3F8XA

Crystal structure of a putative delta-5-3-ketosteroid isomerase (eca2236) from pectobacterium atrosepticum scri1043 at 1.55 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
SPNAAVQSGLQEWHRIIAEADWERLPDLLAEDVVFSNPSTFDPYHGKGPLMVILPAVFSVLENFQYARHFSSKSGYVLEFNANMGDELLTGVDLIEFNDAGKITDLVVMMRPASVVIDLSVEVGKRIAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords putative delta-5-3-ketosteroid isomerase
publication title Crystal structure of putative delta-5-3-ketosteroid isomerase (YP_050331.1) from ERWINIA CAROTOVORA ATROSEPTICA SCRI1043 at 1.55 A resolution
rcsb
source organism Pectobacterium atrosepticum scri1043
total genus 34
structure length 131
sequence length 131
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f8xA00
2I9WA 2XRXB 5IG3A 2UX0A 1TP6A 3KZTA 5CXOA 4STDA 5IG5A 2F98A 2HMMB 5FW5A 1DMNA 1OGXA 5IF6A 5DRVA 3UNLA 1CQSA 2K54A 1K41A 4I4KA 3H51A 3GZRA 5KP1A 3RGAA 3F7XA 4XDWA 3Q90A 4K1VA 3SOAA 2GBXB 3MKIA 3FSDA 1ZO2A 5D83A 2Z76A 3B4OA 3JUMA 3EQQB 4HM0B 1OF5A 3EF8A 5CF1A 5JPUA 6STDA 2Z77A 2OWPA 1UUWB 4RZMA 3EBTA 2RCDA 3FZWA 1IDPA 4FCJA 1NDOB 3I0YA 3GZYB 2CKFB 4IIAA 1C7HA 1ULIB 4LEHA 3MG2A 3KE7A 2YFIB 2XSHB 1E97A 4HM4B 1NU3A 4XB5A 3CNMA 2BMRB 5CF2A 1GYBA 3OX9A 4PEJA 3NHXA 3JUPA 3B8LA 4OUQA 3NV0B 3FGYA 3GWRA 2YFLB 4HKVB 3ER7A 5AIIA 3G8ZA 3F8HA 3SOYA 2STDA 5AIFA 1OCVA 2F86B 3H3HA 3T8NA 3IPTA 3HK4A 3K7CA 3NBRA 3MYTA 3OWUA 3JUOA 1JKGB 3G16A 4HJLB 3CU3A 4HM8B 4OVMA 3EBYA 3HX8A 1OHOA 3NV0A 1STDA 1S5AA 4FCMA 1JB4A 1OF5B 1Q40B 3HZPA 5IEOA 3KSPA 1GS3A 3WMDA 3DUKA 2RFRA 4CDLA 1O7MB 1ZX2A 2A15A 3F8XA 2JQ5A 1O7GB 5D81A 5AIHA 4WYKB 2QIYA 1QJGA 4N3VA 1Z1SA 3F9SA 3SEDA 3DZLA 4H3UA 1JKGA 3UJMA 3MSOA 4HM2B 5AI1A 1OHPA 4GB5A 1GY6A 3ROBA 1EG9B 1Q40A 3FF2A 3EJVA 2BNGA 4HZ9B 1HKXA 3FLJA 1E3VA 1ISKA 5EVHA 3BB9A 4R9LA 3NM2A 4XDVA 3GZXB 3NUVA 1ASKA 1DMMA 4WYKA 4J8TA 5HGRA 4L8OA 5AEUB 3DM8A 1UUVB 3F40A 3G0KA 3OWYA 1O7PB 5STDA 1O7WB 1OUNA 5CK6A 3A76A 3FH1A 2HMNB 3EX9A 3B7CA 1W02A 3MHEA 5AIGA 1JN5B 5DREA 2YFJB 3EN8A 3LYGA 3EC9A 4WP5A 4XBTA 5D82A 3K0ZA 1WQLB 4MJDA 2HMLB 1BUQA 3GZBA 2BMQB 4X2HA 4LGQA 2Z7AA 5IERA 3E99A 4XBYA 5BVBA 1JN5A 5IG4A 4HM7B 1W00A 1JB5A 2HMOB 3OXAA 4LMIA 5KP3A 4HM6B 3GRDA 1OPYA 1QMAA 3F7SA 3STDA 2F99A 5CLKA 5IENA 4X2OA 4HVNA 4KVHA 2CHCA 4L8PA 2B24B 2PZVA 3RGRA 1VZZA 8CHOA 4U13A 3OWSA 1E3RA 3JUNA 1U5OA 2HMKB 5IEPA 1OHSA 1W6YA 4K1UA 3BLZA 1O7NB 2R4IA 3EHCA 3LZAA 4J9AA 5JPPA 5TGNA 2IMJA 3FF0A 4HM3B 4XM4A 5G2GA 2B1XB 1AR0A 2INXA 3DMCA 4XBXA 3VGNA 3ECFA 3NXJA 3VSYA 1OH0A 5AEWB 4WWUC 1SJWA 1GY5A 3S5CA 3FKAA 4R9KA 2W2CA 1OGZA 4L7KA 2HMJB 1GY7A 1DMQA 1JB2A 3EN1B 5IG0A 2XR8B 3MG1A 5BXQA 4HM5B 1A2KA 3M8CA 3CPOA 4Q53A 4HZBB 4R1KA 5KP4A 1TUHA 1O7HB 3JUQA 3DXOA 2BMOB 4ORLA 1NWWA 1W01A 2GEXA 7STDA 3B4PA 3F14A 3KKGA 2QGUA 2GEYA 2GBWB 4HM1B 3MG3A 1ULJB 2RGQA 3OV4A 2XSOB 3D9RA 1EA2A 2GXFA 3T8UA 3CNXA 1Q42A
chains in the Genus database with same CATH superfamily
2I9WA 2XRXB 3SVAA 5IG3A 2OQEC 2UX0A 1TP6A 3KZTA 5CXOA 2ZHXB 2C10A 3WDGB 4STDA 1BRSA 5IG5A 1IK3A 6GSPA 1QAFA 1VQN3 1YVBI 2CW9A 2F98A 3EB8A 2HMMB 4N6UA 5FW5A 1DMNA 2CFWA 5M19A 4GL6A 1OGXA 3LTBA 5IF6A 5DRVA 1NJI4 3X40A 3IJEB 3UNLA 1RCLA 1CQSA 2K54A 1KSIA 1K41A 1G02A 1RGFA 3BNDA 1Y4KA 4J5KA 3GAXA 2BIRA 1ROAA 5M1AA 3WOEB 2FGTA 3H51A 4I4KA 4FCZA 3GZRA 4BU4A 1LNHA 4HAAA 5KP1A 3RGAA 1TFKA 4CCVA 1WMPA 4BL3A 3F7XA 1X1YA 3Q3FA 4KFDA 3J7Yd 4XDWA 2K0MA 3L0RA 3Q90A 3K9MC 1LOYA 4K1VA 1GOUA 2OOVA 1JV2B 3SOAA 1T5YA 2GBXB 4BTYA 1KD14 3MKIA 2UGIA 1RNBA 1Q864 3FSDA 4LSOA 1ZO2A 2FNQA 1GMPA 1BSBA 1JJ22 4KT3B 1VQO3 1YJW3 2F5WA 5D83A 3V98A 1MNLA 1PY3A 2SARA 2Z76A 2PNCA 3B4OA 3LTCA 3LOYA 3JUMA 3EQQB 4HM0B 1NO3A 2ZL8A 2XF3A 2KAAA 4FMAA 3CCL3 1IQXA 4BL2A 2SBLA 4AKYA 3CCM3 1OF5A 2RNTA 7RNTA 3Q2PA 1FW7A 3EF8A 4NPBA 5CF1A 4EBGA 2GU1A 3GSPA 1CYUA 2D1WA 3KIIA 5JPUA 5LC7A 6STDA 2Z77A 2OWPA 1UUWB 4RZMA 1TU5A 1IVXA 3EBTA 2RCDA 3FZWA 4G1MB 1IDPA 4FCJA 1IVUA 1FUTA 1NDOB 2GSPA 1WNHA 1DETA 1BRJA 3FG4A 3GZYB 1BNFA 3I0YA 3KSED 2CKFB 1QALA 2CFGA 3U1WA 1R4CA 2W03A 1C7HA 4IIAA 1QVF2 3WOFB 4RNZA 2BT3A 5ELUA 1RGEA 3U97A 1ULIB 4LEHA 1I0XA 3MG2A 4KFFA 3KE7A 3I563 3AGOA 1BRKA 2KXGA 2YFIB 2XSHB 3WA3A 1AY7A 1E97A 2W04A 1RGCA 1B27A 1NU3A 4HM4B 2W9PA 4XB5A 1I70A 3HIIA 4NREA 1JRQA 1VQ53 3CNMA 1MGRA 3DH2A 2BMRB 1I8VA 5CF2A 1GYBA 1OACA 1PFPA 2Q07A 3OX9A 1BRIA 2E2VA 2XGNA 2BU4A 3KFQC 2OOVC 3CMA3 4PEJA 1I3IA 4QWTA 1HZ1A 1EKMA 3NHXA 3JUPA 2W9QA 3D5GA 3B8LA 4GSPA 3SLUA 1W6CA 2W0QA 2MC8A 4OUQA 4RBNA 1GD3A 1TJDA 3RDEA 3NBBA 1TRPA 4N6TA 8RNTA 1FA3A 3NV0B 3V99A 5G1KA 3DGLA 3FGYA 4IT7A 2LQVA 3WA2X 1I2GA 3GWRA 2YFLB 3NBJA 4HKVB 3AHWA 1G0TA 2KF5A 1RRLA 3ER7A 5AIIA 1FZUA 3SXXA 1WTHA 3ALAA 3G8ZA 1RGGA 3F8HA 1BNIA 3SOYA 1HYFA 2STDA 3NM7A 4TX4A 1EUIC 1BRHA 5I97A 3Q1CA 5AIFA 2D42A 2P0XA 1TFOA 1OCVA 2F86B 3H3HA 3T8NA 5BU4A 3IPTA 1RKYA 1M1K4 1D6ZA 1IV9A 1RJOA 1NNVA 1MWRA 1YGEA 3UB1A 1A2PA 5AYSC 1RCKA 1RHLA 3HK4A 1W7CA 3K7CA 4R4KA 1V58A 3NBRA 4K61A 3MYTA 1W2B2 3OWUA 3JUOA 2OTJ3 1FGRA 1BSAA 1JKGB 2AAEA 3G16A 3S28A 1JNQA 2CWUA 1D6YA 1RLSA 4HJLB 3CU3A 1LXEA 1BU4A 4HM8B 1ROVA 4OVMA 3EBYA 3HX8A 1OHOA 3NV0A 4BIRA 1STDA 1S5AA 4FCMA 4MMXB 1IU7A 4BTXA 2CG0A 1JB4A 1OF5B 1Q40B 1SIIA 1T2HA 3HZPA 5IEOA 3KSPA 1GS3A 1RMSA 4J5GA 1M1XB 1UUGB 3DUKA 3WMDA 3D5IA 1BUJA 1V74A 2RFRA 4CJNA 3D79A 1VQM3 1V57A 1UCJA 2KCDA 3HIGA 5ELJA 4CDLA 6RNTA 1LQGC 1O7MB 1UCIA 1LOXA 1LQMB 3NQZA 1ZX2A 3WHOA 1GMQA 2JDIH 2A15A 3F8XA 1GD4A 1O7GB 2JQ5A 4FMBA 1JBSA 3CCQ3 3CCU3 4WYKB 5AIHA 3FCSB 1WMOA 1RRHA 1FUSA 2QIYA 3BNBA 1QJGA 4JF8A 4WHAA 4BTWA 3OW22 5HOHA 4N3VA 4N6OB 1IYYA 1Z1SA 3F9SA 3SEDA 1W4NA 3DZLA 4H3UA 4MMZB 1JKGA 1UGHI 3UJMA 3DGMA 3UL6A 1VQK3 3MSOA 4HM2B 3N9HA 5AI1A 1OHPA 2L4VA 4EC6A 4GB5A 1GY6A 3PXMA 1EEJA 3ROBA 5M18A 2CC3A 1TRQA 1EG9B 2CFDA 1Q40A 1PYLA 2F5MA 3FF2A 3EJVA 1G96A 1SIHA 3UL5A 3URPA 2BNGA 3V92A 1NB3I 1BANA 4HZ9B 1HKXA 3FLJA 3WODG 2H0GA 1W2ZA 1E3VA 1VQ43 1ISKA 5EVHA 3BB9A 4IPBA 4R9LA 1BSDA 3NM2A 2P09A 1LOWA 5IW9A 4XDVA 2C4BA 2CX0A 4N6MA 3GZXB 3NUVA 2CFLA 1ASKA 1F8NA 3K5TA 1DMMA 1BVIA 4WYKA 3BNEA 4J8TA 2W6JH 5HGRA 1BGSA 4L8OA 1N9EA 2IA7A 3DM8A 5AEUB 2QEX3 2C11A 1UW1A 2CX1A 1R4YA 1UUVB 3F40A 3G0KA 1KC84 2IYJA 3OWYA 1O7PB 4FR9A 1LNIA 5STDA 9RNTA 1O7WB 1RGHA 1OUNA 1C54A 5CK6A 1YVSA 4ZM8A 3A76A 2CG1A 3FH1A 2E2TA 1Q814 2CWVA 1RGKA 2HMNB 3EX9A 3PZWA 2MF7A 2P0MA 4GHOA 1N8R4 3B7CA 4O3VA 1W02A 2Y74A 2BO9B 3PS8A 3MHEA 2IUJA 3S67A 1DE3A 1T3BA 4DKIA 1RGAA 1U8CB 1BAOA 2Y73A 3A5EA 5AIGA 3X3YA 1JN5B 4AEQA 4EYCA 1N5PA 5DREA 1BSCA 1X1WA 3BNCA 3CCR3 2YFJB 3EN8A 3LYGA 1Q7Y4 3CCJ3 1TIJA 2F56A 3LT9A 4N6V0 3I553 3HOHA 1SARA 1LRAA 1RN1A 1JZDA 3EC9A 3BU4A 4EXRA 1X1XA 3DGYA 4WP5A 1IQ8A 1N8QA 1UI8A 4XBTA 1AV4A 1L5GB 1B3SA 5D82A 2CFKA 3K0ZA 3G6E3 1RN4A 1GOYA 1WQLB 1W5ZA 1VQ63 4MJDA 2HMLB 4H61A 3X42A 1MOLA 3AMOB 2HOHA 1B20A 2XFTA 3GZBA 1BUQA 1BSEA 2BMQB 4X2HA 1K28A 1AQZA 2KF3A 4LGQA 1YIT3 2RBIA 3SX1A 1FUWA 4O02B 2WOFA 2Z7AA 1LVNA 5IERA 1BNJA 2GU3A 3E99A 2XH9A 1S723 1FGTA 2RSXA 4XBYA 5BVBA 1JN5A 5IG4A 4HM7B 4MMYB 3PCRA 1W00A 2P05A 2H0IA 1JB5A 2IY2A 1K8A4 1MGWA 2HMOB 1TTOA 3DGNA 1BNEA 4MEIA 1BNSA 3OXAA 4LMIA 4OK0A 2Z6BA 1BRNL 2OCTA 5KP3A 1FYSA 1VQ73 4HM6B 1DVCA 1UGIA 3BIRA 3GRDA 1B2MA 1OPYA 1QMAA 1BNGA 1BOXA 1FGQA 2CK3H 3F7SA 3HI7A 4N6NB 1US1A 3STDA 1B2XA 2F99A 2KRTA 5D81A 1CYVA 5CLKA 2WO0A 5IENA 2M7OA 4R80A 4X2OA 4HVNA 4ILFA 1UCLA 3AMOA 3LH4A 3N8BA 4HBRA 1BNRA 3EE1A 4KFEA 3VF1A 3NX0A 3CXC2 1AVKA 4KVHA 2CHCA 3ZFZA 4CPKA 5EEOA 1QVG2 4NHFA 1K9M4 1GMRA 2B24B 2PZVA 3PCSA 4FMDA 4KZ1A 4L8PA 3FG3A 3S27A 1EQKA 3G4S3 3RGRA 4LZIA 1N9JA 1A90A 2UUGC 1VZZA 8CHOA 4U13A 3D3LA 2E2UA 2ML5A 3CCV3 1LOVA 3T8UA 3CC73 3X41A 1I3FA 2O9UX 1E3RA 3JUNA 1RSNA 1U5OA 1YGWA 3PYJA 2HMKB 3TDGA 5IEPA 1OHSA 1ZS7A 1W6YA 1Q824 1MWUA 4K1UA 3BLZA 1O7NB 2R4IA 3EHCA 3LZAA 4I5QA 4J9AA 5JPPA 4EV5A 1SQWA 1W6GA 3N54B 2V1LA 5TGNA 3KN4A 1M904 3CPW2 3ZG0A 2IMJA 1ZGXA 2WGQA 1RGLA 5AYRB 3X3XA 1RN7A 1DYUA 2CIUA 3FF0A 3RNTA 2H0HA 4HM3B 4RNYA 1D6UA 4XM4A 5G2GA 1RNTA 1CEWI 3O8YA 1YIJ3 2B1XB 1KQS2 1PU4A 1STFI 1AR0A 3LMLA 1SPUA 1BRGA 1DVDA 1MWSA 5G1LA 2IUKA 3QRDA 4LYLB 2INXA 3SYUA 4WFOA 3DMCA 2ZA4A 4XBXA 3ZG5A 2KF6A 3MPHA 1A67A 3CC23 2FXTA 2R41A 3ECFA 3NXJA 3VGNA 3VSYA 1VQP3 1OH0A 5AEWB 2P38A 1B2ZA 1YJN3 4WWUC 3S29A 1IT7A 1SJWA 3LTDA 1GY5A 1IQYA 3CC43 3S5CA 3FKAA 4K90B 1IVVA 4R9KA 1WMNA 3QK9A 2W2CA 2O3OA 4EW5A 1UI7A 2W56B 2K3DA 1IT8A 1OGZA 4L7KA 3CCE3 1JBRA 1JZOA 1YNVX 1YHQ3 1I2EA 4N6LA 1VQL3 3G713 2XEPA 5EQLA 2HMJB 1RDSA 1GY7A 1QAKA 2WOHA 2F4YA 1B2UA 2AADA 3D4AA 2OQEA 1VQ93 1DMQA 1JB2A 2L1SA 1B21A 3MWZA 1FGOA 2ZDJA 7GSPA 4EV2A 3EN1B 3LXUX 4JRFA 5IG0A 5RNTA 3CD63 1GOVA 2XR8B 3MG1A 1Q7HA 1BIRA 2XGLA 2CWTA 1AVLA 4HYZA 1RTUA 5BXQA 3JVCA 4HM5B 1KWIA 1A2KA 1CH0A 3M8CA 4HOHA 1UCKA 3CPOA 3LTAA 1N5HA 4Q53A 2KF4A 1M9GA 2CH9A 5LC6A 1NB5I 1YJ93 4HZBB 4R1KA 1FGMA 4AKZA 1YI23 5KP4A 3AHSA 1TUHA 3PGBA 5GSPA 3X3ZA 1IV7A 1O7HB 1JBTA 1VQ83 3AGNA 1UDII 5BIRA 1IVWA 2J8XB 2YX9A 3JUQA 1T2IA 2W56A 2WGOA 3DXOA 5FGOA 2BMOB 4ORLA 3KCHA 1NWWA 1W01A 3DY5A 2GEXA 1I2FA 3FG1A 1B2SA 2OTL3 1HU9A 7STDA 1VQQA 2LYXA 3B4PA 3F14A 3KKGA 2QGUA 2GEYA 3DGOA 4O8SA 4RNTA 2GBWB 5A0OB 1GSPA 4HM1B 5JBSA 1Q9EA 2BHMA 2XFSA 3MG3A 1ULJB 1A2VA 3LT8A 1I0VA 2RGQA 3WR2A 1X1UA 4O2HA 3IMAB 3CCS3 3OV4A 2QA43 3K63A 3T0UA 4FMCA 2XSOB 3D9RA 2ML6A 1EA2A 1K734 2GXFA 3CME3 1MWTA 1J2BA 3NQYA 3OWSA 3CNXA 1Q42A
chains in the Genus database with same CATH topology
2I9WA 2XRXB 3SVAA 5IG3A 2OQEC 2UX0A 1TP6A 3KZTA 5CXOA 3WDGB 2C10A 4STDA 5IG5A 1IK3A 1VQN3 1QAFA 1YVBI 2CW9A 2F98A 3EB8A 2HMMB 4N6UA 5FW5A 1DMNA 2CFWA 4GL6A 1OGXA 3LTBA 5IF6A 5DRVA 1NJI4 3X40A 3IJEB 3UNLA 1CQSA 2K54A 1KSIA 1K41A 3BNDA 1Y4KA 3GAXA 1ROAA 3WOEB 2FGTA 3H51A 4I4KA 4FCZA 3GZRA 1LNHA 5KP1A 3RGAA 1TFKA 4CCVA 1WMPA 3F7XA 4KFDA 3J7Yd 4XDWA 2K0MA 3L0RA 3Q90A 3K9MC 4K1VA 2OOVA 1JV2B 3SOAA 1T5YA 2GBXB 4BTYA 1KD14 3MKIA 1Q864 3FSDA 4LSOA 1ZO2A 2FNQA 1JJ22 1VQO3 1YJW3 5D83A 3V98A 1MNLA 2Z76A 2PNCA 3B4OA 3LTCA 3LOYA 3JUMA 3EQQB 4HM0B 1NO3A 2ZL8A 2XF3A 4FMAA 3CCL3 1IQXA 2SBLA 4AKYA 3CCM3 1OF5A 3Q2PA 3EF8A 5CF1A 4EBGA 2GU1A 1CYUA 2D1WA 3KIIA 5JPUA 5LC7A 6STDA 2Z77A 2OWPA 1UUWB 4RZMA 1TU5A 1IVXA 3EBTA 2RCDA 3FZWA 4G1MB 1IDPA 4FCJA 1IVUA 1NDOB 3FG4A 3GZYB 1WNHA 3I0YA 3KSED 1PU4A 2CKFB 1QALA 2CFGA 3U1WA 1R4CA 2W03A 1C7HA 4IIAA 1QVF2 3WOFB 4RNZA 2BT3A 5ELUA 3U97A 1ULIB 4LEHA 3MG2A 4KFFA 3KE7A 3I563 2KXGA 2YFIB 2XSHB 3WA3A 1E97A 2W04A 4HM4B 1NU3A 4XB5A 2W9PA 3HIIA 4NREA 1JRQA 1VQ53 3CNMA 2BMRB 5CF2A 1GYBA 1OACA 1PFPA 2Q07A 3OX9A 2E2VA 2XGNA 3KFQC 2OOVC 3CMA3 4PEJA 4QWTA 1EKMA 3NHXA 3JUPA 2W9QA 3B8LA 3SLUA 1W6CA 2W0QA 2MC8A 4OUQA 4RBNA 1GD3A 3RDEA 3NBBA 4N6TA 1FA3A 3NV0B 3V99A 3DGLA 3FGYA 4IT7A 2LQVA 3WA2X 3GWRA 2YFLB 3NBJA 4HKVB 1RRLA 3ER7A 5AIIA 3SXXA 1WTHA 3ALAA 3G8ZA 3F8HA 3SOYA 2STDA 3NM7A 4TX4A 5I97A 3Q1CA 5AIFA 2D42A 2P0XA 1TFOA 1OCVA 2F86B 3H3HA 3T8NA 1RKYA 3IPTA 1M1K4 1D6ZA 1IV9A 1RJOA 1YGEA 3UB1A 5AYSC 3HK4A 1W7CA 3K7CA 4R4KA 3NBRA 4K61A 3MYTA 1W2B2 3OWUA 3JUOA 2OTJ3 1FGRA 1JKGB 3G16A 3S28A 1JNQA 2CWUA 1D6YA 4HJLB 3CU3A 1LXEA 4HM8B 1ROVA 4OVMA 3EBYA 3HX8A 1OHOA 3NV0A 1STDA 1S5AA 4FCMA 4MMXB 1IU7A 4BTXA 2CG0A 1JB4A 1OF5B 1Q40B 1SIIA 3HZPA 5IEOA 3KSPA 1GS3A 1M1XB 3DUKA 3WMDA 1V74A 2RFRA 1VQM3 2KCDA 3HIGA 5ELJA 4CDLA 1O7MB 1LOXA 3NQZA 1ZX2A 2JDIH 2A15A 3F8XA 1GD4A 1O7GB 2JQ5A 4FMBA 3CCQ3 3CCU3 4WYKB 5AIHA 3FCSB 1RRHA 1WMOA 2QIYA 3BNBA 5D81A 1QJGA 4JF8A 4WHAA 4BTWA 3OW22 4N3VA 4N6OB 1Z1SA 3F9SA 3SEDA 1W4NA 3DZLA 4H3UA 4MMZB 1JKGA 3UJMA 3DGMA 3UL6A 1VQK3 3MSOA 4HM2B 3N9HA 5AI1A 1OHPA 2L4VA 4EC6A 4GB5A 1GY6A 3PXMA 3ROBA 2CC3A 1EG9B 2CFDA 1Q40A 3FF2A 3EJVA 1G96A 1SIHA 3UL5A 3V92A 2BNGA 3WODG 1NB3I 4HZ9B 1HKXA 3FLJA 1W2ZA 1E3VA 1VQ43 1ISKA 5EVHA 3BB9A 4IPBA 4R9LA 3NM2A 2P09A 5IW9A 4XDVA 4N6MA 3GZXB 3NUVA 2CFLA 1ASKA 1F8NA 3K5TA 1DMMA 4WYKA 3BNEA 4J8TA 2W6JH 5HGRA 4L8OA 1N9EA 2IA7A 3DM8A 5AEUB 2QEX3 2C11A 1UW1A 1UUVB 3F40A 3G0KA 1KC84 3OWYA 1O7PB 4FR9A 5STDA 1O7WB 1OUNA 5CK6A 4ZM8A 3A76A 2CG1A 3FH1A 2E2TA 1Q814 2CWVA 2HMNB 3EX9A 3PZWA 2MF7A 2P0MA 1N8R4 3B7CA 4O3VA 1W02A 2Y74A 2BO9B 3PS8A 3MHEA 2IUJA 3S67A 1U8CB 2Y73A 4AEQA 5AIGA 3X3YA 1JN5B 4EYCA 1N5PA 5DREA 3BNCA 3CCR3 2YFJB 3EN8A 3LYGA 1Q7Y4 3CCJ3 1TIJA 3LT9A 4N6V0 3I553 3EC9A 4EXRA 4WP5A 1IQ8A 1N8QA 1UI8A 4XBTA 1AV4A 1L5GB 5D82A 2CFKA 3K0ZA 3G6E3 1W5ZA 1WQLB 1VQ63 4MJDA 2HMLB 4H61A 3X42A 1MOLA 3AMOB 2XFTA 3GZBA 1BUQA 2BMQB 4X2HA 1K28A 4LGQA 1YIT3 3SX1A 1FUWA 4O02B 2WOFA 2Z7AA 1LVNA 5IERA 2GU3A 3E99A 2XH9A 1S723 1FGTA 2RSXA 4XBYA 5BVBA 1JN5A 5IG4A 4HM7B 4MMYB 3PCRA 1W00A 2P05A 1JB5A 1K8A4 2HMOB 3DGNA 4MEIA 3OXAA 4LMIA 4OK0A 2Z6BA 2OCTA 5KP3A 1VQ73 4HM6B 1DVCA 3GRDA 1OPYA 1QMAA 3F7SA 1FGQA 2CK3H 3STDA 3HI7A 4N6NB 1US1A 2F99A 2KRTA 1CYVA 5CLKA 2WO0A 5IENA 2M7OA 4R80A 4X2OA 4HVNA 3AMOA 3LH4A 3N8BA 4HBRA 3EE1A 4KFEA 3VF1A 3NX0A 3CXC2 1AVKA 4KVHA 2CHCA 5EEOA 1QVG2 4NHFA 1K9M4 4L8PA 2B24B 2PZVA 3PCSA 4FMDA 4KZ1A 3S27A 3FG3A 1EQKA 3G4S3 3RGRA 4LZIA 1N9JA 1A90A 1VZZA 8CHOA 4U13A 3D3LA 2E2UA 2ML5A 3CCV3 3T8UA 3CC73 3X41A 2O9UX 1E3RA 3JUNA 1U5OA 3PYJA 2HMKB 3TDGA 5IEPA 1OHSA 1W6YA 1Q824 4K1UA 3BLZA 1O7NB 2R4IA 3EHCA 3LZAA 4J9AA 5JPPA 4EV5A 1SQWA 1W6GA 3N54B 2V1LA 5TGNA 3KN4A 1M904 3CPW2 2IMJA 2WGQA 5AYRB 3X3XA 1RN7A 1DYUA 2CIUA 3FF0A 4HM3B 4RNYA 1D6UA 4XM4A 5G2GA 1CEWI 3O8YA 1YIJ3 2B1XB 1KQS2 1STFI 1AR0A 3LMLA 1SPUA 1DVDA 2IUKA 3QRDA 2INXA 4WFOA 3DMCA 4XBXA 1A67A 3MPHA 3CC23 2FXTA 3VGNA 3ECFA 3NXJA 3VSYA 1VQP3 1OH0A 5AEWB 2P38A 1YJN3 4WWUC 3S29A 1IT7A 1SJWA 3LTDA 1GY5A 1IQYA 3CC43 3S5CA 3FKAA 4K90B 1IVVA 4R9KA 1WMNA 3QK9A 2W2CA 2O3OA 1UI7A 2W56B 3CCE3 1IT8A 1OGZA 4L7KA 1YHQ3 4N6LA 1VQL3 3G713 2XEPA 5EQLA 2HMJB 1GY7A 1QAKA 2WOHA 2OQEA 1VQ93 1DMQA 1JB2A 3MWZA 1FGOA 2ZDJA 4EV2A 3EN1B 3LXUX 4JRFA 5IG0A 3CD63 2XR8B 3MG1A 2XGLA 2CWTA 1AVLA 4HYZA 5BXQA 3JVCA 4HM5B 1KWIA 1A2KA 3M8CA 3CPOA 3LTAA 1N5HA 4Q53A 1NB5I 1M9GA 2CH9A 5LC6A 1YJ93 4HZBB 4R1KA 1FGMA 4AKZA 1YI23 5KP4A 1TUHA 3PGBA 3X3ZA 1IV7A 1O7HB 1VQ83 1IVWA 2YX9A 3JUQA 2W56A 2WGOA 3DXOA 5FGOA 2BMOB 4ORLA 1NWWA 1W01A 3DY5A 2GEXA 3FG1A 2OTL3 1HU9A 7STDA 3B4PA 2LYXA 3F14A 3KKGA 4O8SA 2QGUA 2GEYA 3DGOA 2GBWB 5A0OB 4HM1B 5JBSA 3MG3A 2BHMA 2XFSA 1ULJB 1A2VA 3LT8A 2RGQA 4O2HA 3IMAB 3CCS3 3OV4A 2QA43 3K63A 3T0UA 4FMCA 2XSOB 3D9RA 2ML6A 1EA2A 1K734 2GXFA 3CME3 1J2BA 3NQYA 3OWSA 3CNXA 1Q42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9W A;  2XRX B;  5IG3 A;  2UX0 A;  1TP6 A;  3KZT A;  5CXO A;  4STD A;  5IG5 A;  2F98 A;  2HMM B;  5FW5 A;  1DMN A;  1OGX A;  5IF6 A;  5DRV A;  3UNL A;  1CQS A;  2K54 A;  1K41 A;  4I4K A;  3H51 A;  3GZR A;  5KP1 A;  3RGA A;  3F7X A;  4XDW A;  3Q90 A;  4K1V A;  3SOA A;  2GBX B;  3MKI A;  3FSD A;  1ZO2 A;  5D83 A;  2Z76 A;  3B4O A;  3JUM A;  3EQQ B;  4HM0 B;  1OF5 A;  3EF8 A;  5CF1 A;  5JPU A;  6STD A;  2Z77 A;  2OWP A;  1UUW B;  4RZM A;  3EBT A;  2RCD A;  3FZW A;  1IDP A;  4FCJ A;  1NDO B;  3I0Y A;  3GZY B;  2CKF B;  4IIA A;  1C7H A;  1ULI B;  4LEH A;  3MG2 A;  3KE7 A;  2YFI B;  2XSH B;  1E97 A;  4HM4 B;  1NU3 A;  4XB5 A;  3CNM A;  2BMR B;  5CF2 A;  1GYB A;  3OX9 A;  4PEJ A;  3NHX A;  3JUP A;  3B8L A;  4OUQ A;  3NV0 B;  3FGY A;  3GWR A;  2YFL B;  4HKV B;  3ER7 A;  5AII A;  3G8Z A;  3F8H A;  3SOY A;  2STD A;  5AIF A;  1OCV A;  2F86 B;  3H3H A;  3T8N A;  3IPT A;  3HK4 A;  3K7C A;  3NBR A;  3MYT A;  3OWU A;  3JUO A;  1JKG B;  3G16 A;  4HJL B;  3CU3 A;  4HM8 B;  4OVM A;  3EBY A;  3HX8 A;  1OHO A;  3NV0 A;  1STD A;  1S5A A;  4FCM A;  1JB4 A;  1OF5 B;  1Q40 B;  3HZP A;  5IEO A;  3KSP A;  1GS3 A;  3WMD A;  3DUK A;  2RFR A;  4CDL A;  1O7M B;  1ZX2 A;  2A15 A;  3F8X A;  2JQ5 A;  1O7G B;  5D81 A;  5AIH A;  4WYK B;  2QIY A;  1QJG A;  4N3V A;  1Z1S A;  3F9S A;  3SED A;  3DZL A;  4H3U A;  1JKG A;  3UJM A;  3MSO A;  4HM2 B;  5AI1 A;  1OHP A;  4GB5 A;  1GY6 A;  3ROB A;  1EG9 B;  1Q40 A;  3FF2 A;  3EJV A;  2BNG A;  4HZ9 B;  1HKX A;  3FLJ A;  1E3V A;  1ISK A;  5EVH A;  3BB9 A;  4R9L A;  3NM2 A;  4XDV A;  3GZX B;  3NUV A;  1ASK A;  1DMM A;  4WYK A;  4J8T A;  5HGR A;  4L8O A;  5AEU B;  3DM8 A;  1UUV B;  3F40 A;  3G0K A;  3OWY A;  1O7P B;  5STD A;  1O7W B;  1OUN A;  5CK6 A;  3A76 A;  3FH1 A;  2HMN B;  3EX9 A;  3B7C A;  1W02 A;  3MHE A;  5AIG A;  1JN5 B;  5DRE A;  2YFJ B;  3EN8 A;  3LYG A;  3EC9 A;  4WP5 A;  4XBT A;  5D82 A;  3K0Z A;  1WQL B;  4MJD A;  2HML B;  1BUQ A;  3GZB A;  2BMQ B;  4X2H A;  4LGQ A;  2Z7A A;  5IER A;  3E99 A;  4XBY A;  5BVB A;  1JN5 A;  5IG4 A;  4HM7 B;  1W00 A;  1JB5 A;  2HMO B;  3OXA A;  4LMI A;  5KP3 A;  4HM6 B;  3GRD A;  1OPY A;  1QMA A;  3F7S A;  3STD A;  2F99 A;  5CLK A;  5IEN A;  4X2O A;  4HVN A;  4KVH A;  2CHC A;  4L8P A;  2B24 B;  2PZV A;  3RGR A;  1VZZ A;  8CHO A;  4U13 A;  3OWS A;  1E3R A;  3JUN A;  1U5O A;  2HMK B;  5IEP A;  1OHS A;  1W6Y A;  4K1U A;  3BLZ A;  1O7N B;  2R4I A;  3EHC A;  3LZA A;  4J9A A;  5JPP A;  5TGN A;  2IMJ A;  3FF0 A;  4HM3 B;  4XM4 A;  5G2G A;  2B1X B;  1AR0 A;  2INX A;  3DMC A;  4XBX A;  3VGN A;  3ECF A;  3NXJ A;  3VSY A;  1OH0 A;  5AEW B;  4WWU C;  1SJW A;  1GY5 A;  3S5C A;  3FKA A;  4R9K A;  2W2C A;  1OGZ A;  4L7K A;  2HMJ B;  1GY7 A;  1DMQ A;  1JB2 A;  3EN1 B;  5IG0 A;  2XR8 B;  3MG1 A;  5BXQ A;  4HM5 B;  1A2K A;  3M8C A;  3CPO A;  4Q53 A;  4HZB B;  4R1K A;  5KP4 A;  1TUH A;  1O7H B;  3JUQ A;  3DXO A;  2BMO B;  4ORL A;  1NWW A;  1W01 A;  2GEX A;  7STD A;  3B4P A;  3F14 A;  3KKG A;  2QGU A;  2GEY A;  2GBW B;  4HM1 B;  3MG3 A;  1ULJ B;  2RGQ A;  3OV4 A;  2XSO B;  3D9R A;  1EA2 A;  2GXF A;  3T8U A;  3CNX A;  1Q42 A; 
#chains in the Genus database with same CATH topology
 2I9W A;  2XRX B;  3SVA A;  5IG3 A;  2OQE C;  2UX0 A;  1TP6 A;  3KZT A;  5CXO A;  2ZHX B;  2C10 A;  3WDG B;  4STD A;  1BRS A;  5IG5 A;  1IK3 A;  6GSP A;  1QAF A;  1VQN 3;  1YVB I;  2CW9 A;  2F98 A;  3EB8 A;  2HMM B;  4N6U A;  5FW5 A;  1DMN A;  2CFW A;  5M19 A;  4GL6 A;  1OGX A;  3LTB A;  5IF6 A;  5DRV A;  1NJI 4;  3X40 A;  3IJE B;  3UNL A;  1RCL A;  1CQS A;  2K54 A;  1KSI A;  1K41 A;  1G02 A;  1RGF A;  3BND A;  1Y4K A;  4J5K A;  3GAX A;  2BIR A;  1ROA A;  5M1A A;  3WOE B;  2FGT A;  3H51 A;  4I4K A;  4FCZ A;  3GZR A;  4BU4 A;  1LNH A;  4HAA A;  5KP1 A;  3RGA A;  1TFK A;  4CCV A;  1WMP A;  4BL3 A;  3F7X A;  1X1Y A;  3Q3F A;  4KFD A;  3J7Y d;  4XDW A;  2K0M A;  3L0R A;  3Q90 A;  3K9M C;  1LOY A;  4K1V A;  1GOU A;  2OOV A;  1JV2 B;  3SOA A;  1T5Y A;  2GBX B;  4BTY A;  1KD1 4;  3MKI A;  2UGI A;  1RNB A;  1Q86 4;  3FSD A;  4LSO A;  1ZO2 A;  2FNQ A;  1GMP A;  1BSB A;  1JJ2 2;  4KT3 B;  1VQO 3;  1YJW 3;  2F5W A;  5D83 A;  3V98 A;  1MNL A;  1PY3 A;  2SAR A;  2Z76 A;  2PNC A;  3B4O A;  3LTC A;  3LOY A;  3JUM A;  3EQQ B;  4HM0 B;  1NO3 A;  2ZL8 A;  2XF3 A;  2KAA A;  4FMA A;  3CCL 3;  1IQX A;  4BL2 A;  2SBL A;  4AKY A;  3CCM 3;  1OF5 A;  2RNT A;  7RNT A;  3Q2P A;  1FW7 A;  3EF8 A;  4NPB A;  5CF1 A;  4EBG A;  2GU1 A;  3GSP A;  1CYU A;  2D1W A;  3KII A;  5JPU A;  5LC7 A;  6STD A;  2Z77 A;  2OWP A;  1UUW B;  4RZM A;  1TU5 A;  1IVX A;  3EBT A;  2RCD A;  3FZW A;  4G1M B;  1IDP A;  4FCJ A;  1IVU A;  1FUT A;  1NDO B;  2GSP A;  1WNH A;  1DET A;  1BRJ A;  3FG4 A;  3GZY B;  1BNF A;  3I0Y A;  3KSE D;  2CKF B;  1QAL A;  2CFG A;  3U1W A;  1R4C A;  2W03 A;  1C7H A;  4IIA A;  1QVF 2;  3WOF B;  4RNZ A;  2BT3 A;  5ELU A;  1RGE A;  3U97 A;  1ULI B;  4LEH A;  1I0X A;  3MG2 A;  4KFF A;  3KE7 A;  3I56 3;  3AGO A;  1BRK A;  2KXG A;  2YFI B;  2XSH B;  3WA3 A;  1AY7 A;  1E97 A;  2W04 A;  1RGC A;  1B27 A;  1NU3 A;  4HM4 B;  2W9P A;  4XB5 A;  1I70 A;  3HII A;  4NRE A;  1JRQ A;  1VQ5 3;  3CNM A;  1MGR A;  3DH2 A;  2BMR B;  1I8V A;  5CF2 A;  1GYB A;  1OAC A;  1PFP A;  2Q07 A;  3OX9 A;  1BRI A;  2E2V A;  2XGN A;  2BU4 A;  3KFQ C;  2OOV C;  3CMA 3;  4PEJ A;  1I3I A;  4QWT A;  1HZ1 A;  1EKM A;  3NHX A;  3JUP A;  2W9Q A;  3D5G A;  3B8L A;  4GSP A;  3SLU A;  1W6C A;  2W0Q A;  2MC8 A;  4OUQ A;  4RBN A;  1GD3 A;  1TJD A;  3RDE A;  3NBB A;  1TRP A;  4N6T A;  8RNT A;  1FA3 A;  3NV0 B;  3V99 A;  5G1K A;  3DGL A;  3FGY A;  4IT7 A;  2LQV A;  3WA2 X;  1I2G A;  3GWR A;  2YFL B;  3NBJ A;  4HKV B;  3AHW A;  1G0T A;  2KF5 A;  1RRL A;  3ER7 A;  5AII A;  1FZU A;  3SXX A;  1WTH A;  3ALA A;  3G8Z A;  1RGG A;  3F8H A;  1BNI A;  3SOY A;  1HYF A;  2STD A;  3NM7 A;  4TX4 A;  1EUI C;  1BRH A;  5I97 A;  3Q1C A;  5AIF A;  2D42 A;  2P0X A;  1TFO A;  1OCV A;  2F86 B;  3H3H A;  3T8N A;  5BU4 A;  3IPT A;  1RKY A;  1M1K 4;  1D6Z A;  1IV9 A;  1RJO A;  1NNV A;  1MWR A;  1YGE A;  3UB1 A;  1A2P A;  5AYS C;  1RCK A;  1RHL A;  3HK4 A;  1W7C A;  3K7C A;  4R4K A;  1V58 A;  3NBR A;  4K61 A;  3MYT A;  1W2B 2;  3OWU A;  3JUO A;  2OTJ 3;  1FGR A;  1BSA A;  1JKG B;  2AAE A;  3G16 A;  3S28 A;  1JNQ A;  2CWU A;  1D6Y A;  1RLS A;  4HJL B;  3CU3 A;  1LXE A;  1BU4 A;  4HM8 B;  1ROV A;  4OVM A;  3EBY A;  3HX8 A;  1OHO A;  3NV0 A;  4BIR A;  1STD A;  1S5A A;  4FCM A;  4MMX B;  1IU7 A;  4BTX A;  2CG0 A;  1JB4 A;  1OF5 B;  1Q40 B;  1SII A;  1T2H A;  3HZP A;  5IEO A;  3KSP A;  1GS3 A;  1RMS A;  4J5G A;  1M1X B;  1UUG B;  3DUK A;  3WMD A;  3D5I A;  1BUJ A;  1V74 A;  2RFR A;  4CJN A;  3D79 A;  1VQM 3;  1V57 A;  1UCJ A;  2KCD A;  3HIG A;  5ELJ A;  4CDL A;  6RNT A;  1LQG C;  1O7M B;  1UCI A;  1LOX A;  1LQM B;  3NQZ A;  1ZX2 A;  3WHO A;  1GMQ A;  2JDI H;  2A15 A;  3F8X A;  1GD4 A;  1O7G B;  2JQ5 A;  4FMB A;  1JBS A;  3CCQ 3;  3CCU 3;  4WYK B;  5AIH A;  3FCS B;  1WMO A;  1RRH A;  1FUS A;  2QIY A;  3BNB A;  1QJG A;  4JF8 A;  4WHA A;  4BTW A;  3OW2 2;  5HOH A;  4N3V A;  4N6O B;  1IYY A;  1Z1S A;  3F9S A;  3SED A;  1W4N A;  3DZL A;  4H3U A;  4MMZ B;  1JKG A;  1UGH I;  3UJM A;  3DGM A;  3UL6 A;  1VQK 3;  3MSO A;  4HM2 B;  3N9H A;  5AI1 A;  1OHP A;  2L4V A;  4EC6 A;  4GB5 A;  1GY6 A;  3PXM A;  1EEJ A;  3ROB A;  5M18 A;  2CC3 A;  1TRQ A;  1EG9 B;  2CFD A;  1Q40 A;  1PYL A;  2F5M A;  3FF2 A;  3EJV A;  1G96 A;  1SIH A;  3UL5 A;  3URP A;  2BNG A;  3V92 A;  1NB3 I;  1BAN A;  4HZ9 B;  1HKX A;  3FLJ A;  3WOD G;  2H0G A;  1W2Z A;  1E3V A;  1VQ4 3;  1ISK A;  5EVH A;  3BB9 A;  4IPB A;  4R9L A;  1BSD A;  3NM2 A;  2P09 A;  1LOW A;  5IW9 A;  4XDV A;  2C4B A;  2CX0 A;  4N6M A;  3GZX B;  3NUV A;  2CFL A;  1ASK A;  1F8N A;  3K5T A;  1DMM A;  1BVI A;  4WYK A;  3BNE A;  4J8T A;  2W6J H;  5HGR A;  1BGS A;  4L8O A;  1N9E A;  2IA7 A;  3DM8 A;  5AEU B;  2QEX 3;  2C11 A;  1UW1 A;  2CX1 A;  1R4Y A;  1UUV B;  3F40 A;  3G0K A;  1KC8 4;  2IYJ A;  3OWY A;  1O7P B;  4FR9 A;  1LNI A;  5STD A;  9RNT A;  1O7W B;  1RGH A;  1OUN A;  1C54 A;  5CK6 A;  1YVS A;  4ZM8 A;  3A76 A;  2CG1 A;  3FH1 A;  2E2T A;  1Q81 4;  2CWV A;  1RGK A;  2HMN B;  3EX9 A;  3PZW A;  2MF7 A;  2P0M A;  4GHO A;  1N8R 4;  3B7C A;  4O3V A;  1W02 A;  2Y74 A;  2BO9 B;  3PS8 A;  3MHE A;  2IUJ A;  3S67 A;  1DE3 A;  1T3B A;  4DKI A;  1RGA A;  1U8C B;  1BAO A;  2Y73 A;  3A5E A;  5AIG A;  3X3Y A;  1JN5 B;  4AEQ A;  4EYC A;  1N5P A;  5DRE A;  1BSC A;  1X1W A;  3BNC A;  3CCR 3;  2YFJ B;  3EN8 A;  3LYG A;  1Q7Y 4;  3CCJ 3;  1TIJ A;  2F56 A;  3LT9 A;  4N6V 0;  3I55 3;  3HOH A;  1SAR A;  1LRA A;  1RN1 A;  1JZD A;  3EC9 A;  3BU4 A;  4EXR A;  1X1X A;  3DGY A;  4WP5 A;  1IQ8 A;  1N8Q A;  1UI8 A;  4XBT A;  1AV4 A;  1L5G B;  1B3S A;  5D82 A;  2CFK A;  3K0Z A;  3G6E 3;  1RN4 A;  1GOY A;  1WQL B;  1W5Z A;  1VQ6 3;  4MJD A;  2HML B;  4H61 A;  3X42 A;  1MOL A;  3AMO B;  2HOH A;  1B20 A;  2XFT A;  3GZB A;  1BUQ A;  1BSE A;  2BMQ B;  4X2H A;  1K28 A;  1AQZ A;  2KF3 A;  4LGQ A;  1YIT 3;  2RBI A;  3SX1 A;  1FUW A;  4O02 B;  2WOF A;  2Z7A A;  1LVN A;  5IER A;  1BNJ A;  2GU3 A;  3E99 A;  2XH9 A;  1S72 3;  1FGT A;  2RSX A;  4XBY A;  5BVB A;  1JN5 A;  5IG4 A;  4HM7 B;  4MMY B;  3PCR A;  1W00 A;  2P05 A;  2H0I A;  1JB5 A;  2IY2 A;  1K8A 4;  1MGW A;  2HMO B;  1TTO A;  3DGN A;  1BNE A;  4MEI A;  1BNS A;  3OXA A;  4LMI A;  4OK0 A;  2Z6B A;  1BRN L;  2OCT A;  5KP3 A;  1FYS A;  1VQ7 3;  4HM6 B;  1DVC A;  1UGI A;  3BIR A;  3GRD A;  1B2M A;  1OPY A;  1QMA A;  1BNG A;  1BOX A;  1FGQ A;  2CK3 H;  3F7S A;  3HI7 A;  4N6N B;  1US1 A;  3STD A;  1B2X A;  2F99 A;  2KRT A;  5D81 A;  1CYV A;  5CLK A;  2WO0 A;  5IEN A;  2M7O A;  4R80 A;  4X2O A;  4HVN A;  4ILF A;  1UCL A;  3AMO A;  3LH4 A;  3N8B A;  4HBR A;  1BNR A;  3EE1 A;  4KFE A;  3VF1 A;  3NX0 A;  3CXC 2;  1AVK A;  4KVH A;  2CHC A;  3ZFZ A;  4CPK A;  5EEO A;  1QVG 2;  4NHF A;  1K9M 4;  1GMR A;  2B24 B;  2PZV A;  3PCS A;  4FMD A;  4KZ1 A;  4L8P A;  3FG3 A;  3S27 A;  1EQK A;  3G4S 3;  3RGR A;  4LZI A;  1N9J A;  1A90 A;  2UUG C;  1VZZ A;  8CHO A;  4U13 A;  3D3L A;  2E2U A;  2ML5 A;  3CCV 3;  1LOV A;  3T8U A;  3CC7 3;  3X41 A;  1I3F A;  2O9U X;  1E3R A;  3JUN A;  1RSN A;  1U5O A;  1YGW A;  3PYJ A;  2HMK B;  3TDG A;  5IEP A;  1OHS A;  1ZS7 A;  1W6Y A;  1Q82 4;  1MWU A;  4K1U A;  3BLZ A;  1O7N B;  2R4I A;  3EHC A;  3LZA A;  4I5Q A;  4J9A A;  5JPP A;  4EV5 A;  1SQW A;  1W6G A;  3N54 B;  2V1L A;  5TGN A;  3KN4 A;  1M90 4;  3CPW 2;  3ZG0 A;  2IMJ A;  1ZGX A;  2WGQ A;  1RGL A;  5AYR B;  3X3X A;  1RN7 A;  1DYU A;  2CIU A;  3FF0 A;  3RNT A;  2H0H A;  4HM3 B;  4RNY A;  1D6U A;  4XM4 A;  5G2G A;  1RNT A;  1CEW I;  3O8Y A;  1YIJ 3;  2B1X B;  1KQS 2;  1PU4 A;  1STF I;  1AR0 A;  3LML A;  1SPU A;  1BRG A;  1DVD A;  1MWS A;  5G1L A;  2IUK A;  3QRD A;  4LYL B;  2INX A;  3SYU A;  4WFO A;  3DMC A;  2ZA4 A;  4XBX A;  3ZG5 A;  2KF6 A;  3MPH A;  1A67 A;  3CC2 3;  2FXT A;  2R41 A;  3ECF A;  3NXJ A;  3VGN A;  3VSY A;  1VQP 3;  1OH0 A;  5AEW B;  2P38 A;  1B2Z A;  1YJN 3;  4WWU C;  3S29 A;  1IT7 A;  1SJW A;  3LTD A;  1GY5 A;  1IQY A;  3CC4 3;  3S5C A;  3FKA A;  4K90 B;  1IVV A;  4R9K A;  1WMN A;  3QK9 A;  2W2C A;  2O3O A;  4EW5 A;  1UI7 A;  2W56 B;  2K3D A;  1IT8 A;  1OGZ A;  4L7K A;  3CCE 3;  1JBR A;  1JZO A;  1YNV X;  1YHQ 3;  1I2E A;  4N6L A;  1VQL 3;  3G71 3;  2XEP A;  5EQL A;  2HMJ B;  1RDS A;  1GY7 A;  1QAK A;  2WOH A;  2F4Y A;  1B2U A;  2AAD A;  3D4A A;  2OQE A;  1VQ9 3;  1DMQ A;  1JB2 A;  2L1S A;  1B21 A;  3MWZ A;  1FGO A;  2ZDJ A;  7GSP A;  4EV2 A;  3EN1 B;  3LXU X;  4JRF A;  5IG0 A;  5RNT A;  3CD6 3;  1GOV A;  2XR8 B;  3MG1 A;  1Q7H A;  1BIR A;  2XGL A;  2CWT A;  1AVL A;  4HYZ A;  1RTU A;  5BXQ A;  3JVC A;  4HM5 B;  1KWI A;  1A2K A;  1CH0 A;  3M8C A;  4HOH A;  1UCK A;  3CPO A;  3LTA A;  1N5H A;  4Q53 A;  2KF4 A;  1M9G A;  2CH9 A;  5LC6 A;  1NB5 I;  1YJ9 3;  4HZB B;  4R1K A;  1FGM A;  4AKZ A;  1YI2 3;  5KP4 A;  3AHS A;  1TUH A;  3PGB A;  5GSP A;  3X3Z A;  1IV7 A;  1O7H B;  1JBT A;  1VQ8 3;  3AGN A;  1UDI I;  5BIR A;  1IVW A;  2J8X B;  2YX9 A;  3JUQ A;  1T2I A;  2W56 A;  2WGO A;  3DXO A;  5FGO A;  2BMO B;  4ORL A;  3KCH A;  1NWW A;  1W01 A;  3DY5 A;  2GEX A;  1I2F A;  3FG1 A;  1B2S A;  2OTL 3;  1HU9 A;  7STD A;  1VQQ A;  2LYX A;  3B4P A;  3F14 A;  3KKG A;  2QGU A;  2GEY A;  3DGO A;  4O8S A;  4RNT A;  2GBW B;  5A0O B;  1GSP A;  4HM1 B;  5JBS A;  1Q9E A;  2BHM A;  2XFS A;  3MG3 A;  1ULJ B;  1A2V A;  3LT8 A;  1I0V A;  2RGQ A;  3WR2 A;  1X1U A;  4O2H A;  3IMA B;  3CCS 3;  3OV4 A;  2QA4 3;  3K63 A;  3T0U A;  4FMC A;  2XSO B;  3D9R A;  2ML6 A;  1EA2 A;  1K73 4;  2GXF A;  3CME 3;  1MWT A;  1J2B A;  3NQY A;  3OWS A;  3CNX A;  1Q42 A; 
#chains in the Genus database with same CATH homology
 2I9W A;  2XRX B;  3SVA A;  5IG3 A;  2OQE C;  2UX0 A;  1TP6 A;  3KZT A;  5CXO A;  3WDG B;  2C10 A;  4STD A;  5IG5 A;  1IK3 A;  1VQN 3;  1QAF A;  1YVB I;  2CW9 A;  2F98 A;  3EB8 A;  2HMM B;  4N6U A;  5FW5 A;  1DMN A;  2CFW A;  4GL6 A;  1OGX A;  3LTB A;  5IF6 A;  5DRV A;  1NJI 4;  3X40 A;  3IJE B;  3UNL A;  1CQS A;  2K54 A;  1KSI A;  1K41 A;  3BND A;  1Y4K A;  3GAX A;  1ROA A;  3WOE B;  2FGT A;  3H51 A;  4I4K A;  4FCZ A;  3GZR A;  1LNH A;  5KP1 A;  3RGA A;  1TFK A;  4CCV A;  1WMP A;  3F7X A;  4KFD A;  3J7Y d;  4XDW A;  2K0M A;  3L0R A;  3Q90 A;  3K9M C;  4K1V A;  2OOV A;  1JV2 B;  3SOA A;  1T5Y A;  2GBX B;  4BTY A;  1KD1 4;  3MKI A;  1Q86 4;  3FSD A;  4LSO A;  1ZO2 A;  2FNQ A;  1JJ2 2;  1VQO 3;  1YJW 3;  5D83 A;  3V98 A;  1MNL A;  2Z76 A;  2PNC A;  3B4O A;  3LTC A;  3LOY A;  3JUM A;  3EQQ B;  4HM0 B;  1NO3 A;  2ZL8 A;  2XF3 A;  4FMA A;  3CCL 3;  1IQX A;  2SBL A;  4AKY A;  3CCM 3;  1OF5 A;  3Q2P A;  3EF8 A;  5CF1 A;  4EBG A;  2GU1 A;  1CYU A;  2D1W A;  3KII A;  5JPU A;  5LC7 A;  6STD A;  2Z77 A;  2OWP A;  1UUW B;  4RZM A;  1TU5 A;  1IVX A;  3EBT A;  2RCD A;  3FZW A;  4G1M B;  1IDP A;  4FCJ A;  1IVU A;  1NDO B;  3FG4 A;  3GZY B;  1WNH A;  3I0Y A;  3KSE D;  1PU4 A;  2CKF B;  1QAL A;  2CFG A;  3U1W A;  1R4C A;  2W03 A;  1C7H A;  4IIA A;  1QVF 2;  3WOF B;  4RNZ A;  2BT3 A;  5ELU A;  3U97 A;  1ULI B;  4LEH A;  3MG2 A;  4KFF A;  3KE7 A;  3I56 3;  2KXG A;  2YFI B;  2XSH B;  3WA3 A;  1E97 A;  2W04 A;  4HM4 B;  1NU3 A;  4XB5 A;  2W9P A;  3HII A;  4NRE A;  1JRQ A;  1VQ5 3;  3CNM A;  2BMR B;  5CF2 A;  1GYB A;  1OAC A;  1PFP A;  2Q07 A;  3OX9 A;  2E2V A;  2XGN A;  3KFQ C;  2OOV C;  3CMA 3;  4PEJ A;  4QWT A;  1EKM A;  3NHX A;  3JUP A;  2W9Q A;  3B8L A;  3SLU A;  1W6C A;  2W0Q A;  2MC8 A;  4OUQ A;  4RBN A;  1GD3 A;  3RDE A;  3NBB A;  4N6T A;  1FA3 A;  3NV0 B;  3V99 A;  3DGL A;  3FGY A;  4IT7 A;  2LQV A;  3WA2 X;  3GWR A;  2YFL B;  3NBJ A;  4HKV B;  1RRL A;  3ER7 A;  5AII A;  3SXX A;  1WTH A;  3ALA A;  3G8Z A;  3F8H A;  3SOY A;  2STD A;  3NM7 A;  4TX4 A;  5I97 A;  3Q1C A;  5AIF A;  2D42 A;  2P0X A;  1TFO A;  1OCV A;  2F86 B;  3H3H A;  3T8N A;  1RKY A;  3IPT A;  1M1K 4;  1D6Z A;  1IV9 A;  1RJO A;  1YGE A;  3UB1 A;  5AYS C;  3HK4 A;  1W7C A;  3K7C A;  4R4K A;  3NBR A;  4K61 A;  3MYT A;  1W2B 2;  3OWU A;  3JUO A;  2OTJ 3;  1FGR A;  1JKG B;  3G16 A;  3S28 A;  1JNQ A;  2CWU A;  1D6Y A;  4HJL B;  3CU3 A;  1LXE A;  4HM8 B;  1ROV A;  4OVM A;  3EBY A;  3HX8 A;  1OHO A;  3NV0 A;  1STD A;  1S5A A;  4FCM A;  4MMX B;  1IU7 A;  4BTX A;  2CG0 A;  1JB4 A;  1OF5 B;  1Q40 B;  1SII A;  3HZP A;  5IEO A;  3KSP A;  1GS3 A;  1M1X B;  3DUK A;  3WMD A;  1V74 A;  2RFR A;  1VQM 3;  2KCD A;  3HIG A;  5ELJ A;  4CDL A;  1O7M B;  1LOX A;  3NQZ A;  1ZX2 A;  2JDI H;  2A15 A;  3F8X A;  1GD4 A;  1O7G B;  2JQ5 A;  4FMB A;  3CCQ 3;  3CCU 3;  4WYK B;  5AIH A;  3FCS B;  1RRH A;  1WMO A;  2QIY A;  3BNB A;  5D81 A;  1QJG A;  4JF8 A;  4WHA A;  4BTW A;  3OW2 2;  4N3V A;  4N6O B;  1Z1S A;  3F9S A;  3SED A;  1W4N A;  3DZL A;  4H3U A;  4MMZ B;  1JKG A;  3UJM A;  3DGM A;  3UL6 A;  1VQK 3;  3MSO A;  4HM2 B;  3N9H A;  5AI1 A;  1OHP A;  2L4V A;  4EC6 A;  4GB5 A;  1GY6 A;  3PXM A;  3ROB A;  2CC3 A;  1EG9 B;  2CFD A;  1Q40 A;  3FF2 A;  3EJV A;  1G96 A;  1SIH A;  3UL5 A;  3V92 A;  2BNG A;  3WOD G;  1NB3 I;  4HZ9 B;  1HKX A;  3FLJ A;  1W2Z A;  1E3V A;  1VQ4 3;  1ISK A;  5EVH A;  3BB9 A;  4IPB A;  4R9L A;  3NM2 A;  2P09 A;  5IW9 A;  4XDV A;  4N6M A;  3GZX B;  3NUV A;  2CFL A;  1ASK A;  1F8N A;  3K5T A;  1DMM A;  4WYK A;  3BNE A;  4J8T A;  2W6J H;  5HGR A;  4L8O A;  1N9E A;  2IA7 A;  3DM8 A;  5AEU B;  2QEX 3;  2C11 A;  1UW1 A;  1UUV B;  3F40 A;  3G0K A;  1KC8 4;  3OWY A;  1O7P B;  4FR9 A;  5STD A;  1O7W B;  1OUN A;  5CK6 A;  4ZM8 A;  3A76 A;  2CG1 A;  3FH1 A;  2E2T A;  1Q81 4;  2CWV A;  2HMN B;  3EX9 A;  3PZW A;  2MF7 A;  2P0M A;  1N8R 4;  3B7C A;  4O3V A;  1W02 A;  2Y74 A;  2BO9 B;  3PS8 A;  3MHE A;  2IUJ A;  3S67 A;  1U8C B;  2Y73 A;  4AEQ A;  5AIG A;  3X3Y A;  1JN5 B;  4EYC A;  1N5P A;  5DRE A;  3BNC A;  3CCR 3;  2YFJ B;  3EN8 A;  3LYG A;  1Q7Y 4;  3CCJ 3;  1TIJ A;  3LT9 A;  4N6V 0;  3I55 3;  3EC9 A;  4EXR A;  4WP5 A;  1IQ8 A;  1N8Q A;  1UI8 A;  4XBT A;  1AV4 A;  1L5G B;  5D82 A;  2CFK A;  3K0Z A;  3G6E 3;  1W5Z A;  1WQL B;  1VQ6 3;  4MJD A;  2HML B;  4H61 A;  3X42 A;  1MOL A;  3AMO B;  2XFT A;  3GZB A;  1BUQ A;  2BMQ B;  4X2H A;  1K28 A;  4LGQ A;  1YIT 3;  3SX1 A;  1FUW A;  4O02 B;  2WOF A;  2Z7A A;  1LVN A;  5IER A;  2GU3 A;  3E99 A;  2XH9 A;  1S72 3;  1FGT A;  2RSX A;  4XBY A;  5BVB A;  1JN5 A;  5IG4 A;  4HM7 B;  4MMY B;  3PCR A;  1W00 A;  2P05 A;  1JB5 A;  1K8A 4;  2HMO B;  3DGN A;  4MEI A;  3OXA A;  4LMI A;  4OK0 A;  2Z6B A;  2OCT A;  5KP3 A;  1VQ7 3;  4HM6 B;  1DVC A;  3GRD A;  1OPY A;  1QMA A;  3F7S A;  1FGQ A;  2CK3 H;  3STD A;  3HI7 A;  4N6N B;  1US1 A;  2F99 A;  2KRT A;  1CYV A;  5CLK A;  2WO0 A;  5IEN A;  2M7O A;  4R80 A;  4X2O A;  4HVN A;  3AMO A;  3LH4 A;  3N8B A;  4HBR A;  3EE1 A;  4KFE A;  3VF1 A;  3NX0 A;  3CXC 2;  1AVK A;  4KVH A;  2CHC A;  5EEO A;  1QVG 2;  4NHF A;  1K9M 4;  4L8P A;  2B24 B;  2PZV A;  3PCS A;  4FMD A;  4KZ1 A;  3S27 A;  3FG3 A;  1EQK A;  3G4S 3;  3RGR A;  4LZI A;  1N9J A;  1A90 A;  1VZZ A;  8CHO A;  4U13 A;  3D3L A;  2E2U A;  2ML5 A;  3CCV 3;  3T8U A;  3CC7 3;  3X41 A;  2O9U X;  1E3R A;  3JUN A;  1U5O A;  3PYJ A;  2HMK B;  3TDG A;  5IEP A;  1OHS A;  1W6Y A;  1Q82 4;  4K1U A;  3BLZ A;  1O7N B;  2R4I A;  3EHC A;  3LZA A;  4J9A A;  5JPP A;  4EV5 A;  1SQW A;  1W6G A;  3N54 B;  2V1L A;  5TGN A;  3KN4 A;  1M90 4;  3CPW 2;  2IMJ A;  2WGQ A;  5AYR B;  3X3X A;  1RN7 A;  1DYU A;  2CIU A;  3FF0 A;  4HM3 B;  4RNY A;  1D6U A;  4XM4 A;  5G2G A;  1CEW I;  3O8Y A;  1YIJ 3;  2B1X B;  1KQS 2;  1STF I;  1AR0 A;  3LML A;  1SPU A;  1DVD A;  2IUK A;  3QRD A;  2INX A;  4WFO A;  3DMC A;  4XBX A;  1A67 A;  3MPH A;  3CC2 3;  2FXT A;  3VGN A;  3ECF A;  3NXJ A;  3VSY A;  1VQP 3;  1OH0 A;  5AEW B;  2P38 A;  1YJN 3;  4WWU C;  3S29 A;  1IT7 A;  1SJW A;  3LTD A;  1GY5 A;  1IQY A;  3CC4 3;  3S5C A;  3FKA A;  4K90 B;  1IVV A;  4R9K A;  1WMN A;  3QK9 A;  2W2C A;  2O3O A;  1UI7 A;  2W56 B;  3CCE 3;  1IT8 A;  1OGZ A;  4L7K A;  1YHQ 3;  4N6L A;  1VQL 3;  3G71 3;  2XEP A;  5EQL A;  2HMJ B;  1GY7 A;  1QAK A;  2WOH A;  2OQE A;  1VQ9 3;  1DMQ A;  1JB2 A;  3MWZ A;  1FGO A;  2ZDJ A;  4EV2 A;  3EN1 B;  3LXU X;  4JRF A;  5IG0 A;  3CD6 3;  2XR8 B;  3MG1 A;  2XGL A;  2CWT A;  1AVL A;  4HYZ A;  5BXQ A;  3JVC A;  4HM5 B;  1KWI A;  1A2K A;  3M8C A;  3CPO A;  3LTA A;  1N5H A;  4Q53 A;  1NB5 I;  1M9G A;  2CH9 A;  5LC6 A;  1YJ9 3;  4HZB B;  4R1K A;  1FGM A;  4AKZ A;  1YI2 3;  5KP4 A;  1TUH A;  3PGB A;  3X3Z A;  1IV7 A;  1O7H B;  1VQ8 3;  1IVW A;  2YX9 A;  3JUQ A;  2W56 A;  2WGO A;  3DXO A;  5FGO A;  2BMO B;  4ORL A;  1NWW A;  1W01 A;  3DY5 A;  2GEX A;  3FG1 A;  2OTL 3;  1HU9 A;  7STD A;  3B4P A;  2LYX A;  3F14 A;  3KKG A;  4O8S A;  2QGU A;  2GEY A;  3DGO A;  2GBW B;  5A0O B;  4HM1 B;  5JBS A;  3MG3 A;  2BHM A;  2XFS A;  1ULJ B;  1A2V A;  3LT8 A;  2RGQ A;  4O2H A;  3IMA B;  3CCS 3;  3OV4 A;  2QA4 3;  3K63 A;  3T0U A;  4FMC A;  2XSO B;  3D9R A;  2ML6 A;  1EA2 A;  1K73 4;  2GXF A;  3CME 3;  1J2B A;  3NQY A;  3OWS A;  3CNX A;  1Q42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...