2L1SA

Yp_001336205.1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
GAAGIDQYALKEFTADFTQFHIGDTVPAMYLTPEYNIKQWQQRNLPAPDAGSHWTYMGGNYVLITDTEGKILKVYDGEIFYHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein yohN
publication title NMR structure of the Klebsiella pneumoniae protein YP_001336205
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
total genus 16
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11776 RcnB Nickel/cobalt transporter regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.160 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, inner membrane protein cigr 2l1sA00
2L1SA 4EW5A
chains in the Genus database with same CATH superfamily
1YJN3 1OF5B 5JPUA 1PFPA 2QGUA 3RGRA 1BRNL 1ASKA 3EE1A 3F14A 2FGTA 2C11A 1IT7A 2BMRB 2GU1A 3N9HA 1HZ1A 3VF1A 2BHMA 1BRIA 1OACA 1W7CA 3ZG5A 2UX0A 3CC43 2L4VA 1VQN3 2XRXB 3IPTA 3F8XA 4LMIA 2OOVA 1FA3A 2W6JH 2RBIA 2ZL8A 3FG3A 2GEYA 4WP5A 1OPYA 1BU4A 4WYKA 3DY5A 5G1LA 3UB1A 4ILFA 1UUVB 4AKYA 1N5HA 1GOVA 2GXFA 8CHOA 3UL6A 3CNMA 4KFFA 1S5AA 1UCLA 5D83A 5AIIA 2KXGA 2INXA 1Z1SA 1FZUA 2L1SA 4Q53A 3AMOA 3CC73 1E3RA 1T2HA 1I0XA 3ZFZA 1VQ63 1CQSA 2P05A 1RLSA 3STDA 1WMOA 3AHSA 1OUNA 3JUOA 2QEX3 3HX8A 1RGLA 3G0KA 1QJGA 3S28A 1IT8A 2XFTA 3LTCA 1EKMA 4RZMA 3CCR3 1IVXA 4L8PA 1RGHA 1ZO2A 1OHOA 5STDA 1JB2A 1W6YA 2F86B 2RGQA 4KFDA 1VQM3 3GWRA 1J2BA 2SBLA 1GY7A 1CEWI 3GZYB 1A2KA 1VQL3 2KCDA 3E99A 1RGAA 4GB5A 1NO3A 3VGNA 1O7GB 4LYLB 1FGOA 1M9GA 1W2ZA 3QRDA 4K61A 1DETA 4FMDA 3LTBA 2Z6BA 3LXUX 2OCTA 3IMAB 3D5IA 2W9PA 3DZLA 2UUGC 2Y74A 4LSOA 1LQMB 1ROVA 4BL3A 1I2FA 3URPA 1X1WA 3BNEA 2W0QA 5HOHA 1IK3A 1KC84 2P09A 1BIRA 4FCZA 1B27A 1JKGB 1TIJA 1WTHA 1A67A 3DH2A 5FGOA 5IG3A 2RSXA 4IT7A 2P0MA 5AEUB 2O3OA 7GSPA 5KP4A 2XGLA 5CK6A 1YJW3 4HKVB 3X40A 2HMOB 1U8CB 3CC23 1W02A 1E3VA 3NX0A 4TX4A 5BVBA 1VZZA 1KQS2 1BNEA 3DXOA 1OGZA 3MKIA 3A76A 4EXRA 4HM8B 1RKYA 3G6E3 1JN5A 5HGRA 2XF3A 1NJI4 3CCJ3 3UNLA 1A2PA 1QAKA 3FZWA 1FGQA 1X1YA 3Q90A 4WWUC 5CXOA 4KFEA 2CFLA 2CX0A 1ULJB 3X3YA 2O9UX 3D79A 4NPBA 3SX1A 1OHPA 2F56A 3G16A 3V99A 4HAAA 1IV7A 4OUQA 1W5ZA 2FNQA 3FF2A 3GZXB 2ZA4A 4RNYA 5FW5A 1QALA 3HK4A 3I0YA 1WNHA 2AAEA 3MG1A 4FMAA 3T0UA 1CYVA 1AV4A 2W04A 3HIGA 1G96A 1TU5A 2OOVC 3OX9A 4AEQA 4MEIA 1B2ZA 1VQQA 2BIRA 3K7CA 1VQ43 1VQ93 1DMNA 4GL6A 2IMJA 5G1KA 3Q3FA 3BNBA 2KRTA 5BIRA 3D3LA 1B21A 1SIHA 1DMQA 1SPUA 3BNDA 3F7SA 4IPBA 1MGRA 3LH4A 3CME3 3MPHA 4L7KA 1QAFA 2BMQB 1O7WB 7RNTA 3I563 1RGFA 3KE7A 4FCJA 1L5GB 2MC8A 1V57A 1PYLA 1RHLA 5DREA 2BNGA 1I8VA 4BU4A 2LQVA 1HKXA 1UGIA 4CJNA 8RNTA 3CCL3 3WA2X 1OH0A 1IYYA 1RRHA 1B2SA 5RNTA 2RNTA 2CIUA 1K28A 3PZWA 4FCMA 3H51A 3JUQA 4J5GA 1WQLB 1RSNA 2M7OA 4WFOA 2W9QA 2JDIH 4NREA 1I2GA 1BSEA 1OHSA 1K734 3OV4A 1K8A4 1AVLA 1LQGC 2F5WA 3OXAA 4WHAA 5JBSA 1W4NA 5M1AA 1JZOA 4R9LA 4JF8A 1RGCA 2H0IA 3NV0A 2OTJ3 1YHQ3 1LNIA 3WDGB 4HYZA 4RNTA 3S67A 1M904 1UGHI 1BRHA 3EQQB 3GRDA 4BL2A 1GY6A 2E2VA 5IG0A 1I70A 1FW7A 1DE3A 1BNGA 4HM4B 3DUKA 1N8QA 2CKFB 3NXJA 1GY5A 2LYXA 1FGRA 1YJ93 2W03A 3KCHA 5AIFA 3N54B 4XDWA 5D82A 3CNXA 3B7CA 1RRLA 2WGOA 4I4KA 3F9SA 1G02A 1N5PA 1D6YA 3GSPA 3GZBA 3G4S3 3CMA3 3CD63 2CK3H 3PXMA 1V74A 2CWUA 1GOUA 1IQXA 1T5YA 3S29A 3CCV3 1TJDA 4GHOA 2WOFA 4MJDA 3ZG0A 2QA43 1IQ8A 4J5KA 1YVBI 1FYSA 2BT3A 2Q07A 3O8YA 1BNFA 1GMRA 3HIIA 1Q824 1FUSA 1VQP3 4WYKB 2YFJB 3V92A 3NQYA 1FUTA 1BSAA 2CH9A 5EVHA 3U1WA 2SARA 4LGQA 2STDA 1JBSA 1YVSA 1UCKA 1C54A 5IEOA 1RNBA 2CFWA 1EQKA 3AMOB 1UW1A 4RBNA 3NQZA 1A90A 1V58A 2XFSA 1GOYA 1DYUA 1T2IA 4HM6B 5BU4A 3UJMA 3LYGA 3ER7A 4XBTA 1IV9A 3KIIA 3QK9A 2D1WA 5AI1A 3AGNA 5GSPA 3S27A 2B24B 4K1UA 1Q814 1JB4A 1TTOA 4H61A 1CYUA 2GBXB 3EB8A 2IUKA 4XBXA 1RGEA 2GEXA 2BU4A 1I3FA 5M18A 2R4IA 3EX9A 1JJ22 1VQ73 2BO9B 2XH9A 2WGQA 4MMZB 1EG9B 3DGMA 1TRPA 4HM7B 1K41A 3EBYA 3X3XA 1O7PB 1ROAA 1ZX2A 2OQEA 3NBJA 2F4YA 3PYJA 1JV2B 1GS3A 4HBRA 1IQYA 5CF1A 3FLJA 2IY2A 1BGSA 1ISKA 1NB3I 5M19A 1UI7A 5ELJA 1TRQA 2CWTA 2BMOB 1GMPA 1RMSA 4U13A 3CCS3 1RN1A 3ECFA 1UI8A 3MG2A 3OWSA 1VQ83 2WOHA 3KSPA 4X2OA 1C7HA 1Q7Y4 1NWWA 3JVCA 1MWSA 1T3BA 1TUHA 1I3IA 5CF2A 3PGBA 3MSOA 1SQWA 4GSPA 4STDA 1Q9EA 4XB5A 3Q2PA 1ZS7A 1IVVA 4LEHA 2CW9A 5JPPA 3WMDA 4HM2B 5KP3A 2K0MA 3N8BA 3BB9A 1MWUA 1JN5B 3KN4A 3L0RA 1LOYA 1Y4KA 2CFDA 3NHXA 3LT8A 4K1VA 2GSPA 4J8TA 4KVHA 4G1MB 1RN4A 2W56A 4X2HA 3WHOA 1PY3A 4EYCA 2OTL3 1BSDA 1Q40A 3K63A 3LOYA 1I0VA 3AGOA 5IEPA 5BXQA 1BNIA 4R9KA 5KP1A 4N6LA 3UL5A 3K9MC 2GU3A 2ML6A 5A0OB 3X42A 1BUQA 2V1LA 3G713 2XSHB 2K54A 3SVAA 3WR2A 1VQO3 1TP6A 3NM2A 4EBGA 2CHCA 2J8XB 1W6CA 1DVDA 2HMKB 3AHWA 5TGNA 1BNJA 2KF6A 3F40A 3WODG 1OGXA 3CCQ3 1AR0A 1N9JA 1SIIA 1QVF2 2XEPA 2CWVA 1U5OA 2RCDA 6GSPA 1FGTA 1BSCA 3FG4A 1R4YA 1GD3A 1D6UA 2P38A 3OWYA 1JBRA 1O7HB 3WOEB 1SARA 2CX1A 1JB5A 3EBTA 1PU4A 3EC9A 4HM1B 4HOHA 3SYUA 4XM4A 1SJWA 1LXEA 4CDLA 2CC3A 3SXXA 3CCE3 1E97A 1RGKA 3BNCA 1B2XA 1BOXA 1OF5A 1NDOB 2KF4A 1UUWB 1KD14 3EJVA 1AVKA 1LOXA 1Q42A 3X41A 1AY7A 2IYJA 3FSDA 1MOLA 1NU3A 3J7Yd 2FXTA 2C4BA 5AEWB 1O7MB 3CXC2 1IDPA 1B20A 3CPOA 4DKIA 4R4KA 1BANA 3IJEB 3FGYA 2HOHA 3MHEA 4R80A 1IVUA 2CFKA 2CG0A 3SOYA 3HZPA 1US1A 4OK0A 2OQEC 1BRJA 1F8NA 3PS8A 3EHCA 5G2GA 4N6NB 5LC6A 4XDVA 1KWIA 3NV0B 1W00A 2B1XB 4CCVA 5IF6A 2IUJA 2E2TA 3WA3A 3MYTA 4HZBB 1BSBA 1GYBA 1RCKA 1W6GA 1YIJ3 1JRQA 1W01A 1UUGB 3CU3A 1BNRA 4O3VA 1B3SA 1Q864 1JNQA 2ZHXB 1BVIA 3JUPA 1RCLA 4KZ1A 1RDSA 4N6MA 4QWTA 3NBRA 3SOAA 1BRGA 4EW5A 2MF7A 1RNTA 3FF0A 3DGNA 1B2UA 1ZGXA 1FGMA 3HI7A 4I5QA 1O7NB 4N6V0 2XR8B 2A15A 3RDEA 4CPKA 2AADA 2KAAA 3BU4A 1BRSA 3T8NA 1LOVA 5DRVA 2PNCA 1HYFA 4L8OA 4OVMA 3B8LA 2E2UA 2ML5A 5AYRB 1HU9A 2C10A 3D4AA 5IERA 1YIT3 2HMMB 3KZTA 1WMNA 2RFRA 3HOHA 1UCJA 9RNTA 1I2EA 3MWZA 2ZDJA 3Q1CA 1X1XA 3FKAA 1RJOA 1EA2A 3SEDA 2XGNA 3F8HA 4N6UA 5AIGA 3U97A 1VQ53 3LT9A 2P0XA 3K0ZA 4N6OB 3ALAA 4N6TA 5IG4A 3OW22 4BTXA 1UDII 2KF5A 1JKGA 1JZDA 2PZVA 3F7XA 3CCM3 1MNLA 1VQK3 1QVG2 1RTUA 2YFIB 4JRFA 2HMNB 3I553 4PEJA 4H3UA 3X3ZA 2KF3A 1RN7A 4N3VA 3PCRA 3RNTA 4AKZA 1TFOA 5IW9A 2F98A 1KSIA 3NM7A 4HM3B 1IVWA 1MWRA 5EEOA 5IG5A 4BTWA 2JQ5A 1BAOA 1CH0A 3M8CA 4MMYB 5D81A 1GMQA 3T8UA 3TDGA 5I97A 1EEJA 1MGWA 1W2B2 4NHFA 3DM8A 3KKGA 3S5CA 1GD4A 3KSED 3G8ZA 1BNSA 5AIHA 1JBTA 2Y73A 4XBYA 4EC6A 3CPW2 7STDA 1QMAA 1Q7HA 4R1KA 2Z77A 3SLUA 3MG3A 2Z76A 3BLZA 2F99A 2CG1A 2CFGA 2F5MA 3D9RA 2H0GA 1UCIA 3EN1B 2K3DA 1LVNA 2R41A 1YGWA 1AQZA 4MMXB 4BTYA 4J9AA 3DMCA 2Z7AA 2GBWB 4O2HA 3LTDA 4K90B 2XSOB 3LTAA 3A5EA 3JUMA 1D6ZA 4ZM8A 4FMBA 5IENA 1LNHA 3DGYA 1R4CA 3EN8A 3BIRA 3V98A 1DMMA 3KFQC 3H3HA 1A2VA 3DGLA 4HJLB 2D42A 2QIYA 1STFI 3JUNA 3K5TA 2WO0A 6STDA 4BIRA 1BUJA 3LMLA 1NB5I 1M1K4 4HVNA 1LRAA 3PCSA 2HMJB 2W2CA 3B4OA 1WMPA 1YNVX 4O8SA 5LC7A 1MWTA 3NBBA 3RGAA 2W56B 2UGIA 6RNTA 1NNVA 3B4PA 1Q40B 1YGEA 4KT3B 4RNZA 3D5GA 1N8R4 4O02B 1TFKA 4LZIA 3VSYA 1G0TA 4IIAA 3GAXA 1GSPA 2IA7A 1DVCA 5EQLA 4FMCA 1STDA 4ORLA 1N9EA 2OWPA 3WOFB 1IU7A 2YFLB 3CCU3 1S723 1M1XB 4FR9A 3DGOA 5AYSC 1BRKA 4EV2A 2H0HA 1EUIC 3OWUA 1B2MA 1FUWA 1ULIB 3NUVA 3LZAA 1LOWA 2HMLB 5CLKA 5ELUA 1OCVA 3EF8A 1RGGA 2YX9A 4HZ9B 1YI23 2I9WA 1K9M4 1X1UA 3GZRA 4EV5A 3FCSB 4HM0B 3ROBA 3FG1A 3FH1A 4HM5B
chains in the Genus database with same CATH topology
2L1SA 4EW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1S A;  4EW5 A; 
#chains in the Genus database with same CATH topology
 1YJN 3;  1OF5 B;  5JPU A;  1PFP A;  2QGU A;  3RGR A;  1BRN L;  1ASK A;  3EE1 A;  3F14 A;  2FGT A;  2C11 A;  1IT7 A;  2BMR B;  2GU1 A;  3N9H A;  1HZ1 A;  3VF1 A;  2BHM A;  1BRI A;  1OAC A;  1W7C A;  3ZG5 A;  2UX0 A;  3CC4 3;  2L4V A;  1VQN 3;  2XRX B;  3IPT A;  3F8X A;  4LMI A;  2OOV A;  1FA3 A;  2W6J H;  2RBI A;  2ZL8 A;  3FG3 A;  2GEY A;  4WP5 A;  1OPY A;  1BU4 A;  4WYK A;  3DY5 A;  5G1L A;  3UB1 A;  4ILF A;  1UUV B;  4AKY A;  1N5H A;  1GOV A;  2GXF A;  8CHO A;  3UL6 A;  3CNM A;  4KFF A;  1S5A A;  1UCL A;  5D83 A;  5AII A;  2KXG A;  2INX A;  1Z1S A;  1FZU A;  2L1S A;  4Q53 A;  3AMO A;  3CC7 3;  1E3R A;  1T2H A;  1I0X A;  3ZFZ A;  1VQ6 3;  1CQS A;  2P05 A;  1RLS A;  3STD A;  1WMO A;  3AHS A;  1OUN A;  3JUO A;  2QEX 3;  3HX8 A;  1RGL A;  3G0K A;  1QJG A;  3S28 A;  1IT8 A;  2XFT A;  3LTC A;  1EKM A;  4RZM A;  3CCR 3;  1IVX A;  4L8P A;  1RGH A;  1ZO2 A;  1OHO A;  5STD A;  1JB2 A;  1W6Y A;  2F86 B;  2RGQ A;  4KFD A;  1VQM 3;  3GWR A;  1J2B A;  2SBL A;  1GY7 A;  1CEW I;  3GZY B;  1A2K A;  1VQL 3;  2KCD A;  3E99 A;  1RGA A;  4GB5 A;  1NO3 A;  3VGN A;  1O7G B;  4LYL B;  1FGO A;  1M9G A;  1W2Z A;  3QRD A;  4K61 A;  1DET A;  4FMD A;  3LTB A;  2Z6B A;  3LXU X;  2OCT A;  3IMA B;  3D5I A;  2W9P A;  3DZL A;  2UUG C;  2Y74 A;  4LSO A;  1LQM B;  1ROV A;  4BL3 A;  1I2F A;  3URP A;  1X1W A;  3BNE A;  2W0Q A;  5HOH A;  1IK3 A;  1KC8 4;  2P09 A;  1BIR A;  4FCZ A;  1B27 A;  1JKG B;  1TIJ A;  1WTH A;  1A67 A;  3DH2 A;  5FGO A;  5IG3 A;  2RSX A;  4IT7 A;  2P0M A;  5AEU B;  2O3O A;  7GSP A;  5KP4 A;  2XGL A;  5CK6 A;  1YJW 3;  4HKV B;  3X40 A;  2HMO B;  1U8C B;  3CC2 3;  1W02 A;  1E3V A;  3NX0 A;  4TX4 A;  5BVB A;  1VZZ A;  1KQS 2;  1BNE A;  3DXO A;  1OGZ A;  3MKI A;  3A76 A;  4EXR A;  4HM8 B;  1RKY A;  3G6E 3;  1JN5 A;  5HGR A;  2XF3 A;  1NJI 4;  3CCJ 3;  3UNL A;  1A2P A;  1QAK A;  3FZW A;  1FGQ A;  1X1Y A;  3Q90 A;  4WWU C;  5CXO A;  4KFE A;  2CFL A;  2CX0 A;  1ULJ B;  3X3Y A;  2O9U X;  3D79 A;  4NPB A;  3SX1 A;  1OHP A;  2F56 A;  3G16 A;  3V99 A;  4HAA A;  1IV7 A;  4OUQ A;  1W5Z A;  2FNQ A;  3FF2 A;  3GZX B;  2ZA4 A;  4RNY A;  5FW5 A;  1QAL A;  3HK4 A;  3I0Y A;  1WNH A;  2AAE A;  3MG1 A;  4FMA A;  3T0U A;  1CYV A;  1AV4 A;  2W04 A;  3HIG A;  1G96 A;  1TU5 A;  2OOV C;  3OX9 A;  4AEQ A;  4MEI A;  1B2Z A;  1VQQ A;  2BIR A;  3K7C A;  1VQ4 3;  1VQ9 3;  1DMN A;  4GL6 A;  2IMJ A;  5G1K A;  3Q3F A;  3BNB A;  2KRT A;  5BIR A;  3D3L A;  1B21 A;  1SIH A;  1DMQ A;  1SPU A;  3BND A;  3F7S A;  4IPB A;  1MGR A;  3LH4 A;  3CME 3;  3MPH A;  4L7K A;  1QAF A;  2BMQ B;  1O7W B;  7RNT A;  3I56 3;  1RGF A;  3KE7 A;  4FCJ A;  1L5G B;  2MC8 A;  1V57 A;  1PYL A;  1RHL A;  5DRE A;  2BNG A;  1I8V A;  4BU4 A;  2LQV A;  1HKX A;  1UGI A;  4CJN A;  8RNT A;  3CCL 3;  3WA2 X;  1OH0 A;  1IYY A;  1RRH A;  1B2S A;  5RNT A;  2RNT A;  2CIU A;  1K28 A;  3PZW A;  4FCM A;  3H51 A;  3JUQ A;  4J5G A;  1WQL B;  1RSN A;  2M7O A;  4WFO A;  2W9Q A;  2JDI H;  4NRE A;  1I2G A;  1BSE A;  1OHS A;  1K73 4;  3OV4 A;  1K8A 4;  1AVL A;  1LQG C;  2F5W A;  3OXA A;  4WHA A;  5JBS A;  1W4N A;  5M1A A;  1JZO A;  4R9L A;  4JF8 A;  1RGC A;  2H0I A;  3NV0 A;  2OTJ 3;  1YHQ 3;  1LNI A;  3WDG B;  4HYZ A;  4RNT A;  3S67 A;  1M90 4;  1UGH I;  1BRH A;  3EQQ B;  3GRD A;  4BL2 A;  1GY6 A;  2E2V A;  5IG0 A;  1I70 A;  1FW7 A;  1DE3 A;  1BNG A;  4HM4 B;  3DUK A;  1N8Q A;  2CKF B;  3NXJ A;  1GY5 A;  2LYX A;  1FGR A;  1YJ9 3;  2W03 A;  3KCH A;  5AIF A;  3N54 B;  4XDW A;  5D82 A;  3CNX A;  3B7C A;  1RRL A;  2WGO A;  4I4K A;  3F9S A;  1G02 A;  1N5P A;  1D6Y A;  3GSP A;  3GZB A;  3G4S 3;  3CMA 3;  3CD6 3;  2CK3 H;  3PXM A;  1V74 A;  2CWU A;  1GOU A;  1IQX A;  1T5Y A;  3S29 A;  3CCV 3;  1TJD A;  4GHO A;  2WOF A;  4MJD A;  3ZG0 A;  2QA4 3;  1IQ8 A;  4J5K A;  1YVB I;  1FYS A;  2BT3 A;  2Q07 A;  3O8Y A;  1BNF A;  1GMR A;  3HII A;  1Q82 4;  1FUS A;  1VQP 3;  4WYK B;  2YFJ B;  3V92 A;  3NQY A;  1FUT A;  1BSA A;  2CH9 A;  5EVH A;  3U1W A;  2SAR A;  4LGQ A;  2STD A;  1JBS A;  1YVS A;  1UCK A;  1C54 A;  5IEO A;  1RNB A;  2CFW A;  1EQK A;  3AMO B;  1UW1 A;  4RBN A;  3NQZ A;  1A90 A;  1V58 A;  2XFS A;  1GOY A;  1DYU A;  1T2I A;  4HM6 B;  5BU4 A;  3UJM A;  3LYG A;  3ER7 A;  4XBT A;  1IV9 A;  3KII A;  3QK9 A;  2D1W A;  5AI1 A;  3AGN A;  5GSP A;  3S27 A;  2B24 B;  4K1U A;  1Q81 4;  1JB4 A;  1TTO A;  4H61 A;  1CYU A;  2GBX B;  3EB8 A;  2IUK A;  4XBX A;  1RGE A;  2GEX A;  2BU4 A;  1I3F A;  5M18 A;  2R4I A;  3EX9 A;  1JJ2 2;  1VQ7 3;  2BO9 B;  2XH9 A;  2WGQ A;  4MMZ B;  1EG9 B;  3DGM A;  1TRP A;  4HM7 B;  1K41 A;  3EBY A;  3X3X A;  1O7P B;  1ROA A;  1ZX2 A;  2OQE A;  3NBJ A;  2F4Y A;  3PYJ A;  1JV2 B;  1GS3 A;  4HBR A;  1IQY A;  5CF1 A;  3FLJ A;  2IY2 A;  1BGS A;  1ISK A;  1NB3 I;  5M19 A;  1UI7 A;  5ELJ A;  1TRQ A;  2CWT A;  2BMO B;  1GMP A;  1RMS A;  4U13 A;  3CCS 3;  1RN1 A;  3ECF A;  1UI8 A;  3MG2 A;  3OWS A;  1VQ8 3;  2WOH A;  3KSP A;  4X2O A;  1C7H A;  1Q7Y 4;  1NWW A;  3JVC A;  1MWS A;  1T3B A;  1TUH A;  1I3I A;  5CF2 A;  3PGB A;  3MSO A;  1SQW A;  4GSP A;  4STD A;  1Q9E A;  4XB5 A;  3Q2P A;  1ZS7 A;  1IVV A;  4LEH A;  2CW9 A;  5JPP A;  3WMD A;  4HM2 B;  5KP3 A;  2K0M A;  3N8B A;  3BB9 A;  1MWU A;  1JN5 B;  3KN4 A;  3L0R A;  1LOY A;  1Y4K A;  2CFD A;  3NHX A;  3LT8 A;  4K1V A;  2GSP A;  4J8T A;  4KVH A;  4G1M B;  1RN4 A;  2W56 A;  4X2H A;  3WHO A;  1PY3 A;  4EYC A;  2OTL 3;  1BSD A;  1Q40 A;  3K63 A;  3LOY A;  1I0V A;  3AGO A;  5IEP A;  5BXQ A;  1BNI A;  4R9K A;  5KP1 A;  4N6L A;  3UL5 A;  3K9M C;  2GU3 A;  2ML6 A;  5A0O B;  3X42 A;  1BUQ A;  2V1L A;  3G71 3;  2XSH B;  2K54 A;  3SVA A;  3WR2 A;  1VQO 3;  1TP6 A;  3NM2 A;  4EBG A;  2CHC A;  2J8X B;  1W6C A;  1DVD A;  2HMK B;  3AHW A;  5TGN A;  1BNJ A;  2KF6 A;  3F40 A;  3WOD G;  1OGX A;  3CCQ 3;  1AR0 A;  1N9J A;  1SII A;  1QVF 2;  2XEP A;  2CWV A;  1U5O A;  2RCD A;  6GSP A;  1FGT A;  1BSC A;  3FG4 A;  1R4Y A;  1GD3 A;  1D6U A;  2P38 A;  3OWY A;  1JBR A;  1O7H B;  3WOE B;  1SAR A;  2CX1 A;  1JB5 A;  3EBT A;  1PU4 A;  3EC9 A;  4HM1 B;  4HOH A;  3SYU A;  4XM4 A;  1SJW A;  1LXE A;  4CDL A;  2CC3 A;  3SXX A;  3CCE 3;  1E97 A;  1RGK A;  3BNC A;  1B2X A;  1BOX A;  1OF5 A;  1NDO B;  2KF4 A;  1UUW B;  1KD1 4;  3EJV A;  1AVK A;  1LOX A;  1Q42 A;  3X41 A;  1AY7 A;  2IYJ A;  3FSD A;  1MOL A;  1NU3 A;  3J7Y d;  2FXT A;  2C4B A;  5AEW B;  1O7M B;  3CXC 2;  1IDP A;  1B20 A;  3CPO A;  4DKI A;  4R4K A;  1BAN A;  3IJE B;  3FGY A;  2HOH A;  3MHE A;  4R80 A;  1IVU A;  2CFK A;  2CG0 A;  3SOY A;  3HZP A;  1US1 A;  4OK0 A;  2OQE C;  1BRJ A;  1F8N A;  3PS8 A;  3EHC A;  5G2G A;  4N6N B;  5LC6 A;  4XDV A;  1KWI A;  3NV0 B;  1W00 A;  2B1X B;  4CCV A;  5IF6 A;  2IUJ A;  2E2T A;  3WA3 A;  3MYT A;  4HZB B;  1BSB A;  1GYB A;  1RCK A;  1W6G A;  1YIJ 3;  1JRQ A;  1W01 A;  1UUG B;  3CU3 A;  1BNR A;  4O3V A;  1B3S A;  1Q86 4;  1JNQ A;  2ZHX B;  1BVI A;  3JUP A;  1RCL A;  4KZ1 A;  1RDS A;  4N6M A;  4QWT A;  3NBR A;  3SOA A;  1BRG A;  4EW5 A;  2MF7 A;  1RNT A;  3FF0 A;  3DGN A;  1B2U A;  1ZGX A;  1FGM A;  3HI7 A;  4I5Q A;  1O7N B;  4N6V 0;  2XR8 B;  2A15 A;  3RDE A;  4CPK A;  2AAD A;  2KAA A;  3BU4 A;  1BRS A;  3T8N A;  1LOV A;  5DRV A;  2PNC A;  1HYF A;  4L8O A;  4OVM A;  3B8L A;  2E2U A;  2ML5 A;  5AYR B;  1HU9 A;  2C10 A;  3D4A A;  5IER A;  1YIT 3;  2HMM B;  3KZT A;  1WMN A;  2RFR A;  3HOH A;  1UCJ A;  9RNT A;  1I2E A;  3MWZ A;  2ZDJ A;  3Q1C A;  1X1X A;  3FKA A;  1RJO A;  1EA2 A;  3SED A;  2XGN A;  3F8H A;  4N6U A;  5AIG A;  3U97 A;  1VQ5 3;  3LT9 A;  2P0X A;  3K0Z A;  4N6O B;  3ALA A;  4N6T A;  5IG4 A;  3OW2 2;  4BTX A;  1UDI I;  2KF5 A;  1JKG A;  1JZD A;  2PZV A;  3F7X A;  3CCM 3;  1MNL A;  1VQK 3;  1QVG 2;  1RTU A;  2YFI B;  4JRF A;  2HMN B;  3I55 3;  4PEJ A;  4H3U A;  3X3Z A;  2KF3 A;  1RN7 A;  4N3V A;  3PCR A;  3RNT A;  4AKZ A;  1TFO A;  5IW9 A;  2F98 A;  1KSI A;  3NM7 A;  4HM3 B;  1IVW A;  1MWR A;  5EEO A;  5IG5 A;  4BTW A;  2JQ5 A;  1BAO A;  1CH0 A;  3M8C A;  4MMY B;  5D81 A;  1GMQ A;  3T8U A;  3TDG A;  5I97 A;  1EEJ A;  1MGW A;  1W2B 2;  4NHF A;  3DM8 A;  3KKG A;  3S5C A;  1GD4 A;  3KSE D;  3G8Z A;  1BNS A;  5AIH A;  1JBT A;  2Y73 A;  4XBY A;  4EC6 A;  3CPW 2;  7STD A;  1QMA A;  1Q7H A;  4R1K A;  2Z77 A;  3SLU A;  3MG3 A;  2Z76 A;  3BLZ A;  2F99 A;  2CG1 A;  2CFG A;  2F5M A;  3D9R A;  2H0G A;  1UCI A;  3EN1 B;  2K3D A;  1LVN A;  2R41 A;  1YGW A;  1AQZ A;  4MMX B;  4BTY A;  4J9A A;  3DMC A;  2Z7A A;  2GBW B;  4O2H A;  3LTD A;  4K90 B;  2XSO B;  3LTA A;  3A5E A;  3JUM A;  1D6Z A;  4ZM8 A;  4FMB A;  5IEN A;  1LNH A;  3DGY A;  1R4C A;  3EN8 A;  3BIR A;  3V98 A;  1DMM A;  3KFQ C;  3H3H A;  1A2V A;  3DGL A;  4HJL B;  2D42 A;  2QIY A;  1STF I;  3JUN A;  3K5T A;  2WO0 A;  6STD A;  4BIR A;  1BUJ A;  3LML A;  1NB5 I;  1M1K 4;  4HVN A;  1LRA A;  3PCS A;  2HMJ B;  2W2C A;  3B4O A;  1WMP A;  1YNV X;  4O8S A;  5LC7 A;  1MWT A;  3NBB A;  3RGA A;  2W56 B;  2UGI A;  6RNT A;  1NNV A;  3B4P A;  1Q40 B;  1YGE A;  4KT3 B;  4RNZ A;  3D5G A;  1N8R 4;  4O02 B;  1TFK A;  4LZI A;  3VSY A;  1G0T A;  4IIA A;  3GAX A;  1GSP A;  2IA7 A;  1DVC A;  5EQL A;  4FMC A;  1STD A;  4ORL A;  1N9E A;  2OWP A;  3WOF B;  1IU7 A;  2YFL B;  3CCU 3;  1S72 3;  1M1X B;  4FR9 A;  3DGO A;  5AYS C;  1BRK A;  4EV2 A;  2H0H A;  1EUI C;  3OWU A;  1B2M A;  1FUW A;  1ULI B;  3NUV A;  3LZA A;  1LOW A;  2HML B;  5CLK A;  5ELU A;  1OCV A;  3EF8 A;  1RGG A;  2YX9 A;  4HZ9 B;  1YI2 3;  2I9W A;  1K9M 4;  1X1U A;  3GZR A;  4EV5 A;  3FCS B;  4HM0 B;  3ROB A;  3FG1 A;  3FH1 A;  4HM5 B; 
#chains in the Genus database with same CATH homology
 2L1S A;  4EW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...