2RGQA

Crystal structure of a protein of unknown function with a cystatin-like fold (npun_r3134) from nostoc punctiforme pcc 73102 at 1.80 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
MELTALDKLEIMELAARFEMSLDKEDVENYLATFASDGALQGFWGIAKGKEELRQGFYAMLDTFARGKRHCSSNAIIQGNYDEATMESYLTVVNREDLNRAGSAFVKDQVRKINGKWYLILRQIEVDPSLPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Domain of Unknown Function with a Cystatin-Like Fold
publication title Crystal Structure of Domain of Unknown Function with a Cystatin-Like Fold (ZP_00111510.1) from Nostoc punctiforme PCC 73102 at 1.80 A resolution
rcsb
source organism Nostoc punctiforme
total genus 32
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2rgqA00
3NXJA 2B1XB 4XBTA 4Q53A 3LZAA 3JUMA 2INXA 4WWUC 4L8OA 2BMQB 4HJLB 5IF6A 4OVMA 3ECFA 3NUVA 5AIGA 1OCVA 1O7MB 2BMRB 4HM3B 4LMIA 4X2HA 2HMJB 3G0KA 1JKGB 5HGRA 1GY7A 1NDOB 2Z7AA 5CLKA 3CPOA 3MG1A 3GWRA 4N3VA 1NWWA 3GZYB 2F86B 3FLJA 5IG0A 5CF2A 3WMDA 4XDWA 3SOYA 3F14A 3F8XA 1E97A 3IPTA 3GZXB 3KZTA 2XSOB 3F8HA 1OGXA 1STDA 2BMOB 2K54A 2QGUA 1E3VA 2YFLB 3DXOA 1UUVB 5FW5A 3OWSA 5D81A 3F40A 4OUQA 4HM1B 3KKGA 3DM8A 1W01A 2PZVA 1OH0A 3H3HA 5IENA 3RGRA 5BVBA 4K1VA 1GS3A 2HMNB 1U5OA 1O7WB 2HMOB 5AEWB 1DMMA 3RGAA 8CHOA 4HM2B 3MHEA 2I9WA 5TGNA 5AIFA 1C7HA 5JPUA 1OHSA 3T8UA 4RZMA 3S5CA 1JB2A 1Z1SA 3OXAA 2BNGA 3OWUA 1Q42A 2W2CA 1EG9B 3NBRA 1ASKA 3OWYA 4FCJA 4HM8B 4MJDA 3BLZA 5D82A 1GYBA 3VGNA 4LGQA 1UUWB 4L8PA 5KP4A 3JUNA 2GXFA 3SEDA 1JKGA 5IG3A 1ISKA 1DMQA 1GY6A 4R1KA 4K1UA 3H51A 2GBWB 4HM4B 5KP1A 3EBTA 1S5AA 1NU3A 1A2KA 3MSOA 3STDA 2F99A 2RCDA 4XDVA 3FF0A 4XBYA 3F7XA 3EBYA 3E99A 1QMAA 3OV4A 1Q40A 5IEOA 4HM7B 3EN8A 3NM2A 4XM4A 5DREA 2XSHB 4STDA 3HX8A 4WP5A 2GBXB 3DUKA 1W02A 3DZLA 5JPPA 1Q40B 1O7HB 3NV0B 4XB5A 3EF8A 5AIIA 1HKXA 5CK6A 3FGYA 5IERA 3MG3A 3B4OA 1OF5A 3B7CA 1BUQA 4LEHA 2GEXA 1TP6A 4GB5A 3CNMA 1OHOA 2QIYA 3EC9A 1OF5B 4HZ9B 4L7KA 1WQLB 3A76A 4KVHA 1VZZA 3G16A 1E3RA 2HMKB 3SOAA 1ZO2A 1W6YA 4HM5B 1JN5B 3ROBA 2STDA 3OX9A 4IIAA 2R4IA 2CKFB 1SJWA 4FCMA 2RFRA 3KE7A 2B24B 5G2GA 4WYKB 5IEPA 3FKAA 5AEUB 5EVHA 1QJGA 1O7PB 3EN1B 3I0YA 2YFJB 3GRDA 3GZRA 3EJVA 3UNLA 3MG2A 5AI1A 5STDA 3JUPA 2OWPA 4J9AA 4HKVB 3KSPA 1O7NB 4HM6B 2F98A 1GY5A 2A15A 1JB5A 5IG4A 1IDPA 1OUNA 2XRXB 3T8NA 3EQQB 1W00A 4XBXA 3CU3A 3FF2A 3NV0A 1EA2A 4R9LA 2XR8B 4I4KA 2UX0A 4HZBB 4H3UA 3F9SA 5CF1A 3DMCA 2HMMB 3NHXA 5KP3A 1ULJB 3G8ZA 1ZX2A 2Z77A 3FSDA 4X2OA 1K41A 3B8LA 4U13A 3FH1A 4PEJA 4CDLA 1CQSA 3K7CA 2Z76A 3CNXA 4HVNA 3EHCA 4J8TA 5AIHA 3JUOA 1OGZA 3FZWA 3MYTA 5D83A 3VSYA 3GZBA 1JN5A 1TUHA 2RGQA 1O7GB 4ORLA 2HMLB 2CHCA 2YFIB 1DMNA 3LYGA 3UJMA 3JUQA 5BXQA 3EX9A 4WYKA 7STDA 5CXOA 1ULIB 5IG5A 1JB4A 3HK4A 2GEYA 2IMJA 1OPYA 3BB9A 3F7SA 4R9KA 1OHPA 5DRVA 3D9RA 3M8CA 3B4PA 3HZPA 3Q90A 4HM0B 1AR0A 3MKIA 6STDA 3ER7A 3K0ZA 2JQ5A
chains in the Genus database with same CATH superfamily
4IT7A 1VQ93 7RNTA 1BU4A 3NXJA 2B1XB 4XBTA 2CX0A 4Q53A 2KAAA 3LZAA 4BU4A 4OK0A 1V57A 1QALA 3JUMA 3U97A 3G6E3 1DE3A 2BHMA 2INXA 1B3SA 3I553 1BIRA 4WWUC 2W6JH 1VQN3 1R4CA 1KQS2 1IVVA 4L8OA 3KFQC 1W2B2 2GU3A 2BMQB 3IMAB 3UB1A 1Q9EA 1A67A 2KXGA 3SVAA 3FG4A 1IQYA 2Y73A 4N6MA 3AGNA 4HJLB 5IF6A 1BRNL 5DRVA 4OVMA 3CD63 3ECFA 3CCE3 3NUVA 1YGWA 2PNCA 5AIGA 2F5WA 1OCVA 1O7MB 7GSPA 3DGNA 1VQ73 3WA2X 1PYLA 1I3IA 2BMRB 4HM3B 1IVWA 4LMIA 4IIAA 4X2HA 3WOEB 2HMJB 1AV4A 2SBLA 3FCSB 3G0KA 1JKGB 5HGRA 1GY7A 1NDOB 2Z7AA 1TRQA 3WHOA 2GSPA 5HOHA 1BUJA 1EUIC 4KFFA 5CLKA 4CPKA 3CPOA 2WOFA 5AYSC 3CCV3 3MG1A 5FGOA 3GWRA 3URPA 3G4S3 1UUGB 2XF3A 2CWUA 4N3VA 4EV2A 1N9EA 2OOVC 2KF3A 4FMDA 1NWWA 3X41A 1LQMB 2OTL3 1YJN3 3DGYA 1X1UA 4LSOA 3GZYB 2F86B 1YNVX 1TJDA 3FLJA 5IG0A 6GSPA 1I2EA 5CF2A 3S28A 3CMA3 3WMDA 2BO9B 1I70A 4XDWA 3SOYA 3F14A 1KD14 3F8XA 2KF6A 3LT8A 1E97A 1YIJ3 1R4YA 3IPTA 3GZXB 2BIRA 3KZTA 2XSOB 3SLUA 3F8HA 1OGXA 4CCVA 1STDA 2BMOB 2K54A 3DY5A 2H0HA 4RNZA 2AAEA 4BL3A 1X1XA 1MWSA 4KZ1A 1RCLA 1TIJA 2QGUA 3HIIA 6RNTA 1IYYA 4WHAA 3NQZA 1E3VA 3NQYA 1FUSA 1RCKA 2CW9A 3CCS3 1BRJA 1V74A 3D5GA 1WMPA 1VQ53 3CCU3 1LXEA 2YFLB 3DXOA 2WGQA 1UUVB 1BRSA 1LNIA 1JV2B 3BIRA 3K5TA 1CYVA 2F56A 4O3VA 5A0OB 3PYJA 1B2XA 3J7Yd 1VQ83 3CPW2 1BSDA 2BT3A 3OWSA 5D81A 5FW5A 1BVIA 2L4VA 3F40A 1YHQ3 1M1K4 1V58A 1VQ63 3Q1CA 4HM1B 4OUQA 3KKGA 3DM8A 1S723 2OCTA 1W01A 2PZVA 3CC73 1OH0A 3H3HA 5IENA 3RGRA 4I5QA 5BVBA 4K1VA 1TFKA 4EXRA 1VQL3 1GS3A 1Q864 3GAXA 3BNEA 2HMNB 1U5OA 3SX1A 1M9GA 1BRGA 1STFI 2CFLA 2K3DA 1O7WB 2HMOB 1RMSA 2ML6A 1DMMA 2P09A 2M7OA 1EKMA 4QWTA 3RGAA 5AEWB 1JBSA 4N6NB 1J2BA 1CEWI 8CHOA 3PGBA 3X40A 4HAAA 1I2FA 3MHEA 4HM2B 1GSPA 1FGOA 2K0MA 2I9WA 3LOYA 1IU7A 3CCL3 4GL6A 5TGNA 3AMOA 1QAFA 4EC6A 1RJOA 1JBRA 5AIFA 2XH9A 1C7HA 4FMAA 1OACA 5JPUA 1OHSA 1B2MA 5I97A 4EV5A 3T8UA 4H61A 4RZMA 3S5CA 1BGSA 1JB2A 2C10A 3ZFZA 2R41A 1D6ZA 2XFTA 1CH0A 1FGTA 1Z1SA 3EE1A 3OXAA 2KRTA 2BNGA 3OWUA 4MMZB 4WFOA 4BIRA 2QEX3 1Q42A 1GOUA 1MNLA 2W2CA 3X3YA 1EG9B 3NBRA 2C11A 1ASKA 3OWYA 2FNQA 4FCJA 4HM8B 2Y74A 2W56A 1UDII 4FCZA 4GHOA 4ILFA 3BLZA 4MJDA 5D82A 4LZIA 9RNTA 1T2HA 2O9UX 3SYUA 1GYBA 2W04A 4LGQA 3VGNA 1UUWB 1Q7HA 1VQ43 1I3FA 3OW22 4L8PA 5KP4A 2P0XA 3JUNA 1W4NA 2GXFA 1B21A 1DVCA 3SEDA 4MEIA 1DVDA 1KSIA 1LOYA 1BRKA 1NJI4 3X3ZA 2CX1A 1JKGA 5JBSA 5IG3A 2OQEA 2GU1A 1Y4KA 4O8SA 1IVXA 4N6UA 3RDEA 1ISKA 1DMQA 2W56B 1JZOA 2CWTA 5M18A 1GOYA 3V98A 2XGNA 4EBGA 3DGMA 1DETA 1GY6A 2E2TA 2H0IA 4R1KA 1MGWA 3AHWA 1GD3A 4K1UA 5M1AA 3PS8A 1U8CB 3H51A 2CIUA 2GBWB 4HM4B 2CC3A 1W6CA 4KFDA 5KP1A 5LC6A 1TU5A 2AADA 3CC23 4HBRA 2LQVA 1GOVA 3ZG0A 3S29A 1RGEA 3EBTA 3UL6A 1UI7A 3D5IA 1S5AA 2Q07A 1QAKA 3I563 1YVSA 1UI8A 1NU3A 2UGIA 3L0RA 1A2KA 2IA7A 1A2VA 3MSOA 3FG3A 2RNTA 4J5GA 1BNGA 2FXTA 2HOHA 3N54B 1RNBA 1BSBA 1QVF2 1FUTA 4GSPA 1IQ8A 1RGGA 1NB3I 3GSPA 1ZGXA 3CC43 3STDA 2F99A 2RCDA 4XDVA 1F8NA 2RSXA 3FF0A 3X3XA 4XBYA 3F7XA 1WTHA 1KWIA 1GD4A 3EBYA 3BNDA 1IV9A 3E99A 3CCQ3 3ALAA 1LVNA 1QMAA 1UCIA 1YIT3 3LTAA 1A90A 4K90B 1MOLA 3EB8A 3OV4A 1Q40A 3Q3FA 5IEOA 4HM7B 4BTXA 3EN8A 3JVCA 2ZA4A 3NM2A 5BIRA 1FGQA 4JRFA 4XM4A 4AKYA 5DREA 4DKIA 2OQEC 2XSHB 3HX8A 4K61A 2F4YA 1LOXA 3NX0A 4STDA 1FUWA 4WP5A 1YGEA 3S67A 2GBXB 5ELUA 1RRLA 1W7CA 3MPHA 3DUKA 1RSNA 1RKYA 1W02A 2IUKA 3KCHA 1YI23 3UL5A 3DZLA 2SARA 5JPPA 1TRPA 1D6UA 2CFGA 2CFDA 1N5PA 1Q40B 4LYLB 4AEQA 1O7HB 1RGHA 3NV0B 1RGKA 1UCKA 4XB5A 2XFSA 1BNEA 1FW7A 3EF8A 5AIIA 2IY2A 1HKXA 5CK6A 2KF5A 5EQLA 2W9PA 4FR9A 1G02A 1BSEA 3ER7A 3FGYA 4NPBA 5M19A 5IERA 1SIIA 3MG3A 3B4OA 1KC84 3K9MC 1N8R4 1B2UA 1OF5A 3DH2A 3B7CA 1BUQA 4LEHA 2CWVA 4R4KA 1JBTA 1K734 4TX4A 1SIHA 3S27A 2GEXA 3NBBA 1I8VA 1JZDA 1RLSA 1TP6A 2W03A 4KFEA 1CYUA 3VF1A 1UCLA 1K8A4 3TDGA 1PY3A 3AHSA 4GB5A 2J8XB 3CNMA 2C4BA 1AY7A 1WMNA 4N6OB 1UGIA 1VQO3 1OHOA 2W0QA 3LMLA 3KN4A 3A5EA 1BNIA 1C54A 1W5ZA 2QIYA 3N9HA 3EC9A 3PZWA 3RNTA 1OF5B 3CCJ3 3PCRA 4HZ9B 4L7KA 4AKZA 1WQLB 1FZUA 1RDSA 2CFKA 1BNFA 1MWUA 1NNVA 1WNHA 3A76A 4KVHA 1BRIA 1VZZA 3G16A 3WR2A 1I0XA 1E3RA 2HMKB 3SOAA 3LT9A 1W6GA 2ZL8A 3HOHA 3HI7A 1ZO2A 2O3OA 2Z6BA 1VQP3 1FGRA 2E2VA 3FG1A 1HU9A 3D3LA 3PXMA 4G1MB 1W6YA 3WOFB 1JNQA 3SXXA 4HM5B 1US1A 1TTOA 3BU4A 1N5HA 1JN5B 2STDA 3ROBA 2ZHXB 2CFWA 1DYUA 1T3BA 1ZS7A 2R4IA 2CKFB 1SJWA 1G96A 3OX9A 1SQWA 4FMCA 1UW1A 2KF4A 4MMYB 4FCMA 4EW5A 1BNSA 1GMRA 1RGCA 2RFRA 5RNTA 3KE7A 2B24B 2ZDJA 5G2GA 4WYKB 1IK3A 1BOXA 5IEPA 3FKAA 1FA3A 2H0GA 2P38A 4KT3B 5AEUB 5EVHA 1QJGA 1O7PB 2E2UA 1D6YA 3EN1B 1I0VA 2QA43 1K28A 3I0YA 1SARA 2YFJB 1UCJA 3CCM3 3GRDA 1NB5I 1AVKA 3GZRA 1IT8A 3EJVA 1IV7A 1B2SA 3KIIA 1HZ1A 1RRHA 3UNLA 3MG2A 4BL2A 5AI1A 3T0UA 3CXC2 5STDA 3JUPA 1M1XB 2OWPA 4J9AA 1RN1A 2XGLA 5G1KA 4JF8A 2W9QA 1L5GB 3Q2PA 1BAOA 4HKVB 3KSPA 1ROAA 1FGMA 1O7NB 2RBIA 4HM6B 2OTJ3 2F98A 2A15A 1GY5A 2L1SA 5GSPA 1RGAA 3LH4A 1YJW3 1TFOA 3LXUX 2UUGC 1RTUA 3NBJA 1JB5A 2WGOA 1EQKA 2ML5A 5IG4A 1IVUA 1IDPA 1OUNA 2XRXB 3T8NA 3O8YA 5BU4A 1LOWA 3EQQB 4RBNA 1W00A 4XBXA 1LQGC 4NREA 3CU3A 1RHLA 1Q7Y4 4N6V0 2IUJA 1A2PA 1PFPA 3FF2A 3NV0A 1EA2A 3BNCA 1IT7A 4R9LA 2CK3H 1RGFA 3N8BA 2XR8B 4N6TA 1IQXA 4I4KA 5IW9A 2UX0A 1PU4A 1VQQA 4N6LA 3V92A 3WA3A 2D1WA 4HZBB 4CJNA 1LOVA 4H3UA 2F5MA 3F9SA 1VQM3 5CF1A 1RN4A 1BRHA 1RN7A 4NHFA 3DMCA 2HMMB 3D4AA 8RNTA 3NHXA 1BANA 5KP3A 1EEJA 1RGLA 1ROVA 1B27A 3K63A 3NM7A 4BTWA 1AVLA 1ULJB 1BNRA 3G8ZA 2FGTA 1ZX2A 2Z77A 3FSDA 3LTDA 1RNTA 1HYFA 1JRQA 1K41A 1X1YA 4X2OA 5EEOA 2WO0A 3B8LA 4U13A 1MGRA 3V99A 5AYRB 1WMOA 1Q814 3IJEB 1N8QA 4HOHA 2MF7A 2D42A 1T5YA 3FH1A 4PEJA 4HYZA 4CDLA 1B20A 3HIGA 2KCDA 3DGLA 1CQSA 3QRDA 4O2HA 1MWRA 2Z76A 3DGOA 3K7CA 5ELJA 2V1LA 3AGOA 3CCR3 1X1WA 3D79A 1JJ22 3CNXA 4HVNA 1I2GA 1Q824 3EHCA 4J8TA 2WOHA 5AIHA 4RNTA 3WODG 2JDIH 1G0TA 3JUOA 1VQK3 2P0MA 3BNBA 4IPBA 1OGZA 2IYJA 3FZWA 2CG0A 3LTBA 1FYSA 3MWZA 3MYTA 4R80A 5D83A 5LC7A 3GZBA 3QK9A 1MWTA 3LTCA 3VSYA 1JN5A 1TUHA 1LRAA 2RGQA 1M904 1O7GB 3PCSA 1W2ZA 4ORLA 2HMLB 2CHCA 2YFIB 4BTYA 1BSAA 1DMNA 3LYGA 4O02B 2XEPA 1BSCA 4J5KA 2LYXA 1YJ93 3UJMA 3JUQA 5BXQA 1AQZA 3EX9A 1GMPA 2CG1A 4WYKA 3WDGB 1QVG2 3X42A 7STDA 4FMBA 5CXOA 1ULIB 1GMQA 1N9JA 5IG5A 1JB4A 2CH9A 3HK4A 2OOVA 2GEYA 1NO3A 1SPUA 1K9M4 2BU4A 3CME3 2IMJA 4MMXB 4EYCA 1B2ZA 1YVBI 1OPYA 3BB9A 1T2IA 3F7SA 4RNYA 2YX9A 5G1LA 4R9KA 1OHPA 3U1WA 3D9RA 1LNHA 3M8CA 1BNJA 3B4PA 1UGHI 3HZPA 3Q90A 1AR0A 2P05A 3MKIA 4HM0B 2MC8A 3KSED 3ZG5A 6STDA 3G713 3AMOB 4ZM8A 3K0ZA 2JQ5A
chains in the Genus database with same CATH topology
4IT7A 1VQ93 3NXJA 2B1XB 4XBTA 4Q53A 3LZAA 4OK0A 3U97A 1QALA 3JUMA 3G6E3 2BHMA 2INXA 3I553 4WWUC 2W6JH 1VQN3 1R4CA 1KQS2 1IVVA 4L8OA 3KFQC 1W2B2 2GU3A 2BMQB 3IMAB 3UB1A 1A67A 2KXGA 3SVAA 3FG4A 1IQYA 2Y73A 4N6MA 4HJLB 5IF6A 3CD63 4OVMA 3ECFA 3CCE3 3NUVA 2PNCA 5AIGA 1OCVA 1O7MB 3DGNA 1VQ73 3WA2X 2BMRB 4HM3B 1IVWA 4LMIA 4X2HA 3WOEB 2HMJB 1AV4A 2SBLA 3FCSB 3G0KA 1JKGB 5HGRA 1GY7A 1NDOB 2Z7AA 1DVDA 4KFFA 5CLKA 3CPOA 2WOFA 5AYSC 3CCV3 3MG1A 5FGOA 3GWRA 3G4S3 2XF3A 2CWUA 4N3VA 4EV2A 1N9EA 2OOVC 4FMDA 1NWWA 3X41A 2OTL3 1YJN3 4LSOA 3GZYB 2F86B 3FLJA 5IG0A 5CF2A 3S28A 3CMA3 3WMDA 2BO9B 4XDWA 3SOYA 3F14A 1KD14 3F8XA 3LT8A 1E97A 1YIJ3 3IPTA 3GZXB 3KZTA 2XSOB 3SLUA 3F8HA 1OGXA 4CCVA 1STDA 2BMOB 2K54A 3DY5A 4RNZA 4KZ1A 3HIIA 1TIJA 2QGUA 4WHAA 3NQZA 1E3VA 3NQYA 3CCS3 2CW9A 1V74A 1WMPA 1VQ53 3CCU3 1LXEA 2YFLB 3DXOA 2WGQA 1UUVB 3K5TA 1JV2B 1CYVA 4O3VA 5A0OB 3J7Yd 3PYJA 1VQ83 3CPW2 2BT3A 3OWSA 5D81A 5FW5A 2L4VA 3F40A 1YHQ3 1M1K4 1VQ63 3Q1CA 4HM1B 4OUQA 3KKGA 3DM8A 1S723 2OCTA 1W01A 2PZVA 3CC73 1OH0A 3H3HA 5IENA 3RGRA 5BVBA 4K1VA 1TFKA 4EXRA 1VQL3 1GS3A 1Q864 3GAXA 3BNEA 2HMNB 1U5OA 3SX1A 1M9GA 1STFI 2CFLA 1O7WB 2HMOB 5AEWB 2ML6A 1DMMA 2P09A 2M7OA 1EKMA 4QWTA 3RGAA 1J2BA 4N6NB 1CEWI 8CHOA 3PGBA 3X40A 4HM2B 3MHEA 1FGOA 2K0MA 2I9WA 3LOYA 1IU7A 3CCL3 4GL6A 5TGNA 3AMOA 1QAFA 4EC6A 1RJOA 5AIFA 2XH9A 1C7HA 4FMAA 1OACA 5JPUA 1OHSA 5I97A 4EV5A 3T8UA 4H61A 4RZMA 3S5CA 1JB2A 2C10A 1D6ZA 2XFTA 1FGTA 1Z1SA 3EE1A 3OXAA 2KRTA 2BNGA 3OWUA 4MMZB 4WFOA 2QEX3 1Q42A 1MNLA 2W2CA 3X3YA 1EG9B 3NBRA 2C11A 1ASKA 3OWYA 2FNQA 4FCJA 4HM8B 2Y74A 2W56A 4FCZA 4MJDA 3BLZA 5D82A 4LZIA 2O9UX 1GYBA 2W04A 4LGQA 3VGNA 1UUWB 1VQ43 3OW22 4L8PA 5KP4A 2P0XA 3JUNA 1W4NA 2GXFA 3SEDA 1DVCA 4MEIA 1KSIA 1NJI4 3X3ZA 1JKGA 5JBSA 5IG3A 2GU1A 1Y4KA 4O8SA 1IVXA 4N6UA 3RDEA 1ISKA 1DMQA 2W56B 2CWTA 3V98A 2XGNA 4EBGA 3DGMA 1GY6A 2E2TA 4R1KA 1GD3A 4K1UA 3PS8A 1U8CB 3H51A 2CIUA 2GBWB 4HM4B 2CC3A 1W6CA 4KFDA 5KP1A 5LC6A 1TU5A 3CC23 4HBRA 2LQVA 3S29A 3EBTA 3UL6A 1UI7A 1S5AA 2Q07A 1QAKA 3I563 1UI8A 1NU3A 3L0RA 1A2KA 2IA7A 1A2VA 3MSOA 3FG3A 2FXTA 3N54B 1QVF2 1IQ8A 1NB3I 3CC43 3STDA 2F99A 2RCDA 4XDVA 1F8NA 2RSXA 3FF0A 3X3XA 4XBYA 3F7XA 1KWIA 1WTHA 1GD4A 3EBYA 3BNDA 1IV9A 3E99A 3CCQ3 3ALAA 1LVNA 1QMAA 1YIT3 3LTAA 1A90A 4K90B 1MOLA 3EB8A 3OV4A 1Q40A 5IEOA 4HM7B 4BTXA 3EN8A 3JVCA 3NM2A 1FGQA 4JRFA 4XM4A 4AKYA 5DREA 2OQEC 2XSHB 3HX8A 4K61A 4STDA 1LOXA 3NX0A 1FUWA 4WP5A 1YGEA 3S67A 2GBXB 5ELUA 1RRLA 1W7CA 3MPHA 3DUKA 1RKYA 1W02A 2IUKA 1YI23 3UL5A 3DZLA 5JPPA 1D6UA 2CFGA 2CFDA 1N5PA 1Q40B 4AEQA 1O7HB 3NV0B 4XB5A 2XFSA 3EF8A 5AIIA 1HKXA 5CK6A 5EQLA 2W9PA 4FR9A 3ER7A 3FGYA 5IERA 1SIIA 3MG3A 3B4OA 1KC84 3K9MC 1N8R4 1OF5A 3B7CA 1BUQA 4LEHA 2CWVA 4R4KA 1K734 4TX4A 1SIHA 3S27A 2GEXA 3NBBA 2W03A 1TP6A 4KFEA 1CYUA 3VF1A 1K8A4 3TDGA 4GB5A 3CNMA 1WMNA 4N6OB 1VQO3 1OHOA 2W0QA 3LMLA 3KN4A 1W5ZA 2QIYA 3N9HA 3EC9A 3PZWA 1OF5B 3CCJ3 3PCRA 4HZ9B 4L7KA 4AKZA 1WQLB 2CFKA 1WNHA 3A76A 4KVHA 1VZZA 3G16A 1E3RA 2HMKB 3SOAA 3LT9A 1W6GA 2ZL8A 3HI7A 1ZO2A 2O3OA 2Z6BA 1VQP3 1FGRA 2E2VA 3FG1A 1HU9A 3D3LA 3PXMA 4G1MB 1W6YA 3WOFB 1JNQA 3SXXA 4HM5B 1US1A 1N5HA 1JN5B 2STDA 3ROBA 3OX9A 2CFWA 1DYUA 4IIAA 2OQEA 2R4IA 2CKFB 1SJWA 1G96A 4FMCA 1SQWA 1UW1A 4MMYB 4FCMA 2RFRA 3KE7A 2B24B 2ZDJA 5G2GA 4WYKB 1IK3A 5IEPA 3FKAA 1FA3A 2P38A 5AEUB 5EVHA 1QJGA 1O7PB 2E2UA 1D6YA 3EN1B 2QA43 1K28A 3I0YA 2YFJB 3CCM3 3GRDA 1NB5I 1AVKA 3GZRA 1IT8A 3EJVA 1IV7A 3KIIA 1RRHA 3UNLA 3MG2A 5AI1A 3T0UA 3CXC2 5STDA 3JUPA 1M1XB 2OWPA 4J9AA 2XGLA 4JF8A 2W9QA 1L5GB 3Q2PA 4HKVB 3KSPA 1ROAA 1FGMA 1O7NB 4HM6B 2OTJ3 2F98A 2A15A 1GY5A 3LH4A 1YJW3 1TFOA 3LXUX 3NBJA 1JB5A 2WGOA 1EQKA 2ML5A 5IG4A 1IVUA 1IDPA 1OUNA 2XRXB 3T8NA 3O8YA 3EQQB 4RBNA 1W00A 4XBXA 4NREA 3CU3A 1Q7Y4 4N6V0 2IUJA 1PFPA 3FF2A 3NV0A 1EA2A 3BNCA 1IT7A 4R9LA 2CK3H 4N6TA 3N8BA 2XR8B 1IQXA 4I4KA 5IW9A 2UX0A 1PU4A 4N6LA 3V92A 3WA3A 2D1WA 4HZBB 4H3UA 3F9SA 1VQM3 5CF1A 1RN7A 4NHFA 3DMCA 2HMMB 3NHXA 5KP3A 1ROVA 3K63A 3NM7A 4BTWA 1AVLA 1ULJB 3G8ZA 2FGTA 1ZX2A 2Z77A 3FSDA 3LTDA 4X2OA 1JRQA 1K41A 5EEOA 2WO0A 3B8LA 4U13A 3V99A 5AYRB 1WMOA 1Q814 3IJEB 1N8QA 2MF7A 2D42A 1T5YA 3FH1A 4PEJA 4HYZA 4CDLA 3HIGA 2KCDA 3DGLA 1CQSA 3QRDA 4O2HA 3DGOA 2Z76A 3K7CA 5ELJA 2V1LA 3CCR3 1JJ22 3CNXA 4HVNA 1Q824 3EHCA 4J8TA 2WOHA 5AIHA 3WODG 2JDIH 3JUOA 1VQK3 2P0MA 3BNBA 4IPBA 1OGZA 3FZWA 2CG0A 3LTBA 3MYTA 3MWZA 4R80A 5D83A 5LC7A 3GZBA 3QK9A 3LTCA 3VSYA 1JN5A 1TUHA 2RGQA 1M904 1O7GB 3PCSA 1W2ZA 4ORLA 2HMLB 2CHCA 2YFIB 4BTYA 1DMNA 3LYGA 4O02B 2XEPA 2LYXA 1YJ93 3UJMA 3JUQA 5BXQA 3EX9A 2CG1A 4WYKA 3WDGB 1QVG2 3X42A 7STDA 4FMBA 5CXOA 1ULIB 1N9JA 5IG5A 1JB4A 2CH9A 3HK4A 2OOVA 2GEYA 1NO3A 1SPUA 1K9M4 3CME3 2IMJA 4MMXB 4EYCA 1YVBI 1OPYA 3BB9A 3F7SA 4RNYA 2YX9A 4R9KA 1OHPA 3U1WA 3D9RA 1LNHA 3M8CA 3B4PA 3HZPA 3Q90A 4HM0B 5DRVA 1AR0A 2P05A 3MKIA 2MC8A 3KSED 6STDA 3G713 3AMOB 4ZM8A 3K0ZA 2JQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NXJ A;  2B1X B;  4XBT A;  4Q53 A;  3LZA A;  3JUM A;  2INX A;  4WWU C;  4L8O A;  2BMQ B;  4HJL B;  5IF6 A;  4OVM A;  3ECF A;  3NUV A;  5AIG A;  1OCV A;  1O7M B;  2BMR B;  4HM3 B;  4LMI A;  4X2H A;  2HMJ B;  3G0K A;  1JKG B;  5HGR A;  1GY7 A;  1NDO B;  2Z7A A;  5CLK A;  3CPO A;  3MG1 A;  3GWR A;  4N3V A;  1NWW A;  3GZY B;  2F86 B;  3FLJ A;  5IG0 A;  5CF2 A;  3WMD A;  4XDW A;  3SOY A;  3F14 A;  3F8X A;  1E97 A;  3IPT A;  3GZX B;  3KZT A;  2XSO B;  3F8H A;  1OGX A;  1STD A;  2BMO B;  2K54 A;  2QGU A;  1E3V A;  2YFL B;  3DXO A;  1UUV B;  5FW5 A;  3OWS A;  5D81 A;  3F40 A;  4OUQ A;  4HM1 B;  3KKG A;  3DM8 A;  1W01 A;  2PZV A;  1OH0 A;  3H3H A;  5IEN A;  3RGR A;  5BVB A;  4K1V A;  1GS3 A;  2HMN B;  1U5O A;  1O7W B;  2HMO B;  5AEW B;  1DMM A;  3RGA A;  8CHO A;  4HM2 B;  3MHE A;  2I9W A;  5TGN A;  5AIF A;  1C7H A;  5JPU A;  1OHS A;  3T8U A;  4RZM A;  3S5C A;  1JB2 A;  1Z1S A;  3OXA A;  2BNG A;  3OWU A;  1Q42 A;  2W2C A;  1EG9 B;  3NBR A;  1ASK A;  3OWY A;  4FCJ A;  4HM8 B;  4MJD A;  3BLZ A;  5D82 A;  1GYB A;  3VGN A;  4LGQ A;  1UUW B;  4L8P A;  5KP4 A;  3JUN A;  2GXF A;  3SED A;  1JKG A;  5IG3 A;  1ISK A;  1DMQ A;  1GY6 A;  4R1K A;  4K1U A;  3H51 A;  2GBW B;  4HM4 B;  5KP1 A;  3EBT A;  1S5A A;  1NU3 A;  1A2K A;  3MSO A;  3STD A;  2F99 A;  2RCD A;  4XDV A;  3FF0 A;  4XBY A;  3F7X A;  3EBY A;  3E99 A;  1QMA A;  3OV4 A;  1Q40 A;  5IEO A;  4HM7 B;  3EN8 A;  3NM2 A;  4XM4 A;  5DRE A;  2XSH B;  4STD A;  3HX8 A;  4WP5 A;  2GBX B;  3DUK A;  1W02 A;  3DZL A;  5JPP A;  1Q40 B;  1O7H B;  3NV0 B;  4XB5 A;  3EF8 A;  5AII A;  1HKX A;  5CK6 A;  3FGY A;  5IER A;  3MG3 A;  3B4O A;  1OF5 A;  3B7C A;  1BUQ A;  4LEH A;  2GEX A;  1TP6 A;  4GB5 A;  3CNM A;  1OHO A;  2QIY A;  3EC9 A;  1OF5 B;  4HZ9 B;  4L7K A;  1WQL B;  3A76 A;  4KVH A;  1VZZ A;  3G16 A;  1E3R A;  2HMK B;  3SOA A;  1ZO2 A;  1W6Y A;  4HM5 B;  1JN5 B;  3ROB A;  2STD A;  3OX9 A;  4IIA A;  2R4I A;  2CKF B;  1SJW A;  4FCM A;  2RFR A;  3KE7 A;  2B24 B;  5G2G A;  4WYK B;  5IEP A;  3FKA A;  5AEU B;  5EVH A;  1QJG A;  1O7P B;  3EN1 B;  3I0Y A;  2YFJ B;  3GRD A;  3GZR A;  3EJV A;  3UNL A;  3MG2 A;  5AI1 A;  5STD A;  3JUP A;  2OWP A;  4J9A A;  4HKV B;  3KSP A;  1O7N B;  4HM6 B;  2F98 A;  1GY5 A;  2A15 A;  1JB5 A;  5IG4 A;  1IDP A;  1OUN A;  2XRX B;  3T8N A;  3EQQ B;  1W00 A;  4XBX A;  3CU3 A;  3FF2 A;  3NV0 A;  1EA2 A;  4R9L A;  2XR8 B;  4I4K A;  2UX0 A;  4HZB B;  4H3U A;  3F9S A;  5CF1 A;  3DMC A;  2HMM B;  3NHX A;  5KP3 A;  1ULJ B;  3G8Z A;  1ZX2 A;  2Z77 A;  3FSD A;  4X2O A;  1K41 A;  3B8L A;  4U13 A;  3FH1 A;  4PEJ A;  4CDL A;  1CQS A;  3K7C A;  2Z76 A;  3CNX A;  4HVN A;  3EHC A;  4J8T A;  5AIH A;  3JUO A;  1OGZ A;  3FZW A;  3MYT A;  5D83 A;  3VSY A;  3GZB A;  1JN5 A;  1TUH A;  2RGQ A;  1O7G B;  4ORL A;  2HML B;  2CHC A;  2YFI B;  1DMN A;  3LYG A;  3UJM A;  3JUQ A;  5BXQ A;  3EX9 A;  4WYK A;  7STD A;  5CXO A;  1ULI B;  5IG5 A;  1JB4 A;  3HK4 A;  2GEY A;  2IMJ A;  1OPY A;  3BB9 A;  3F7S A;  4R9K A;  1OHP A;  5DRV A;  3D9R A;  3M8C A;  3B4P A;  3HZP A;  3Q90 A;  4HM0 B;  1AR0 A;  3MKI A;  6STD A;  3ER7 A;  3K0Z A;  2JQ5 A; 
#chains in the Genus database with same CATH topology
 4IT7 A;  1VQ9 3;  7RNT A;  1BU4 A;  3NXJ A;  2B1X B;  4XBT A;  2CX0 A;  4Q53 A;  2KAA A;  3LZA A;  4BU4 A;  4OK0 A;  1V57 A;  1QAL A;  3JUM A;  3U97 A;  3G6E 3;  1DE3 A;  2BHM A;  2INX A;  1B3S A;  3I55 3;  1BIR A;  4WWU C;  2W6J H;  1VQN 3;  1R4C A;  1KQS 2;  1IVV A;  4L8O A;  3KFQ C;  1W2B 2;  2GU3 A;  2BMQ B;  3IMA B;  3UB1 A;  1Q9E A;  1A67 A;  2KXG A;  3SVA A;  3FG4 A;  1IQY A;  2Y73 A;  4N6M A;  3AGN A;  4HJL B;  5IF6 A;  1BRN L;  5DRV A;  4OVM A;  3CD6 3;  3ECF A;  3CCE 3;  3NUV A;  1YGW A;  2PNC A;  5AIG A;  2F5W A;  1OCV A;  1O7M B;  7GSP A;  3DGN A;  1VQ7 3;  3WA2 X;  1PYL A;  1I3I A;  2BMR B;  4HM3 B;  1IVW A;  4LMI A;  4IIA A;  4X2H A;  3WOE B;  2HMJ B;  1AV4 A;  2SBL A;  3FCS B;  3G0K A;  1JKG B;  5HGR A;  1GY7 A;  1NDO B;  2Z7A A;  1TRQ A;  3WHO A;  2GSP A;  5HOH A;  1BUJ A;  1EUI C;  4KFF A;  5CLK A;  4CPK A;  3CPO A;  2WOF A;  5AYS C;  3CCV 3;  3MG1 A;  5FGO A;  3GWR A;  3URP A;  3G4S 3;  1UUG B;  2XF3 A;  2CWU A;  4N3V A;  4EV2 A;  1N9E A;  2OOV C;  2KF3 A;  4FMD A;  1NWW A;  3X41 A;  1LQM B;  2OTL 3;  1YJN 3;  3DGY A;  1X1U A;  4LSO A;  3GZY B;  2F86 B;  1YNV X;  1TJD A;  3FLJ A;  5IG0 A;  6GSP A;  1I2E A;  5CF2 A;  3S28 A;  3CMA 3;  3WMD A;  2BO9 B;  1I70 A;  4XDW A;  3SOY A;  3F14 A;  1KD1 4;  3F8X A;  2KF6 A;  3LT8 A;  1E97 A;  1YIJ 3;  1R4Y A;  3IPT A;  3GZX B;  2BIR A;  3KZT A;  2XSO B;  3SLU A;  3F8H A;  1OGX A;  4CCV A;  1STD A;  2BMO B;  2K54 A;  3DY5 A;  2H0H A;  4RNZ A;  2AAE A;  4BL3 A;  1X1X A;  1MWS A;  4KZ1 A;  1RCL A;  1TIJ A;  2QGU A;  3HII A;  6RNT A;  1IYY A;  4WHA A;  3NQZ A;  1E3V A;  3NQY A;  1FUS A;  1RCK A;  2CW9 A;  3CCS 3;  1BRJ A;  1V74 A;  3D5G A;  1WMP A;  1VQ5 3;  3CCU 3;  1LXE A;  2YFL B;  3DXO A;  2WGQ A;  1UUV B;  1BRS A;  1LNI A;  1JV2 B;  3BIR A;  3K5T A;  1CYV A;  2F56 A;  4O3V A;  5A0O B;  3PYJ A;  1B2X A;  3J7Y d;  1VQ8 3;  3CPW 2;  1BSD A;  2BT3 A;  3OWS A;  5D81 A;  5FW5 A;  1BVI A;  2L4V A;  3F40 A;  1YHQ 3;  1M1K 4;  1V58 A;  1VQ6 3;  3Q1C A;  4HM1 B;  4OUQ A;  3KKG A;  3DM8 A;  1S72 3;  2OCT A;  1W01 A;  2PZV A;  3CC7 3;  1OH0 A;  3H3H A;  5IEN A;  3RGR A;  4I5Q A;  5BVB A;  4K1V A;  1TFK A;  4EXR A;  1VQL 3;  1GS3 A;  1Q86 4;  3GAX A;  3BNE A;  2HMN B;  1U5O A;  3SX1 A;  1M9G A;  1BRG A;  1STF I;  2CFL A;  2K3D A;  1O7W B;  2HMO B;  1RMS A;  2ML6 A;  1DMM A;  2P09 A;  2M7O A;  1EKM A;  4QWT A;  3RGA A;  5AEW B;  1JBS A;  4N6N B;  1J2B A;  1CEW I;  8CHO A;  3PGB A;  3X40 A;  4HAA A;  1I2F A;  3MHE A;  4HM2 B;  1GSP A;  1FGO A;  2K0M A;  2I9W A;  3LOY A;  1IU7 A;  3CCL 3;  4GL6 A;  5TGN A;  3AMO A;  1QAF A;  4EC6 A;  1RJO A;  1JBR A;  5AIF A;  2XH9 A;  1C7H A;  4FMA A;  1OAC A;  5JPU A;  1OHS A;  1B2M A;  5I97 A;  4EV5 A;  3T8U A;  4H61 A;  4RZM A;  3S5C A;  1BGS A;  1JB2 A;  2C10 A;  3ZFZ A;  2R41 A;  1D6Z A;  2XFT A;  1CH0 A;  1FGT A;  1Z1S A;  3EE1 A;  3OXA A;  2KRT A;  2BNG A;  3OWU A;  4MMZ B;  4WFO A;  4BIR A;  2QEX 3;  1Q42 A;  1GOU A;  1MNL A;  2W2C A;  3X3Y A;  1EG9 B;  3NBR A;  2C11 A;  1ASK A;  3OWY A;  2FNQ A;  4FCJ A;  4HM8 B;  2Y74 A;  2W56 A;  1UDI I;  4FCZ A;  4GHO A;  4ILF A;  3BLZ A;  4MJD A;  5D82 A;  4LZI A;  9RNT A;  1T2H A;  2O9U X;  3SYU A;  1GYB A;  2W04 A;  4LGQ A;  3VGN A;  1UUW B;  1Q7H A;  1VQ4 3;  1I3F A;  3OW2 2;  4L8P A;  5KP4 A;  2P0X A;  3JUN A;  1W4N A;  2GXF A;  1B21 A;  1DVC A;  3SED A;  4MEI A;  1DVD A;  1KSI A;  1LOY A;  1BRK A;  1NJI 4;  3X3Z A;  2CX1 A;  1JKG A;  5JBS A;  5IG3 A;  2OQE A;  2GU1 A;  1Y4K A;  4O8S A;  1IVX A;  4N6U A;  3RDE A;  1ISK A;  1DMQ A;  2W56 B;  1JZO A;  2CWT A;  5M18 A;  1GOY A;  3V98 A;  2XGN A;  4EBG A;  3DGM A;  1DET A;  1GY6 A;  2E2T A;  2H0I A;  4R1K A;  1MGW A;  3AHW A;  1GD3 A;  4K1U A;  5M1A A;  3PS8 A;  1U8C B;  3H51 A;  2CIU A;  2GBW B;  4HM4 B;  2CC3 A;  1W6C A;  4KFD A;  5KP1 A;  5LC6 A;  1TU5 A;  2AAD A;  3CC2 3;  4HBR A;  2LQV A;  1GOV A;  3ZG0 A;  3S29 A;  1RGE A;  3EBT A;  3UL6 A;  1UI7 A;  3D5I A;  1S5A A;  2Q07 A;  1QAK A;  3I56 3;  1YVS A;  1UI8 A;  1NU3 A;  2UGI A;  3L0R A;  1A2K A;  2IA7 A;  1A2V A;  3MSO A;  3FG3 A;  2RNT A;  4J5G A;  1BNG A;  2FXT A;  2HOH A;  3N54 B;  1RNB A;  1BSB A;  1QVF 2;  1FUT A;  4GSP A;  1IQ8 A;  1RGG A;  1NB3 I;  3GSP A;  1ZGX A;  3CC4 3;  3STD A;  2F99 A;  2RCD A;  4XDV A;  1F8N A;  2RSX A;  3FF0 A;  3X3X A;  4XBY A;  3F7X A;  1WTH A;  1KWI A;  1GD4 A;  3EBY A;  3BND A;  1IV9 A;  3E99 A;  3CCQ 3;  3ALA A;  1LVN A;  1QMA A;  1UCI A;  1YIT 3;  3LTA A;  1A90 A;  4K90 B;  1MOL A;  3EB8 A;  3OV4 A;  1Q40 A;  3Q3F A;  5IEO A;  4HM7 B;  4BTX A;  3EN8 A;  3JVC A;  2ZA4 A;  3NM2 A;  5BIR A;  1FGQ A;  4JRF A;  4XM4 A;  4AKY A;  5DRE A;  4DKI A;  2OQE C;  2XSH B;  3HX8 A;  4K61 A;  2F4Y A;  1LOX A;  3NX0 A;  4STD A;  1FUW A;  4WP5 A;  1YGE A;  3S67 A;  2GBX B;  5ELU A;  1RRL A;  1W7C A;  3MPH A;  3DUK A;  1RSN A;  1RKY A;  1W02 A;  2IUK A;  3KCH A;  1YI2 3;  3UL5 A;  3DZL A;  2SAR A;  5JPP A;  1TRP A;  1D6U A;  2CFG A;  2CFD A;  1N5P A;  1Q40 B;  4LYL B;  4AEQ A;  1O7H B;  1RGH A;  3NV0 B;  1RGK A;  1UCK A;  4XB5 A;  2XFS A;  1BNE A;  1FW7 A;  3EF8 A;  5AII A;  2IY2 A;  1HKX A;  5CK6 A;  2KF5 A;  5EQL A;  2W9P A;  4FR9 A;  1G02 A;  1BSE A;  3ER7 A;  3FGY A;  4NPB A;  5M19 A;  5IER A;  1SII A;  3MG3 A;  3B4O A;  1KC8 4;  3K9M C;  1N8R 4;  1B2U A;  1OF5 A;  3DH2 A;  3B7C A;  1BUQ A;  4LEH A;  2CWV A;  4R4K A;  1JBT A;  1K73 4;  4TX4 A;  1SIH A;  3S27 A;  2GEX A;  3NBB A;  1I8V A;  1JZD A;  1RLS A;  1TP6 A;  2W03 A;  4KFE A;  1CYU A;  3VF1 A;  1UCL A;  1K8A 4;  3TDG A;  1PY3 A;  3AHS A;  4GB5 A;  2J8X B;  3CNM A;  2C4B A;  1AY7 A;  1WMN A;  4N6O B;  1UGI A;  1VQO 3;  1OHO A;  2W0Q A;  3LML A;  3KN4 A;  3A5E A;  1BNI A;  1C54 A;  1W5Z A;  2QIY A;  3N9H A;  3EC9 A;  3PZW A;  3RNT A;  1OF5 B;  3CCJ 3;  3PCR A;  4HZ9 B;  4L7K A;  4AKZ A;  1WQL B;  1FZU A;  1RDS A;  2CFK A;  1BNF A;  1MWU A;  1NNV A;  1WNH A;  3A76 A;  4KVH A;  1BRI A;  1VZZ A;  3G16 A;  3WR2 A;  1I0X A;  1E3R A;  2HMK B;  3SOA A;  3LT9 A;  1W6G A;  2ZL8 A;  3HOH A;  3HI7 A;  1ZO2 A;  2O3O A;  2Z6B A;  1VQP 3;  1FGR A;  2E2V A;  3FG1 A;  1HU9 A;  3D3L A;  3PXM A;  4G1M B;  1W6Y A;  3WOF B;  1JNQ A;  3SXX A;  4HM5 B;  1US1 A;  1TTO A;  3BU4 A;  1N5H A;  1JN5 B;  2STD A;  3ROB A;  2ZHX B;  2CFW A;  1DYU A;  1T3B A;  1ZS7 A;  2R4I A;  2CKF B;  1SJW A;  1G96 A;  3OX9 A;  1SQW A;  4FMC A;  1UW1 A;  2KF4 A;  4MMY B;  4FCM A;  4EW5 A;  1BNS A;  1GMR A;  1RGC A;  2RFR A;  5RNT A;  3KE7 A;  2B24 B;  2ZDJ A;  5G2G A;  4WYK B;  1IK3 A;  1BOX A;  5IEP A;  3FKA A;  1FA3 A;  2H0G A;  2P38 A;  4KT3 B;  5AEU B;  5EVH A;  1QJG A;  1O7P B;  2E2U A;  1D6Y A;  3EN1 B;  1I0V A;  2QA4 3;  1K28 A;  3I0Y A;  1SAR A;  2YFJ B;  1UCJ A;  3CCM 3;  3GRD A;  1NB5 I;  1AVK A;  3GZR A;  1IT8 A;  3EJV A;  1IV7 A;  1B2S A;  3KII A;  1HZ1 A;  1RRH A;  3UNL A;  3MG2 A;  4BL2 A;  5AI1 A;  3T0U A;  3CXC 2;  5STD A;  3JUP A;  1M1X B;  2OWP A;  4J9A A;  1RN1 A;  2XGL A;  5G1K A;  4JF8 A;  2W9Q A;  1L5G B;  3Q2P A;  1BAO A;  4HKV B;  3KSP A;  1ROA A;  1FGM A;  1O7N B;  2RBI A;  4HM6 B;  2OTJ 3;  2F98 A;  2A15 A;  1GY5 A;  2L1S A;  5GSP A;  1RGA A;  3LH4 A;  1YJW 3;  1TFO A;  3LXU X;  2UUG C;  1RTU A;  3NBJ A;  1JB5 A;  2WGO A;  1EQK A;  2ML5 A;  5IG4 A;  1IVU A;  1IDP A;  1OUN A;  2XRX B;  3T8N A;  3O8Y A;  5BU4 A;  1LOW A;  3EQQ B;  4RBN A;  1W00 A;  4XBX A;  1LQG C;  4NRE A;  3CU3 A;  1RHL A;  1Q7Y 4;  4N6V 0;  2IUJ A;  1A2P A;  1PFP A;  3FF2 A;  3NV0 A;  1EA2 A;  3BNC A;  1IT7 A;  4R9L A;  2CK3 H;  1RGF A;  3N8B A;  2XR8 B;  4N6T A;  1IQX A;  4I4K A;  5IW9 A;  2UX0 A;  1PU4 A;  1VQQ A;  4N6L A;  3V92 A;  3WA3 A;  2D1W A;  4HZB B;  4CJN A;  1LOV A;  4H3U A;  2F5M A;  3F9S A;  1VQM 3;  5CF1 A;  1RN4 A;  1BRH A;  1RN7 A;  4NHF A;  3DMC A;  2HMM B;  3D4A A;  8RNT A;  3NHX A;  1BAN A;  5KP3 A;  1EEJ A;  1RGL A;  1ROV A;  1B27 A;  3K63 A;  3NM7 A;  4BTW A;  1AVL A;  1ULJ B;  1BNR A;  3G8Z A;  2FGT A;  1ZX2 A;  2Z77 A;  3FSD A;  3LTD A;  1RNT A;  1HYF A;  1JRQ A;  1K41 A;  1X1Y A;  4X2O A;  5EEO A;  2WO0 A;  3B8L A;  4U13 A;  1MGR A;  3V99 A;  5AYR B;  1WMO A;  1Q81 4;  3IJE B;  1N8Q A;  4HOH A;  2MF7 A;  2D42 A;  1T5Y A;  3FH1 A;  4PEJ A;  4HYZ A;  4CDL A;  1B20 A;  3HIG A;  2KCD A;  3DGL A;  1CQS A;  3QRD A;  4O2H A;  1MWR A;  2Z76 A;  3DGO A;  3K7C A;  5ELJ A;  2V1L A;  3AGO A;  3CCR 3;  1X1W A;  3D79 A;  1JJ2 2;  3CNX A;  4HVN A;  1I2G A;  1Q82 4;  3EHC A;  4J8T A;  2WOH A;  5AIH A;  4RNT A;  3WOD G;  2JDI H;  1G0T A;  3JUO A;  1VQK 3;  2P0M A;  3BNB A;  4IPB A;  1OGZ A;  2IYJ A;  3FZW A;  2CG0 A;  3LTB A;  1FYS A;  3MWZ A;  3MYT A;  4R80 A;  5D83 A;  5LC7 A;  3GZB A;  3QK9 A;  1MWT A;  3LTC A;  3VSY A;  1JN5 A;  1TUH A;  1LRA A;  2RGQ A;  1M90 4;  1O7G B;  3PCS A;  1W2Z A;  4ORL A;  2HML B;  2CHC A;  2YFI B;  4BTY A;  1BSA A;  1DMN A;  3LYG A;  4O02 B;  2XEP A;  1BSC A;  4J5K A;  2LYX A;  1YJ9 3;  3UJM A;  3JUQ A;  5BXQ A;  1AQZ A;  3EX9 A;  1GMP A;  2CG1 A;  4WYK A;  3WDG B;  1QVG 2;  3X42 A;  7STD A;  4FMB A;  5CXO A;  1ULI B;  1GMQ A;  1N9J A;  5IG5 A;  1JB4 A;  2CH9 A;  3HK4 A;  2OOV A;  2GEY A;  1NO3 A;  1SPU A;  1K9M 4;  2BU4 A;  3CME 3;  2IMJ A;  4MMX B;  4EYC A;  1B2Z A;  1YVB I;  1OPY A;  3BB9 A;  1T2I A;  3F7S A;  4RNY A;  2YX9 A;  5G1L A;  4R9K A;  1OHP A;  3U1W A;  3D9R A;  1LNH A;  3M8C A;  1BNJ A;  3B4P A;  1UGH I;  3HZP A;  3Q90 A;  1AR0 A;  2P05 A;  3MKI A;  4HM0 B;  2MC8 A;  3KSE D;  3ZG5 A;  6STD A;  3G71 3;  3AMO B;  4ZM8 A;  3K0Z A;  2JQ5 A; 
#chains in the Genus database with same CATH homology
 4IT7 A;  1VQ9 3;  3NXJ A;  2B1X B;  4XBT A;  4Q53 A;  3LZA A;  4OK0 A;  3U97 A;  1QAL A;  3JUM A;  3G6E 3;  2BHM A;  2INX A;  3I55 3;  4WWU C;  2W6J H;  1VQN 3;  1R4C A;  1KQS 2;  1IVV A;  4L8O A;  3KFQ C;  1W2B 2;  2GU3 A;  2BMQ B;  3IMA B;  3UB1 A;  1A67 A;  2KXG A;  3SVA A;  3FG4 A;  1IQY A;  2Y73 A;  4N6M A;  4HJL B;  5IF6 A;  3CD6 3;  4OVM A;  3ECF A;  3CCE 3;  3NUV A;  2PNC A;  5AIG A;  1OCV A;  1O7M B;  3DGN A;  1VQ7 3;  3WA2 X;  2BMR B;  4HM3 B;  1IVW A;  4LMI A;  4X2H A;  3WOE B;  2HMJ B;  1AV4 A;  2SBL A;  3FCS B;  3G0K A;  1JKG B;  5HGR A;  1GY7 A;  1NDO B;  2Z7A A;  1DVD A;  4KFF A;  5CLK A;  3CPO A;  2WOF A;  5AYS C;  3CCV 3;  3MG1 A;  5FGO A;  3GWR A;  3G4S 3;  2XF3 A;  2CWU A;  4N3V A;  4EV2 A;  1N9E A;  2OOV C;  4FMD A;  1NWW A;  3X41 A;  2OTL 3;  1YJN 3;  4LSO A;  3GZY B;  2F86 B;  3FLJ A;  5IG0 A;  5CF2 A;  3S28 A;  3CMA 3;  3WMD A;  2BO9 B;  4XDW A;  3SOY A;  3F14 A;  1KD1 4;  3F8X A;  3LT8 A;  1E97 A;  1YIJ 3;  3IPT A;  3GZX B;  3KZT A;  2XSO B;  3SLU A;  3F8H A;  1OGX A;  4CCV A;  1STD A;  2BMO B;  2K54 A;  3DY5 A;  4RNZ A;  4KZ1 A;  3HII A;  1TIJ A;  2QGU A;  4WHA A;  3NQZ A;  1E3V A;  3NQY A;  3CCS 3;  2CW9 A;  1V74 A;  1WMP A;  1VQ5 3;  3CCU 3;  1LXE A;  2YFL B;  3DXO A;  2WGQ A;  1UUV B;  3K5T A;  1JV2 B;  1CYV A;  4O3V A;  5A0O B;  3J7Y d;  3PYJ A;  1VQ8 3;  3CPW 2;  2BT3 A;  3OWS A;  5D81 A;  5FW5 A;  2L4V A;  3F40 A;  1YHQ 3;  1M1K 4;  1VQ6 3;  3Q1C A;  4HM1 B;  4OUQ A;  3KKG A;  3DM8 A;  1S72 3;  2OCT A;  1W01 A;  2PZV A;  3CC7 3;  1OH0 A;  3H3H A;  5IEN A;  3RGR A;  5BVB A;  4K1V A;  1TFK A;  4EXR A;  1VQL 3;  1GS3 A;  1Q86 4;  3GAX A;  3BNE A;  2HMN B;  1U5O A;  3SX1 A;  1M9G A;  1STF I;  2CFL A;  1O7W B;  2HMO B;  5AEW B;  2ML6 A;  1DMM A;  2P09 A;  2M7O A;  1EKM A;  4QWT A;  3RGA A;  1J2B A;  4N6N B;  1CEW I;  8CHO A;  3PGB A;  3X40 A;  4HM2 B;  3MHE A;  1FGO A;  2K0M A;  2I9W A;  3LOY A;  1IU7 A;  3CCL 3;  4GL6 A;  5TGN A;  3AMO A;  1QAF A;  4EC6 A;  1RJO A;  5AIF A;  2XH9 A;  1C7H A;  4FMA A;  1OAC A;  5JPU A;  1OHS A;  5I97 A;  4EV5 A;  3T8U A;  4H61 A;  4RZM A;  3S5C A;  1JB2 A;  2C10 A;  1D6Z A;  2XFT A;  1FGT A;  1Z1S A;  3EE1 A;  3OXA A;  2KRT A;  2BNG A;  3OWU A;  4MMZ B;  4WFO A;  2QEX 3;  1Q42 A;  1MNL A;  2W2C A;  3X3Y A;  1EG9 B;  3NBR A;  2C11 A;  1ASK A;  3OWY A;  2FNQ A;  4FCJ A;  4HM8 B;  2Y74 A;  2W56 A;  4FCZ A;  4MJD A;  3BLZ A;  5D82 A;  4LZI A;  2O9U X;  1GYB A;  2W04 A;  4LGQ A;  3VGN A;  1UUW B;  1VQ4 3;  3OW2 2;  4L8P A;  5KP4 A;  2P0X A;  3JUN A;  1W4N A;  2GXF A;  3SED A;  1DVC A;  4MEI A;  1KSI A;  1NJI 4;  3X3Z A;  1JKG A;  5JBS A;  5IG3 A;  2GU1 A;  1Y4K A;  4O8S A;  1IVX A;  4N6U A;  3RDE A;  1ISK A;  1DMQ A;  2W56 B;  2CWT A;  3V98 A;  2XGN A;  4EBG A;  3DGM A;  1GY6 A;  2E2T A;  4R1K A;  1GD3 A;  4K1U A;  3PS8 A;  1U8C B;  3H51 A;  2CIU A;  2GBW B;  4HM4 B;  2CC3 A;  1W6C A;  4KFD A;  5KP1 A;  5LC6 A;  1TU5 A;  3CC2 3;  4HBR A;  2LQV A;  3S29 A;  3EBT A;  3UL6 A;  1UI7 A;  1S5A A;  2Q07 A;  1QAK A;  3I56 3;  1UI8 A;  1NU3 A;  3L0R A;  1A2K A;  2IA7 A;  1A2V A;  3MSO A;  3FG3 A;  2FXT A;  3N54 B;  1QVF 2;  1IQ8 A;  1NB3 I;  3CC4 3;  3STD A;  2F99 A;  2RCD A;  4XDV A;  1F8N A;  2RSX A;  3FF0 A;  3X3X A;  4XBY A;  3F7X A;  1KWI A;  1WTH A;  1GD4 A;  3EBY A;  3BND A;  1IV9 A;  3E99 A;  3CCQ 3;  3ALA A;  1LVN A;  1QMA A;  1YIT 3;  3LTA A;  1A90 A;  4K90 B;  1MOL A;  3EB8 A;  3OV4 A;  1Q40 A;  5IEO A;  4HM7 B;  4BTX A;  3EN8 A;  3JVC A;  3NM2 A;  1FGQ A;  4JRF A;  4XM4 A;  4AKY A;  5DRE A;  2OQE C;  2XSH B;  3HX8 A;  4K61 A;  4STD A;  1LOX A;  3NX0 A;  1FUW A;  4WP5 A;  1YGE A;  3S67 A;  2GBX B;  5ELU A;  1RRL A;  1W7C A;  3MPH A;  3DUK A;  1RKY A;  1W02 A;  2IUK A;  1YI2 3;  3UL5 A;  3DZL A;  5JPP A;  1D6U A;  2CFG A;  2CFD A;  1N5P A;  1Q40 B;  4AEQ A;  1O7H B;  3NV0 B;  4XB5 A;  2XFS A;  3EF8 A;  5AII A;  1HKX A;  5CK6 A;  5EQL A;  2W9P A;  4FR9 A;  3ER7 A;  3FGY A;  5IER A;  1SII A;  3MG3 A;  3B4O A;  1KC8 4;  3K9M C;  1N8R 4;  1OF5 A;  3B7C A;  1BUQ A;  4LEH A;  2CWV A;  4R4K A;  1K73 4;  4TX4 A;  1SIH A;  3S27 A;  2GEX A;  3NBB A;  2W03 A;  1TP6 A;  4KFE A;  1CYU A;  3VF1 A;  1K8A 4;  3TDG A;  4GB5 A;  3CNM A;  1WMN A;  4N6O B;  1VQO 3;  1OHO A;  2W0Q A;  3LML A;  3KN4 A;  1W5Z A;  2QIY A;  3N9H A;  3EC9 A;  3PZW A;  1OF5 B;  3CCJ 3;  3PCR A;  4HZ9 B;  4L7K A;  4AKZ A;  1WQL B;  2CFK A;  1WNH A;  3A76 A;  4KVH A;  1VZZ A;  3G16 A;  1E3R A;  2HMK B;  3SOA A;  3LT9 A;  1W6G A;  2ZL8 A;  3HI7 A;  1ZO2 A;  2O3O A;  2Z6B A;  1VQP 3;  1FGR A;  2E2V A;  3FG1 A;  1HU9 A;  3D3L A;  3PXM A;  4G1M B;  1W6Y A;  3WOF B;  1JNQ A;  3SXX A;  4HM5 B;  1US1 A;  1N5H A;  1JN5 B;  2STD A;  3ROB A;  3OX9 A;  2CFW A;  1DYU A;  4IIA A;  2OQE A;  2R4I A;  2CKF B;  1SJW A;  1G96 A;  4FMC A;  1SQW A;  1UW1 A;  4MMY B;  4FCM A;  2RFR A;  3KE7 A;  2B24 B;  2ZDJ A;  5G2G A;  4WYK B;  1IK3 A;  5IEP A;  3FKA A;  1FA3 A;  2P38 A;  5AEU B;  5EVH A;  1QJG A;  1O7P B;  2E2U A;  1D6Y A;  3EN1 B;  2QA4 3;  1K28 A;  3I0Y A;  2YFJ B;  3CCM 3;  3GRD A;  1NB5 I;  1AVK A;  3GZR A;  1IT8 A;  3EJV A;  1IV7 A;  3KII A;  1RRH A;  3UNL A;  3MG2 A;  5AI1 A;  3T0U A;  3CXC 2;  5STD A;  3JUP A;  1M1X B;  2OWP A;  4J9A A;  2XGL A;  4JF8 A;  2W9Q A;  1L5G B;  3Q2P A;  4HKV B;  3KSP A;  1ROA A;  1FGM A;  1O7N B;  4HM6 B;  2OTJ 3;  2F98 A;  2A15 A;  1GY5 A;  3LH4 A;  1YJW 3;  1TFO A;  3LXU X;  3NBJ A;  1JB5 A;  2WGO A;  1EQK A;  2ML5 A;  5IG4 A;  1IVU A;  1IDP A;  1OUN A;  2XRX B;  3T8N A;  3O8Y A;  3EQQ B;  4RBN A;  1W00 A;  4XBX A;  4NRE A;  3CU3 A;  1Q7Y 4;  4N6V 0;  2IUJ A;  1PFP A;  3FF2 A;  3NV0 A;  1EA2 A;  3BNC A;  1IT7 A;  4R9L A;  2CK3 H;  4N6T A;  3N8B A;  2XR8 B;  1IQX A;  4I4K A;  5IW9 A;  2UX0 A;  1PU4 A;  4N6L A;  3V92 A;  3WA3 A;  2D1W A;  4HZB B;  4H3U A;  3F9S A;  1VQM 3;  5CF1 A;  1RN7 A;  4NHF A;  3DMC A;  2HMM B;  3NHX A;  5KP3 A;  1ROV A;  3K63 A;  3NM7 A;  4BTW A;  1AVL A;  1ULJ B;  3G8Z A;  2FGT A;  1ZX2 A;  2Z77 A;  3FSD A;  3LTD A;  4X2O A;  1JRQ A;  1K41 A;  5EEO A;  2WO0 A;  3B8L A;  4U13 A;  3V99 A;  5AYR B;  1WMO A;  1Q81 4;  3IJE B;  1N8Q A;  2MF7 A;  2D42 A;  1T5Y A;  3FH1 A;  4PEJ A;  4HYZ A;  4CDL A;  3HIG A;  2KCD A;  3DGL A;  1CQS A;  3QRD A;  4O2H A;  3DGO A;  2Z76 A;  3K7C A;  5ELJ A;  2V1L A;  3CCR 3;  1JJ2 2;  3CNX A;  4HVN A;  1Q82 4;  3EHC A;  4J8T A;  2WOH A;  5AIH A;  3WOD G;  2JDI H;  3JUO A;  1VQK 3;  2P0M A;  3BNB A;  4IPB A;  1OGZ A;  3FZW A;  2CG0 A;  3LTB A;  3MYT A;  3MWZ A;  4R80 A;  5D83 A;  5LC7 A;  3GZB A;  3QK9 A;  3LTC A;  3VSY A;  1JN5 A;  1TUH A;  2RGQ A;  1M90 4;  1O7G B;  3PCS A;  1W2Z A;  4ORL A;  2HML B;  2CHC A;  2YFI B;  4BTY A;  1DMN A;  3LYG A;  4O02 B;  2XEP A;  2LYX A;  1YJ9 3;  3UJM A;  3JUQ A;  5BXQ A;  3EX9 A;  2CG1 A;  4WYK A;  3WDG B;  1QVG 2;  3X42 A;  7STD A;  4FMB A;  5CXO A;  1ULI B;  1N9J A;  5IG5 A;  1JB4 A;  2CH9 A;  3HK4 A;  2OOV A;  2GEY A;  1NO3 A;  1SPU A;  1K9M 4;  3CME 3;  2IMJ A;  4MMX B;  4EYC A;  1YVB I;  1OPY A;  3BB9 A;  3F7S A;  4RNY A;  2YX9 A;  4R9K A;  1OHP A;  3U1W A;  3D9R A;  1LNH A;  3M8C A;  3B4P A;  3HZP A;  3Q90 A;  4HM0 B;  5DRV A;  1AR0 A;  2P05 A;  3MKI A;  2MC8 A;  3KSE D;  6STD A;  3G71 3;  3AMO B;  4ZM8 A;  3K0Z A;  2JQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...