2RGQA

Crystal structure of a protein of unknown function with a cystatin-like fold (npun_r3134) from nostoc punctiforme pcc 73102 at 1.80 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
MELTALDKLEIMELAARFEMSLDKEDVENYLATFASDGALQGFWGIAKGKEELRQGFYAMLDTFARGKRHCSSNAIIQGNYDEATMESYLTVVNREDLNRAGSAFVKDQVRKINGKWYLILRQIEVDPSLPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Domain of Unknown Function with a Cystatin-Like Fold
publication title Crystal Structure of Domain of Unknown Function with a Cystatin-Like Fold (ZP_00111510.1) from Nostoc punctiforme PCC 73102 at 1.80 A resolution
rcsb
source organism Nostoc punctiforme
molecule tags Unknown function
total genus 32
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2rgqA00
5IF6A 3WMDA 3EHCA 1AR0A 3LZAA 3EF8A 3BLZA 3FLJA 4HJLB 1JB4A 2GEXA 1ISKA 5CF1A 1OHSA 4OVMA 3ER7A 1JN5B 3JUOA 4WYKB 3D9RA 4X2HA 1WQLB 5AIHA 1GS3A 5IG0A 4FCMA 2GXFA 4L8PA 1JN5A 3GZYB 2BMRB 3FF2A 4WYKA 1O7NB 1GY5A 3OX9A 1C7HA 1DMMA 3EC9A 3OWYA 1OHOA 3F8HA 1O7HB 3M8CA 3DZLA 1NU3A 4HM1B 2RFRA 4WP5A 3S5CA 3H51A 3CPOA 4HM3B 3MHEA 1ASKA 5JPUA 1JB2A 4LEHA 3F40A 4J8TA 1IDPA 2YFJB 2INXA 3Q90A 1W00A 5CXOA 2UX0A 4K1VA 4XDVA 3HX8A 2XR8B 4MJDA 2A15A 5D82A 5JPPA 1A2KA 1GY6A 2HMOB 5IEOA 1QMAA 2Z77A 1OHPA 3GRDA 5BXQA 3JUMA 4N3VA 3NM2A 3EX9A 5AIGA 3I0YA 4IIAA 3UNLA 1W02A 3NV0A 1QJGA 4HZBB 2XSHB 4XDWA 5CK6A 2RGQA 1TUHA 5AI1A 3GWRA 3KZTA 5HGRA 3NUVA 5G2GA 4R1KA 5KP4A 3STDA 6STDA 2GBWB 4RZMA 2CKFB 2BMQB 1OCVA 4K1UA 1E3VA 4L7KA 4HZ9B 3F7XA 2I9WA 1OUNA 4OUQA 1UUVB 2F99A 3A76A 3DM8A 1O7WB 2OWPA 2HMJB 1GY7A 3F9SA 3GZBA 4L8OA 3MYTA 3EN8A 5AIIA 1OH0A 3LYGA 2JQ5A 3JUNA 3MG1A 1DMQA 3EBTA 2PZVA 1OGZA 3FKAA 5EVHA 4STDA 1Q40B 4ORLA 4LMIA 3OWSA 1NWWA 1JKGB 3T8NA 1O7GB 3FF0A 5TGNA 3HK4A 1Q40A 1STDA 3ROBA 1EG9B 1ZX2A 5IEPA 3T8UA 2F86B 5CF2A 1JKGA 2YFLB 3UJMA 2IMJA 5D83A 1VZZA 4XB5A 1W01A 5AEUB 1Z1SA 4WWUC 1CQSA 2GEYA 3CU3A 3NV0B 3FGYA 4Q53A 2XSOB 3FH1A 1O7MB 1OPYA 2YFIB 3B8LA 1O7PB 4J9AA 3EQQB 1E3RA 2HMNB 3B4OA 1TP6A 1ZO2A 4XBTA 3OV4A 3K7CA 1ULJB 3B4PA 3DMCA 3G8ZA 3JUQA 4HM8B 3CNMA 7STDA 2B1XB 1K41A 1EA2A 3EN1B 2CHCA 2HMLB 3H3HA 3G0KA 5DRVA 3MG3A 5IG4A 4R9KA 3E99A 4HKVB 3F8XA 5STDA 3FSDA 3G16A 3IPTA 4HM6B 8CHOA 3F14A 3NBRA 5KP1A 4XBYA 3DUKA 5IERA 3DXOA 4HM0B 2HMMB 3B7CA 1ULIB 2R4IA 4XM4A 5IG5A 3ECFA 2B24B 1W6YA 1U5OA 3SOAA 2RCDA 5FW5A 4PEJA 3SOYA 3HZPA 3VGNA 1Q42A 3K0ZA 5BVBA 3FZWA 4U13A 4XBXA 3NHXA 3MG2A 4HM5B 4CDLA 3CNXA 5DREA 4X2OA 2QIYA 1E97A 3BB9A 1DMNA 4GB5A 3MSOA 2HMKB 1BUQA 4KVHA 4HVNA 4HM2B 1SJWA 2XRXB 3KSPA 3JUPA 5AEWB 5CLKA 4HM4B 3KKGA 3EBYA 2F98A 3VSYA 1UUWB 1GYBA 3NXJA 2BMOB 3GZRA 4HM7B 1OGXA 1JB5A 4H3UA 2STDA 3MKIA 3OWUA 1HKXA 4FCJA 1NDOB 3KE7A 3RGAA 3F7SA 3RGRA 1OF5B 2GBXB 5IENA 1S5AA 4R9LA 3GZXB 2K54A 1OF5A 5AIFA 2Z76A 2W2CA 3SEDA 4I4KA 2QGUA 5D81A 5IG3A 2Z7AA 2BNGA 5KP3A 3OXAA 4LGQA 3EJVA
chains in the Genus database with same CATH superfamily
1GMPA 5IF6A 1CEWI 1DE3A 1A2PA 6RNTA 1IQYA 1K28A 1FGTA 1GOUA 1M1XB 3WMDA 3EHCA 3NBBA 1N5HA 2P09A 1RGAA 2O3OA 1WMOA 1Q864 1AR0A 3LZAA 3EF8A 4LYLB 2CFLA 1BNIA 3BLZA 1GSPA 1NNVA 4O3VA 5M1AA 3LH4A 3S67A 2E2UA 3FLJA 4WFOA 2XGLA 5ELUA 1FW7A 2BHMA 4GSPA 4HJLB 1JB4A 3WHOA 1RHLA 2GEXA 1ISKA 5CF1A 2CX1A 3NX0A 1KD14 1U8CB 2P38A 3LOYA 4AKYA 1B2XA 1MWSA 1OHSA 3JVCA 4FMDA 2RSXA 1QAFA 1RMSA 4OVMA 3ER7A 1VQQA 3DGLA 1JN5B 4CCVA 3HIIA 3FG4A 3CCL3 4HBRA 1YJ93 5LC7A 1WTHA 3JUOA 4WYKB 3D9RA 4DKIA 1I8VA 4X2HA 1FGMA 1IVWA 1WQLB 2OTL3 2KF4A 3J7Yd 1OACA 1VQO3 5AIHA 1VQN3 3WA2X 1GS3A 1I3IA 2OQEC 4FCMA 4TX4A 2GXFA 5IG0A 1BRKA 4L8PA 3URPA 1UCIA 2CFGA 1IK3A 1JRQA 1JN5A 3GZYB 2C4BA 2O9UX 4JRFA 4NREA 2KRTA 2BMRB 2WOHA 3FF2A 4WYKA 2Y73A 1O7NB 1GY5A 3OX9A 2LYXA 2ML6A 1C7HA 3WOEB 1DMMA 4G1MB 3EC9A 1I70A 3AGOA 3OWYA 3UB1A 1OHOA 1Q814 3F8HA 1O7HB 3M8CA 1MWUA 1W6GA 3DZLA 1RGFA 1NU3A 2CFKA 2GU1A 4HM1B 1LRAA 2H0IA 5AYSC 2RFRA 4WP5A 2OOVA 4BTXA 1ROAA 3S5CA 3H51A 1RGLA 3CPOA 2F56A 2W04A 2BO9B 4HM3B 2XF3A 3MHEA 4BL3A 1LOVA 3S29A 2IY2A 4EYCA 5BIRA 1BOXA 3OW22 1ASKA 1PFPA 2R41A 5JPUA 1RRLA 2IYJA 1TTOA 4MMYB 3UL6A 2C10A 2FNQA 3SXXA 1FUSA 1JB2A 1WMPA 1MGWA 2KF5A 1W2B2 1TJDA 2CIUA 3K63A 4LEHA 5M19A 5G1KA 4EV2A 3F40A 3WR2A 4J8TA 1IDPA 2WOFA 2Z6BA 2YFJB 3CD63 1JZOA 1BUJA 1HU9A 1VQM3 2XFTA 2AADA 4K61A 1KSIA 1Q7Y4 2INXA 1WMNA 3PXMA 3Q90A 1W00A 1FZUA 1AVLA 5CXOA 2UX0A 1JNQA 4K1VA 1VQ93 1MGRA 4FMCA 3SOYA 4XDVA 1RSNA 3N9HA 3HX8A 2XR8B 4MJDA 3NQYA 2W0QA 3PYJA 4I5QA 3WODG 1CYVA 3NBJA 2A15A 3AMOB 3D5IA 3LMLA 5D82A 5JPPA 1A2KA 1B2UA 3KFQC 3G4S3 1GY6A 3PCSA 1RN1A 1I2GA 3LT8A 2HMOB 4RNYA 1FGQA 3BNBA 1QMAA 5IEOA 1KC84 1VQ43 1CH0A 1BNGA 1US1A 2Z77A 1STFI 1JBRA 1DVCA 1OHPA 1T2IA 1NJI4 2L1SA 3GRDA 5BXQA 3JUMA 4N3VA 3U1WA 1BRJA 3NM2A 1IYYA 3CCJ3 3EX9A 5AIGA 1PY3A 2KCDA 4LSOA 3I0YA 1MWTA 1V57A 3LTBA 4IIAA 4MMXB 2ZL8A 4N6V0 1W02A 1PYLA 1YGEA 3D4AA 3UNLA 4EBGA 4IPBA 3A5EA 1AV4A 3NV0A 1IVXA 1BNRA 1QJGA 2XGNA 1VQ63 4HZBB 4OK0A 1LQMB 2W56B 2XSHB 2BIRA 2LQVA 4AEQA 3EE1A 3FCSB 4EV5A 4XDWA 5CK6A 2RGQA 1X1UA 1G02A 1TUHA 5AI1A 3GWRA 3KZTA 1SIIA 5HGRA 5LC6A 2IUJA 1VQ73 2WGOA 3NUVA 1UCJA 1UCKA 5G2GA 3DGOA 4ZM8A 1NB3I 2F4YA 4R1KA 5KP4A 2CH9A 3STDA 1B20A 4KZ1A 6STDA 2OTJ3 2W56A 2GBWB 1JV2B 4RZMA 2CKFB 2BMQB 5FGOA 1OCVA 3LTDA 3T0UA 1N5PA 3PGBA 3ZG5A 1BGSA 4K1UA 1E3VA 3TDGA 1YNVX 4L7KA 2JDIH 3KN4A 4HZ9B 1GMRA 3F7XA 2BT3A 3X3YA 1N8QA 1LXEA 3O8YA 4IT7A 4N6LA 1UGIA 3X3XA 4HOHA 2I9WA 1OUNA 1T3BA 1UDII 4EC6A 4OUQA 3CCR3 4O2HA 3HOHA 1UUVB 2F99A 1FGRA 3A76A 3DM8A 1RN7A 1O7WB 1DVDA 2OWPA 1KWIA 1GY7A 1TRPA 2HMJB 2W03A 3F9SA 3GZBA 4L8OA 4FMAA 1RGHA 1TRQA 1S723 1T5YA 3MYTA 3EN8A 5AIIA 4LZIA 3UL5A 1OH0A 1Q7HA 2BU4A 4FMBA 1JBTA 2W6JH 3LYGA 4N6MA 1YJN3 2JQ5A 3JUNA 4N6UA 3K9MC 2D1WA 3MG1A 1DMQA 1FA3A 2P05A 3EBTA 4H61A 2PZVA 2ZDJA 3Q3FA 1K8A4 1T2HA 1OGZA 1I0VA 4J5GA 2CW9A 1J2BA 1EUIC 3CPW2 2OOVC 3FKAA 5EVHA 4STDA 1UUGB 1UI8A 2GU3A 8RNTA 1PU4A 3GAXA 1F8NA 1RDSA 3AHSA 1DYUA 1RN4A 1Q40B 3AHWA 1IQXA 1VQ83 4ORLA 4LMIA 1YGWA 3OWSA 3CXC2 1IT8A 1NWWA 1RRHA 4QWTA 9RNTA 1GD3A 1JKGB 2J8XB 3BNEA 3T8NA 1O7GB 4N6NB 3FF0A 5TGNA 3K5TA 1MNLA 3HK4A 7GSPA 3CCE3 1CYUA 3U97A 1Q40A 1STDA 3IJEB 2FXTA 2WGQA 1UW1A 3ROBA 3AGNA 3GSPA 1EEJA 1EG9B 1BSCA 1ZX2A 3S27A 3T8UA 2F86B 5IEPA 1D6YA 2QA43 3N8BA 1FUWA 5CF2A 1FUTA 1JKGA 2YFLB 4JF8A 2AAEA 1K9M4 1D6ZA 2IUKA 3FG3A 3RDEA 4RBNA 4GL6A 1B21A 1I0XA 1B2SA 1I2FA 1Y4KA 3X3ZA 1BU4A 3UJMA 1W5ZA 1BNSA 2IMJA 5D83A 2WO0A 1Q824 1W4NA 2SARA 1BRNL 1SIHA 2P0MA 3BNDA 4N6TA 1VZZA 4XB5A 5ELJA 1GD4A 1VQP3 2CG0A 1AY7A 2XEPA 2Y74A 1A67A 1W01A 5AEUB 4N6OB 2HOHA 1Z1SA 1BSBA 1MOLA 1N9EA 3MWZA 1VQK3 4WWUC 7RNTA 1M1K4 1DETA 1JZDA 1IQ8A 1QALA 1CQSA 2GEYA 3CU3A 1IT7A 2FGTA 2M7OA 1FYSA 1UI7A 3FGYA 3NV0B 4Q53A 3CC43 3CCQ3 1BRIA 2XSOB 1WNHA 2H0GA 3HIGA 2CWVA 4BTWA 1QAKA 5RNTA 3FH1A 1O7MB 1A90A 1RGGA 1OPYA 3SYUA 4BTYA 2YFIB 3B8LA 1O7PB 1YVBI 4FCZA 1AVKA 4J9AA 3EQQB 1E3RA 3DGMA 4CJNA 1YI23 2HMNB 4FR9A 4CPKA 4RNTA 5GSPA 3B4OA 3DH2A 1TP6A 1ZO2A 2V1LA 4XBTA 3D3LA 3WDGB 1LQGC 1BSEA 3OV4A 4KFFA 3WA3A 3G6E3 3HI7A 3D79A 3K7CA 3QRDA 1B3SA 1LOWA 1ULJB 1BIRA 1NB5I 3B4PA 1YHQ3 3DMCA 1HZ1A 3G8ZA 1GMQA 3JUQA 1NO3A 1RCLA 3V98A 4HM8B 3CNMA 7STDA 3X41A 3CCM3 2B1XB 1K41A 3Q2PA 5M18A 1EA2A 1RLSA 3EN1B 2CHCA 2HMLB 4MEIA 3H3HA 1GOYA 2CWTA 3G0KA 5DRVA 3IMAB 3MG3A 3I553 1ZS7A 3D5GA 5IG4A 5IW9A 4NPBA 3FG1A 2RBIA 3E99A 4R9KA 4HKVB 2MF7A 3LT9A 1LVNA 3F8XA 4KFDA 2CC3A 2UGIA 5STDA 1M904 3LXUX 3PZWA 3ZFZA 3FSDA 1W7CA 1N8R4 3G16A 1BANA 3IPTA 4HM6B 4HYZA 8CHOA 1K734 3F14A 3NBRA 1G0TA 1GOVA 1RGKA 5KP1A 2ZA4A 4XBYA 3DUKA 4K90B 3DXOA 1W6CA 4HM0B 5IERA 2HMMB 3B7CA 3X40A 1YIJ3 2E2VA 1LNHA 1RCKA 1ULIB 2R4IA 1RGEA 3DGNA 1ROVA 4XM4A 3VF1A 3SVAA 3DGYA 3CMA3 1X1XA 1C54A 3LTAA 5IG5A 3KIIA 3ECFA 1IU7A 3BU4A 2B24B 1N9JA 1U5OA 1W6YA 1EKMA 3SOAA 3G713 3EB8A 5A0OB 2RCDA 5FW5A 3CCS3 4PEJA 1B2MA 2KF6A 3ALAA 3RNTA 1FGOA 1G96A 2OCTA 2F5MA 3N54B 2OQEA 1V58A 3HZPA 1Q42A 1BNJA 1RGCA 2F5WA 3K0ZA 1B27A 3QK9A 4RNZA 3VGNA 4AKZA 3CCV3 1SARA 1QVG2 5BVBA 1BRGA 3FZWA 1IV9A 2Q07A 4U13A 4XBXA 3NHXA 1X1YA 1MWRA 2CFDA 2XH9A 3KSED 1UCLA 1TU5A 3NQZA 3MG2A 4HM5B 1SPUA 4CDLA 1QVF2 3CNXA 5DREA 4X2OA 2QIYA 3SLUA 1E97A 4EW5A 3BB9A 1DMNA 5G1LA 1X1WA 2IA7A 1JBSA 1IVVA 2MC8A 1M9GA 2ML5A 5EEOA 1YVSA 4GB5A 1RNBA 3WOFB 3MSOA 2HMKB 4BU4A 4KVHA 1TIJA 1BUQA 4HVNA 4HM2B 1SJWA 4KT3B 3ZG0A 2K3DA 2XRXB 3KSPA 1RNTA 1L5GB 2QEX3 4J5KA 3JUPA 4NHFA 2C11A 1BNEA 1IVUA 4BIRA 3CCU3 5AEWB 5CLKA 1R4YA 2L4VA 3MPHA 1TFKA 1W2ZA 2KXGA 3KKGA 4HM4B 3LTCA 2CX0A 3EBYA 1UGHI 3NM7A 2W9QA 2P0XA 3CC73 2F98A 3VSYA 3BIRA 1UUWB 1GYBA 1AQZA 4ILFA 2D42A 1LOYA 3KCHA 3NXJA 3Q1CA 3V92A 2BMOB 2GSPA 3PS8A 3X42A 3I563 3GZRA 4HM7B 1OGXA 4HAAA 2CK3H 2UUGC 3CME3 1VQL3 1ZGXA 2KAAA 6GSPA 1B2ZA 1JB5A 1A2VA 1BRSA 4H3UA 5BU4A 1Q9EA 2STDA 1KQS2 3CC23 5I97A 1HYFA 5HOHA 1VQ53 1BAOA 1BSAA 1YIT3 3MKIA 2CFWA 3OWUA 1HKXA 5EQLA 1YJW3 4FCJA 1JJ22 1NDOB 3KE7A 3RGAA 4GHOA 3F7SA 4BL2A 2K0MA 3RGRA 1RKYA 1OF5B 1RTUA 2CWUA 2CG1A 1LOXA 2GBXB 3PCRA 2SBLA 3SX1A 1SQWA 1BVIA 4O02B 1LNIA 2W9PA 1BNFA 1V74A 2ZHXB 4R4KA 4EXRA 5IENA 1S5AA 1D6UA 5AYRB 4R9LA 3GZXB 2K54A 4WHAA 3L0RA 1OF5A 2XFSA 1RJOA 3DY5A 3AMOA 5AIFA 4O8SA 5JBSA 1TFOA 1IV7A 2Z76A 2W2CA 3SEDA 4MMZB 4I4KA 2PNCA 2RNTA 4KFEA 3V99A 2QGUA 1BRHA 5D81A 4R80A 5IG3A 1EQKA 1I2EA 2BNGA 2Z7AA 3BNCA 2H0HA 2KF3A 5KP3A 3OXAA 2YX9A 4LGQA 1I3FA 3EJVA 3S28A 1R4CA 1BSDA 2E2TA
chains in the Genus database with same CATH topology
5IF6A 1CEWI 1IQYA 1K28A 1FGTA 1M1XB 3WMDA 3EHCA 3NBBA 1N5HA 2P09A 2O3OA 1WMOA 1Q864 1AR0A 3LZAA 3EF8A 2CFLA 3BLZA 4O3VA 3LH4A 3S67A 2E2UA 3FLJA 4WFOA 2XGLA 5ELUA 2BHMA 4HJLB 1JB4A 2GEXA 1ISKA 5CF1A 3NX0A 1KD14 1U8CB 2P38A 3LOYA 4AKYA 1OHSA 3JVCA 4FMDA 2RSXA 1QAFA 4OVMA 3ER7A 3DGLA 1JN5B 4CCVA 3HIIA 3FG4A 3CCL3 4HBRA 1YJ93 5LC7A 1WTHA 3JUOA 4WYKB 3D9RA 4X2HA 1FGMA 1IVWA 1WQLB 2OTL3 3J7Yd 1VQO3 1OACA 1VQN3 5AIHA 3WA2X 1GS3A 2OQEC 5IG0A 4FCMA 4TX4A 2GXFA 4L8PA 2CFGA 1IK3A 1JRQA 1JN5A 3GZYB 4JRFA 2O9UX 4NREA 2KRTA 2BMRB 2WOHA 3FF2A 4WYKA 2Y73A 1O7NB 1GY5A 3OX9A 2LYXA 2ML6A 1C7HA 3WOEB 1DMMA 4G1MB 3EC9A 3OWYA 3UB1A 1OHOA 1Q814 3F8HA 1O7HB 3M8CA 1W6GA 3DZLA 2CFKA 1NU3A 2GU1A 4HM1B 5AYSC 2OOVA 2RFRA 4WP5A 4BTXA 1ROAA 3S5CA 3H51A 3CPOA 2W04A 2BO9B 4HM3B 2XF3A 3MHEA 4EYCA 3S29A 3OW22 1ASKA 1PFPA 5JPUA 1RRLA 4MMYB 3UL6A 2C10A 2FNQA 3SXXA 1JB2A 1WMPA 1W2B2 2CIUA 3K63A 4LEHA 3F40A 4J8TA 1IDPA 2WOFA 2Z6BA 2YFJB 3CD63 1HU9A 1VQM3 2XFTA 4K61A 1KSIA 1Q7Y4 2INXA 1WMNA 3PXMA 3Q90A 1W00A 1AVLA 5CXOA 2UX0A 1JNQA 4K1VA 1VQ93 4FMCA 4XDVA 3N9HA 3HX8A 2XR8B 4MJDA 3NQYA 2W0QA 3PYJA 3WODG 1CYVA 3NBJA 2A15A 3AMOB 3LMLA 5D82A 5JPPA 1A2KA 3KFQC 3G4S3 1GY6A 3PCSA 1KC84 3LT8A 2HMOB 4RNYA 1FGQA 3BNBA 1QMAA 5IEOA 1VQ43 1US1A 2Z77A 1STFI 1DVCA 1OHPA 1NJI4 3GRDA 5BXQA 3JUMA 4N3VA 3U1WA 3NM2A 3CCJ3 3EX9A 5AIGA 2KCDA 4LSOA 3I0YA 4MMXB 1K8A4 3LTBA 4IIAA 3UNLA 2ZL8A 4N6V0 1W02A 1YGEA 3WOFB 4EBGA 4IPBA 1AV4A 3NV0A 1IVXA 1QJGA 2XGNA 1VQ63 4HZBB 4OK0A 2W56B 2XSHB 2LQVA 4AEQA 3EE1A 3FCSB 4EV5A 4XDWA 5CK6A 2RGQA 1TUHA 5AI1A 3GWRA 3KZTA 1SIIA 5HGRA 5LC6A 2IUJA 1VQ73 2WGOA 3NUVA 5G2GA 4ZM8A 3DGOA 1NB3I 4R1KA 5KP4A 2CH9A 3STDA 6STDA 4KZ1A 2OTJ3 2W56A 2GBWB 1JV2B 4RZMA 2CKFB 2BMQB 5FGOA 1OCVA 3LTDA 3T0UA 1N5PA 3PGBA 4K1UA 1E3VA 3TDGA 4L7KA 2JDIH 3KN4A 4HZ9B 3F7XA 2BT3A 3X3YA 1N8QA 1LXEA 3O8YA 4IT7A 4N6LA 3X3XA 2I9WA 1OUNA 4EC6A 4OUQA 3CCR3 4O2HA 1UUVB 2F99A 1FGRA 3A76A 3DM8A 1RN7A 1O7WB 1DVDA 2OWPA 1KWIA 1GY7A 2HMJB 3F9SA 2W03A 3GZBA 4L8OA 4FMAA 1S723 1T5YA 3MYTA 3EN8A 5AIIA 4LZIA 3UL5A 1OH0A 4FMBA 2W6JH 3LYGA 4N6MA 1YJN3 2JQ5A 3JUNA 4N6UA 3K9MC 2D1WA 3MG1A 1DMQA 1FA3A 2P05A 3EBTA 4H61A 2PZVA 2ZDJA 1OGZA 1J2BA 2CW9A 3CPW2 2OOVC 3FKAA 5EVHA 4STDA 1UI8A 2GU3A 1PU4A 3GAXA 1F8NA 1DYUA 1Q40B 1IQXA 1VQ83 4ORLA 4LMIA 3CXC2 3OWSA 1IT8A 1NWWA 1RRHA 4QWTA 1GD3A 1JKGB 3BNEA 3T8NA 1O7GB 4N6NB 3FF0A 5TGNA 3K5TA 1MNLA 3HK4A 3CCE3 1CYUA 3U97A 1Q40A 1STDA 3IJEB 2FXTA 2WGQA 1UW1A 3ROBA 1EG9B 3S27A 1ZX2A 5IEPA 3T8UA 2F86B 1D6YA 2QA43 3N8BA 1FUWA 5CF2A 1JKGA 2YFLB 4JF8A 1K9M4 1D6ZA 2IUKA 3FG3A 3RDEA 4RBNA 4GL6A 1Y4KA 3X3ZA 3UJMA 1W5ZA 2IMJA 5D83A 2WO0A 1Q824 1W4NA 1SIHA 2P0MA 3BNDA 4N6TA 1VZZA 4XB5A 5ELJA 1GD4A 1VQP3 2CG0A 1A67A 2XEPA 2Y74A 1W01A 5AEUB 4N6OB 1Z1SA 1MOLA 1N9EA 3MWZA 1VQK3 4WWUC 1M1K4 1IQ8A 1QALA 1CQSA 2GEYA 3CU3A 1IT7A 2FGTA 2M7OA 3FGYA 1UI7A 3NV0B 4Q53A 1M904 3CC43 3CCQ3 2XSOB 1WNHA 3HIGA 4BTWA 2CWVA 1QAKA 3FH1A 1O7MB 1A90A 4BTYA 1OPYA 2YFIB 3B8LA 1O7PB 1YVBI 4FCZA 1AVKA 4J9AA 3EQQB 1E3RA 3DGMA 1YI23 2HMNB 4FR9A 3B4OA 1TP6A 1ZO2A 2V1LA 4XBTA 3D3LA 3WDGB 3OV4A 4KFFA 3WA3A 3G6E3 3HI7A 3K7CA 3QRDA 1ULJB 1NB5I 3B4PA 1YHQ3 3DMCA 3G8ZA 3JUQA 1NO3A 3V98A 4HM8B 3CNMA 7STDA 3X41A 3CCM3 2B1XB 1K41A 3Q2PA 1EA2A 3EN1B 2CHCA 2HMLB 4MEIA 3H3HA 2CWTA 3G0KA 5DRVA 3IMAB 3MG3A 3I553 5IG4A 5IW9A 3FG1A 4R9KA 3E99A 4HKVB 2MF7A 3LT9A 1LVNA 3F8XA 4KFDA 2CC3A 5STDA 3LXUX 3PZWA 3FSDA 1W7CA 1N8R4 3G16A 3IPTA 4HM6B 4HYZA 8CHOA 1K734 3F14A 3NBRA 5KP1A 4XBYA 3DUKA 4K90B 3DXOA 1W6CA 4HM0B 5IERA 2HMMB 3B7CA 3X40A 1YIJ3 2E2VA 1LNHA 1ULIB 2R4IA 3DGNA 1ROVA 4XM4A 3VF1A 3SVAA 3CMA3 3LTAA 5IG5A 3KIIA 3ECFA 1IU7A 2B24B 1N9JA 1U5OA 1W6YA 1EKMA 3SOAA 3G713 3EB8A 5A0OB 2RCDA 5FW5A 3CCS3 4PEJA 3ALAA 3SOYA 1FGOA 1G96A 2OCTA 3N54B 2OQEA 3HZPA 3VGNA 1Q42A 3K0ZA 4RNZA 4AKZA 3QK9A 3CCV3 1QVG2 5BVBA 3FZWA 1IV9A 2Q07A 4U13A 4XBXA 3NHXA 2CFDA 2XH9A 3KSED 1TU5A 3NQZA 3MG2A 4HM5B 1SPUA 4CDLA 1QVF2 3CNXA 5DREA 4X2OA 2QIYA 3SLUA 1E97A 3BB9A 1DMNA 2IA7A 1IVVA 2MC8A 1M9GA 2ML5A 5EEOA 4GB5A 3MSOA 2HMKB 1BUQA 4KVHA 1TIJA 4HVNA 4HM2B 1SJWA 2XRXB 3KSPA 1L5GB 2QEX3 3JUPA 4NHFA 2C11A 1IVUA 3CCU3 5AEWB 5CLKA 2L4VA 3MPHA 1TFKA 1W2ZA 2KXGA 3KKGA 4HM4B 3LTCA 3EBYA 3CC73 3NM7A 2W9QA 2P0XA 2F98A 3VSYA 1UUWB 1GYBA 2D42A 3Q1CA 3NXJA 3V92A 4EV2A 3I563 2BMOB 3PS8A 3X42A 3GZRA 4HM7B 1OGXA 2CK3H 3CME3 1VQL3 1JB5A 4H3UA 1A2VA 2STDA 1KQS2 3CC23 5I97A 1VQ53 1YIT3 1YJW3 3MKIA 2CFWA 3OWUA 1HKXA 5EQLA 1JJ22 4FCJA 1NDOB 3KE7A 3RGAA 3F7SA 2K0MA 3RGRA 1RKYA 1OF5B 2CWUA 2CG1A 1LOXA 2GBXB 3PCRA 2SBLA 3SX1A 1SQWA 4O02B 2W9PA 1V74A 4R4KA 5IENA 4EXRA 1S5AA 1D6UA 5AYRB 4R9LA 3GZXB 2K54A 4WHAA 3L0RA 1OF5A 2XFSA 1RJOA 3DY5A 3AMOA 5AIFA 4O8SA 5JBSA 1TFOA 1IV7A 2Z76A 2W2CA 3SEDA 4MMZB 4I4KA 2PNCA 4KFEA 3V99A 2QGUA 5D81A 4R80A 5IG3A 1EQKA 2Z7AA 2BNGA 3BNCA 5KP3A 3OXAA 2YX9A 4LGQA 3EJVA 3S28A 1R4CA 2E2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IF6 A;  3WMD A;  3EHC A;  1AR0 A;  3LZA A;  3EF8 A;  3BLZ A;  3FLJ A;  4HJL B;  1JB4 A;  2GEX A;  1ISK A;  5CF1 A;  1OHS A;  4OVM A;  3ER7 A;  1JN5 B;  3JUO A;  4WYK B;  3D9R A;  4X2H A;  1WQL B;  5AIH A;  1GS3 A;  5IG0 A;  4FCM A;  2GXF A;  4L8P A;  1JN5 A;  3GZY B;  2BMR B;  3FF2 A;  4WYK A;  1O7N B;  1GY5 A;  3OX9 A;  1C7H A;  1DMM A;  3EC9 A;  3OWY A;  1OHO A;  3F8H A;  1O7H B;  3M8C A;  3DZL A;  1NU3 A;  4HM1 B;  2RFR A;  4WP5 A;  3S5C A;  3H51 A;  3CPO A;  4HM3 B;  3MHE A;  1ASK A;  5JPU A;  1JB2 A;  4LEH A;  3F40 A;  4J8T A;  1IDP A;  2YFJ B;  2INX A;  3Q90 A;  1W00 A;  5CXO A;  2UX0 A;  4K1V A;  4XDV A;  3HX8 A;  2XR8 B;  4MJD A;  2A15 A;  5D82 A;  5JPP A;  1A2K A;  1GY6 A;  2HMO B;  5IEO A;  1QMA A;  2Z77 A;  1OHP A;  3GRD A;  5BXQ A;  3JUM A;  4N3V A;  3NM2 A;  3EX9 A;  5AIG A;  3I0Y A;  4IIA A;  3UNL A;  1W02 A;  3NV0 A;  1QJG A;  4HZB B;  2XSH B;  4XDW A;  5CK6 A;  2RGQ A;  1TUH A;  5AI1 A;  3GWR A;  3KZT A;  5HGR A;  3NUV A;  5G2G A;  4R1K A;  5KP4 A;  3STD A;  6STD A;  2GBW B;  4RZM A;  2CKF B;  2BMQ B;  1OCV A;  4K1U A;  1E3V A;  4L7K A;  4HZ9 B;  3F7X A;  2I9W A;  1OUN A;  4OUQ A;  1UUV B;  2F99 A;  3A76 A;  3DM8 A;  1O7W B;  2OWP A;  2HMJ B;  1GY7 A;  3F9S A;  3GZB A;  4L8O A;  3MYT A;  3EN8 A;  5AII A;  1OH0 A;  3LYG A;  2JQ5 A;  3JUN A;  3MG1 A;  1DMQ A;  3EBT A;  2PZV A;  1OGZ A;  3FKA A;  5EVH A;  4STD A;  1Q40 B;  4ORL A;  4LMI A;  3OWS A;  1NWW A;  1JKG B;  3T8N A;  1O7G B;  3FF0 A;  5TGN A;  3HK4 A;  1Q40 A;  1STD A;  3ROB A;  1EG9 B;  1ZX2 A;  5IEP A;  3T8U A;  2F86 B;  5CF2 A;  1JKG A;  2YFL B;  3UJM A;  2IMJ A;  5D83 A;  1VZZ A;  4XB5 A;  1W01 A;  5AEU B;  1Z1S A;  4WWU C;  1CQS A;  2GEY A;  3CU3 A;  3NV0 B;  3FGY A;  4Q53 A;  2XSO B;  3FH1 A;  1O7M B;  1OPY A;  2YFI B;  3B8L A;  1O7P B;  4J9A A;  3EQQ B;  1E3R A;  2HMN B;  3B4O A;  1TP6 A;  1ZO2 A;  4XBT A;  3OV4 A;  3K7C A;  1ULJ B;  3B4P A;  3DMC A;  3G8Z A;  3JUQ A;  4HM8 B;  3CNM A;  7STD A;  2B1X B;  1K41 A;  1EA2 A;  3EN1 B;  2CHC A;  2HML B;  3H3H A;  3G0K A;  5DRV A;  3MG3 A;  5IG4 A;  4R9K A;  3E99 A;  4HKV B;  3F8X A;  5STD A;  3FSD A;  3G16 A;  3IPT A;  4HM6 B;  8CHO A;  3F14 A;  3NBR A;  5KP1 A;  4XBY A;  3DUK A;  5IER A;  3DXO A;  4HM0 B;  2HMM B;  3B7C A;  1ULI B;  2R4I A;  4XM4 A;  5IG5 A;  3ECF A;  2B24 B;  1W6Y A;  1U5O A;  3SOA A;  2RCD A;  5FW5 A;  4PEJ A;  3SOY A;  3HZP A;  3VGN A;  1Q42 A;  3K0Z A;  5BVB A;  3FZW A;  4U13 A;  4XBX A;  3NHX A;  3MG2 A;  4HM5 B;  4CDL A;  3CNX A;  5DRE A;  4X2O A;  2QIY A;  1E97 A;  3BB9 A;  1DMN A;  4GB5 A;  3MSO A;  2HMK B;  1BUQ A;  4KVH A;  4HVN A;  4HM2 B;  1SJW A;  2XRX B;  3KSP A;  3JUP A;  5AEW B;  5CLK A;  4HM4 B;  3KKG A;  3EBY A;  2F98 A;  3VSY A;  1UUW B;  1GYB A;  3NXJ A;  2BMO B;  3GZR A;  4HM7 B;  1OGX A;  1JB5 A;  4H3U A;  2STD A;  3MKI A;  3OWU A;  1HKX A;  4FCJ A;  1NDO B;  3KE7 A;  3RGA A;  3F7S A;  3RGR A;  1OF5 B;  2GBX B;  5IEN A;  1S5A A;  4R9L A;  3GZX B;  2K54 A;  1OF5 A;  5AIF A;  2Z76 A;  2W2C A;  3SED A;  4I4K A;  2QGU A;  5D81 A;  5IG3 A;  2Z7A A;  2BNG A;  5KP3 A;  3OXA A;  4LGQ A;  3EJV A; 
#chains in the Genus database with same CATH topology
 1GMP A;  5IF6 A;  1CEW I;  1DE3 A;  1A2P A;  6RNT A;  1IQY A;  1K28 A;  1FGT A;  1GOU A;  1M1X B;  3WMD A;  3EHC A;  3NBB A;  1N5H A;  2P09 A;  1RGA A;  2O3O A;  1WMO A;  1Q86 4;  1AR0 A;  3LZA A;  3EF8 A;  4LYL B;  2CFL A;  1BNI A;  3BLZ A;  1GSP A;  1NNV A;  4O3V A;  5M1A A;  3LH4 A;  3S67 A;  2E2U A;  3FLJ A;  4WFO A;  2XGL A;  5ELU A;  1FW7 A;  2BHM A;  4GSP A;  4HJL B;  1JB4 A;  3WHO A;  1RHL A;  2GEX A;  1ISK A;  5CF1 A;  2CX1 A;  3NX0 A;  1KD1 4;  1U8C B;  2P38 A;  3LOY A;  4AKY A;  1B2X A;  1MWS A;  1OHS A;  3JVC A;  4FMD A;  2RSX A;  1QAF A;  1RMS A;  4OVM A;  3ER7 A;  1VQQ A;  3DGL A;  1JN5 B;  4CCV A;  3HII A;  3FG4 A;  3CCL 3;  4HBR A;  1YJ9 3;  5LC7 A;  1WTH A;  3JUO A;  4WYK B;  3D9R A;  4DKI A;  1I8V A;  4X2H A;  1FGM A;  1IVW A;  1WQL B;  2OTL 3;  2KF4 A;  3J7Y d;  1OAC A;  1VQO 3;  5AIH A;  1VQN 3;  3WA2 X;  1GS3 A;  1I3I A;  2OQE C;  4FCM A;  4TX4 A;  2GXF A;  5IG0 A;  1BRK A;  4L8P A;  3URP A;  1UCI A;  2CFG A;  1IK3 A;  1JRQ A;  1JN5 A;  3GZY B;  2C4B A;  2O9U X;  4JRF A;  4NRE A;  2KRT A;  2BMR B;  2WOH A;  3FF2 A;  4WYK A;  2Y73 A;  1O7N B;  1GY5 A;  3OX9 A;  2LYX A;  2ML6 A;  1C7H A;  3WOE B;  1DMM A;  4G1M B;  3EC9 A;  1I70 A;  3AGO A;  3OWY A;  3UB1 A;  1OHO A;  1Q81 4;  3F8H A;  1O7H B;  3M8C A;  1MWU A;  1W6G A;  3DZL A;  1RGF A;  1NU3 A;  2CFK A;  2GU1 A;  4HM1 B;  1LRA A;  2H0I A;  5AYS C;  2RFR A;  4WP5 A;  2OOV A;  4BTX A;  1ROA A;  3S5C A;  3H51 A;  1RGL A;  3CPO A;  2F56 A;  2W04 A;  2BO9 B;  4HM3 B;  2XF3 A;  3MHE A;  4BL3 A;  1LOV A;  3S29 A;  2IY2 A;  4EYC A;  5BIR A;  1BOX A;  3OW2 2;  1ASK A;  1PFP A;  2R41 A;  5JPU A;  1RRL A;  2IYJ A;  1TTO A;  4MMY B;  3UL6 A;  2C10 A;  2FNQ A;  3SXX A;  1FUS A;  1JB2 A;  1WMP A;  1MGW A;  2KF5 A;  1W2B 2;  1TJD A;  2CIU A;  3K63 A;  4LEH A;  5M19 A;  5G1K A;  4EV2 A;  3F40 A;  3WR2 A;  4J8T A;  1IDP A;  2WOF A;  2Z6B A;  2YFJ B;  3CD6 3;  1JZO A;  1BUJ A;  1HU9 A;  1VQM 3;  2XFT A;  2AAD A;  4K61 A;  1KSI A;  1Q7Y 4;  2INX A;  1WMN A;  3PXM A;  3Q90 A;  1W00 A;  1FZU A;  1AVL A;  5CXO A;  2UX0 A;  1JNQ A;  4K1V A;  1VQ9 3;  1MGR A;  4FMC A;  3SOY A;  4XDV A;  1RSN A;  3N9H A;  3HX8 A;  2XR8 B;  4MJD A;  3NQY A;  2W0Q A;  3PYJ A;  4I5Q A;  3WOD G;  1CYV A;  3NBJ A;  2A15 A;  3AMO B;  3D5I A;  3LML A;  5D82 A;  5JPP A;  1A2K A;  1B2U A;  3KFQ C;  3G4S 3;  1GY6 A;  3PCS A;  1RN1 A;  1I2G A;  3LT8 A;  2HMO B;  4RNY A;  1FGQ A;  3BNB A;  1QMA A;  5IEO A;  1KC8 4;  1VQ4 3;  1CH0 A;  1BNG A;  1US1 A;  2Z77 A;  1STF I;  1JBR A;  1DVC A;  1OHP A;  1T2I A;  1NJI 4;  2L1S A;  3GRD A;  5BXQ A;  3JUM A;  4N3V A;  3U1W A;  1BRJ A;  3NM2 A;  1IYY A;  3CCJ 3;  3EX9 A;  5AIG A;  1PY3 A;  2KCD A;  4LSO A;  3I0Y A;  1MWT A;  1V57 A;  3LTB A;  4IIA A;  4MMX B;  2ZL8 A;  4N6V 0;  1W02 A;  1PYL A;  1YGE A;  3D4A A;  3UNL A;  4EBG A;  4IPB A;  3A5E A;  1AV4 A;  3NV0 A;  1IVX A;  1BNR A;  1QJG A;  2XGN A;  1VQ6 3;  4HZB B;  4OK0 A;  1LQM B;  2W56 B;  2XSH B;  2BIR A;  2LQV A;  4AEQ A;  3EE1 A;  3FCS B;  4EV5 A;  4XDW A;  5CK6 A;  2RGQ A;  1X1U A;  1G02 A;  1TUH A;  5AI1 A;  3GWR A;  3KZT A;  1SII A;  5HGR A;  5LC6 A;  2IUJ A;  1VQ7 3;  2WGO A;  3NUV A;  1UCJ A;  1UCK A;  5G2G A;  3DGO A;  4ZM8 A;  1NB3 I;  2F4Y A;  4R1K A;  5KP4 A;  2CH9 A;  3STD A;  1B20 A;  4KZ1 A;  6STD A;  2OTJ 3;  2W56 A;  2GBW B;  1JV2 B;  4RZM A;  2CKF B;  2BMQ B;  5FGO A;  1OCV A;  3LTD A;  3T0U A;  1N5P A;  3PGB A;  3ZG5 A;  1BGS A;  4K1U A;  1E3V A;  3TDG A;  1YNV X;  4L7K A;  2JDI H;  3KN4 A;  4HZ9 B;  1GMR A;  3F7X A;  2BT3 A;  3X3Y A;  1N8Q A;  1LXE A;  3O8Y A;  4IT7 A;  4N6L A;  1UGI A;  3X3X A;  4HOH A;  2I9W A;  1OUN A;  1T3B A;  1UDI I;  4EC6 A;  4OUQ A;  3CCR 3;  4O2H A;  3HOH A;  1UUV B;  2F99 A;  1FGR A;  3A76 A;  3DM8 A;  1RN7 A;  1O7W B;  1DVD A;  2OWP A;  1KWI A;  1GY7 A;  1TRP A;  2HMJ B;  2W03 A;  3F9S A;  3GZB A;  4L8O A;  4FMA A;  1RGH A;  1TRQ A;  1S72 3;  1T5Y A;  3MYT A;  3EN8 A;  5AII A;  4LZI A;  3UL5 A;  1OH0 A;  1Q7H A;  2BU4 A;  4FMB A;  1JBT A;  2W6J H;  3LYG A;  4N6M A;  1YJN 3;  2JQ5 A;  3JUN A;  4N6U A;  3K9M C;  2D1W A;  3MG1 A;  1DMQ A;  1FA3 A;  2P05 A;  3EBT A;  4H61 A;  2PZV A;  2ZDJ A;  3Q3F A;  1K8A 4;  1T2H A;  1OGZ A;  1I0V A;  4J5G A;  2CW9 A;  1J2B A;  1EUI C;  3CPW 2;  2OOV C;  3FKA A;  5EVH A;  4STD A;  1UUG B;  1UI8 A;  2GU3 A;  8RNT A;  1PU4 A;  3GAX A;  1F8N A;  1RDS A;  3AHS A;  1DYU A;  1RN4 A;  1Q40 B;  3AHW A;  1IQX A;  1VQ8 3;  4ORL A;  4LMI A;  1YGW A;  3OWS A;  3CXC 2;  1IT8 A;  1NWW A;  1RRH A;  4QWT A;  9RNT A;  1GD3 A;  1JKG B;  2J8X B;  3BNE A;  3T8N A;  1O7G B;  4N6N B;  3FF0 A;  5TGN A;  3K5T A;  1MNL A;  3HK4 A;  7GSP A;  3CCE 3;  1CYU A;  3U97 A;  1Q40 A;  1STD A;  3IJE B;  2FXT A;  2WGQ A;  1UW1 A;  3ROB A;  3AGN A;  3GSP A;  1EEJ A;  1EG9 B;  1BSC A;  1ZX2 A;  3S27 A;  3T8U A;  2F86 B;  5IEP A;  1D6Y A;  2QA4 3;  3N8B A;  1FUW A;  5CF2 A;  1FUT A;  1JKG A;  2YFL B;  4JF8 A;  2AAE A;  1K9M 4;  1D6Z A;  2IUK A;  3FG3 A;  3RDE A;  4RBN A;  4GL6 A;  1B21 A;  1I0X A;  1B2S A;  1I2F A;  1Y4K A;  3X3Z A;  1BU4 A;  3UJM A;  1W5Z A;  1BNS A;  2IMJ A;  5D83 A;  2WO0 A;  1Q82 4;  1W4N A;  2SAR A;  1BRN L;  1SIH A;  2P0M A;  3BND A;  4N6T A;  1VZZ A;  4XB5 A;  5ELJ A;  1GD4 A;  1VQP 3;  2CG0 A;  1AY7 A;  2XEP A;  2Y74 A;  1A67 A;  1W01 A;  5AEU B;  4N6O B;  2HOH A;  1Z1S A;  1BSB A;  1MOL A;  1N9E A;  3MWZ A;  1VQK 3;  4WWU C;  7RNT A;  1M1K 4;  1DET A;  1JZD A;  1IQ8 A;  1QAL A;  1CQS A;  2GEY A;  3CU3 A;  1IT7 A;  2FGT A;  2M7O A;  1FYS A;  1UI7 A;  3FGY A;  3NV0 B;  4Q53 A;  3CC4 3;  3CCQ 3;  1BRI A;  2XSO B;  1WNH A;  2H0G A;  3HIG A;  2CWV A;  4BTW A;  1QAK A;  5RNT A;  3FH1 A;  1O7M B;  1A90 A;  1RGG A;  1OPY A;  3SYU A;  4BTY A;  2YFI B;  3B8L A;  1O7P B;  1YVB I;  4FCZ A;  1AVK A;  4J9A A;  3EQQ B;  1E3R A;  3DGM A;  4CJN A;  1YI2 3;  2HMN B;  4FR9 A;  4CPK A;  4RNT A;  5GSP A;  3B4O A;  3DH2 A;  1TP6 A;  1ZO2 A;  2V1L A;  4XBT A;  3D3L A;  3WDG B;  1LQG C;  1BSE A;  3OV4 A;  4KFF A;  3WA3 A;  3G6E 3;  3HI7 A;  3D79 A;  3K7C A;  3QRD A;  1B3S A;  1LOW A;  1ULJ B;  1BIR A;  1NB5 I;  3B4P A;  1YHQ 3;  3DMC A;  1HZ1 A;  3G8Z A;  1GMQ A;  3JUQ A;  1NO3 A;  1RCL A;  3V98 A;  4HM8 B;  3CNM A;  7STD A;  3X41 A;  3CCM 3;  2B1X B;  1K41 A;  3Q2P A;  5M18 A;  1EA2 A;  1RLS A;  3EN1 B;  2CHC A;  2HML B;  4MEI A;  3H3H A;  1GOY A;  2CWT A;  3G0K A;  5DRV A;  3IMA B;  3MG3 A;  3I55 3;  1ZS7 A;  3D5G A;  5IG4 A;  5IW9 A;  4NPB A;  3FG1 A;  2RBI A;  3E99 A;  4R9K A;  4HKV B;  2MF7 A;  3LT9 A;  1LVN A;  3F8X A;  4KFD A;  2CC3 A;  2UGI A;  5STD A;  1M90 4;  3LXU X;  3PZW A;  3ZFZ A;  3FSD A;  1W7C A;  1N8R 4;  3G16 A;  1BAN A;  3IPT A;  4HM6 B;  4HYZ A;  8CHO A;  1K73 4;  3F14 A;  3NBR A;  1G0T A;  1GOV A;  1RGK A;  5KP1 A;  2ZA4 A;  4XBY A;  3DUK A;  4K90 B;  3DXO A;  1W6C A;  4HM0 B;  5IER A;  2HMM B;  3B7C A;  3X40 A;  1YIJ 3;  2E2V A;  1LNH A;  1RCK A;  1ULI B;  2R4I A;  1RGE A;  3DGN A;  1ROV A;  4XM4 A;  3VF1 A;  3SVA A;  3DGY A;  3CMA 3;  1X1X A;  1C54 A;  3LTA A;  5IG5 A;  3KII A;  3ECF A;  1IU7 A;  3BU4 A;  2B24 B;  1N9J A;  1U5O A;  1W6Y A;  1EKM A;  3SOA A;  3G71 3;  3EB8 A;  5A0O B;  2RCD A;  5FW5 A;  3CCS 3;  4PEJ A;  1B2M A;  2KF6 A;  3ALA A;  3RNT A;  1FGO A;  1G96 A;  2OCT A;  2F5M A;  3N54 B;  2OQE A;  1V58 A;  3HZP A;  1Q42 A;  1BNJ A;  1RGC A;  2F5W A;  3K0Z A;  1B27 A;  3QK9 A;  4RNZ A;  3VGN A;  4AKZ A;  3CCV 3;  1SAR A;  1QVG 2;  5BVB A;  1BRG A;  3FZW A;  1IV9 A;  2Q07 A;  4U13 A;  4XBX A;  3NHX A;  1X1Y A;  1MWR A;  2CFD A;  2XH9 A;  3KSE D;  1UCL A;  1TU5 A;  3NQZ A;  3MG2 A;  4HM5 B;  1SPU A;  4CDL A;  1QVF 2;  3CNX A;  5DRE A;  4X2O A;  2QIY A;  3SLU A;  1E97 A;  4EW5 A;  3BB9 A;  1DMN A;  5G1L A;  1X1W A;  2IA7 A;  1JBS A;  1IVV A;  2MC8 A;  1M9G A;  2ML5 A;  5EEO A;  1YVS A;  4GB5 A;  1RNB A;  3WOF B;  3MSO A;  2HMK B;  4BU4 A;  4KVH A;  1TIJ A;  1BUQ A;  4HVN A;  4HM2 B;  1SJW A;  4KT3 B;  3ZG0 A;  2K3D A;  2XRX B;  3KSP A;  1RNT A;  1L5G B;  2QEX 3;  4J5K A;  3JUP A;  4NHF A;  2C11 A;  1BNE A;  1IVU A;  4BIR A;  3CCU 3;  5AEW B;  5CLK A;  1R4Y A;  2L4V A;  3MPH A;  1TFK A;  1W2Z A;  2KXG A;  3KKG A;  4HM4 B;  3LTC A;  2CX0 A;  3EBY A;  1UGH I;  3NM7 A;  2W9Q A;  2P0X A;  3CC7 3;  2F98 A;  3VSY A;  3BIR A;  1UUW B;  1GYB A;  1AQZ A;  4ILF A;  2D42 A;  1LOY A;  3KCH A;  3NXJ A;  3Q1C A;  3V92 A;  2BMO B;  2GSP A;  3PS8 A;  3X42 A;  3I56 3;  3GZR A;  4HM7 B;  1OGX A;  4HAA A;  2CK3 H;  2UUG C;  3CME 3;  1VQL 3;  1ZGX A;  2KAA A;  6GSP A;  1B2Z A;  1JB5 A;  1A2V A;  1BRS A;  4H3U A;  5BU4 A;  1Q9E A;  2STD A;  1KQS 2;  3CC2 3;  5I97 A;  1HYF A;  5HOH A;  1VQ5 3;  1BAO A;  1BSA A;  1YIT 3;  3MKI A;  2CFW A;  3OWU A;  1HKX A;  5EQL A;  1YJW 3;  4FCJ A;  1JJ2 2;  1NDO B;  3KE7 A;  3RGA A;  4GHO A;  3F7S A;  4BL2 A;  2K0M A;  3RGR A;  1RKY A;  1OF5 B;  1RTU A;  2CWU A;  2CG1 A;  1LOX A;  2GBX B;  3PCR A;  2SBL A;  3SX1 A;  1SQW A;  1BVI A;  4O02 B;  1LNI A;  2W9P A;  1BNF A;  1V74 A;  2ZHX B;  4R4K A;  4EXR A;  5IEN A;  1S5A A;  1D6U A;  5AYR B;  4R9L A;  3GZX B;  2K54 A;  4WHA A;  3L0R A;  1OF5 A;  2XFS A;  1RJO A;  3DY5 A;  3AMO A;  5AIF A;  4O8S A;  5JBS A;  1TFO A;  1IV7 A;  2Z76 A;  2W2C A;  3SED A;  4MMZ B;  4I4K A;  2PNC A;  2RNT A;  4KFE A;  3V99 A;  2QGU A;  1BRH A;  5D81 A;  4R80 A;  5IG3 A;  1EQK A;  1I2E A;  2BNG A;  2Z7A A;  3BNC A;  2H0H A;  2KF3 A;  5KP3 A;  3OXA A;  2YX9 A;  4LGQ A;  1I3F A;  3EJV A;  3S28 A;  1R4C A;  1BSD A;  2E2T A; 
#chains in the Genus database with same CATH homology
 5IF6 A;  1CEW I;  1IQY A;  1K28 A;  1FGT A;  1M1X B;  3WMD A;  3EHC A;  3NBB A;  1N5H A;  2P09 A;  2O3O A;  1WMO A;  1Q86 4;  1AR0 A;  3LZA A;  3EF8 A;  2CFL A;  3BLZ A;  4O3V A;  3LH4 A;  3S67 A;  2E2U A;  3FLJ A;  4WFO A;  2XGL A;  5ELU A;  2BHM A;  4HJL B;  1JB4 A;  2GEX A;  1ISK A;  5CF1 A;  3NX0 A;  1KD1 4;  1U8C B;  2P38 A;  3LOY A;  4AKY A;  1OHS A;  3JVC A;  4FMD A;  2RSX A;  1QAF A;  4OVM A;  3ER7 A;  3DGL A;  1JN5 B;  4CCV A;  3HII A;  3FG4 A;  3CCL 3;  4HBR A;  1YJ9 3;  5LC7 A;  1WTH A;  3JUO A;  4WYK B;  3D9R A;  4X2H A;  1FGM A;  1IVW A;  1WQL B;  2OTL 3;  3J7Y d;  1VQO 3;  1OAC A;  1VQN 3;  5AIH A;  3WA2 X;  1GS3 A;  2OQE C;  5IG0 A;  4FCM A;  4TX4 A;  2GXF A;  4L8P A;  2CFG A;  1IK3 A;  1JRQ A;  1JN5 A;  3GZY B;  4JRF A;  2O9U X;  4NRE A;  2KRT A;  2BMR B;  2WOH A;  3FF2 A;  4WYK A;  2Y73 A;  1O7N B;  1GY5 A;  3OX9 A;  2LYX A;  2ML6 A;  1C7H A;  3WOE B;  1DMM A;  4G1M B;  3EC9 A;  3OWY A;  3UB1 A;  1OHO A;  1Q81 4;  3F8H A;  1O7H B;  3M8C A;  1W6G A;  3DZL A;  2CFK A;  1NU3 A;  2GU1 A;  4HM1 B;  5AYS C;  2OOV A;  2RFR A;  4WP5 A;  4BTX A;  1ROA A;  3S5C A;  3H51 A;  3CPO A;  2W04 A;  2BO9 B;  4HM3 B;  2XF3 A;  3MHE A;  4EYC A;  3S29 A;  3OW2 2;  1ASK A;  1PFP A;  5JPU A;  1RRL A;  4MMY B;  3UL6 A;  2C10 A;  2FNQ A;  3SXX A;  1JB2 A;  1WMP A;  1W2B 2;  2CIU A;  3K63 A;  4LEH A;  3F40 A;  4J8T A;  1IDP A;  2WOF A;  2Z6B A;  2YFJ B;  3CD6 3;  1HU9 A;  1VQM 3;  2XFT A;  4K61 A;  1KSI A;  1Q7Y 4;  2INX A;  1WMN A;  3PXM A;  3Q90 A;  1W00 A;  1AVL A;  5CXO A;  2UX0 A;  1JNQ A;  4K1V A;  1VQ9 3;  4FMC A;  4XDV A;  3N9H A;  3HX8 A;  2XR8 B;  4MJD A;  3NQY A;  2W0Q A;  3PYJ A;  3WOD G;  1CYV A;  3NBJ A;  2A15 A;  3AMO B;  3LML A;  5D82 A;  5JPP A;  1A2K A;  3KFQ C;  3G4S 3;  1GY6 A;  3PCS A;  1KC8 4;  3LT8 A;  2HMO B;  4RNY A;  1FGQ A;  3BNB A;  1QMA A;  5IEO A;  1VQ4 3;  1US1 A;  2Z77 A;  1STF I;  1DVC A;  1OHP A;  1NJI 4;  3GRD A;  5BXQ A;  3JUM A;  4N3V A;  3U1W A;  3NM2 A;  3CCJ 3;  3EX9 A;  5AIG A;  2KCD A;  4LSO A;  3I0Y A;  4MMX B;  1K8A 4;  3LTB A;  4IIA A;  3UNL A;  2ZL8 A;  4N6V 0;  1W02 A;  1YGE A;  3WOF B;  4EBG A;  4IPB A;  1AV4 A;  3NV0 A;  1IVX A;  1QJG A;  2XGN A;  1VQ6 3;  4HZB B;  4OK0 A;  2W56 B;  2XSH B;  2LQV A;  4AEQ A;  3EE1 A;  3FCS B;  4EV5 A;  4XDW A;  5CK6 A;  2RGQ A;  1TUH A;  5AI1 A;  3GWR A;  3KZT A;  1SII A;  5HGR A;  5LC6 A;  2IUJ A;  1VQ7 3;  2WGO A;  3NUV A;  5G2G A;  4ZM8 A;  3DGO A;  1NB3 I;  4R1K A;  5KP4 A;  2CH9 A;  3STD A;  6STD A;  4KZ1 A;  2OTJ 3;  2W56 A;  2GBW B;  1JV2 B;  4RZM A;  2CKF B;  2BMQ B;  5FGO A;  1OCV A;  3LTD A;  3T0U A;  1N5P A;  3PGB A;  4K1U A;  1E3V A;  3TDG A;  4L7K A;  2JDI H;  3KN4 A;  4HZ9 B;  3F7X A;  2BT3 A;  3X3Y A;  1N8Q A;  1LXE A;  3O8Y A;  4IT7 A;  4N6L A;  3X3X A;  2I9W A;  1OUN A;  4EC6 A;  4OUQ A;  3CCR 3;  4O2H A;  1UUV B;  2F99 A;  1FGR A;  3A76 A;  3DM8 A;  1RN7 A;  1O7W B;  1DVD A;  2OWP A;  1KWI A;  1GY7 A;  2HMJ B;  3F9S A;  2W03 A;  3GZB A;  4L8O A;  4FMA A;  1S72 3;  1T5Y A;  3MYT A;  3EN8 A;  5AII A;  4LZI A;  3UL5 A;  1OH0 A;  4FMB A;  2W6J H;  3LYG A;  4N6M A;  1YJN 3;  2JQ5 A;  3JUN A;  4N6U A;  3K9M C;  2D1W A;  3MG1 A;  1DMQ A;  1FA3 A;  2P05 A;  3EBT A;  4H61 A;  2PZV A;  2ZDJ A;  1OGZ A;  1J2B A;  2CW9 A;  3CPW 2;  2OOV C;  3FKA A;  5EVH A;  4STD A;  1UI8 A;  2GU3 A;  1PU4 A;  3GAX A;  1F8N A;  1DYU A;  1Q40 B;  1IQX A;  1VQ8 3;  4ORL A;  4LMI A;  3CXC 2;  3OWS A;  1IT8 A;  1NWW A;  1RRH A;  4QWT A;  1GD3 A;  1JKG B;  3BNE A;  3T8N A;  1O7G B;  4N6N B;  3FF0 A;  5TGN A;  3K5T A;  1MNL A;  3HK4 A;  3CCE 3;  1CYU A;  3U97 A;  1Q40 A;  1STD A;  3IJE B;  2FXT A;  2WGQ A;  1UW1 A;  3ROB A;  1EG9 B;  3S27 A;  1ZX2 A;  5IEP A;  3T8U A;  2F86 B;  1D6Y A;  2QA4 3;  3N8B A;  1FUW A;  5CF2 A;  1JKG A;  2YFL B;  4JF8 A;  1K9M 4;  1D6Z A;  2IUK A;  3FG3 A;  3RDE A;  4RBN A;  4GL6 A;  1Y4K A;  3X3Z A;  3UJM A;  1W5Z A;  2IMJ A;  5D83 A;  2WO0 A;  1Q82 4;  1W4N A;  1SIH A;  2P0M A;  3BND A;  4N6T A;  1VZZ A;  4XB5 A;  5ELJ A;  1GD4 A;  1VQP 3;  2CG0 A;  1A67 A;  2XEP A;  2Y74 A;  1W01 A;  5AEU B;  4N6O B;  1Z1S A;  1MOL A;  1N9E A;  3MWZ A;  1VQK 3;  4WWU C;  1M1K 4;  1IQ8 A;  1QAL A;  1CQS A;  2GEY A;  3CU3 A;  1IT7 A;  2FGT A;  2M7O A;  3FGY A;  1UI7 A;  3NV0 B;  4Q53 A;  1M90 4;  3CC4 3;  3CCQ 3;  2XSO B;  1WNH A;  3HIG A;  4BTW A;  2CWV A;  1QAK A;  3FH1 A;  1O7M B;  1A90 A;  4BTY A;  1OPY A;  2YFI B;  3B8L A;  1O7P B;  1YVB I;  4FCZ A;  1AVK A;  4J9A A;  3EQQ B;  1E3R A;  3DGM A;  1YI2 3;  2HMN B;  4FR9 A;  3B4O A;  1TP6 A;  1ZO2 A;  2V1L A;  4XBT A;  3D3L A;  3WDG B;  3OV4 A;  4KFF A;  3WA3 A;  3G6E 3;  3HI7 A;  3K7C A;  3QRD A;  1ULJ B;  1NB5 I;  3B4P A;  1YHQ 3;  3DMC A;  3G8Z A;  3JUQ A;  1NO3 A;  3V98 A;  4HM8 B;  3CNM A;  7STD A;  3X41 A;  3CCM 3;  2B1X B;  1K41 A;  3Q2P A;  1EA2 A;  3EN1 B;  2CHC A;  2HML B;  4MEI A;  3H3H A;  2CWT A;  3G0K A;  5DRV A;  3IMA B;  3MG3 A;  3I55 3;  5IG4 A;  5IW9 A;  3FG1 A;  4R9K A;  3E99 A;  4HKV B;  2MF7 A;  3LT9 A;  1LVN A;  3F8X A;  4KFD A;  2CC3 A;  5STD A;  3LXU X;  3PZW A;  3FSD A;  1W7C A;  1N8R 4;  3G16 A;  3IPT A;  4HM6 B;  4HYZ A;  8CHO A;  1K73 4;  3F14 A;  3NBR A;  5KP1 A;  4XBY A;  3DUK A;  4K90 B;  3DXO A;  1W6C A;  4HM0 B;  5IER A;  2HMM B;  3B7C A;  3X40 A;  1YIJ 3;  2E2V A;  1LNH A;  1ULI B;  2R4I A;  3DGN A;  1ROV A;  4XM4 A;  3VF1 A;  3SVA A;  3CMA 3;  3LTA A;  5IG5 A;  3KII A;  3ECF A;  1IU7 A;  2B24 B;  1N9J A;  1U5O A;  1W6Y A;  1EKM A;  3SOA A;  3G71 3;  3EB8 A;  5A0O B;  2RCD A;  5FW5 A;  3CCS 3;  4PEJ A;  3ALA A;  3SOY A;  1FGO A;  1G96 A;  2OCT A;  3N54 B;  2OQE A;  3HZP A;  3VGN A;  1Q42 A;  3K0Z A;  4RNZ A;  4AKZ A;  3QK9 A;  3CCV 3;  1QVG 2;  5BVB A;  3FZW A;  1IV9 A;  2Q07 A;  4U13 A;  4XBX A;  3NHX A;  2CFD A;  2XH9 A;  3KSE D;  1TU5 A;  3NQZ A;  3MG2 A;  4HM5 B;  1SPU A;  4CDL A;  1QVF 2;  3CNX A;  5DRE A;  4X2O A;  2QIY A;  3SLU A;  1E97 A;  3BB9 A;  1DMN A;  2IA7 A;  1IVV A;  2MC8 A;  1M9G A;  2ML5 A;  5EEO A;  4GB5 A;  3MSO A;  2HMK B;  1BUQ A;  4KVH A;  1TIJ A;  4HVN A;  4HM2 B;  1SJW A;  2XRX B;  3KSP A;  1L5G B;  2QEX 3;  3JUP A;  4NHF A;  2C11 A;  1IVU A;  3CCU 3;  5AEW B;  5CLK A;  2L4V A;  3MPH A;  1TFK A;  1W2Z A;  2KXG A;  3KKG A;  4HM4 B;  3LTC A;  3EBY A;  3CC7 3;  3NM7 A;  2W9Q A;  2P0X A;  2F98 A;  3VSY A;  1UUW B;  1GYB A;  2D42 A;  3Q1C A;  3NXJ A;  3V92 A;  4EV2 A;  3I56 3;  2BMO B;  3PS8 A;  3X42 A;  3GZR A;  4HM7 B;  1OGX A;  2CK3 H;  3CME 3;  1VQL 3;  1JB5 A;  4H3U A;  1A2V A;  2STD A;  1KQS 2;  3CC2 3;  5I97 A;  1VQ5 3;  1YIT 3;  1YJW 3;  3MKI A;  2CFW A;  3OWU A;  1HKX A;  5EQL A;  1JJ2 2;  4FCJ A;  1NDO B;  3KE7 A;  3RGA A;  3F7S A;  2K0M A;  3RGR A;  1RKY A;  1OF5 B;  2CWU A;  2CG1 A;  1LOX A;  2GBX B;  3PCR A;  2SBL A;  3SX1 A;  1SQW A;  4O02 B;  2W9P A;  1V74 A;  4R4K A;  5IEN A;  4EXR A;  1S5A A;  1D6U A;  5AYR B;  4R9L A;  3GZX B;  2K54 A;  4WHA A;  3L0R A;  1OF5 A;  2XFS A;  1RJO A;  3DY5 A;  3AMO A;  5AIF A;  4O8S A;  5JBS A;  1TFO A;  1IV7 A;  2Z76 A;  2W2C A;  3SED A;  4MMZ B;  4I4K A;  2PNC A;  4KFE A;  3V99 A;  2QGU A;  5D81 A;  4R80 A;  5IG3 A;  1EQK A;  2Z7A A;  2BNG A;  3BNC A;  5KP3 A;  3OXA A;  2YX9 A;  4LGQ A;  3EJV A;  3S28 A;  1R4C A;  2E2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...