3EX9A 2XSOB 2CKFB 3B4OA 3D9RA 3EQQB 3RGAA 1JB4A 1ZO2A 3CNMA 1ISKA 2HMOB 1JB2A 3UJMA 1GY6A 1OPYA 5CLKA 2GBWB 3KE7A 2STDA 3E99A 3EBTA 3MKIA 3VSYA 5IEPA 4GB5A 4X2OA 3CU3A 4L8PA 1A2KA 3ECFA 3GZBA 2CHCA 2BMOB 3F7XA 5AI1A 1CQSA 2Z77A 5IG3A 3DM8A 1NDOB 3JUOA 3VGNA 8CHOA 3DMCA 4WP5A 2IMJA 2INXA 1E97A 4HZ9B 1UUVB 4XM4A 5AIIA 5IF6A 4R1KA 3H51A 4XDWA 2Z76A 4L8OA 3Q90A 3JUNA 3UNLA 4K1UA 4XBXA 3GZYB 4HM0B 3I0YA 1K41A 1OCVA 3B4PA 3CNXA 2HMKB 3JUMA 5AEWB 1NU3A 3NBRA 3F9SA 2F86B 2RCDA 1SJWA 2XSHB 3FGYA 2BMQB 3GRDA 5AEUB 5IG4A 5HGRA 1QMAA 1JN5A 3EHCA 3HZPA 5KP3A 2F99A 2PZVA 4XBTA 1OHOA 1OUNA 3EJVA 1S5AA 3GZRA 4HM6B 2HMMB 3RGRA 1Q40A 1OGXA 1O7GB 2W2CA 1W00A 3B7CA 1ZX2A 2YFIB 2GBXB 3EN1B 3OWSA 4HM7B 4HM3B 3SEDA 4WYKA 3LYGA 5D83A 3MSOA 2OWPA 1TP6A 3OV4A 1JKGA 4HM1B 3IPTA 1DMNA 2RGQA
chains in the Genus database with same CATH superfamily
3F40A 1RGGA 2KF3A 4TX4A 1Q824 3BB9A 3EE1A 2R4IA 1LOVA 4O2HA 1K9M4 2WOFA 3KCHA 4MMYB 3MG3A 3N8BA 2CIUA 1OHPA 1BNJA 1EKMA 2CWVA 4EXRA 1BRGA 2F5WA 3N9HA 1MOLA 3RNTA 1VZZA 3F14A 4FCJA 2XFSA 2KXGA 3LZAA 1BU4A 5AYRB 3NHXA 2HOHA 1OHSA 1BUQA 1BNFA 1LQMB 1RRLA 1IVXA 3A76A 4U13A 2F4YA 4N3VA 1WMNA 2OOVC 1EA2A 3MG1A 1DVDA 6STDA 4J5KA 2RNTA 3G8ZA 3G16A 2CK3H 1D6UA 1WQLB 4HM2B 1K8A4 1E3RA 1OF5B 2WGQA 4STDA 2XH9A 1RRHA 1S723 1B2SA 2UX0A 2CWTA 1ZS7A 5DREA 2QA43 1BRIA 1JBRA 5CF1A 4DKIA 3O8YA 4KT3B 2A15A 1W7CA 5GSPA 1UUWB 1AY7A 1SIIA 1Y4KA 2K54A 3OX9A 2WGOA 4I4KA 3EN8A 2XR8B 1JV2B 2W03A 2KF5A 3HOHA 1IDPA 4KFEA 1W6YA 3H3HA 3NUVA 1FZUA 1RJOA 1RTUA 1X1UA 3NX0A 4HM8B 5BU4A 2JQ5A 1BNGA 3WA2X 1KQS2 4O8SA 4WFOA 2GSPA 3N54B 5STDA 1LNHA 2CC3A 1STDA 2CFLA 2LQVA 3GSPA 5AYSC 4RNZA 3X42A 1AV4A 1RGAA 2L1SA 2XFTA 3NM7A 1N8QA 1MWTA 1V58A 2W56B 1FGMA 3X41A 4AKZA 3CCQ3 1BSAA 3G4S3 2SBLA 4LEHA 1N5PA 3Q3FA 3ZFZA 1IU7A 4XB5A 2P0XA 3DY5A 3NQYA 1DYUA 4FMBA 1Q42A 2IY2A 4HM5B 5FW5A 1UI7A 5CK6A 1YI23 1TUHA 1GSPA 2R41A 1RN1A 3PCRA 3MWZA 3T8NA 1W5ZA 1AR0A 3X3ZA 1JJ22 2HMLB 4BL2A 1O7WB 5G2GA 1MWSA 2CX0A 1B21A 1B20A 3DGMA 4J9AA 5JPUA 1YGEA 3D5GA 4G1MB 3S27A 1Q814 4LZIA 2CW9A 2KRTA 2Q07A 3WHOA 4BTWA 4H61A 5IG5A 3U1WA 2V1LA 1RCKA 3HX8A 3EF8A 1A2PA 1FUTA 3T8UA 3UL6A 2YFLB 3DUKA 3EBYA 5G1LA 1GMPA 2B1XB 1BVIA 2CWUA 2K3DA 2XRXB 3DXOA 1I70A 3KSPA 1JBTA 1DMQA 2FXTA 3GAXA 4LGQA 2ML5A 1TFOA 4N6MA 5KP1A 3G713 3CCM3 2P38A 1E3VA 4HAAA 1OACA 2ZDJA 2SARA 1WMOA 1JB5A 3AGNA 2HMJB 4X2HA 3KIIA 2RFRA 4OVMA 3V99A 3LH4A 4CPKA 3I563 3GWRA 5KP4A 2QEX3 3K5TA 1KD14 1D6ZA 3NV0B 5EEOA 5A0OB 4K1VA 1CEWI 4KZ1A 4J8TA 3GZXB 3BU4A 1T5YA 1YVSA 4CCVA 1RGCA 3FF2A 1QJGA 2I9WA 2Y73A 2BMRB 1KWIA 4FCMA 2ML6A 3BNDA 1NWWA 3OXAA 4K61A 1FGQA 2H0IA 1VQK3 4KFDA 4QWTA 7RNTA 1IT8A 1BRJA 1PU4A 5TGNA 2CFGA 1QALA 1WTHA 2GXFA 4WYKB 1ULIB 2IA7A 1AVLA 2Y74A 1ASKA 2P05A 4R9KA 2GEYA 2P0MA 3SVAA 3ZG5A 1IQXA 4NREA 1O7PB 3Q1CA 2GU1A 2RSXA 3X40A 5IERA 2OTL3 1JKGB 1UDII 2O9UX 1GS3A 2W6JH 1BANA 3PCSA 4L7KA 3X3XA 1RKYA 3SOYA 1FW7A 2BO9B 5IG0A 1O7HB 4R9LA 1I0VA 3FSDA 2AAEA 1R4CA 1QVF2 4FMAA 1RSNA 3BIRA 1F8NA 1BAOA 1D6YA 4HKVB 5BVBA 2W9PA 3JUPA 3NBBA 2CH9A 1EUIC 3HK4A 1LOYA 1N8R4 4N6UA 4HOHA 3RDEA 3ROBA 4R80A 4Q53A 5EVHA 1Z1SA 2Z7AA 4LMIA 4N6TA 4OUQA 1YIJ3 3ER7A 3LXUX 1PFPA 5FGOA 1DMMA 1TJDA 4AEQA 3WA3A 3AMOB 1V57A 3MHEA 1OH0A 4GSPA 1LVNA 2XF3A 1NNVA 3S5CA 1QAKA 3OWYA 3CCL3 3MG2A 1O7NB 5ELUA 1TTOA 2GU3A 1LOWA 2W0QA 3CXC2 1G0TA 2YFJB 2UUGC 4ORLA 1IV9A 2W04A 1VQ73 1UGHI 3CCU3 5EQLA 4H3UA 4MMZB 9RNTA 3EC9A 4WWUC 1B2XA 1B27A 1BSBA 1T2HA 1W02A 2JDIH 2OOVA 2QIYA 1OF5A 1ROVA 1VQ63 3M8CA 1TIJA 1TRPA 3WOEB 4KFFA 1KSIA 5RNTA 3F8XA 1YIT3 5AIHA 1IV7A 2C10A 3G0KA 2YX9A 4NPBA 1SQWA 4EBGA 1MWRA 1J2BA 3KZTA 1A2VA 3SYUA 1RLSA 5D81A 3FKAA 4MMXB 2OCTA 4BL3A 1VQL3 3SOAA 1C54A 1W01A 4HVNA 4XDVA 3CCR3 2CFDA 4HBRA 1M9GA 3CPOA 3MYTA 1PYLA 4HM4B 3KN4A 3STDA 4CDLA 2BT3A 2D1WA 2RBIA 3CD63 1ZGXA 1NJI4 1SIHA 2UGIA 1TU5A 3NBJA 1GY5A 3ZG0A 1VQ53 1M1K4 2GEXA 7STDA 3K9MC 3VF1A 3T0UA 2XEPA 3LT8A 3FH1A 4PEJA 2F98A 1NB3I 2B24B 3D4AA 4HZBB 1A90A 3QK9A 1RGKA 2K0MA 5IEOA 3LT9A 3DGYA 4OK0A 3V98A 3PGBA 3PZWA 3F8HA 4EV5A 5CXOA 1IVWA 3KKGA 3S28A 2OQEC 3DGLA 3LTCA 5BXQA 3CCE3 1MGWA 1MNLA 4LSOA 3NM2A 1HZ1A 1IT7A 1JRQA 2WOHA 3HI7A 4FMDA 2BIRA 1EG9B 3BLZA 3NXJA 3X3YA 1UGIA 1BGSA 1BSDA 1JN5B 3B8LA 2BNGA 1ULJB 1GY7A 3FF0A 1VQ83 2QGUA 5LC7A 4AKYA 1WMPA 3LTAA 3JUQA 1DETA 1QAFA 2O3OA 1UUGB 3BNEA 4KVHA 1OGZA 1HKXA 3AHSA 3OWUA 4NHFA 3AHWA 1SPUA 1IQ8A 1B3SA 1I0XA 1FA3A 1BRKA 1IVUA 1Q40B 5CF2A 3FLJA 4RZMA 1UCIA 4IT7A 1VQQA 1BNSA 1RGHA 1BNIA 2C11A 2ZHXB 2HMNB 4XBYA 2ZL8A 4FCZA 1BIRA 1GYBA 1O7MB 5AIFA 1BRHA 4BTYA 1K734 4MJDA 3DZLA 3NV0A 3FZWA 5DRVA 1BNEA 4BIRA 8RNTA 1M904 4HJLB 1IQYA 4BU4A 1EQKA 5AIGA 3F7SA 3IJEB 5D82A 4N6NB 1C7HA 1RDSA 3K0ZA 3I553 1UW1A 1VQO3 2H0HA 1CYUA 3FG3A 3WMDA 1U5OA 1YJ93 2WO0A 3SXXA 3K7CA 1BUJA 3NQZA 4K90B 2MF7A 5IENA 5JPPA 2L4VA 3OW22 4HYZA 1FUSA 3EX9A 4IIAA 1W4NA 2XSOB 3BNCA 6RNTA 2CKFB 3B4OA 2KF6A 3D9RA 3EQQB 1VQM3 3D5IA 1WNHA 3RGAA 1JB4A 1ZO2A 1B2MA 1JZOA 3V92A 1UCJA 2CX1A 3CNMA 3FCSB 1BSCA 3S29A 1ISKA 1GD3A 3WDGB 2IUKA 1STFI 2HMOB 1JB2A 1Q7Y4 1IYYA 4N6OB 3UJMA 3QRDA 1YHQ3 1UCLA 1V74A 1GY6A 5I97A 1OPYA 1I3IA 4EYCA 3WR2A 1RN4A 1JZDA 5CLKA 2J8XB 1YJN3 2GBWB 3KE7A 1W2B2 2STDA 3E99A 3EBTA 3MKIA 1L5GB 5HOHA 3VSYA 4RNYA 5LC6A 5IEPA 3JVCA 1U8CB 4GB5A 4N6LA 1NB5I 4X2OA 3CU3A 3FG4A 3DGOA 4EW5A 4L8PA 1A2KA 3A5EA 1GMRA 4GL6A 3ECFA 3HIIA 1RMSA 1G96A 3GZBA 4LYLB 4N6V0 2Z6BA 3URPA 1MWUA 2CHCA 2CG0A 2BMOB 3K63A 5G1KA 1YJW3 2LYXA 3AMOA 5JBSA 5M19A 1Q9EA 2FGTA 4ZM8A 3CPW2 1RHLA 1W6CA 3F7XA 5AI1A 1CQSA 2Z77A 5IG3A 3CCV3 3DM8A 1NDOB 3JUOA 4I5QA 1LOXA 5IW9A 3VGNA 8CHOA 3DMCA 3CC73 4WP5A 1AVKA 3TDGA 2IMJA 2F56A 2PNCA 1IK3A 3U97A 3G6E3 3D3LA 2C4BA 2INXA 1W2ZA 3EB8A 4RBNA 3UL5A 4FR9A 1E97A 1M1XB 1TFKA 1BOXA 1N9JA 1B2UA 4HZ9B 1BRNL 1BRSA 1DVCA 3S67A 1UUVB 4EC6A 4XM4A 5AIIA 1FGRA 3KFQC 3PXMA 1IVVA 3H51A 4R1KA 5IF6A 4XDWA 1X1YA 1G02A 1FGTA 4CJNA 5M1AA 1NO3A 1RGFA 1RNBA 2W56A 2Z76A 4L8OA 1X1XA 3Q90A 3LOYA 3BNBA 3JUNA 4O3VA 1N9EA 1TRQA 3UNLA 3D79A 1GD4A 4K1UA 2KF4A 4XBXA 2AADA 1EEJA 1RCLA 4JRFA 2F5MA 1FUWA 1YVBI 1YGWA 1CH0A 3GZYB 7GSPA 4HM0B 5BIRA 4IPBA 1UI8A 1QVG2 3I0YA 2OTJ3 1K41A 1LXEA 2E2VA 2CG1A 1RGEA 1OCVA 3B4PA 4MEIA 3WODG 3CNXA 4EV2A 2HMKB 5ELJA 3CME3 3JUMA 1JNQA 5AEWB 1I3FA 1NU3A 2M7OA 4ILFA 3UB1A 5M18A 1DE3A 3WOFB 2E2UA 3IMAB 3L0RA 3F9SA 2F86B 1BSEA 3NBRA 3Q2PA 1I2EA 2RCDA 4J5GA 1VQ43 1SJWA 2XSHB 3FGYA 1K28A 4GHOA 2BMQB 3KSED 3GRDA 5AEUB 3CMA3 2MC8A 1LNIA 5IG4A 1JBSA 1SARA 1I2GA 3PYJA 2BHMA 5HGRA 1YNVX 4RNTA 2OQEA 3LTBA 1B2ZA 1GOYA 1FYSA 1QMAA 1JN5A 1FGOA 1RNTA 1T2IA 2E2TA 3MPHA 3EHCA 1I2FA 3HZPA 2FNQA 5KP3A 1ROAA 2F99A 2PZVA 3FG1A 3LTDA 4XBTA 3CC23 1Q7HA 3DH2A 1OHOA 1GMQA 1OUNA 1S5AA 3EJVA 2BU4A 3GZRA 4HM6B 3CC43 4O02B 3SX1A 2HMMB 3CCJ3 6GSPA 2W9QA 1GOVA 1W6GA 1LRAA 1I8VA 1HYFA 1VQ93 1MGRA 1PY3A 3RGRA 4FMCA 1HU9A 1Q40A 1OGXA 2P09A 2IUJA 1T3BA 1O7GB 1X1WA 2W2CA 2H0GA 2XGNA 4R4KA 3HIGA 3J7Yd 1W00A 3B7CA 2XGLA 3PS8A 1BNRA 1ZX2A 3DGNA 2YFIB 1AQZA 2IYJA 2GBXB 1R4YA 2D42A 3AGOA 3EN1B 3OWSA 1N5HA 1UCKA 4HM7B 1A67A 4HM3B 3SEDA 2ZA4A 4WYKA 3LYGA 1KC84 1VQP3 4WHAA 1LQGC 1GOUA 5D83A 3MSOA 2CFKA 1US1A 1TP6A 2OWPA 3OV4A 3ALAA 3SLUA 1Q864 1JKGA 4BTXA 3CCS3 2CFWA 1VQN3 4HM1B 1RN7A 4JF8A 3IPTA 3LMLA 1DMNA 2KAAA 1RGLA 2RGQA 1CYVA 2KCDA
chains in the Genus database with same CATH topology
3F40A 4TX4A 1Q824 3BB9A 3EE1A 2R4IA 4O2HA 1K9M4 2WOFA 4MMYB 3MG3A 3N8BA 2CIUA 1OHPA 1EKMA 2CWVA 4EXRA 3N9HA 1MOLA 1VZZA 3F14A 4FCJA 2XFSA 2KXGA 3LZAA 5AYRB 3NHXA 1BUQA 1OHSA 1RRLA 3A76A 4U13A 4N3VA 1WMNA 2OOVC 1EA2A 3MG1A 1DVDA 6STDA 3G8ZA 3G16A 2CK3H 1D6UA 1WQLB 4HM2B 1K8A4 1E3RA 1OF5B 2WGQA 4STDA 2XH9A 1RRHA 1S723 2UX0A 2CWTA 5DREA 2QA43 5CF1A 3O8YA 2A15A 1W7CA 1UUWB 1SIIA 1Y4KA 2K54A 3OX9A 2WGOA 4I4KA 3EN8A 2XR8B 1JV2B 2W03A 4KFEA 1IDPA 1W6YA 3H3HA 3NUVA 1RJOA 3NX0A 4HM8B 2JQ5A 3WA2X 1KQS2 4O8SA 4WFOA 3N54B 5STDA 1LNHA 2CC3A 1STDA 2CFLA 2LQVA 5AYSC 4RNZA 3X42A 1AV4A 2XFTA 3NM7A 1N8QA 2W56B 1FGMA 3X41A 4AKZA 3CCQ3 3G4S3 2SBLA 4LEHA 1N5PA 1IU7A 4XB5A 2P0XA 3DY5A 3NQYA 1DYUA 4FMBA 1Q42A 4HM5B 5FW5A 1UI7A 5CK6A 1YI23 1TUHA 3PCRA 3MWZA 3T8NA 1W5ZA 1AR0A 3X3ZA 1JJ22 2HMLB 1O7WB 5G2GA 5JPUA 3DGMA 4J9AA 1YGEA 4G1MB 3S27A 1Q814 4LZIA 2CW9A 2KRTA 2Q07A 4BTWA 4H61A 5IG5A 3U1WA 2V1LA 3HX8A 3EF8A 3T8UA 3UL6A 2YFLB 3DUKA 3EBYA 2B1XB 2CWUA 2XRXB 3DXOA 3KSPA 1DMQA 2FXTA 3GAXA 4LGQA 2ML5A 1TFOA 4N6MA 5KP1A 3G713 3CCM3 2P38A 1E3VA 1OACA 2ZDJA 1WMOA 1JB5A 2HMJB 4X2HA 3KIIA 2RFRA 4OVMA 3V99A 3LH4A 3I563 3GWRA 5KP4A 2QEX3 3K5TA 1KD14 1D6ZA 3NV0B 5EEOA 5A0OB 4K1VA 1CEWI 4KZ1A 4J8TA 3GZXB 1T5YA 4CCVA 3FF2A 1QJGA 2I9WA 2Y73A 2BMRB 1KWIA 4FCMA 2ML6A 3BNDA 1NWWA 3OXAA 4K61A 1FGQA 1VQK3 4KFDA 4QWTA 1IT8A 1PU4A 5TGNA 2CFGA 1QALA 1WTHA 2GXFA 4WYKB 1ULIB 2Y74A 1AVLA 2IA7A 1ASKA 2P05A 4R9KA 2GEYA 2P0MA 3SVAA 1FUWA 1IQXA 4NREA 1O7PB 3Q1CA 2GU1A 2RSXA 3X40A 5IERA 2OTL3 1JKGB 2O9UX 2W6JH 1GS3A 3PCSA 3X3XA 4L7KA 1RKYA 3SOYA 2BO9B 5IG0A 1O7HB 4R9LA 3FSDA 1R4CA 1QVF2 4FMAA 1F8NA 1D6YA 4HKVB 5BVBA 2W9PA 3JUPA 3NBBA 2CH9A 3HK4A 1N8R4 4N6UA 3RDEA 3ROBA 4R80A 4Q53A 5EVHA 1Z1SA 2Z7AA 4LMIA 4N6TA 4OUQA 1YIJ3 3ER7A 3LXUX 1PFPA 5FGOA 1DMMA 3WA3A 4AEQA 3AMOB 3MHEA 1OH0A 1LVNA 2XF3A 3S5CA 1QAKA 3OWYA 3CCL3 3MG2A 1O7NB 5ELUA 2GU3A 2W0QA 3CXC2 2YFJB 4ORLA 1IV9A 2W04A 1VQ73 3CCU3 5EQLA 4H3UA 4MMZB 3EC9A 4WWUC 1W02A 2JDIH 2OOVA 2QIYA 1OF5A 1ROVA 1VQ63 3M8CA 1TIJA 3WOEB 4KFFA 1KSIA 1YIT3 3F8XA 5AIHA 1IV7A 2C10A 3G0KA 2YX9A 1J2BA 1SQWA 4EBGA 3KZTA 1A2VA 5D81A 3FKAA 4MMXB 2OCTA 1VQL3 3SOAA 1W01A 4HVNA 4XDVA 3CCR3 2CFDA 4HBRA 1M9GA 3CPOA 3MYTA 3STDA 4HM4B 3KN4A 4CDLA 2BT3A 2D1WA 3CD63 1NJI4 1SIHA 1TU5A 3NBJA 1GY5A 1VQ53 1M1K4 2GEXA 7STDA 3K9MC 3VF1A 3T0UA 2XEPA 3LT8A 3FH1A 4PEJA 2F98A 1NB3I 2B24B 4HZBB 1A90A 3QK9A 2K0MA 5IEOA 3LT9A 4OK0A 3V98A 3PGBA 3PZWA 3F8HA 4EV5A 5CXOA 1IVWA 3KKGA 3S28A 2OQEC 3DGLA 3LTCA 5BXQA 3CCE3 1MNLA 4LSOA 3NM2A 1IT7A 1JRQA 2WOHA 3HI7A 4FMDA 3BLZA 1EG9B 3NXJA 3X3YA 1JN5B 3B8LA 2BNGA 1ULJB 1GY7A 3FF0A 1VQ83 2QGUA 5LC7A 4AKYA 1WMPA 3LTAA 3JUQA 1QAFA 2O3OA 3BNEA 4KVHA 1OGZA 1HKXA 3OWUA 4NHFA 1SPUA 1IQ8A 1FA3A 1IVUA 1Q40B 5CF2A 3FLJA 4RZMA 4IT7A 2C11A 2HMNB 4XBYA 2ZL8A 4FCZA 1GYBA 1O7MB 5AIFA 4BTYA 1K734 4MJDA 3DZLA 3NV0A 3FZWA 5DRVA 1M904 4HJLB 1IQYA 1EQKA 5AIGA 3F7SA 3IJEB 5D82A 4N6NB 1C7HA 3I553 3K0ZA 1VQO3 1UW1A 1CYUA 3FG3A 3WMDA 1U5OA 1YJ93 2WO0A 3SXXA 3K7CA 3NQZA 4K90B 2MF7A 5IENA 5JPPA 2L4VA 3OW22 4HYZA 4IIAA 3EX9A 1W4NA 2XSOB 3BNCA 2CKFB 3B4OA 3D9RA 3EQQB 1VQM3 3RGAA 1WNHA 1JB4A 1ZO2A 3V92A 3CNMA 3FCSB 3S29A 1ISKA 1GD3A 3WDGB 2IUKA 1STFI 2HMOB 1JB2A 1Q7Y4 4N6OB 3UJMA 3QRDA 1YHQ3 1V74A 1GY6A 5I97A 1OPYA 4EYCA 5CLKA 1YJN3 2GBWB 3KE7A 1W2B2 2STDA 3E99A 3EBTA 3MKIA 1L5GB 3VSYA 4RNYA 5LC6A 5IEPA 3JVCA 1U8CB 4GB5A 4N6LA 1NB5I 4X2OA 3CU3A 3FG4A 3DGOA 4L8PA 1A2KA 4GL6A 3ECFA 3HIIA 1G96A 3GZBA 4N6V0 2Z6BA 3K63A 2CHCA 2CG0A 2BMOB 1YJW3 2LYXA 3AMOA 5JBSA 2FGTA 4ZM8A 3CPW2 3F7XA 1W6CA 5AI1A 1CQSA 2Z77A 5IG3A 3CCV3 3DM8A 1NDOB 3JUOA 1LOXA 5IW9A 3VGNA 8CHOA 3DMCA 3CC73 4WP5A 1AVKA 3TDGA 2IMJA 2PNCA 1IK3A 3U97A 3G6E3 3D3LA 2INXA 1W2ZA 3EB8A 4RBNA 3UL5A 4FR9A 1E97A 1M1XB 1TFKA 1N9JA 4HZ9B 1DVCA 3S67A 1UUVB 4EC6A 4XM4A 5AIIA 1FGRA 3KFQC 3PXMA 1IVVA 3H51A 4R1KA 5IF6A 4XDWA 1FGTA 1NO3A 2W56A 2Z76A 4L8OA 3Q90A 3LOYA 3BNBA 3JUNA 4O3VA 1N9EA 3UNLA 1GD4A 4K1UA 4XBXA 4JRFA 1YVBI 3GZYB 4HM0B 4IPBA 1UI8A 1QVG2 3I0YA 2OTJ3 1K41A 1LXEA 2E2VA 2CG1A 1OCVA 3B4PA 4MEIA 3WODG 3CNXA 4EV2A 2HMKB 5ELJA 3CME3 3JUMA 1JNQA 5AEWB 1NU3A 2M7OA 3UB1A 3WOFB 2E2UA 3IMAB 3L0RA 3F9SA 2F86B 3NBRA 3Q2PA 2RCDA 1VQ43 1SJWA 2XSHB 3FGYA 1K28A 2BMQB 3KSED 3GRDA 5AEUB 3CMA3 2MC8A 5IG4A 3PYJA 2BHMA 5HGRA 2OQEA 3LTBA 1QMAA 1JN5A 1FGOA 2E2TA 3MPHA 3EHCA 3HZPA 5KP3A 2FNQA 1ROAA 2F99A 2PZVA 3FG1A 3LTDA 4XBTA 3CC23 1OHOA 1OUNA 3EJVA 1S5AA 3GZRA 3CC43 4HM6B 4O02B 3SX1A 2HMMB 3CCJ3 2W9QA 1W6GA 1VQ93 3RGRA 4FMCA 1HU9A 1Q40A 1OGXA 2P09A 2IUJA 1O7GB 2W2CA 2XGNA 4R4KA 3HIGA 3J7Yd 1W00A 3B7CA 2XGLA 3PS8A 1ZX2A 3DGNA 2YFIB 2GBXB 2D42A 3EN1B 3OWSA 1N5HA 4HM7B 1A67A 4HM3B 3SEDA 4WYKA 3LYGA 1KC84 1VQP3 4WHAA 5D83A 3MSOA 2CFKA 2OWPA 1US1A 1TP6A 3OV4A 3ALAA 3SLUA 1Q864 1JKGA 4BTXA 3CCS3 2CFWA 1VQN3 4HM1B 1RN7A 4JF8A 3IPTA 3LMLA 1DMNA 1IVXA 2RGQA 1CYVA 2KCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F40 A;  3BB9 A;  2R4I A;  3MG3 A;  1OHP A;  1VZZ A;  3F14 A;  4FCJ A;  3LZA A;  3NHX A;  1BUQ A;  1OHS A;  3A76 A;  4U13 A;  4N3V A;  1EA2 A;  3MG1 A;  6STD A;  3G8Z A;  3G16 A;  1WQL B;  4HM2 B;  1E3R A;  1OF5 B;  4STD A;  2UX0 A;  5DRE A;  5CF1 A;  2A15 A;  1UUW B;  2K54 A;  3OX9 A;  4I4K A;  3EN8 A;  2XR8 B;  1IDP A;  1W6Y A;  3H3H A;  3NUV A;  4HM8 B;  2JQ5 A;  5STD A;  1STD A;  4LEH A;  4XB5 A;  1Q42 A;  4HM5 B;  5FW5 A;  5CK6 A;  1TUH A;  3T8N A;  1AR0 A;  2HML B;  1O7W B;  5G2G A;  5JPU A;  4J9A A;  5IG5 A;  3HX8 A;  3EF8 A;  3T8U A;  2YFL B;  3DUK A;  3EBY A;  2B1X B;  2XRX B;  3DXO A;  3KSP A;  1DMQ A;  4LGQ A;  5KP1 A;  1E3V A;  1JB5 A;  2HMJ B;  4X2H A;  2RFR A;  4OVM A;  3GWR A;  5KP4 A;  3NV0 B;  4K1V A;  4J8T A;  3GZX B;  3FF2 A;  1QJG A;  2I9W A;  2BMR B;  4FCM A;  1NWW A;  3OXA A;  5TGN A;  2GXF A;  4WYK B;  1ULI B;  4R9K A;  1ASK A;  2GEY A;  1O7P B;  5IER A;  1JKG B;  1GS3 A;  4L7K A;  3SOY A;  5IG0 A;  1O7H B;  4R9L A;  3FSD A;  4HKV B;  5BVB A;  3JUP A;  3HK4 A;  3ROB A;  4Q53 A;  5EVH A;  1Z1S A;  2Z7A A;  4LMI A;  4OUQ A;  3ER7 A;  1DMM A;  3MHE A;  1OH0 A;  3S5C A;  3OWY A;  3MG2 A;  1O7N B;  2YFJ B;  4ORL A;  4H3U A;  3EC9 A;  4WWU C;  1W02 A;  2QIY A;  1OF5 A;  3M8C A;  3F8X A;  5AIH A;  3G0K A;  3KZT A;  5D81 A;  3FKA A;  3SOA A;  1W01 A;  4HVN A;  4XDV A;  4CDL A;  3CPO A;  3MYT A;  3STD A;  4HM4 B;  1GY5 A;  2GEX A;  7STD A;  3FH1 A;  4PEJ A;  2F98 A;  2B24 B;  4HZB B;  5IEO A;  3F8H A;  5CXO A;  3KKG A;  5BXQ A;  3NM2 A;  3BLZ A;  1EG9 B;  3NXJ A;  1JN5 B;  3B8L A;  2BNG A;  1ULJ B;  1GY7 A;  3FF0 A;  2QGU A;  3JUQ A;  4KVH A;  1OGZ A;  1HKX A;  3OWU A;  1Q40 B;  5CF2 A;  3FLJ A;  4RZM A;  2HMN B;  4XBY A;  1GYB A;  1O7M B;  5AIF A;  4MJD A;  3DZL A;  3NV0 A;  3FZW A;  5DRV A;  4HJL B;  5AIG A;  3F7S A;  5D82 A;  1C7H A;  3K0Z A;  3WMD A;  1U5O A;  3K7C A;  5IEN A;  5JPP A;  4IIA A;  3EX9 A;  2XSO B;  2CKF B;  3B4O A;  3D9R A;  3EQQ B;  3RGA A;  1JB4 A;  1ZO2 A;  3CNM A;  1ISK A;  2HMO B;  1JB2 A;  3UJM A;  1GY6 A;  1OPY A;  5CLK A;  2GBW B;  3KE7 A;  2STD A;  3E99 A;  3EBT A;  3MKI A;  3VSY A;  5IEP A;  4GB5 A;  4X2O A;  3CU3 A;  4L8P A;  1A2K A;  3ECF A;  3GZB A;  2CHC A;  2BMO B;  3F7X A;  5AI1 A;  1CQS A;  2Z77 A;  5IG3 A;  3DM8 A;  1NDO B;  3JUO A;  3VGN A;  8CHO A;  3DMC A;  4WP5 A;  2IMJ A;  2INX A;  1E97 A;  4HZ9 B;  1UUV B;  4XM4 A;  5AII A;  5IF6 A;  4R1K A;  3H51 A;  4XDW A;  2Z76 A;  4L8O A;  3Q90 A;  3JUN A;  3UNL A;  4K1U A;  4XBX A;  3GZY B;  4HM0 B;  3I0Y A;  1K41 A;  1OCV A;  3B4P A;  3CNX A;  2HMK B;  3JUM A;  5AEW B;  1NU3 A;  3NBR A;  3F9S A;  2F86 B;  2RCD A;  1SJW A;  2XSH B;  3FGY A;  2BMQ B;  3GRD A;  5AEU B;  5IG4 A;  5HGR A;  1QMA A;  1JN5 A;  3EHC A;  3HZP A;  5KP3 A;  2F99 A;  2PZV A;  4XBT A;  1OHO A;  1OUN A;  3EJV A;  1S5A A;  3GZR A;  4HM6 B;  2HMM B;  3RGR A;  1Q40 A;  1OGX A;  1O7G B;  2W2C A;  1W00 A;  3B7C A;  1ZX2 A;  2YFI B;  2GBX B;  3EN1 B;  3OWS A;  4HM7 B;  4HM3 B;  3SED A;  4WYK A;  3LYG A;  5D83 A;  3MSO A;  2OWP A;  1TP6 A;  3OV4 A;  1JKG A;  4HM1 B;  3IPT A;  1DMN A;  2RGQ A; 
#chains in the Genus database with same CATH topology
 3F40 A;  1RGG A;  2KF3 A;  4TX4 A;  1Q82 4;  3BB9 A;  3EE1 A;  2R4I A;  1LOV A;  4O2H A;  1K9M 4;  2WOF A;  3KCH A;  4MMY B;  3MG3 A;  3N8B A;  2CIU A;  1OHP A;  1BNJ A;  1EKM A;  2CWV A;  4EXR A;  1BRG A;  2F5W A;  3N9H A;  1MOL A;  3RNT A;  1VZZ A;  3F14 A;  4FCJ A;  2XFS A;  2KXG A;  3LZA A;  1BU4 A;  5AYR B;  3NHX A;  2HOH A;  1OHS A;  1BUQ A;  1BNF A;  1LQM B;  1RRL A;  1IVX A;  3A76 A;  4U13 A;  2F4Y A;  4N3V A;  1WMN A;  2OOV C;  1EA2 A;  3MG1 A;  1DVD A;  6STD A;  4J5K A;  2RNT A;  3G8Z A;  3G16 A;  2CK3 H;  1D6U A;  1WQL B;  4HM2 B;  1K8A 4;  1E3R A;  1OF5 B;  2WGQ A;  4STD A;  2XH9 A;  1RRH A;  1S72 3;  1B2S A;  2UX0 A;  2CWT A;  1ZS7 A;  5DRE A;  2QA4 3;  1BRI A;  1JBR A;  5CF1 A;  4DKI A;  3O8Y A;  4KT3 B;  2A15 A;  1W7C A;  5GSP A;  1UUW B;  1AY7 A;  1SII A;  1Y4K A;  2K54 A;  3OX9 A;  2WGO A;  4I4K A;  3EN8 A;  2XR8 B;  1JV2 B;  2W03 A;  2KF5 A;  3HOH A;  1IDP A;  4KFE A;  1W6Y A;  3H3H A;  3NUV A;  1FZU A;  1RJO A;  1RTU A;  1X1U A;  3NX0 A;  4HM8 B;  5BU4 A;  2JQ5 A;  1BNG A;  3WA2 X;  1KQS 2;  4O8S A;  4WFO A;  2GSP A;  3N54 B;  5STD A;  1LNH A;  2CC3 A;  1STD A;  2CFL A;  2LQV A;  3GSP A;  5AYS C;  4RNZ A;  3X42 A;  1AV4 A;  1RGA A;  2L1S A;  2XFT A;  3NM7 A;  1N8Q A;  1MWT A;  1V58 A;  2W56 B;  1FGM A;  3X41 A;  4AKZ A;  3CCQ 3;  1BSA A;  3G4S 3;  2SBL A;  4LEH A;  1N5P A;  3Q3F A;  3ZFZ A;  1IU7 A;  4XB5 A;  2P0X A;  3DY5 A;  3NQY A;  1DYU A;  4FMB A;  1Q42 A;  2IY2 A;  4HM5 B;  5FW5 A;  1UI7 A;  5CK6 A;  1YI2 3;  1TUH A;  1GSP A;  2R41 A;  1RN1 A;  3PCR A;  3MWZ A;  3T8N A;  1W5Z A;  1AR0 A;  3X3Z A;  1JJ2 2;  2HML B;  4BL2 A;  1O7W B;  5G2G A;  1MWS A;  2CX0 A;  1B21 A;  1B20 A;  3DGM A;  4J9A A;  5JPU A;  1YGE A;  3D5G A;  4G1M B;  3S27 A;  1Q81 4;  4LZI A;  2CW9 A;  2KRT A;  2Q07 A;  3WHO A;  4BTW A;  4H61 A;  5IG5 A;  3U1W A;  2V1L A;  1RCK A;  3HX8 A;  3EF8 A;  1A2P A;  1FUT A;  3T8U A;  3UL6 A;  2YFL B;  3DUK A;  3EBY A;  5G1L A;  1GMP A;  2B1X B;  1BVI A;  2CWU A;  2K3D A;  2XRX B;  3DXO A;  1I70 A;  3KSP A;  1JBT A;  1DMQ A;  2FXT A;  3GAX A;  4LGQ A;  2ML5 A;  1TFO A;  4N6M A;  5KP1 A;  3G71 3;  3CCM 3;  2P38 A;  1E3V A;  4HAA A;  1OAC A;  2ZDJ A;  2SAR A;  1WMO A;  1JB5 A;  3AGN A;  2HMJ B;  4X2H A;  3KII A;  2RFR A;  4OVM A;  3V99 A;  3LH4 A;  4CPK A;  3I56 3;  3GWR A;  5KP4 A;  2QEX 3;  3K5T A;  1KD1 4;  1D6Z A;  3NV0 B;  5EEO A;  5A0O B;  4K1V A;  1CEW I;  4KZ1 A;  4J8T A;  3GZX B;  3BU4 A;  1T5Y A;  1YVS A;  4CCV A;  1RGC A;  3FF2 A;  1QJG A;  2I9W A;  2Y73 A;  2BMR B;  1KWI A;  4FCM A;  2ML6 A;  3BND A;  1NWW A;  3OXA A;  4K61 A;  1FGQ A;  2H0I A;  1VQK 3;  4KFD A;  4QWT A;  7RNT A;  1IT8 A;  1BRJ A;  1PU4 A;  5TGN A;  2CFG A;  1QAL A;  1WTH A;  2GXF A;  4WYK B;  1ULI B;  2IA7 A;  1AVL A;  2Y74 A;  1ASK A;  2P05 A;  4R9K A;  2GEY A;  2P0M A;  3SVA A;  3ZG5 A;  1IQX A;  4NRE A;  1O7P B;  3Q1C A;  2GU1 A;  2RSX A;  3X40 A;  5IER A;  2OTL 3;  1JKG B;  1UDI I;  2O9U X;  1GS3 A;  2W6J H;  1BAN A;  3PCS A;  4L7K A;  3X3X A;  1RKY A;  3SOY A;  1FW7 A;  2BO9 B;  5IG0 A;  1O7H B;  4R9L A;  1I0V A;  3FSD A;  2AAE A;  1R4C A;  1QVF 2;  4FMA A;  1RSN A;  3BIR A;  1F8N A;  1BAO A;  1D6Y A;  4HKV B;  5BVB A;  2W9P A;  3JUP A;  3NBB A;  2CH9 A;  1EUI C;  3HK4 A;  1LOY A;  1N8R 4;  4N6U A;  4HOH A;  3RDE A;  3ROB A;  4R80 A;  4Q53 A;  5EVH A;  1Z1S A;  2Z7A A;  4LMI A;  4N6T A;  4OUQ A;  1YIJ 3;  3ER7 A;  3LXU X;  1PFP A;  5FGO A;  1DMM A;  1TJD A;  4AEQ A;  3WA3 A;  3AMO B;  1V57 A;  3MHE A;  1OH0 A;  4GSP A;  1LVN A;  2XF3 A;  1NNV A;  3S5C A;  1QAK A;  3OWY A;  3CCL 3;  3MG2 A;  1O7N B;  5ELU A;  1TTO A;  2GU3 A;  1LOW A;  2W0Q A;  3CXC 2;  1G0T A;  2YFJ B;  2UUG C;  4ORL A;  1IV9 A;  2W04 A;  1VQ7 3;  1UGH I;  3CCU 3;  5EQL A;  4H3U A;  4MMZ B;  9RNT A;  3EC9 A;  4WWU C;  1B2X A;  1B27 A;  1BSB A;  1T2H A;  1W02 A;  2JDI H;  2OOV A;  2QIY A;  1OF5 A;  1ROV A;  1VQ6 3;  3M8C A;  1TIJ A;  1TRP A;  3WOE B;  4KFF A;  1KSI A;  5RNT A;  3F8X A;  1YIT 3;  5AIH A;  1IV7 A;  2C10 A;  3G0K A;  2YX9 A;  4NPB A;  1SQW A;  4EBG A;  1MWR A;  1J2B A;  3KZT A;  1A2V A;  3SYU A;  1RLS A;  5D81 A;  3FKA A;  4MMX B;  2OCT A;  4BL3 A;  1VQL 3;  3SOA A;  1C54 A;  1W01 A;  4HVN A;  4XDV A;  3CCR 3;  2CFD A;  4HBR A;  1M9G A;  3CPO A;  3MYT A;  1PYL A;  4HM4 B;  3KN4 A;  3STD A;  4CDL A;  2BT3 A;  2D1W A;  2RBI A;  3CD6 3;  1ZGX A;  1NJI 4;  1SIH A;  2UGI A;  1TU5 A;  3NBJ A;  1GY5 A;  3ZG0 A;  1VQ5 3;  1M1K 4;  2GEX A;  7STD A;  3K9M C;  3VF1 A;  3T0U A;  2XEP A;  3LT8 A;  3FH1 A;  4PEJ A;  2F98 A;  1NB3 I;  2B24 B;  3D4A A;  4HZB B;  1A90 A;  3QK9 A;  1RGK A;  2K0M A;  5IEO A;  3LT9 A;  3DGY A;  4OK0 A;  3V98 A;  3PGB A;  3PZW A;  3F8H A;  4EV5 A;  5CXO A;  1IVW A;  3KKG A;  3S28 A;  2OQE C;  3DGL A;  3LTC A;  5BXQ A;  3CCE 3;  1MGW A;  1MNL A;  4LSO A;  3NM2 A;  1HZ1 A;  1IT7 A;  1JRQ A;  2WOH A;  3HI7 A;  4FMD A;  2BIR A;  1EG9 B;  3BLZ A;  3NXJ A;  3X3Y A;  1UGI A;  1BGS A;  1BSD A;  1JN5 B;  3B8L A;  2BNG A;  1ULJ B;  1GY7 A;  3FF0 A;  1VQ8 3;  2QGU A;  5LC7 A;  4AKY A;  1WMP A;  3LTA A;  3JUQ A;  1DET A;  1QAF A;  2O3O A;  1UUG B;  3BNE A;  4KVH A;  1OGZ A;  1HKX A;  3AHS A;  3OWU A;  4NHF A;  3AHW A;  1SPU A;  1IQ8 A;  1B3S A;  1I0X A;  1FA3 A;  1BRK A;  1IVU A;  1Q40 B;  5CF2 A;  3FLJ A;  4RZM A;  1UCI A;  4IT7 A;  1VQQ A;  1BNS A;  1RGH A;  1BNI A;  2C11 A;  2ZHX B;  2HMN B;  4XBY A;  2ZL8 A;  4FCZ A;  1BIR A;  1GYB A;  1O7M B;  5AIF A;  1BRH A;  4BTY A;  1K73 4;  4MJD A;  3DZL A;  3NV0 A;  3FZW A;  5DRV A;  1BNE A;  4BIR A;  8RNT A;  1M90 4;  4HJL B;  1IQY A;  4BU4 A;  1EQK A;  5AIG A;  3F7S A;  3IJE B;  5D82 A;  4N6N B;  1C7H A;  1RDS A;  3K0Z A;  3I55 3;  1UW1 A;  1VQO 3;  2H0H A;  1CYU A;  3FG3 A;  3WMD A;  1U5O A;  1YJ9 3;  2WO0 A;  3SXX A;  3K7C A;  1BUJ A;  3NQZ A;  4K90 B;  2MF7 A;  5IEN A;  5JPP A;  2L4V A;  3OW2 2;  4HYZ A;  1FUS A;  3EX9 A;  4IIA A;  1W4N A;  2XSO B;  3BNC A;  6RNT A;  2CKF B;  3B4O A;  2KF6 A;  3D9R A;  3EQQ B;  1VQM 3;  3D5I A;  1WNH A;  3RGA A;  1JB4 A;  1ZO2 A;  1B2M A;  1JZO A;  3V92 A;  1UCJ A;  2CX1 A;  3CNM A;  3FCS B;  1BSC A;  3S29 A;  1ISK A;  1GD3 A;  3WDG B;  2IUK A;  1STF I;  2HMO B;  1JB2 A;  1Q7Y 4;  1IYY A;  4N6O B;  3UJM A;  3QRD A;  1YHQ 3;  1UCL A;  1V74 A;  1GY6 A;  5I97 A;  1OPY A;  1I3I A;  4EYC A;  3WR2 A;  1RN4 A;  1JZD A;  5CLK A;  2J8X B;  1YJN 3;  2GBW B;  3KE7 A;  1W2B 2;  2STD A;  3E99 A;  3EBT A;  3MKI A;  1L5G B;  5HOH A;  3VSY A;  4RNY A;  5LC6 A;  5IEP A;  3JVC A;  1U8C B;  4GB5 A;  4N6L A;  1NB5 I;  4X2O A;  3CU3 A;  3FG4 A;  3DGO A;  4EW5 A;  4L8P A;  1A2K A;  3A5E A;  1GMR A;  4GL6 A;  3ECF A;  3HII A;  1RMS A;  1G96 A;  3GZB A;  4LYL B;  4N6V 0;  2Z6B A;  3URP A;  1MWU A;  2CHC A;  2CG0 A;  2BMO B;  3K63 A;  5G1K A;  1YJW 3;  2LYX A;  3AMO A;  5JBS A;  5M19 A;  1Q9E A;  2FGT A;  4ZM8 A;  3CPW 2;  1RHL A;  1W6C A;  3F7X A;  5AI1 A;  1CQS A;  2Z77 A;  5IG3 A;  3CCV 3;  3DM8 A;  1NDO B;  3JUO A;  4I5Q A;  1LOX A;  5IW9 A;  3VGN A;  8CHO A;  3DMC A;  3CC7 3;  4WP5 A;  1AVK A;  3TDG A;  2IMJ A;  2F56 A;  2PNC A;  1IK3 A;  3U97 A;  3G6E 3;  3D3L A;  2C4B A;  2INX A;  1W2Z A;  3EB8 A;  4RBN A;  3UL5 A;  4FR9 A;  1E97 A;  1M1X B;  1TFK A;  1BOX A;  1N9J A;  1B2U A;  4HZ9 B;  1BRN L;  1BRS A;  1DVC A;  3S67 A;  1UUV B;  4EC6 A;  4XM4 A;  5AII A;  1FGR A;  3KFQ C;  3PXM A;  1IVV A;  3H51 A;  4R1K A;  5IF6 A;  4XDW A;  1X1Y A;  1G02 A;  1FGT A;  4CJN A;  5M1A A;  1NO3 A;  1RGF A;  1RNB A;  2W56 A;  2Z76 A;  4L8O A;  1X1X A;  3Q90 A;  3LOY A;  3BNB A;  3JUN A;  4O3V A;  1N9E A;  1TRQ A;  3UNL A;  3D79 A;  1GD4 A;  4K1U A;  2KF4 A;  4XBX A;  2AAD A;  1EEJ A;  1RCL A;  4JRF A;  2F5M A;  1FUW A;  1YVB I;  1YGW A;  1CH0 A;  3GZY B;  7GSP A;  4HM0 B;  5BIR A;  4IPB A;  1UI8 A;  1QVG 2;  3I0Y A;  2OTJ 3;  1K41 A;  1LXE A;  2E2V A;  2CG1 A;  1RGE A;  1OCV A;  3B4P A;  4MEI A;  3WOD G;  3CNX A;  4EV2 A;  2HMK B;  5ELJ A;  3CME 3;  3JUM A;  1JNQ A;  5AEW B;  1I3F A;  1NU3 A;  2M7O A;  4ILF A;  3UB1 A;  5M18 A;  1DE3 A;  3WOF B;  2E2U A;  3IMA B;  3L0R A;  3F9S A;  2F86 B;  1BSE A;  3NBR A;  3Q2P A;  1I2E A;  2RCD A;  4J5G A;  1VQ4 3;  1SJW A;  2XSH B;  3FGY A;  1K28 A;  4GHO A;  2BMQ B;  3KSE D;  3GRD A;  5AEU B;  3CMA 3;  2MC8 A;  1LNI A;  5IG4 A;  1JBS A;  1SAR A;  1I2G A;  3PYJ A;  2BHM A;  5HGR A;  1YNV X;  4RNT A;  2OQE A;  3LTB A;  1B2Z A;  1GOY A;  1FYS A;  1QMA A;  1JN5 A;  1FGO A;  1RNT A;  1T2I A;  2E2T A;  3MPH A;  3EHC A;  1I2F A;  3HZP A;  2FNQ A;  5KP3 A;  1ROA A;  2F99 A;  2PZV A;  3FG1 A;  3LTD A;  4XBT A;  3CC2 3;  1Q7H A;  3DH2 A;  1OHO A;  1GMQ A;  1OUN A;  1S5A A;  3EJV A;  2BU4 A;  3GZR A;  4HM6 B;  3CC4 3;  4O02 B;  3SX1 A;  2HMM B;  3CCJ 3;  6GSP A;  2W9Q A;  1GOV A;  1W6G A;  1LRA A;  1I8V A;  1HYF A;  1VQ9 3;  1MGR A;  1PY3 A;  3RGR A;  4FMC A;  1HU9 A;  1Q40 A;  1OGX A;  2P09 A;  2IUJ A;  1T3B A;  1O7G B;  1X1W A;  2W2C A;  2H0G A;  2XGN A;  4R4K A;  3HIG A;  3J7Y d;  1W00 A;  3B7C A;  2XGL A;  3PS8 A;  1BNR A;  1ZX2 A;  3DGN A;  2YFI B;  1AQZ A;  2IYJ A;  2GBX B;  1R4Y A;  2D42 A;  3AGO A;  3EN1 B;  3OWS A;  1N5H A;  1UCK A;  4HM7 B;  1A67 A;  4HM3 B;  3SED A;  2ZA4 A;  4WYK A;  3LYG A;  1KC8 4;  1VQP 3;  4WHA A;  1LQG C;  1GOU A;  5D83 A;  3MSO A;  2CFK A;  1US1 A;  1TP6 A;  2OWP A;  3OV4 A;  3ALA A;  3SLU A;  1Q86 4;  1JKG A;  4BTX A;  3CCS 3;  2CFW A;  1VQN 3;  4HM1 B;  1RN7 A;  4JF8 A;  3IPT A;  3LML A;  1DMN A;  2KAA A;  1RGL A;  2RGQ A;  1CYV A;  2KCD A; 
#chains in the Genus database with same CATH homology
 3F40 A;  4TX4 A;  1Q82 4;  3BB9 A;  3EE1 A;  2R4I A;  4O2H A;  1K9M 4;  2WOF A;  4MMY B;  3MG3 A;  3N8B A;  2CIU A;  1OHP A;  1EKM A;  2CWV A;  4EXR A;  3N9H A;  1MOL A;  1VZZ A;  3F14 A;  4FCJ A;  2XFS A;  2KXG A;  3LZA A;  5AYR B;  3NHX A;  1BUQ A;  1OHS A;  1RRL A;  3A76 A;  4U13 A;  4N3V A;  1WMN A;  2OOV C;  1EA2 A;  3MG1 A;  1DVD A;  6STD A;  3G8Z A;  3G16 A;  2CK3 H;  1D6U A;  1WQL B;  4HM2 B;  1K8A 4;  1E3R A;  1OF5 B;  2WGQ A;  4STD A;  2XH9 A;  1RRH A;  1S72 3;  2UX0 A;  2CWT A;  5DRE A;  2QA4 3;  5CF1 A;  3O8Y A;  2A15 A;  1W7C A;  1UUW B;  1SII A;  1Y4K A;  2K54 A;  3OX9 A;  2WGO A;  4I4K A;  3EN8 A;  2XR8 B;  1JV2 B;  2W03 A;  4KFE A;  1IDP A;  1W6Y A;  3H3H A;  3NUV A;  1RJO A;  3NX0 A;  4HM8 B;  2JQ5 A;  3WA2 X;  1KQS 2;  4O8S A;  4WFO A;  3N54 B;  5STD A;  1LNH A;  2CC3 A;  1STD A;  2CFL A;  2LQV A;  5AYS C;  4RNZ A;  3X42 A;  1AV4 A;  2XFT A;  3NM7 A;  1N8Q A;  2W56 B;  1FGM A;  3X41 A;  4AKZ A;  3CCQ 3;  3G4S 3;  2SBL A;  4LEH A;  1N5P A;  1IU7 A;  4XB5 A;  2P0X A;  3DY5 A;  3NQY A;  1DYU A;  4FMB A;  1Q42 A;  4HM5 B;  5FW5 A;  1UI7 A;  5CK6 A;  1YI2 3;  1TUH A;  3PCR A;  3MWZ A;  3T8N A;  1W5Z A;  1AR0 A;  3X3Z A;  1JJ2 2;  2HML B;  1O7W B;  5G2G A;  5JPU A;  3DGM A;  4J9A A;  1YGE A;  4G1M B;  3S27 A;  1Q81 4;  4LZI A;  2CW9 A;  2KRT A;  2Q07 A;  4BTW A;  4H61 A;  5IG5 A;  3U1W A;  2V1L A;  3HX8 A;  3EF8 A;  3T8U A;  3UL6 A;  2YFL B;  3DUK A;  3EBY A;  2B1X B;  2CWU A;  2XRX B;  3DXO A;  3KSP A;  1DMQ A;  2FXT A;  3GAX A;  4LGQ A;  2ML5 A;  1TFO A;  4N6M A;  5KP1 A;  3G71 3;  3CCM 3;  2P38 A;  1E3V A;  1OAC A;  2ZDJ A;  1WMO A;  1JB5 A;  2HMJ B;  4X2H A;  3KII A;  2RFR A;  4OVM A;  3V99 A;  3LH4 A;  3I56 3;  3GWR A;  5KP4 A;  2QEX 3;  3K5T A;  1KD1 4;  1D6Z A;  3NV0 B;  5EEO A;  5A0O B;  4K1V A;  1CEW I;  4KZ1 A;  4J8T A;  3GZX B;  1T5Y A;  4CCV A;  3FF2 A;  1QJG A;  2I9W A;  2Y73 A;  2BMR B;  1KWI A;  4FCM A;  2ML6 A;  3BND A;  1NWW A;  3OXA A;  4K61 A;  1FGQ A;  1VQK 3;  4KFD A;  4QWT A;  1IT8 A;  1PU4 A;  5TGN A;  2CFG A;  1QAL A;  1WTH A;  2GXF A;  4WYK B;  1ULI B;  2Y74 A;  1AVL A;  2IA7 A;  1ASK A;  2P05 A;  4R9K A;  2GEY A;  2P0M A;  3SVA A;  1FUW A;  1IQX A;  4NRE A;  1O7P B;  3Q1C A;  2GU1 A;  2RSX A;  3X40 A;  5IER A;  2OTL 3;  1JKG B;  2O9U X;  2W6J H;  1GS3 A;  3PCS A;  3X3X A;  4L7K A;  1RKY A;  3SOY A;  2BO9 B;  5IG0 A;  1O7H B;  4R9L A;  3FSD A;  1R4C A;  1QVF 2;  4FMA A;  1F8N A;  1D6Y A;  4HKV B;  5BVB A;  2W9P A;  3JUP A;  3NBB A;  2CH9 A;  3HK4 A;  1N8R 4;  4N6U A;  3RDE A;  3ROB A;  4R80 A;  4Q53 A;  5EVH A;  1Z1S A;  2Z7A A;  4LMI A;  4N6T A;  4OUQ A;  1YIJ 3;  3ER7 A;  3LXU X;  1PFP A;  5FGO A;  1DMM A;  3WA3 A;  4AEQ A;  3AMO B;  3MHE A;  1OH0 A;  1LVN A;  2XF3 A;  3S5C A;  1QAK A;  3OWY A;  3CCL 3;  3MG2 A;  1O7N B;  5ELU A;  2GU3 A;  2W0Q A;  3CXC 2;  2YFJ B;  4ORL A;  1IV9 A;  2W04 A;  1VQ7 3;  3CCU 3;  5EQL A;  4H3U A;  4MMZ B;  3EC9 A;  4WWU C;  1W02 A;  2JDI H;  2OOV A;  2QIY A;  1OF5 A;  1ROV A;  1VQ6 3;  3M8C A;  1TIJ A;  3WOE B;  4KFF A;  1KSI A;  1YIT 3;  3F8X A;  5AIH A;  1IV7 A;  2C10 A;  3G0K A;  2YX9 A;  1J2B A;  1SQW A;  4EBG A;  3KZT A;  1A2V A;  5D81 A;  3FKA A;  4MMX B;  2OCT A;  1VQL 3;  3SOA A;  1W01 A;  4HVN A;  4XDV A;  3CCR 3;  2CFD A;  4HBR A;  1M9G A;  3CPO A;  3MYT A;  3STD A;  4HM4 B;  3KN4 A;  4CDL A;  2BT3 A;  2D1W A;  3CD6 3;  1NJI 4;  1SIH A;  1TU5 A;  3NBJ A;  1GY5 A;  1VQ5 3;  1M1K 4;  2GEX A;  7STD A;  3K9M C;  3VF1 A;  3T0U A;  2XEP A;  3LT8 A;  3FH1 A;  4PEJ A;  2F98 A;  1NB3 I;  2B24 B;  4HZB B;  1A90 A;  3QK9 A;  2K0M A;  5IEO A;  3LT9 A;  4OK0 A;  3V98 A;  3PGB A;  3PZW A;  3F8H A;  4EV5 A;  5CXO A;  1IVW A;  3KKG A;  3S28 A;  2OQE C;  3DGL A;  3LTC A;  5BXQ A;  3CCE 3;  1MNL A;  4LSO A;  3NM2 A;  1IT7 A;  1JRQ A;  2WOH A;  3HI7 A;  4FMD A;  3BLZ A;  1EG9 B;  3NXJ A;  3X3Y A;  1JN5 B;  3B8L A;  2BNG A;  1ULJ B;  1GY7 A;  3FF0 A;  1VQ8 3;  2QGU A;  5LC7 A;  4AKY A;  1WMP A;  3LTA A;  3JUQ A;  1QAF A;  2O3O A;  3BNE A;  4KVH A;  1OGZ A;  1HKX A;  3OWU A;  4NHF A;  1SPU A;  1IQ8 A;  1FA3 A;  1IVU A;  1Q40 B;  5CF2 A;  3FLJ A;  4RZM A;  4IT7 A;  2C11 A;  2HMN B;  4XBY A;  2ZL8 A;  4FCZ A;  1GYB A;  1O7M B;  5AIF A;  4BTY A;  1K73 4;  4MJD A;  3DZL A;  3NV0 A;  3FZW A;  5DRV A;  1M90 4;  4HJL B;  1IQY A;  1EQK A;  5AIG A;  3F7S A;  3IJE B;  5D82 A;  4N6N B;  1C7H A;  3I55 3;  3K0Z A;  1VQO 3;  1UW1 A;  1CYU A;  3FG3 A;  3WMD A;  1U5O A;  1YJ9 3;  2WO0 A;  3SXX A;  3K7C A;  3NQZ A;  4K90 B;  2MF7 A;  5IEN A;  5JPP A;  2L4V A;  3OW2 2;  4HYZ A;  4IIA A;  3EX9 A;  1W4N A;  2XSO B;  3BNC A;  2CKF B;  3B4O A;  3D9R A;  3EQQ B;  1VQM 3;  3RGA A;  1WNH A;  1JB4 A;  1ZO2 A;  3V92 A;  3CNM A;  3FCS B;  3S29 A;  1ISK A;  1GD3 A;  3WDG B;  2IUK A;  1STF I;  2HMO B;  1JB2 A;  1Q7Y 4;  4N6O B;  3UJM A;  3QRD A;  1YHQ 3;  1V74 A;  1GY6 A;  5I97 A;  1OPY A;  4EYC A;  5CLK A;  1YJN 3;  2GBW B;  3KE7 A;  1W2B 2;  2STD A;  3E99 A;  3EBT A;  3MKI A;  1L5G B;  3VSY A;  4RNY A;  5LC6 A;  5IEP A;  3JVC A;  1U8C B;  4GB5 A;  4N6L A;  1NB5 I;  4X2O A;  3CU3 A;  3FG4 A;  3DGO A;  4L8P A;  1A2K A;  4GL6 A;  3ECF A;  3HII A;  1G96 A;  3GZB A;  4N6V 0;  2Z6B A;  3K63 A;  2CHC A;  2CG0 A;  2BMO B;  1YJW 3;  2LYX A;  3AMO A;  5JBS A;  2FGT A;  4ZM8 A;  3CPW 2;  3F7X A;  1W6C A;  5AI1 A;  1CQS A;  2Z77 A;  5IG3 A;  3CCV 3;  3DM8 A;  1NDO B;  3JUO A;  1LOX A;  5IW9 A;  3VGN A;  8CHO A;  3DMC A;  3CC7 3;  4WP5 A;  1AVK A;  3TDG A;  2IMJ A;  2PNC A;  1IK3 A;  3U97 A;  3G6E 3;  3D3L A;  2INX A;  1W2Z A;  3EB8 A;  4RBN A;  3UL5 A;  4FR9 A;  1E97 A;  1M1X B;  1TFK A;  1N9J A;  4HZ9 B;  1DVC A;  3S67 A;  1UUV B;  4EC6 A;  4XM4 A;  5AII A;  1FGR A;  3KFQ C;  3PXM A;  1IVV A;  3H51 A;  4R1K A;  5IF6 A;  4XDW A;  1FGT A;  1NO3 A;  2W56 A;  2Z76 A;  4L8O A;  3Q90 A;  3LOY A;  3BNB A;  3JUN A;  4O3V A;  1N9E A;  3UNL A;  1GD4 A;  4K1U A;  4XBX A;  4JRF A;  1YVB I;  3GZY B;  4HM0 B;  4IPB A;  1UI8 A;  1QVG 2;  3I0Y A;  2OTJ 3;  1K41 A;  1LXE A;  2E2V A;  2CG1 A;  1OCV A;  3B4P A;  4MEI A;  3WOD G;  3CNX A;  4EV2 A;  2HMK B;  5ELJ A;  3CME 3;  3JUM A;  1JNQ A;  5AEW B;  1NU3 A;  2M7O A;  3UB1 A;  3WOF B;  2E2U A;  3IMA B;  3L0R A;  3F9S A;  2F86 B;  3NBR A;  3Q2P A;  2RCD A;  1VQ4 3;  1SJW A;  2XSH B;  3FGY A;  1K28 A;  2BMQ B;  3KSE D;  3GRD A;  5AEU B;  3CMA 3;  2MC8 A;  5IG4 A;  3PYJ A;  2BHM A;  5HGR A;  2OQE A;  3LTB A;  1QMA A;  1JN5 A;  1FGO A;  2E2T A;  3MPH A;  3EHC A;  3HZP A;  5KP3 A;  2FNQ A;  1ROA A;  2F99 A;  2PZV A;  3FG1 A;  3LTD A;  4XBT A;  3CC2 3;  1OHO A;  1OUN A;  3EJV A;  1S5A A;  3GZR A;  3CC4 3;  4HM6 B;  4O02 B;  3SX1 A;  2HMM B;  3CCJ 3;  2W9Q A;  1W6G A;  1VQ9 3;  3RGR A;  4FMC A;  1HU9 A;  1Q40 A;  1OGX A;  2P09 A;  2IUJ A;  1O7G B;  2W2C A;  2XGN A;  4R4K A;  3HIG A;  3J7Y d;  1W00 A;  3B7C A;  2XGL A;  3PS8 A;  1ZX2 A;  3DGN A;  2YFI B;  2GBX B;  2D42 A;  3EN1 B;  3OWS A;  1N5H A;  4HM7 B;  1A67 A;  4HM3 B;  3SED A;  4WYK A;  3LYG A;  1KC8 4;  1VQP 3;  4WHA A;  5D83 A;  3MSO A;  2CFK A;  2OWP A;  1US1 A;  1TP6 A;  3OV4 A;  3ALA A;  3SLU A;  1Q86 4;  1JKG A;  4BTX A;  3CCS 3;  2CFW A;  1VQN 3;  4HM1 B;  1RN7 A;  4JF8 A;  3IPT A;  3LML A;  1DMN A;  1IVX A;  2RGQ A;  1CYV A;  2KCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...