3JVCA

Crystal structure of the lipoprotein_17 domain from q9pra0_urepa protein of ureaplasma parvum. northeast structural genomics consortium target uur17a.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
b'FKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKNGTLKLSLMLTDKKNNQVYYKLLEVSGFKSNPYGVDENGTIPGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Conserved hypothetical membrane lipoprotein
publication title Crystal Structure of the Lipoprotein_17 domain from Q9PRA0_UREPA protein of Ureaplasma parvum.
rcsb
source organism Ureaplasma parvum serovar 3 str. atcc 700970
molecule tags Lipid binding protein
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04200 Lipoprotein_17 Lipoprotein associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.270 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3jvcA01
2KRTA 3K63A 3JVCA
chains in the Genus database with same CATH superfamily
1JB2A 1RN1A 2CHCA 2E2VA 1JKGA 3NX0A 2OQEA 1K8A4 1Z1SA 3MG3A 3SXXA 3FG3A 1YVBI 5KP1A 1D6UA 1GD3A 2RBIA 1S723 1IVXA 1U8CB 3K9MC 3WHOA 2QIYA 3G8ZA 1QVF2 1IVWA 3AHSA 1W6CA 2V1LA 3BU4A 3SX1A 2GBWB 3L0RA 1VQ83 1A2PA 5AYSC 2INXA 1SJWA 1TFKA 1SARA 3NHXA 1IVUA 1T2HA 1B21A 2Z77A 1TRQA 4HM1B 5LC6A 2IA7A 2FGTA 4R9LA 4XBTA 1N8QA 3KSPA 1R4YA 2K0MA 2MF7A 2CX1A 2OOVA 1BRIA 5AIGA 3PYJA 3B4PA 4BTXA 5IG3A 1IQXA 2QEX3 1I2FA 2PNCA 5GSPA 1NNVA 3CC23 1UW1A 3G713 2XSHB 3IJEB 3ZG5A 2XR8B 2QA43 3EQQB 3EN8A 3MYTA 2F56A 1RGLA 3PZWA 3H3HA 2OCTA 3ZG0A 1RSNA 2CWUA 3FG1A 3CC73 1Q7Y4 1BANA 3ALAA 3NBBA 1YJ93 1BSEA 3CU3A 5JBSA 1QALA 2W9QA 2XGNA 3ROBA 1BGSA 4KVHA 1CH0A 1RHLA 1SPUA 1OHOA 4EC6A 1HKXA 1UCJA 2IYJA 5BU4A 4N3VA 1BSAA 4XDWA 1KD14 2PZVA 3LTBA 3CME3 3AHWA 2W9PA 1NWWA 1AVKA 1MWSA 4RNZA 4XM4A 5IENA 5RNTA 2K54A 3HZPA 3F8XA 4EV2A 2RNTA 1BVIA 1TIJA 1RDSA 4GSPA 4R9KA 1Q9EA 3DM8A 4HM0B 1MWTA 1RGAA 1E97A 2XH9A 2HMJB 3H51A 1JBTA 1BNIA 1G0TA 2WGQA 1DYUA 3OXAA 1BNJA 3A5EA 5DREA 5AEUB 2K3DA 1N5HA 1ULJB 3OWYA 4MMXB 1YNVX 3OWUA 3RDEA 2YFJB 1N9JA 1O7GB 2L4VA 2W0QA 3QK9A 4HZ9B 2W56A 1W02A 2LQVA 2IUKA 1WMOA 3J7Yd 3CMA3 1PFPA 3SLUA 4LGQA 5I97A 3KCHA 3UL5A 3D5IA 3G16A 4LEHA 4JF8A 2C10A 2F4YA 1EA2A 1ISKA 3HOHA 1FGRA 1VQ53 1OPYA 2XF3A 1YVSA 2CIUA 1X1XA 4WYKA 3ECFA 3WOEB 1FUSA 5LC7A 9RNTA 1YGWA 4XDVA 1FUWA 1Q7HA 1W7CA 3V99A 1LXEA 3FLJA 2FXTA 3X3YA 3S27A 1HZ1A 3AGOA 3F9SA 4I5QA 4IT7A 3URPA 3CNXA 5FGOA 1O7PB 3DGOA 1T2IA 4EYCA 3CC43 1LOVA 4WFOA 3NQZA 4FMDA 1Q864 4HYZA 3FF2A 1JBSA 1FGTA 1LOWA 1I3IA 2SARA 1KQS2 1NJI4 3PCRA 3FCSB 5G1KA 1IU7A 5IG5A 5IG4A 1VQ73 1SIHA 2D42A 4XB5A 1GS3A 3DH2A 1TUHA 2D1WA 5D82A 3T8NA 2GSPA 3K0ZA 2KF4A 2B24B 1OH0A 3Q1CA 3SVAA 1IVVA 2F86B 5DRVA 2CFLA 2Y73A 1GD4A 1W2ZA 1YI23 4HOHA 3ZFZA 1RJOA 3CCQ3 3S29A 4LMIA 1Q40A 5AIFA 1V74A 2RSXA 3CCS3 3CNMA 1Q814 1DMMA 2A15A 1GYBA 3MG1A 2H0HA 1ROAA 1DVCA 1X1YA 2ML5A 3FSDA 3VGNA 3EC9A 1IK3A 2Z6BA 3SEDA 4XBYA 4OUQA 3VSYA 4KFDA 4OVMA 3NBRA 1K734 2OWPA 1RGFA 1UUVB 4GL6A 3UJMA 3G4S3 2OQEC 1VZZA 3VF1A 4I4KA 1YJN3 1W5ZA 2HMKB 1K41A 3GSPA 1BNSA 2L1SA 3KIIA 3I0YA 4J9AA 4X2OA 4H61A 3B7CA 1O7MB 1ULIB 3SYUA 2GBXB 3JUMA 2O3OA 1B2MA 1BRKA 1RGGA 5G1LA 2CG1A 1BNEA 2HMLB 3NBJA 4HM6B 1KWIA 2BMOB 3BB9A 3M8CA 1Q824 1AR0A 3WA2X 4H3UA 4KFEA 4XBXA 6RNTA 4MEIA 3GRDA 3FZWA 4O3VA 1N8R4 3GZYB 2KF5A 1STDA 1B2ZA 1YIJ3 1GSPA 1TFOA 2YFLB 1BAOA 2YX9A 3N9HA 4KT3B 1UI7A 2OOVC 3LXUX 1MWUA 2I9WA 1ZS7A 1YGEA 4WHAA 7RNTA 3I563 5STDA 1RN4A 3GWRA 3B8LA 3F8HA 3KSED 1ZO2A 1G96A 5CXOA 4MMYB 2ZDJA 2CFGA 5CLKA 2CWTA 2RFRA 1EUIC 3NM7A 1CQSA 1J2BA 1US1A 2QGUA 2P38A 3GZXB 1ROVA 4HM5B 3G6E3 3Q90A 1BUQA 1M9GA 4LZIA 2W2CA 1GMQA 2WGOA 1AY7A 4FMCA 4R4KA 1VQN3 1I2GA 3F7XA 1RGKA 3UL6A 4HJLB 1OGZA 1OF5B 8CHOA 1B2SA 1JV2B 2CWVA 3HIIA 3DGMA 1O7WB 2M7OA 1CYVA 1BUJA 4BL3A 2BMQB 2UX0A 2GEYA 5G2GA 1RCLA 2WOFA 4FMAA 3F40A 4BTWA 1TU5A 5EVHA 1FYSA 3G0KA 1WQLB 3DGLA 2FNQA 1RNTA 3I553 4BU4A 1FA3A 1A2VA 1FGOA 8RNTA 1W4NA 5A0OB 1BNRA 4HVNA 1AQZA 4R80A 2O9UX 2CG0A 3AMOB 3X41A 5JPPA 4K1VA 3MPHA 2HMMB 4BIRA 1TRPA 1BU4A 3MWZA 3SOYA 3JUQA 7GSPA 1LNHA 3V98A 3KE7A 2CFWA 1W01A 1KSIA 2H0IA 3NV0B 1GY5A 5IG0A 2IMJA 4L7KA 1ASKA 3CCM3 1VQO3 2KXGA 5CF2A 4N6MA 3JUPA 4N6V0 1EQKA 4CDLA 1OHSA 5AIIA 4JRFA 4GB5A 4J5GA 3KKGA 5CK6A 1FW7A 2GEXA 5CF1A 1EKMA 1W6GA 2R41A 4HM2B 1GOVA 2BNGA 1FZUA 2SBLA 2ZL8A 1Q42A 1GMPA 2H0GA 2KF6A 2P0MA 1L5GB 2KAAA 3OX9A 2ZA4A 3DY5A 1K9M4 1VQ93 1RCKA 3MSOA 1F8NA 1QVG2 1VQP3 1FGQA 1LOXA 1OUNA 3D4AA 3KFQC 2Q07A 4O8SA 1I3FA 4CCVA 2KRTA 4FR9A 1VQM3 1YIT3 1DETA 3EJVA 4FCJA 1BSCA 2CW9A 3FKAA 4KZ1A 4RNTA 3AMOA 2P05A 1QMAA 1IT8A 1PY3A 2F5MA 3FF0A 4U13A 1W00A 1MOLA 3V92A 1TP6A 4LSOA 3STDA 2Z76A 3D79A 1WMPA 3LTDA 3UNLA 1N5PA 1T3BA 2CH9A 3BNDA 1MGRA 1B3SA 1UUWB 4EXRA 2GXFA 4MJDA 1LQMB 4ZM8A 1M904 1VQ43 2W03A 1VQK3 1AV4A 1RLSA 2E2UA 3S67A 2STDA 3D5GA 4HBRA 4L8PA 4HKVB 1JZDA 2XEPA 3OW22 2XGLA 1M1K4 1BSDA 1DMNA 1FGMA 1DE3A 1DMQA 1RMSA 3EBYA 1CEWI 3WR2A 5ELUA 1UI8A 3DUKA 1G02A 3DXOA 1A2KA 3MG2A 4STDA 5IEPA 3EN1B 1RRLA 2P09A 1O7NB 2BU4A 1IV7A 3DGYA 3F14A 3CCE3 1JJ22 3T8UA 1B2XA 2CFKA 5JPUA 2YFIB 1VQ63 1S5AA 3DZLA 3EX9A 4TX4A 4BL2A 1QJGA 3U1WA 4N6LA 1OCVA 2HOHA 2UGIA 3LT9A 1X1UA 3LOYA 3MKIA 3QRDA 4X2HA 5M18A 3CCJ3 3D3LA 2JQ5A 5BXQA 2UUGC 1JNQA 3JVCA 2BMRB 5D83A 4AKYA 3EE1A 4NPBA 2MC8A 1QAFA 3A76A 3LH4A 1RNBA 1UUGB 2AAEA 3N8BA 1U5OA 1JN5B 1X1WA 3EB8A 2XFSA 3IPTA 2ML6A 3NXJA 3BLZA 1GMRA 1M1XB 2B1XB 3T0UA 3X3ZA 2HMOB 1I8VA 2ZHXB 1EG9B 1WTHA 5IEOA 4Q53A 5TGNA 1LOYA 3RNTA 4AEQA 1KC84 3PCSA 3PGBA 1RGEA 1RKYA 4HM7B 1IDPA 2CFDA 4AKZA 1IV9A 1UCLA 3FGYA 3S28A 1BOXA 1BRGA 1GY7A 3K7CA 3JUOA 3DGNA 3NUVA 1MWRA 1A67A 4N6UA 2CK3H 3CCR3 1I2EA 1GOYA 2C4BA 1I70A 4HM3B 3UB1A 4HAAA 3AGNA 4FCZA 4IPBA 5M19A 3SOAA 2IY2A 1A90A 1BNFA 4IIAA 3PXMA 5BIRA 3NQYA 1E3VA 1BRHA 2HMNB 3WDGB 1JN5A 1EEJA 1O7HB 1B27A 3Q2PA 4GHOA 3OV4A 2W56B 1N9EA 4FMBA 1PYLA 4EW5A 1WMNA 4WWUC 3LTCA 2RCDA 1JB4A 1IQYA 3BNCA 1QAKA 3GZRA 4O2HA 1HU9A 4RBNA 1JBRA 5HGRA 4NHFA 4CJNA 3OWSA 3GAXA 3KZTA 4HZBB 4K61A 4PEJA 4WYKB 2Z7AA 3RGRA 3B4OA 5KP3A 3IMAB 3LYGA 1UCKA 5FW5A 1NB5I 3X42A 3LZAA 4NREA 1ZGXA 1W2B2 4ILFA 1I0VA 4KFFA 5AIHA 1ZX2A 1RGCA 3DMCA 1STFI 4RNYA 4J8TA 2GU3A 1RTUA 1NDOB 5IERA 2OTJ3 3JUNA 2Y74A 3HI7A 1AVLA 4WP5A 2XFTA 5HOHA 4N6OB 2BHMA 1NO3A 3F7SA 1B2UA 2WOHA 1R4CA 1OF5A 1V58A 3BNBA 1VQQA 2LYXA 4MMZB 2XSOB 1T5YA 1K28A 3D9RA 6STDA 3WODG 2KCDA 2R4IA 5BVBA 1CYUA 3EHCA 1UGHI 2RGQA 2P0XA 1FUTA 3GZBA 3LTAA 5ELJA 4J5KA 1UCIA 1RN7A 1TJDA 4O02B 1NU3A 5D81A 3CCL3 4EV5A 3K5TA 1SQWA 2W6JH 3HIGA 5IF6A 1MNLA 2IUJA 1BNGA 2BT3A 1Q40B 3EBTA 3E99A 4K1UA 2AADA 2CKFB 3RGAA 2C11A 3LMLA 1DVDA 3NV0A 1SIIA 3EF8A 1OHPA 2F98A 7STDA 4DKIA 3CPW2 1JRQA 1BRJA 2E2TA 3CCV3 2JDIH 1GY6A 2GU1A 1JZOA 1UGIA 5EQLA 1I0XA 1LVNA 6GSPA 1C7HA 2BIRA 1YJW3 1TTOA 4N6NB 3KN4A 4HM8B 1JKGB 1GOUA 3U97A 5KP4A 1V57A 3CXC2 1OGXA 3S5CA 4LYLB 3HX8A 2F5WA 4BTYA 1VQL3 1MGWA 1BRSA 5AEWB 3ER7A 1E3RA 1BIRA 1RRHA 2XRXB 5AYRB 3CCU3 1D6ZA 3TDGA 1PU4A 2CX0A 1LQGC 1LRAA 1Y4KA 2CC3A 2KF3A 3BIRA 5IW9A 1YHQ3 1WNHA 1RGHA 1C54A 2J8XB 3BNEA 1NB3I 3Q3FA 3LT8A 3NM2A 4N6TA 4QWTA 1IQ8A 2BO9B 3CPOA 1JB5A 4R1KA 2OTL3 4K90B 3K63A 1IYYA 1BSBA 4FCMA 4RZMA 5AI1A 1B20A 1HYFA 3WOFB 4L8OA 3WA3A 4CPKA 1LNIA 3O8YA 2F99A 2W04A 3X3XA 4HM4B 3PS8A 1IT7A 3N54B 4OK0A 3X40A 4G1MB 3FH1A 4EBGA 1UDII 3HK4A 3MHEA 1W6YA 4ORLA 5M1AA 2WO0A 3CD63 1BRNL 3WMDA 1D6YA 3FG4A 1OACA 5EEOA
chains in the Genus database with same CATH topology
1JB2A 2CHCA 2E2VA 3NX0A 1JKGA 2OQEA 1K8A4 1Z1SA 3MG3A 3SXXA 3FG3A 1YVBI 5KP1A 1D6UA 1GD3A 1S723 1IVXA 1U8CB 3K9MC 2QIYA 3G8ZA 1QVF2 1IVWA 1W6CA 2V1LA 3SX1A 2GBWB 3L0RA 1VQ83 5AYSC 2INXA 1SJWA 1TFKA 3NHXA 1IVUA 2Z77A 4HM1B 5LC6A 2IA7A 2FGTA 4R9LA 4XBTA 1N8QA 3KSPA 2K0MA 2MF7A 2OOVA 5AIGA 4BTXA 3PYJA 3B4PA 5IG3A 2QEX3 1IQXA 2PNCA 3CC23 1UW1A 3G713 2XSHB 3IJEB 2QA43 2XR8B 3EQQB 3EN8A 3MYTA 3PZWA 3CC73 3H3HA 2OCTA 2CWUA 3FG1A 1Q7Y4 3ALAA 3NBBA 1YJ93 3CU3A 5JBSA 1QALA 2W9QA 2XGNA 3ROBA 4KVHA 1SPUA 1OHOA 4EC6A 1HKXA 4N3VA 4XDWA 1KD14 2PZVA 3LTBA 3CME3 2W9PA 1NWWA 1AVKA 4RNZA 5IENA 4XM4A 2K54A 3HZPA 3F8XA 4EV2A 1TIJA 4R9KA 3DM8A 4HM0B 1E97A 2XH9A 2HMJB 3H51A 2WGQA 1DYUA 3OXAA 5DREA 5AEUB 1N5HA 1ULJB 3OWYA 4MMXB 3OWUA 3RDEA 2YFJB 1N9JA 1O7GB 2L4VA 2W0QA 3QK9A 4HZ9B 2W56A 1W02A 2LQVA 2IUKA 1WMOA 3J7Yd 3CMA3 1PFPA 3SLUA 4LGQA 5I97A 3UL5A 3G16A 4LEHA 4JF8A 2C10A 1EA2A 1ISKA 1FGRA 1VQ53 1OPYA 2XF3A 2CIUA 4WYKA 3WOEB 3ECFA 5LC7A 4XDVA 1FUWA 1W7CA 3V99A 1LXEA 3FLJA 2FXTA 3X3YA 3S27A 3F9SA 4IT7A 3CNXA 5FGOA 1O7PB 3DGOA 4EYCA 3CC43 4WFOA 3NQZA 4FMDA 1Q864 4HYZA 3FF2A 1FGTA 1KQS2 1NJI4 3PCRA 3FCSB 1IU7A 5IG5A 5IG4A 1VQ73 1SIHA 2D42A 4XB5A 1GS3A 1TUHA 2D1WA 5D82A 3T8NA 3K0ZA 2B24B 1OH0A 3Q1CA 3SVAA 1IVVA 2F86B 5DRVA 2CFLA 2Y73A 1GD4A 1W2ZA 1YI23 1RJOA 3CCQ3 3S29A 4LMIA 1Q40A 5AIFA 1V74A 2RSXA 3CCS3 3CNMA 1Q814 1DMMA 2A15A 1GYBA 3MG1A 1ROAA 1DVCA 2ML5A 3FSDA 3VGNA 3EC9A 1IK3A 2Z6BA 3SEDA 4XBYA 4OUQA 3VSYA 4KFDA 4OVMA 3NBRA 1K734 2OWPA 1UUVB 4GL6A 3UJMA 3G4S3 2OQEC 1VZZA 3VF1A 4I4KA 1YJN3 1W5ZA 2HMKB 1K41A 3KIIA 4X2OA 4J9AA 3I0YA 4H61A 3B7CA 1O7MB 1ULIB 2GBXB 3JUMA 2O3OA 2CG1A 2HMLB 3NBJA 4HM6B 1KWIA 2BMOB 3BB9A 3M8CA 1Q824 1AR0A 3WA2X 4H3UA 4KFEA 4XBXA 4MEIA 3GRDA 3FZWA 4O3VA 1N8R4 3GZYB 1STDA 1YIJ3 1TFOA 2YFLB 2YX9A 3N9HA 1UI7A 2OOVC 3LXUX 2I9WA 1YGEA 4WHAA 3I563 5STDA 3GWRA 3B8LA 3F8HA 3KSED 1ZO2A 1G96A 5CXOA 4MMYB 2ZDJA 2CFGA 5CLKA 2CWTA 2RFRA 3NM7A 1CQSA 1J2BA 1US1A 2QGUA 2P38A 3GZXB 1ROVA 4HM5B 3G6E3 3Q90A 1BUQA 1M9GA 4LZIA 2W2CA 2WGOA 4FMCA 4R4KA 1VQN3 3F7XA 3UL6A 4HJLB 1OGZA 1OF5B 8CHOA 1JV2B 2CWVA 3HIIA 3DGMA 1O7WB 2M7OA 1CYVA 2BMQB 2UX0A 2GEYA 5G2GA 2WOFA 4FMAA 3F40A 4BTWA 1TU5A 5EVHA 3I553 3G0KA 1WQLB 3DGLA 2FNQA 1FA3A 1A2VA 1FGOA 1W4NA 5A0OB 4HVNA 4R80A 2O9UX 2CG0A 3AMOB 3X41A 5JPPA 4K1VA 3MPHA 2HMMB 3SOYA 3MWZA 3JUQA 1LNHA 3V98A 3KE7A 2CFWA 1W01A 1KSIA 3NV0B 5IG0A 1GY5A 2IMJA 4L7KA 1ASKA 3CCM3 1VQO3 2KXGA 5CF2A 4N6MA 3JUPA 4N6V0 1EQKA 4CDLA 1OHSA 5AIIA 4JRFA 4GB5A 3KKGA 5CK6A 2GEXA 5CF1A 1EKMA 1W6GA 4HM2B 2BNGA 2SBLA 2ZL8A 1Q42A 2P0MA 1L5GB 3OX9A 3DY5A 1K9M4 1VQ93 3MSOA 1F8NA 1QVG2 1VQP3 1FGQA 1LOXA 1OUNA 3KFQC 2Q07A 4O8SA 4CCVA 2KRTA 4FR9A 1VQM3 1YIT3 3EJVA 4FCJA 2CW9A 4KZ1A 3FKAA 3AMOA 2P05A 1QMAA 1IT8A 3FF0A 4U13A 1W00A 1MOLA 3V92A 1TP6A 4LSOA 3STDA 2Z76A 1D6YA 1WMPA 3LTDA 3UNLA 1N5PA 2CH9A 3BNDA 1UUWB 4EXRA 2GXFA 4MJDA 4ZM8A 1M904 1VQ43 2W03A 1VQK3 1AV4A 2E2UA 3S67A 2STDA 4HBRA 4L8PA 4HKVB 2XEPA 3OW22 2XGLA 1M1K4 1FGMA 1DMNA 1DMQA 3EBYA 1CEWI 5ELUA 1UI8A 3DUKA 3MG2A 3DXOA 1A2KA 4STDA 5IEPA 3EN1B 1RRLA 2P09A 1O7NB 1IV7A 3CCE3 3F14A 1JJ22 3T8UA 2CFKA 5JPUA 2YFIB 1VQ63 1S5AA 3DZLA 3EX9A 4TX4A 1QJGA 3U1WA 4N6LA 1OCVA 4X2HA 3QRDA 3LT9A 3LOYA 3MKIA 3CCJ3 3D3LA 2JQ5A 5BXQA 1JNQA 3JVCA 2BMRB 5D83A 4AKYA 3EE1A 2MC8A 1QAFA 3A76A 3LH4A 3N8BA 1U5OA 1JN5B 3EB8A 2XFSA 3IPTA 2ML6A 3NXJA 3BLZA 1M1XB 2B1XB 3T0UA 3X3ZA 2HMOB 1EG9B 1WTHA 5IEOA 4Q53A 5TGNA 1KC84 4AEQA 3PCSA 3PGBA 1RKYA 4HM7B 1IDPA 2CFDA 4AKZA 1IV9A 3FGYA 3S28A 1GY7A 3K7CA 3JUOA 3DGNA 3NUVA 1A67A 4N6UA 2CK3H 3CCR3 4HM3B 3UB1A 4FCZA 4IPBA 1A90A 3SOAA 4IIAA 3PXMA 3NQYA 1E3VA 2HMNB 3WDGB 1JN5A 1O7HB 3Q2PA 3OV4A 2W56B 1N9EA 4FMBA 1WMNA 4WWUC 3LTCA 2RCDA 1JB4A 1IQYA 3BNCA 1QAKA 3GZRA 4O2HA 1HU9A 4RBNA 5HGRA 4NHFA 3OWSA 3GAXA 3KZTA 4HZBB 4K61A 4PEJA 4WYKB 2Z7AA 3RGRA 3B4OA 5KP3A 3IMAB 3LYGA 5FW5A 1NB5I 3X42A 3LZAA 4NREA 1W2B2 4KFFA 5AIHA 1ZX2A 3DMCA 1STFI 4RNYA 4J8TA 2GU3A 1NDOB 5IERA 2OTJ3 3JUNA 2Y74A 3HI7A 1AVLA 4WP5A 2XFTA 4N6OB 2BHMA 1NO3A 3F7SA 2WOHA 1R4CA 1OF5A 3BNBA 2LYXA 4MMZB 2XSOB 1T5YA 1K28A 3D9RA 6STDA 3WODG 2KCDA 2R4IA 5BVBA 1CYUA 3EHCA 2RGQA 3GZBA 3LTAA 5ELJA 1RN7A 4O02B 1NU3A 5D81A 3CCL3 4EV5A 3K5TA 1SQWA 2W6JH 3HIGA 5IF6A 1MNLA 2IUJA 2BT3A 1Q40B 3EBTA 3E99A 4K1UA 2CKFB 3RGAA 2C11A 3LMLA 1DVDA 3NV0A 1SIIA 3EF8A 1OHPA 2F98A 7STDA 3CPW2 1JRQA 2E2TA 3CCV3 2JDIH 1GY6A 2GU1A 5EQLA 1LVNA 1C7HA 1YJW3 4N6NB 3KN4A 4HM8B 1JKGB 3U97A 5KP4A 3CXC2 1OGXA 3S5CA 3HX8A 4BTYA 1VQL3 5AEWB 3ER7A 1E3RA 1RRHA 2XRXB 5AYRB 3CCU3 1D6ZA 3TDGA 1PU4A 1Y4KA 2CC3A 5IW9A 1YHQ3 1WNHA 4N6TA 3BNEA 1NB3I 3LT8A 3NM2A 4QWTA 1IQ8A 2BO9B 3CPOA 1JB5A 4R1KA 2OTL3 4K90B 3K63A 4FCMA 4RZMA 5AI1A 3WOFB 4L8OA 3WA3A 3O8YA 2F99A 2W04A 3X3XA 4HM4B 3PS8A 1IT7A 3N54B 4OK0A 3X40A 4G1MB 3FH1A 4EBGA 3HK4A 3MHEA 1W6YA 4ORLA 2WO0A 3CD63 3WMDA 2P0XA 3FG4A 1OACA 5EEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRT A;  3K63 A;  3JVC A; 
#chains in the Genus database with same CATH topology
 1JB2 A;  1RN1 A;  2CHC A;  2E2V A;  1JKG A;  3NX0 A;  2OQE A;  1K8A 4;  1Z1S A;  3MG3 A;  3SXX A;  3FG3 A;  1YVB I;  5KP1 A;  1D6U A;  1GD3 A;  2RBI A;  1S72 3;  1IVX A;  1U8C B;  3K9M C;  3WHO A;  2QIY A;  3G8Z A;  1QVF 2;  1IVW A;  3AHS A;  1W6C A;  2V1L A;  3BU4 A;  3SX1 A;  2GBW B;  3L0R A;  1VQ8 3;  1A2P A;  5AYS C;  2INX A;  1SJW A;  1TFK A;  1SAR A;  3NHX A;  1IVU A;  1T2H A;  1B21 A;  2Z77 A;  1TRQ A;  4HM1 B;  5LC6 A;  2IA7 A;  2FGT A;  4R9L A;  4XBT A;  1N8Q A;  3KSP A;  1R4Y A;  2K0M A;  2MF7 A;  2CX1 A;  2OOV A;  1BRI A;  5AIG A;  3PYJ A;  3B4P A;  4BTX A;  5IG3 A;  1IQX A;  2QEX 3;  1I2F A;  2PNC A;  5GSP A;  1NNV A;  3CC2 3;  1UW1 A;  3G71 3;  2XSH B;  3IJE B;  3ZG5 A;  2XR8 B;  2QA4 3;  3EQQ B;  3EN8 A;  3MYT A;  2F56 A;  1RGL A;  3PZW A;  3H3H A;  2OCT A;  3ZG0 A;  1RSN A;  2CWU A;  3FG1 A;  3CC7 3;  1Q7Y 4;  1BAN A;  3ALA A;  3NBB A;  1YJ9 3;  1BSE A;  3CU3 A;  5JBS A;  1QAL A;  2W9Q A;  2XGN A;  3ROB A;  1BGS A;  4KVH A;  1CH0 A;  1RHL A;  1SPU A;  1OHO A;  4EC6 A;  1HKX A;  1UCJ A;  2IYJ A;  5BU4 A;  4N3V A;  1BSA A;  4XDW A;  1KD1 4;  2PZV A;  3LTB A;  3CME 3;  3AHW A;  2W9P A;  1NWW A;  1AVK A;  1MWS A;  4RNZ A;  4XM4 A;  5IEN A;  5RNT A;  2K54 A;  3HZP A;  3F8X A;  4EV2 A;  2RNT A;  1BVI A;  1TIJ A;  1RDS A;  4GSP A;  4R9K A;  1Q9E A;  3DM8 A;  4HM0 B;  1MWT A;  1RGA A;  1E97 A;  2XH9 A;  2HMJ B;  3H51 A;  1JBT A;  1BNI A;  1G0T A;  2WGQ A;  1DYU A;  3OXA A;  1BNJ A;  3A5E A;  5DRE A;  5AEU B;  2K3D A;  1N5H A;  1ULJ B;  3OWY A;  4MMX B;  1YNV X;  3OWU A;  3RDE A;  2YFJ B;  1N9J A;  1O7G B;  2L4V A;  2W0Q A;  3QK9 A;  4HZ9 B;  2W56 A;  1W02 A;  2LQV A;  2IUK A;  1WMO A;  3J7Y d;  3CMA 3;  1PFP A;  3SLU A;  4LGQ A;  5I97 A;  3KCH A;  3UL5 A;  3D5I A;  3G16 A;  4LEH A;  4JF8 A;  2C10 A;  2F4Y A;  1EA2 A;  1ISK A;  3HOH A;  1FGR A;  1VQ5 3;  1OPY A;  2XF3 A;  1YVS A;  2CIU A;  1X1X A;  4WYK A;  3ECF A;  3WOE B;  1FUS A;  5LC7 A;  9RNT A;  1YGW A;  4XDV A;  1FUW A;  1Q7H A;  1W7C A;  3V99 A;  1LXE A;  3FLJ A;  2FXT A;  3X3Y A;  3S27 A;  1HZ1 A;  3AGO A;  3F9S A;  4I5Q A;  4IT7 A;  3URP A;  3CNX A;  5FGO A;  1O7P B;  3DGO A;  1T2I A;  4EYC A;  3CC4 3;  1LOV A;  4WFO A;  3NQZ A;  4FMD A;  1Q86 4;  4HYZ A;  3FF2 A;  1JBS A;  1FGT A;  1LOW A;  1I3I A;  2SAR A;  1KQS 2;  1NJI 4;  3PCR A;  3FCS B;  5G1K A;  1IU7 A;  5IG5 A;  5IG4 A;  1VQ7 3;  1SIH A;  2D42 A;  4XB5 A;  1GS3 A;  3DH2 A;  1TUH A;  2D1W A;  5D82 A;  3T8N A;  2GSP A;  3K0Z A;  2KF4 A;  2B24 B;  1OH0 A;  3Q1C A;  3SVA A;  1IVV A;  2F86 B;  5DRV A;  2CFL A;  2Y73 A;  1GD4 A;  1W2Z A;  1YI2 3;  4HOH A;  3ZFZ A;  1RJO A;  3CCQ 3;  3S29 A;  4LMI A;  1Q40 A;  5AIF A;  1V74 A;  2RSX A;  3CCS 3;  3CNM A;  1Q81 4;  1DMM A;  2A15 A;  1GYB A;  3MG1 A;  2H0H A;  1ROA A;  1DVC A;  1X1Y A;  2ML5 A;  3FSD A;  3VGN A;  3EC9 A;  1IK3 A;  2Z6B A;  3SED A;  4XBY A;  4OUQ A;  3VSY A;  4KFD A;  4OVM A;  3NBR A;  1K73 4;  2OWP A;  1RGF A;  1UUV B;  4GL6 A;  3UJM A;  3G4S 3;  2OQE C;  1VZZ A;  3VF1 A;  4I4K A;  1YJN 3;  1W5Z A;  2HMK B;  1K41 A;  3GSP A;  1BNS A;  2L1S A;  3KII A;  3I0Y A;  4J9A A;  4X2O A;  4H61 A;  3B7C A;  1O7M B;  1ULI B;  3SYU A;  2GBX B;  3JUM A;  2O3O A;  1B2M A;  1BRK A;  1RGG A;  5G1L A;  2CG1 A;  1BNE A;  2HML B;  3NBJ A;  4HM6 B;  1KWI A;  2BMO B;  3BB9 A;  3M8C A;  1Q82 4;  1AR0 A;  3WA2 X;  4H3U A;  4KFE A;  4XBX A;  6RNT A;  4MEI A;  3GRD A;  3FZW A;  4O3V A;  1N8R 4;  3GZY B;  2KF5 A;  1STD A;  1B2Z A;  1YIJ 3;  1GSP A;  1TFO A;  2YFL B;  1BAO A;  2YX9 A;  3N9H A;  4KT3 B;  1UI7 A;  2OOV C;  3LXU X;  1MWU A;  2I9W A;  1ZS7 A;  1YGE A;  4WHA A;  7RNT A;  3I56 3;  5STD A;  1RN4 A;  3GWR A;  3B8L A;  3F8H A;  3KSE D;  1ZO2 A;  1G96 A;  5CXO A;  4MMY B;  2ZDJ A;  2CFG A;  5CLK A;  2CWT A;  2RFR A;  1EUI C;  3NM7 A;  1CQS A;  1J2B A;  1US1 A;  2QGU A;  2P38 A;  3GZX B;  1ROV A;  4HM5 B;  3G6E 3;  3Q90 A;  1BUQ A;  1M9G A;  4LZI A;  2W2C A;  1GMQ A;  2WGO A;  1AY7 A;  4FMC A;  4R4K A;  1VQN 3;  1I2G A;  3F7X A;  1RGK A;  3UL6 A;  4HJL B;  1OGZ A;  1OF5 B;  8CHO A;  1B2S A;  1JV2 B;  2CWV A;  3HII A;  3DGM A;  1O7W B;  2M7O A;  1CYV A;  1BUJ A;  4BL3 A;  2BMQ B;  2UX0 A;  2GEY A;  5G2G A;  1RCL A;  2WOF A;  4FMA A;  3F40 A;  4BTW A;  1TU5 A;  5EVH A;  1FYS A;  3G0K A;  1WQL B;  3DGL A;  2FNQ A;  1RNT A;  3I55 3;  4BU4 A;  1FA3 A;  1A2V A;  1FGO A;  8RNT A;  1W4N A;  5A0O B;  1BNR A;  4HVN A;  1AQZ A;  4R80 A;  2O9U X;  2CG0 A;  3AMO B;  3X41 A;  5JPP A;  4K1V A;  3MPH A;  2HMM B;  4BIR A;  1TRP A;  1BU4 A;  3MWZ A;  3SOY A;  3JUQ A;  7GSP A;  1LNH A;  3V98 A;  3KE7 A;  2CFW A;  1W01 A;  1KSI A;  2H0I A;  3NV0 B;  1GY5 A;  5IG0 A;  2IMJ A;  4L7K A;  1ASK A;  3CCM 3;  1VQO 3;  2KXG A;  5CF2 A;  4N6M A;  3JUP A;  4N6V 0;  1EQK A;  4CDL A;  1OHS A;  5AII A;  4JRF A;  4GB5 A;  4J5G A;  3KKG A;  5CK6 A;  1FW7 A;  2GEX A;  5CF1 A;  1EKM A;  1W6G A;  2R41 A;  4HM2 B;  1GOV A;  2BNG A;  1FZU A;  2SBL A;  2ZL8 A;  1Q42 A;  1GMP A;  2H0G A;  2KF6 A;  2P0M A;  1L5G B;  2KAA A;  3OX9 A;  2ZA4 A;  3DY5 A;  1K9M 4;  1VQ9 3;  1RCK A;  3MSO A;  1F8N A;  1QVG 2;  1VQP 3;  1FGQ A;  1LOX A;  1OUN A;  3D4A A;  3KFQ C;  2Q07 A;  4O8S A;  1I3F A;  4CCV A;  2KRT A;  4FR9 A;  1VQM 3;  1YIT 3;  1DET A;  3EJV A;  4FCJ A;  1BSC A;  2CW9 A;  3FKA A;  4KZ1 A;  4RNT A;  3AMO A;  2P05 A;  1QMA A;  1IT8 A;  1PY3 A;  2F5M A;  3FF0 A;  4U13 A;  1W00 A;  1MOL A;  3V92 A;  1TP6 A;  4LSO A;  3STD A;  2Z76 A;  3D79 A;  1WMP A;  3LTD A;  3UNL A;  1N5P A;  1T3B A;  2CH9 A;  3BND A;  1MGR A;  1B3S A;  1UUW B;  4EXR A;  2GXF A;  4MJD A;  1LQM B;  4ZM8 A;  1M90 4;  1VQ4 3;  2W03 A;  1VQK 3;  1AV4 A;  1RLS A;  2E2U A;  3S67 A;  2STD A;  3D5G A;  4HBR A;  4L8P A;  4HKV B;  1JZD A;  2XEP A;  3OW2 2;  2XGL A;  1M1K 4;  1BSD A;  1DMN A;  1FGM A;  1DE3 A;  1DMQ A;  1RMS A;  3EBY A;  1CEW I;  3WR2 A;  5ELU A;  1UI8 A;  3DUK A;  1G02 A;  3DXO A;  1A2K A;  3MG2 A;  4STD A;  5IEP A;  3EN1 B;  1RRL A;  2P09 A;  1O7N B;  2BU4 A;  1IV7 A;  3DGY A;  3F14 A;  3CCE 3;  1JJ2 2;  3T8U A;  1B2X A;  2CFK A;  5JPU A;  2YFI B;  1VQ6 3;  1S5A A;  3DZL A;  3EX9 A;  4TX4 A;  4BL2 A;  1QJG A;  3U1W A;  4N6L A;  1OCV A;  2HOH A;  2UGI A;  3LT9 A;  1X1U A;  3LOY A;  3MKI A;  3QRD A;  4X2H A;  5M18 A;  3CCJ 3;  3D3L A;  2JQ5 A;  5BXQ A;  2UUG C;  1JNQ A;  3JVC A;  2BMR B;  5D83 A;  4AKY A;  3EE1 A;  4NPB A;  2MC8 A;  1QAF A;  3A76 A;  3LH4 A;  1RNB A;  1UUG B;  2AAE A;  3N8B A;  1U5O A;  1JN5 B;  1X1W A;  3EB8 A;  2XFS A;  3IPT A;  2ML6 A;  3NXJ A;  3BLZ A;  1GMR A;  1M1X B;  2B1X B;  3T0U A;  3X3Z A;  2HMO B;  1I8V A;  2ZHX B;  1EG9 B;  1WTH A;  5IEO A;  4Q53 A;  5TGN A;  1LOY A;  3RNT A;  4AEQ A;  1KC8 4;  3PCS A;  3PGB A;  1RGE A;  1RKY A;  4HM7 B;  1IDP A;  2CFD A;  4AKZ A;  1IV9 A;  1UCL A;  3FGY A;  3S28 A;  1BOX A;  1BRG A;  1GY7 A;  3K7C A;  3JUO A;  3DGN A;  3NUV A;  1MWR A;  1A67 A;  4N6U A;  2CK3 H;  3CCR 3;  1I2E A;  1GOY A;  2C4B A;  1I70 A;  4HM3 B;  3UB1 A;  4HAA A;  3AGN A;  4FCZ A;  4IPB A;  5M19 A;  3SOA A;  2IY2 A;  1A90 A;  1BNF A;  4IIA A;  3PXM A;  5BIR A;  3NQY A;  1E3V A;  1BRH A;  2HMN B;  3WDG B;  1JN5 A;  1EEJ A;  1O7H B;  1B27 A;  3Q2P A;  4GHO A;  3OV4 A;  2W56 B;  1N9E A;  4FMB A;  1PYL A;  4EW5 A;  1WMN A;  4WWU C;  3LTC A;  2RCD A;  1JB4 A;  1IQY A;  3BNC A;  1QAK A;  3GZR A;  4O2H A;  1HU9 A;  4RBN A;  1JBR A;  5HGR A;  4NHF A;  4CJN A;  3OWS A;  3GAX A;  3KZT A;  4HZB B;  4K61 A;  4PEJ A;  4WYK B;  2Z7A A;  3RGR A;  3B4O A;  5KP3 A;  3IMA B;  3LYG A;  1UCK A;  5FW5 A;  1NB5 I;  3X42 A;  3LZA A;  4NRE A;  1ZGX A;  1W2B 2;  4ILF A;  1I0V A;  4KFF A;  5AIH A;  1ZX2 A;  1RGC A;  3DMC A;  1STF I;  4RNY A;  4J8T A;  2GU3 A;  1RTU A;  1NDO B;  5IER A;  2OTJ 3;  3JUN A;  2Y74 A;  3HI7 A;  1AVL A;  4WP5 A;  2XFT A;  5HOH A;  4N6O B;  2BHM A;  1NO3 A;  3F7S A;  1B2U A;  2WOH A;  1R4C A;  1OF5 A;  1V58 A;  3BNB A;  1VQQ A;  2LYX A;  4MMZ B;  2XSO B;  1T5Y A;  1K28 A;  3D9R A;  6STD A;  3WOD G;  2KCD A;  2R4I A;  5BVB A;  1CYU A;  3EHC A;  1UGH I;  2RGQ A;  2P0X A;  1FUT A;  3GZB A;  3LTA A;  5ELJ A;  4J5K A;  1UCI A;  1RN7 A;  1TJD A;  4O02 B;  1NU3 A;  5D81 A;  3CCL 3;  4EV5 A;  3K5T A;  1SQW A;  2W6J H;  3HIG A;  5IF6 A;  1MNL A;  2IUJ A;  1BNG A;  2BT3 A;  1Q40 B;  3EBT A;  3E99 A;  4K1U A;  2AAD A;  2CKF B;  3RGA A;  2C11 A;  3LML A;  1DVD A;  3NV0 A;  1SII A;  3EF8 A;  1OHP A;  2F98 A;  7STD A;  4DKI A;  3CPW 2;  1JRQ A;  1BRJ A;  2E2T A;  3CCV 3;  2JDI H;  1GY6 A;  2GU1 A;  1JZO A;  1UGI A;  5EQL A;  1I0X A;  1LVN A;  6GSP A;  1C7H A;  2BIR A;  1YJW 3;  1TTO A;  4N6N B;  3KN4 A;  4HM8 B;  1JKG B;  1GOU A;  3U97 A;  5KP4 A;  1V57 A;  3CXC 2;  1OGX A;  3S5C A;  4LYL B;  3HX8 A;  2F5W A;  4BTY A;  1VQL 3;  1MGW A;  1BRS A;  5AEW B;  3ER7 A;  1E3R A;  1BIR A;  1RRH A;  2XRX B;  5AYR B;  3CCU 3;  1D6Z A;  3TDG A;  1PU4 A;  2CX0 A;  1LQG C;  1LRA A;  1Y4K A;  2CC3 A;  2KF3 A;  3BIR A;  5IW9 A;  1YHQ 3;  1WNH A;  1RGH A;  1C54 A;  2J8X B;  3BNE A;  1NB3 I;  3Q3F A;  3LT8 A;  3NM2 A;  4N6T A;  4QWT A;  1IQ8 A;  2BO9 B;  3CPO A;  1JB5 A;  4R1K A;  2OTL 3;  4K90 B;  3K63 A;  1IYY A;  1BSB A;  4FCM A;  4RZM A;  5AI1 A;  1B20 A;  1HYF A;  3WOF B;  4L8O A;  3WA3 A;  4CPK A;  1LNI A;  3O8Y A;  2F99 A;  2W04 A;  3X3X A;  4HM4 B;  3PS8 A;  1IT7 A;  3N54 B;  4OK0 A;  3X40 A;  4G1M B;  3FH1 A;  4EBG A;  1UDI I;  3HK4 A;  3MHE A;  1W6Y A;  4ORL A;  5M1A A;  2WO0 A;  3CD6 3;  1BRN L;  3WMD A;  1D6Y A;  3FG4 A;  1OAC A;  5EEO A; 
#chains in the Genus database with same CATH homology
 1JB2 A;  2CHC A;  2E2V A;  3NX0 A;  1JKG A;  2OQE A;  1K8A 4;  1Z1S A;  3MG3 A;  3SXX A;  3FG3 A;  1YVB I;  5KP1 A;  1D6U A;  1GD3 A;  1S72 3;  1IVX A;  1U8C B;  3K9M C;  2QIY A;  3G8Z A;  1QVF 2;  1IVW A;  1W6C A;  2V1L A;  3SX1 A;  2GBW B;  3L0R A;  1VQ8 3;  5AYS C;  2INX A;  1SJW A;  1TFK A;  3NHX A;  1IVU A;  2Z77 A;  4HM1 B;  5LC6 A;  2IA7 A;  2FGT A;  4R9L A;  4XBT A;  1N8Q A;  3KSP A;  2K0M A;  2MF7 A;  2OOV A;  5AIG A;  4BTX A;  3PYJ A;  3B4P A;  5IG3 A;  2QEX 3;  1IQX A;  2PNC A;  3CC2 3;  1UW1 A;  3G71 3;  2XSH B;  3IJE B;  2QA4 3;  2XR8 B;  3EQQ B;  3EN8 A;  3MYT A;  3PZW A;  3CC7 3;  3H3H A;  2OCT A;  2CWU A;  3FG1 A;  1Q7Y 4;  3ALA A;  3NBB A;  1YJ9 3;  3CU3 A;  5JBS A;  1QAL A;  2W9Q A;  2XGN A;  3ROB A;  4KVH A;  1SPU A;  1OHO A;  4EC6 A;  1HKX A;  4N3V A;  4XDW A;  1KD1 4;  2PZV A;  3LTB A;  3CME 3;  2W9P A;  1NWW A;  1AVK A;  4RNZ A;  5IEN A;  4XM4 A;  2K54 A;  3HZP A;  3F8X A;  4EV2 A;  1TIJ A;  4R9K A;  3DM8 A;  4HM0 B;  1E97 A;  2XH9 A;  2HMJ B;  3H51 A;  2WGQ A;  1DYU A;  3OXA A;  5DRE A;  5AEU B;  1N5H A;  1ULJ B;  3OWY A;  4MMX B;  3OWU A;  3RDE A;  2YFJ B;  1N9J A;  1O7G B;  2L4V A;  2W0Q A;  3QK9 A;  4HZ9 B;  2W56 A;  1W02 A;  2LQV A;  2IUK A;  1WMO A;  3J7Y d;  3CMA 3;  1PFP A;  3SLU A;  4LGQ A;  5I97 A;  3UL5 A;  3G16 A;  4LEH A;  4JF8 A;  2C10 A;  1EA2 A;  1ISK A;  1FGR A;  1VQ5 3;  1OPY A;  2XF3 A;  2CIU A;  4WYK A;  3WOE B;  3ECF A;  5LC7 A;  4XDV A;  1FUW A;  1W7C A;  3V99 A;  1LXE A;  3FLJ A;  2FXT A;  3X3Y A;  3S27 A;  3F9S A;  4IT7 A;  3CNX A;  5FGO A;  1O7P B;  3DGO A;  4EYC A;  3CC4 3;  4WFO A;  3NQZ A;  4FMD A;  1Q86 4;  4HYZ A;  3FF2 A;  1FGT A;  1KQS 2;  1NJI 4;  3PCR A;  3FCS B;  1IU7 A;  5IG5 A;  5IG4 A;  1VQ7 3;  1SIH A;  2D42 A;  4XB5 A;  1GS3 A;  1TUH A;  2D1W A;  5D82 A;  3T8N A;  3K0Z A;  2B24 B;  1OH0 A;  3Q1C A;  3SVA A;  1IVV A;  2F86 B;  5DRV A;  2CFL A;  2Y73 A;  1GD4 A;  1W2Z A;  1YI2 3;  1RJO A;  3CCQ 3;  3S29 A;  4LMI A;  1Q40 A;  5AIF A;  1V74 A;  2RSX A;  3CCS 3;  3CNM A;  1Q81 4;  1DMM A;  2A15 A;  1GYB A;  3MG1 A;  1ROA A;  1DVC A;  2ML5 A;  3FSD A;  3VGN A;  3EC9 A;  1IK3 A;  2Z6B A;  3SED A;  4XBY A;  4OUQ A;  3VSY A;  4KFD A;  4OVM A;  3NBR A;  1K73 4;  2OWP A;  1UUV B;  4GL6 A;  3UJM A;  3G4S 3;  2OQE C;  1VZZ A;  3VF1 A;  4I4K A;  1YJN 3;  1W5Z A;  2HMK B;  1K41 A;  3KII A;  4X2O A;  4J9A A;  3I0Y A;  4H61 A;  3B7C A;  1O7M B;  1ULI B;  2GBX B;  3JUM A;  2O3O A;  2CG1 A;  2HML B;  3NBJ A;  4HM6 B;  1KWI A;  2BMO B;  3BB9 A;  3M8C A;  1Q82 4;  1AR0 A;  3WA2 X;  4H3U A;  4KFE A;  4XBX A;  4MEI A;  3GRD A;  3FZW A;  4O3V A;  1N8R 4;  3GZY B;  1STD A;  1YIJ 3;  1TFO A;  2YFL B;  2YX9 A;  3N9H A;  1UI7 A;  2OOV C;  3LXU X;  2I9W A;  1YGE A;  4WHA A;  3I56 3;  5STD A;  3GWR A;  3B8L A;  3F8H A;  3KSE D;  1ZO2 A;  1G96 A;  5CXO A;  4MMY B;  2ZDJ A;  2CFG A;  5CLK A;  2CWT A;  2RFR A;  3NM7 A;  1CQS A;  1J2B A;  1US1 A;  2QGU A;  2P38 A;  3GZX B;  1ROV A;  4HM5 B;  3G6E 3;  3Q90 A;  1BUQ A;  1M9G A;  4LZI A;  2W2C A;  2WGO A;  4FMC A;  4R4K A;  1VQN 3;  3F7X A;  3UL6 A;  4HJL B;  1OGZ A;  1OF5 B;  8CHO A;  1JV2 B;  2CWV A;  3HII A;  3DGM A;  1O7W B;  2M7O A;  1CYV A;  2BMQ B;  2UX0 A;  2GEY A;  5G2G A;  2WOF A;  4FMA A;  3F40 A;  4BTW A;  1TU5 A;  5EVH A;  3I55 3;  3G0K A;  1WQL B;  3DGL A;  2FNQ A;  1FA3 A;  1A2V A;  1FGO A;  1W4N A;  5A0O B;  4HVN A;  4R80 A;  2O9U X;  2CG0 A;  3AMO B;  3X41 A;  5JPP A;  4K1V A;  3MPH A;  2HMM B;  3SOY A;  3MWZ A;  3JUQ A;  1LNH A;  3V98 A;  3KE7 A;  2CFW A;  1W01 A;  1KSI A;  3NV0 B;  5IG0 A;  1GY5 A;  2IMJ A;  4L7K A;  1ASK A;  3CCM 3;  1VQO 3;  2KXG A;  5CF2 A;  4N6M A;  3JUP A;  4N6V 0;  1EQK A;  4CDL A;  1OHS A;  5AII A;  4JRF A;  4GB5 A;  3KKG A;  5CK6 A;  2GEX A;  5CF1 A;  1EKM A;  1W6G A;  4HM2 B;  2BNG A;  2SBL A;  2ZL8 A;  1Q42 A;  2P0M A;  1L5G B;  3OX9 A;  3DY5 A;  1K9M 4;  1VQ9 3;  3MSO A;  1F8N A;  1QVG 2;  1VQP 3;  1FGQ A;  1LOX A;  1OUN A;  3KFQ C;  2Q07 A;  4O8S A;  4CCV A;  2KRT A;  4FR9 A;  1VQM 3;  1YIT 3;  3EJV A;  4FCJ A;  2CW9 A;  4KZ1 A;  3FKA A;  3AMO A;  2P05 A;  1QMA A;  1IT8 A;  3FF0 A;  4U13 A;  1W00 A;  1MOL A;  3V92 A;  1TP6 A;  4LSO A;  3STD A;  2Z76 A;  1D6Y A;  1WMP A;  3LTD A;  3UNL A;  1N5P A;  2CH9 A;  3BND A;  1UUW B;  4EXR A;  2GXF A;  4MJD A;  4ZM8 A;  1M90 4;  1VQ4 3;  2W03 A;  1VQK 3;  1AV4 A;  2E2U A;  3S67 A;  2STD A;  4HBR A;  4L8P A;  4HKV B;  2XEP A;  3OW2 2;  2XGL A;  1M1K 4;  1FGM A;  1DMN A;  1DMQ A;  3EBY A;  1CEW I;  5ELU A;  1UI8 A;  3DUK A;  3MG2 A;  3DXO A;  1A2K A;  4STD A;  5IEP A;  3EN1 B;  1RRL A;  2P09 A;  1O7N B;  1IV7 A;  3CCE 3;  3F14 A;  1JJ2 2;  3T8U A;  2CFK A;  5JPU A;  2YFI B;  1VQ6 3;  1S5A A;  3DZL A;  3EX9 A;  4TX4 A;  1QJG A;  3U1W A;  4N6L A;  1OCV A;  4X2H A;  3QRD A;  3LT9 A;  3LOY A;  3MKI A;  3CCJ 3;  3D3L A;  2JQ5 A;  5BXQ A;  1JNQ A;  3JVC A;  2BMR B;  5D83 A;  4AKY A;  3EE1 A;  2MC8 A;  1QAF A;  3A76 A;  3LH4 A;  3N8B A;  1U5O A;  1JN5 B;  3EB8 A;  2XFS A;  3IPT A;  2ML6 A;  3NXJ A;  3BLZ A;  1M1X B;  2B1X B;  3T0U A;  3X3Z A;  2HMO B;  1EG9 B;  1WTH A;  5IEO A;  4Q53 A;  5TGN A;  1KC8 4;  4AEQ A;  3PCS A;  3PGB A;  1RKY A;  4HM7 B;  1IDP A;  2CFD A;  4AKZ A;  1IV9 A;  3FGY A;  3S28 A;  1GY7 A;  3K7C A;  3JUO A;  3DGN A;  3NUV A;  1A67 A;  4N6U A;  2CK3 H;  3CCR 3;  4HM3 B;  3UB1 A;  4FCZ A;  4IPB A;  1A90 A;  3SOA A;  4IIA A;  3PXM A;  3NQY A;  1E3V A;  2HMN B;  3WDG B;  1JN5 A;  1O7H B;  3Q2P A;  3OV4 A;  2W56 B;  1N9E A;  4FMB A;  1WMN A;  4WWU C;  3LTC A;  2RCD A;  1JB4 A;  1IQY A;  3BNC A;  1QAK A;  3GZR A;  4O2H A;  1HU9 A;  4RBN A;  5HGR A;  4NHF A;  3OWS A;  3GAX A;  3KZT A;  4HZB B;  4K61 A;  4PEJ A;  4WYK B;  2Z7A A;  3RGR A;  3B4O A;  5KP3 A;  3IMA B;  3LYG A;  5FW5 A;  1NB5 I;  3X42 A;  3LZA A;  4NRE A;  1W2B 2;  4KFF A;  5AIH A;  1ZX2 A;  3DMC A;  1STF I;  4RNY A;  4J8T A;  2GU3 A;  1NDO B;  5IER A;  2OTJ 3;  3JUN A;  2Y74 A;  3HI7 A;  1AVL A;  4WP5 A;  2XFT A;  4N6O B;  2BHM A;  1NO3 A;  3F7S A;  2WOH A;  1R4C A;  1OF5 A;  3BNB A;  2LYX A;  4MMZ B;  2XSO B;  1T5Y A;  1K28 A;  3D9R A;  6STD A;  3WOD G;  2KCD A;  2R4I A;  5BVB A;  1CYU A;  3EHC A;  2RGQ A;  3GZB A;  3LTA A;  5ELJ A;  1RN7 A;  4O02 B;  1NU3 A;  5D81 A;  3CCL 3;  4EV5 A;  3K5T A;  1SQW A;  2W6J H;  3HIG A;  5IF6 A;  1MNL A;  2IUJ A;  2BT3 A;  1Q40 B;  3EBT A;  3E99 A;  4K1U A;  2CKF B;  3RGA A;  2C11 A;  3LML A;  1DVD A;  3NV0 A;  1SII A;  3EF8 A;  1OHP A;  2F98 A;  7STD A;  3CPW 2;  1JRQ A;  2E2T A;  3CCV 3;  2JDI H;  1GY6 A;  2GU1 A;  5EQL A;  1LVN A;  1C7H A;  1YJW 3;  4N6N B;  3KN4 A;  4HM8 B;  1JKG B;  3U97 A;  5KP4 A;  3CXC 2;  1OGX A;  3S5C A;  3HX8 A;  4BTY A;  1VQL 3;  5AEW B;  3ER7 A;  1E3R A;  1RRH A;  2XRX B;  5AYR B;  3CCU 3;  1D6Z A;  3TDG A;  1PU4 A;  1Y4K A;  2CC3 A;  5IW9 A;  1YHQ 3;  1WNH A;  4N6T A;  3BNE A;  1NB3 I;  3LT8 A;  3NM2 A;  4QWT A;  1IQ8 A;  2BO9 B;  3CPO A;  1JB5 A;  4R1K A;  2OTL 3;  4K90 B;  3K63 A;  4FCM A;  4RZM A;  5AI1 A;  3WOF B;  4L8O A;  3WA3 A;  3O8Y A;  2F99 A;  2W04 A;  3X3X A;  4HM4 B;  3PS8 A;  1IT7 A;  3N54 B;  4OK0 A;  3X40 A;  4G1M B;  3FH1 A;  4EBG A;  3HK4 A;  3MHE A;  1W6Y A;  4ORL A;  2WO0 A;  3CD6 3;  3WMD A;  2P0X A;  3FG4 A;  1OAC A;  5EEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...