3JVCA

Crystal structure of the lipoprotein_17 domain from q9pra0_urepa protein of ureaplasma parvum. northeast structural genomics consortium target uur17a.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
FKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKNGTLKLSLMLTDKKNNQVYYKLLEVSGFKSNPYGVDENGTIPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid binding protein
molecule keywords Conserved hypothetical membrane lipoprotein
publication title Crystal Structure of the Lipoprotein_17 domain from Q9PRA0_UREPA protein of Ureaplasma parvum.
rcsb
source organism Ureaplasma parvum serovar 3 str. atcc 700970
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04200 Lipoprotein_17 Lipoprotein associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.270 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3jvcA01
2KRTA 3JVCA 3K63A
chains in the Genus database with same CATH superfamily
1LQMB 2CH9A 2Y73A 3CCE3 1JBSA 1HKXA 1RDSA 2IY2A 1UGHI 1TUHA 3EN1B 3EX9A 1BNSA 2P0XA 2W2CA 1OH0A 4FCZA 2CWTA 1X1XA 4X2OA 2GU3A 3B8LA 1QMAA 1OGXA 2ZA4A 1RCLA 1LOYA 3TDGA 5FW5A 3HI7A 3BIRA 4BL3A 6GSPA 4MJDA 3CCU3 2CFLA 2F56A 3UB1A 1M904 1Q814 1EKMA 1IYYA 3K7CA 4AKZA 1U8CB 5IF6A 1CYVA 2XFTA 1PU4A 2QIYA 4FCMA 1TFOA 3S28A 3OX9A 3CCS3 3J7Yd 2BHMA 1JRQA 5IG3A 3CNMA 4J9AA 1I3FA 2HMKB 4HM0B 1JJ22 1O7HB 1V58A 2KCDA 3DH2A 3CXC2 2CC3A 2GSPA 1FGRA 1RGGA 1YGWA 2K54A 2IMJA 2OQEA 1IVWA 2W6JH 3ER7A 3CC23 3BB9A 3V98A 3MG2A 3ZG5A 2CX1A 1VQL3 2HMLB 1AVKA 1RRLA 1N5PA 3G0KA 1GOYA 1Q9EA 3ZG0A 3DGYA 1B2XA 1DVCA 2PZVA 3NM2A 1JB4A 1KC84 1X1UA 3EBTA 5I97A 4BL2A 7GSPA 1TU5A 2W9QA 3UL5A 2AAEA 5ELJA 2W9PA 2RSXA 1ZX2A 1RKYA 3GZXB 2XRXB 3EQQB 1ROVA 3KFQC 1V57A 1PFPA 1QALA 5BVBA 1RSNA 2CKFB 1I0XA 1WNHA 3OWSA 1CEWI 4OUQA 2BMQB 3IJEB 3SX1A 5KP1A 3PS8A 1NNVA 1EQKA 1A2VA 1W4NA 3NV0B 5KP3A 2KF4A 3SYUA 1M1K4 4DKIA 2V1LA 4HM4B 2QEX3 3CCJ3 3KSPA 3D5GA 3F8HA 3FG3A 4L7KA 4XBXA 1CQSA 1RGCA 1IQYA 1S723 1V74A 1QJGA 3B7CA 2K0MA 3K5TA 2W56B 3SOYA 1S5AA 4KFEA 2P09A 3KKGA 1DMMA 3X41A 1TRPA 1GOVA 1O7NB 8RNTA 4XDWA 1FUWA 3RGAA 3T0UA 3X3XA 1NB3I 1TP6A 1NJI4 2SARA 3NX0A 5DRVA 3ZFZA 5KP4A 1VQN3 1Q7HA 3BNEA 4HZ9B 3LYGA 2XFSA 2CFGA 3CCR3 1IQXA 1JN5B 2KF6A 1UW1A 5LC6A 1AVLA 1E3RA 1W2B2 3CME3 1PYLA 1D6ZA 2AADA 2HMOB 2ZDJA 3EC9A 1A2KA 3A76A 3OV4A 4BTXA 5IG5A 3KCHA 5EQLA 3HZPA 4FMAA 2CWUA 5DREA 3CCQ3 2RCDA 2C4BA 1BNIA 3O8YA 3F9SA 1TJDA 1UI8A 5CK6A 1ULJB 1RGHA 1VQK3 1DETA 1LVNA 2BNGA 2XSHB 1NDOB 1YJN3 4R4KA 1R4YA 3MYTA 1KD14 5IEOA 1GMQA 5AEWB 1RGEA 1LNIA 3WMDA 1FYSA 1JBTA 3F40A 3VF1A 2RFRA 4GB5A 4EV2A 1BOXA 3X3ZA 1RN4A 2IYJA 2INXA 3FGYA 1OUNA 1FUSA 3DXOA 2Y74A 1I0VA 2IUKA 1ZGXA 4WWUC 5BIRA 1VQ73 3SEDA 3AMOA 1JBRA 1DE3A 1TTOA 3NUVA 3JUQA 4FMBA 4IPBA 3OWYA 4LEHA 1WTHA 4HM5B 1YI23 4N6TA 5IERA 3F7SA 3PYJA 3BU4A 1SQWA 3CCM3 2CHCA 1KWIA 5A0OB 1E97A 5AIHA 1MGWA 1STDA 4J5KA 4MMXB 2QA43 3CMA3 1RN7A 3GZYB 2RNTA 4HAAA 2P0MA 4FR9A 1N8QA 3ECFA 1TRQA 2CIUA 2UGIA 1HYFA 2GXFA 1UGIA 1B2UA 2BU4A 1B2ZA 4R80A 3EB8A 4RBNA 1G02A 4N6NB 1N5HA 3UJMA 5AEUB 3LTAA 3CCL3 1SIIA 1FUTA 1BU4A 1UI7A 2ML5A 1RNBA 1T5YA 4EYCA 4N6LA 5D82A 3X40A 2WOHA 3PZWA 1VQQA 1NB5I 2IA7A 3FF0A 1I2GA 2BMRB 2GEXA 2JDIH 3EN8A 3G8ZA 1JZDA 2E2TA 4KFDA 4R9KA 4NHFA 4BTWA 3NBRA 3G713 3CU3A 4RZMA 5D83A 3DGOA 3HIGA 3FZWA 3V92A 4N6V0 3VGNA 2HMNB 2GEYA 3DMCA 5M18A 3LT8A 1VQ93 2OQEC 3WOFB 9RNTA 1UCJA 1MOLA 5G1LA 3RDEA 5IEPA 1JKGB 4K61A 3NXJA 1VQM3 2FNQA 1X1WA 1U5OA 5IG0A 2WGQA 3KZTA 1ZO2A 1A2PA 1IVUA 1BSDA 1PY3A 3EHCA 1MWSA 2XEPA 3BNDA 1UCKA 3WA2X 1UDII 3LTCA 3AHWA 3OWUA 1WMPA 3K9MC 3T8NA 1RTUA 8CHOA 2J8XB 1AQZA 3KSED 5CLKA 5GSPA 2E2VA 2ZL8A 1LQGC 4BTYA 2F98A 1SIHA 1X1YA 2A15A 2STDA 1UCIA 1T2HA 3HOHA 1ASKA 4K1VA 1IT8A 3DUKA 3LTDA 1STFI 1W02A 3WDGB 2ZHXB 2F4YA 2GBXB 2E2UA 5CXOA 2W56A 4EV5A 4HZBB 1N8R4 3STDA 3QK9A 4EW5A 3KE7A 4HBRA 2OTL3 1CH0A 1QAKA 3K63A 2P38A 1BNJA 1NU3A 2O9UX 4EXRA 1VQ63 1K8A4 3DGMA 2BO9B 2WOFA 4PEJA 1RGAA 5JPPA 1RGFA 1MGRA 1OF5B 4OVMA 2XR8B 3I0YA 1QVG2 2CFKA 5FGOA 1BIRA 5M1AA 5CF2A 1VZZA 2BT3A 1BRIA 1BSCA 1Y4KA 4JRFA 1GY7A 3HX8A 2IUJA 2D42A 5AIFA 1LRAA 4HM1B 2XH9A 3IMAB 3ROBA 4HM7B 4WYKB 3N54B 4KVHA 3EF8A 5TGNA 4GHOA 1MWUA 2RGQA 3X42A 2KXGA 3B4PA 3BNBA 3DY5A 1RGKA 3NBJA 1DVDA 3G16A 4MEIA 2F99A 4G1MB 4HOHA 1AV4A 4HM3B 1BRJA 1HU9A 1I8VA 3AHSA 2XGLA 3SXXA 2CX0A 5G2GA 2CFDA 1VQ83 1GS3A 1W01A 2B1XB 2CWVA 4L8OA 3Q90A 5HGRA 1Q40A 1BNRA 1RN1A 3EBYA 3GRDA 4I4KA 3S67A 1K41A 1O7GB 1YVSA 3D5IA 1E3VA 4MMYB 1RHLA 1ROAA 2YX9A 1MNLA 2P05A 1GSPA 1BNEA 3FG4A 3CC43 2YFLB 1IDPA 3KN4A 3E99A 4TX4A 3EJVA 1GD3A 3MPHA 4FMCA 3KIIA 4H3UA 4QWTA 3EE1A 1OHPA 3FSDA 1OACA 2LQVA 1K28A 4CJNA 3G4S3 1Q7Y4 5STDA 3NQYA 4XDVA 2FXTA 1L5GB 1Z1SA 1YGEA 1RCKA 3NQZA 4N6UA 3H3HA 4AKYA 3LT9A 4R9LA 4X2HA 2RBIA 1FGOA 1DMQA 2MF7A 1NWWA 1BGSA 3U97A 4H61A 1B2SA 3Q2PA 4N6OB 3FKAA 2BMOB 1W6GA 1G0TA 1GY5A 4BU4A 2QGUA 1VQO3 3I563 2YFJB 4HM2B 3BNCA 2BIRA 5JBSA 1LXEA 1JNQA 5M19A 1BRKA 3PGBA 1JB2A 3PXMA 2F5WA 2H0GA 2UX0A 3D4AA 4WHAA 1A90A 4NPBA 3FH1A 3H51A 3WODG 3LZAA 2CW9A 2CG1A 6RNTA 1AY7A 1YJ93 1W2ZA 4XM4A 2I9WA 1D6UA 1BANA 3F7XA 3S5CA 1GMRA 6STDA 3FG1A 1FZUA 1M9GA 2LYXA 1C54A 2WO0A 3Q3FA 3WOEB 2PNCA 1Q824 2OTJ3 1VQP3 3FLJA 4N3VA 3VSYA 4J8TA 5IW9A 4J5GA 1VQ43 4ILFA 4BIRA 3JUPA 3NHXA 4HVNA 3DGLA 5BU4A 2C10A 3LXUX 2W0QA 4N6MA 3X3YA 1BRSA 1IT7A 1UCLA 3SOAA 1W6CA 1SJWA 3JVCA 3D79A 2CK3H 2R41A 2R4IA 4O2HA 5IENA 1BUJA 2F5MA 4RNTA 2OOVA 3SVAA 2Z77A 1O7MB 1T3BA 3I553 1KQS2 1EA2A 1SARA 1WQLB 1UUVB 1R4CA 2JQ5A 3DZLA 1OGZA 4MMZB 5ELUA 2K3DA 2KAAA 2H0IA 3UL6A 1K9M4 1JZOA 1ULIB 2XSOB 2KRTA 2M7OA 3HK4A 4GL6A 4JF8A 4LSOA 3FCSB 3WR2A 1I3IA 1IV9A 1OHOA 1RJOA 5AIIA 3NV0A 1I2EA 2Q07A 2L1SA 3DM8A 1IVXA 1OF5A 5D81A 1AR0A 3N9HA 1TIJA 1EG9B 2GBWB 3B4OA 4AEQA 1K734 1BUQA 1CYUA 1UUWB 1YIJ3 2W04A 3MG3A 3CC73 3CNXA 3D3LA 4EC6A 4Q53A 3G6E3 3OXAA 4HJLB 2KF5A 2MC8A 5IG4A 2GU1A 3FF2A 1IV7A 4WYKA 2OWPA 2KF3A 3LOYA 4I5QA 1YNVX 4KT3B 1GMPA 5BXQA 2HMMB 3AGNA 1FGQA 1J2BA 4O8SA 2CFWA 3PCRA 3CPW2 1FGMA 1GYBA 4XBYA 5LC7A 2HMJB 1BRNL 1GY6A 1OPYA 3CPOA 3OW22 1LOWA 1C7HA 1LNHA 1JN5A 1RMSA 4KZ1A 1W7CA 1QAFA 1B21A 4XB5A 5HOHA 2XGNA 2Z7AA 3GZRA 1MWRA 3QRDA 4K90B 2C11A 2CG0A 4KFFA 1M1XB 1OHSA 1LOXA 3LTBA 5AI1A 3IPTA 4CPKA 3L0RA 5JPUA 3N8BA 1NO3A 1B3SA 4CCVA 1BNGA 1YVBI 4IT7A 1BRHA 1B20A 1IVVA 1DYUA 1ZS7A 3PCSA 1BAOA 3GZBA 1B27A 1T2IA 3M8CA 1KSIA 1W00A 2SBLA 1RGLA 5AYSC 1G96A 1BVIA 1GD4A 2H0HA 4FMDA 4WP5A 5CF1A 2FGTA 2B24B 1I2FA 3NBBA 3GWRA 5AIGA 2Z6BA 1BRGA 1W5ZA 2WGOA 3MWZA 4HYZA 7STDA 4CDLA 1BNFA 5EEOA 3Q1CA 1BSBA 4HKVB 1QVF2 3MKIA 1LOVA 3MHEA 3A5EA 3LH4A 2O3OA 1D6YA 1Q42A 2W03A 1JB5A 3BLZA 1ISKA 1UUGB 3V99A 1EUIC 4FCJA 4LMIA 4STDA 3D9RA 4O3VA 1I70A 3MSOA 3GAXA 4RNZA 3ALAA 3JUMA 2Z76A 2YFIB 2D1WA 1IQ8A 4OK0A 4LZIA 3DGNA 1O7WB 3T8UA 1YHQ3 1IU7A 1US1A 3SLUA 2UUGC 1BSAA 1SPUA 3JUOA 1WMOA 4IIAA 4O02B 7RNTA 1RNTA 3F8XA 1OCVA 1IK3A 1F8NA 2ML6A 3CCV3 1HZ1A 4R1KA 1DMNA 2F86B 4ZM8A 3RNTA 3WHOA 3K0ZA 5RNTA 4HM8B 1YJW3 1FA3A 1RRHA 4U13A 4XBTA 1N9JA 1FW7A 1A67A 3S29A 3MG1A 3URPA 4NREA 1B2MA 1Q40B 3JUNA 1MWTA 2HOHA 1YIT3 1JV2B 5EVHA 3NM7A 1GOUA 4HM6B 3F14A 1TFKA 3RGRA 4ORLA 1N9EA 3CD63 5G1KA 3UNLA 1WMNA 4EBGA 4K1UA 4LYLB 1Q864 1W6YA 1VQ53 1RLSA 4GSPA 2XF3A 2OCTA 1O7PB 3AGOA 3GSPA 3HIIA 3LMLA 1FGTA 4L8PA 5AYRB 3U1WA 1JKGA 3WA3A 3S27A 1BSEA 2OOVC 2L4VA 4RNYA 4LGQA 3AMOB 4WFOA 1EEJA
chains in the Genus database with same CATH topology
2CH9A 2Y73A 3CCE3 1HKXA 1TUHA 3EN1B 3EX9A 2P0XA 2W2CA 1OH0A 4FCZA 2CWTA 4X2OA 2GU3A 3B8LA 1QMAA 1OGXA 3TDGA 5FW5A 3HI7A 4MJDA 3CCU3 2CFLA 3UB1A 1M904 1Q814 1EKMA 3K7CA 4AKZA 1U8CB 5IF6A 1CYVA 2XFTA 1PU4A 2QIYA 4FCMA 1TFOA 3S28A 3OX9A 3CCS3 3J7Yd 2BHMA 1JRQA 5IG3A 3CNMA 4J9AA 2HMKB 4HM0B 1JJ22 1O7HB 2KCDA 3CXC2 2CC3A 1FGRA 2K54A 2IMJA 2OQEA 1IVWA 2W6JH 3ER7A 3CC23 3BB9A 3V98A 3MG2A 1VQL3 2HMLB 1AVKA 1RRLA 1N5PA 3G0KA 1DVCA 2PZVA 3NM2A 1JB4A 1KC84 3EBTA 5I97A 1TU5A 2W9QA 3UL5A 5ELJA 2W9PA 2RSXA 1ZX2A 1RKYA 3GZXB 2XRXB 3EQQB 1ROVA 3KFQC 1PFPA 1QALA 5BVBA 2CKFB 1WNHA 3OWSA 1CEWI 4OUQA 2BMQB 3IJEB 3SX1A 5KP1A 3PS8A 1EQKA 1A2VA 1W4NA 3NV0B 5KP3A 1M1K4 2V1LA 4HM4B 2QEX3 3CCJ3 3KSPA 3F8HA 3FG3A 4L7KA 4XBXA 1CQSA 1IQYA 1V74A 1QJGA 3B7CA 2K0MA 3K5TA 2W56B 3SOYA 1S5AA 4KFEA 2P09A 3KKGA 1DMMA 3X41A 1O7NB 4XDWA 1FUWA 3RGAA 3T0UA 3X3XA 1NB3I 1TP6A 1NJI4 3NX0A 5DRVA 1VQN3 5KP4A 4HZ9B 3BNEA 3LYGA 2XFSA 2CFGA 3CCR3 1IQXA 1JN5B 1UW1A 5LC6A 1AVLA 1E3RA 1W2B2 3CME3 1D6ZA 2ZDJA 2HMOB 3EC9A 4BTXA 1A2KA 3A76A 3OV4A 5IG5A 1YIT3 5EQLA 3HZPA 4FMAA 2CWUA 5DREA 3CCQ3 2RCDA 3O8YA 3F9SA 1UI8A 5CK6A 1ULJB 1VQK3 1YJN3 1LVNA 2BNGA 2XSHB 1NDOB 4R4KA 3MYTA 1KD14 5IEOA 5AEWB 3WMDA 3F40A 3VF1A 2RFRA 4GB5A 4EV2A 3X3ZA 2INXA 3FGYA 1OUNA 3DXOA 2Y74A 2IUKA 4WWUC 1VQ73 3SEDA 3AMOA 3NUVA 3JUQA 4FMBA 4IPBA 3OWYA 4LEHA 1WTHA 4HM5B 1YI23 4N6TA 5IERA 3F7SA 3PYJA 1SQWA 3CCM3 2CHCA 1KWIA 5A0OB 1E97A 5AIHA 1STDA 2QA43 4MMXB 3CMA3 1RN7A 3GZYB 2P0MA 4FR9A 1N8QA 3ECFA 2CIUA 2GXFA 4RBNA 4R80A 3EB8A 5AEUB 4N6NB 1N5HA 3UJMA 3CCL3 3LTAA 1SIIA 1UI7A 2ML5A 1T5YA 4EYCA 4N6LA 5D82A 3X40A 2WOHA 3PZWA 1NB5I 2IA7A 3FF0A 2BMRB 2JDIH 2GEXA 3EN8A 3G8ZA 4KFDA 4R9KA 2E2TA 4NHFA 4BTWA 3NBRA 3G713 3CU3A 4RZMA 5D83A 3DGOA 3HIGA 3FZWA 3V92A 4N6V0 3VGNA 2GEYA 3DMCA 3LT8A 1VQ93 2OQEC 3WOFB 1MOLA 3RDEA 5IEPA 1JKGB 4K61A 3NXJA 1VQM3 2FNQA 1U5OA 5IG0A 2WGQA 3KZTA 1ZO2A 1IVUA 3EHCA 2XEPA 3BNDA 3WA2X 3LTCA 3T8NA 3OWUA 1WMPA 3K9MC 8CHOA 3KSED 5CLKA 4BTYA 2E2VA 2ZL8A 2F98A 1SIHA 2A15A 2STDA 1ASKA 4K1VA 1IT8A 3DUKA 3LTDA 1STFI 1W02A 3WDGB 2GBXB 2E2UA 5CXOA 2W56A 4EV5A 4HZBB 1N8R4 3STDA 3QK9A 3KE7A 4HBRA 2OTL3 3K63A 1QAKA 2P38A 1NU3A 2O9UX 4EXRA 1VQ63 1K8A4 3DGMA 2BO9B 2WOFA 4PEJA 5JPPA 1OF5B 4OVMA 2XR8B 3I0YA 1QVG2 2CFKA 5FGOA 5CF2A 1VZZA 2BT3A 1Y4KA 4JRFA 1GY7A 3HX8A 2IUJA 2D42A 5AIFA 4HM1B 2XH9A 3IMAB 3ROBA 4HM7B 4WYKB 3N54B 4KVHA 3EF8A 5TGNA 2RGQA 3X42A 2KXGA 3B4PA 3BNBA 3DY5A 3NBJA 1DVDA 3G16A 4MEIA 2F99A 4G1MB 1AV4A 4HM3B 1HU9A 3SXXA 2XGLA 5G2GA 2CFDA 1VQ83 1GS3A 1W01A 2B1XB 2CWVA 4L8OA 3Q90A 5HGRA 1Q40A 3EBYA 3GRDA 4I4KA 3S67A 1K41A 1O7GB 1E3VA 4MMYB 1ROAA 2YX9A 1MNLA 2P05A 3FG4A 3CC43 2YFLB 1IDPA 3KN4A 3E99A 4TX4A 3EJVA 1GD3A 3MPHA 4FMCA 3KIIA 4H3UA 4QWTA 3EE1A 1OHPA 3FSDA 1OACA 2LQVA 1K28A 3G4S3 1Q7Y4 5STDA 3NQYA 4XDVA 2FXTA 1L5GB 1Z1SA 1YGEA 3NQZA 4N6UA 3H3HA 4AKYA 3LT9A 4R9LA 4X2HA 1FGOA 1DMQA 2MF7A 1NWWA 3U97A 4H61A 3Q2PA 4N6OB 3FKAA 2BMOB 1W6GA 1GY5A 2QGUA 1VQO3 3I563 2YFJB 4HM2B 3BNCA 5JBSA 1LXEA 1JNQA 3PGBA 1JB2A 3PXMA 2UX0A 4WHAA 1A90A 3FH1A 3H51A 3WODG 3LZAA 2CW9A 2CG1A 1YJ93 1W2ZA 4XM4A 2I9WA 1D6UA 3F7XA 3S5CA 6STDA 3FG1A 1M9GA 2LYXA 2WO0A 3WOEB 2PNCA 1Q824 2OTJ3 1VQP3 3FLJA 4N3VA 3VSYA 4J8TA 5IW9A 1VQ43 3JUPA 3NHXA 4HVNA 3DGLA 2C10A 3LXUX 2W0QA 4N6MA 3X3YA 1IT7A 3SOAA 1W6CA 1SJWA 3JVCA 2CK3H 2R4IA 4O2HA 5IENA 2OOVA 3SVAA 2Z77A 1O7MB 3I553 1KQS2 1EA2A 3DZLA 1UUVB 1WQLB 1R4CA 2JQ5A 4MMZB 1OGZA 5ELUA 3UL6A 1K9M4 1ULIB 2XSOB 2KRTA 2M7OA 3HK4A 4GL6A 4JF8A 4LSOA 3FCSB 1IV9A 1OHOA 1RJOA 5AIIA 3NV0A 2Q07A 3DM8A 1IVXA 1OF5A 5D81A 1AR0A 3N9HA 2GBWB 3B4OA 1TIJA 1EG9B 4AEQA 1K734 1CYUA 1UUWB 1YIJ3 2W04A 3MG3A 3CC73 3CNXA 3D3LA 4EC6A 4Q53A 3G6E3 3OXAA 4HJLB 2MC8A 5IG4A 2GU1A 3FF2A 1IV7A 4WYKA 2OWPA 3LOYA 5BXQA 2HMMB 1J2BA 1FGQA 4O8SA 2CFWA 3PCRA 3CPW2 1FGMA 1GYBA 4XBYA 5LC7A 2HMJB 1GY6A 1OPYA 3CPOA 3OW22 1LNHA 1C7HA 4KZ1A 1JN5A 1W7CA 1QAFA 4XB5A 2XGNA 2Z7AA 3GZRA 3QRDA 4K90B 2C11A 2CG0A 4KFFA 1M1XB 1OHSA 1LOXA 3LTBA 5AI1A 3IPTA 1BUQA 3L0RA 5JPUA 3N8BA 1NO3A 4CCVA 1S723 1YVBI 4IT7A 1IVVA 1DYUA 3PCSA 3GZBA 3M8CA 1KSIA 1W00A 2SBLA 5AYSC 1G96A 1GD4A 4FMDA 4WP5A 5CF1A 2FGTA 2B24B 3NBBA 3GWRA 5AIGA 2Z6BA 1W5ZA 2WGOA 3MWZA 4HYZA 7STDA 4CDLA 5EEOA 3Q1CA 4HKVB 1QVF2 3MKIA 3MHEA 3LH4A 2O3OA 1D6YA 1Q42A 2W03A 1JB5A 3BLZA 1ISKA 3V99A 4LMIA 4FCJA 4STDA 3D9RA 4O3VA 3MSOA 3GAXA 4RNZA 3ALAA 3JUMA 2Z76A 2YFIB 2D1WA 1IQ8A 4OK0A 4LZIA 3DGNA 1O7WB 3T8UA 1YHQ3 1IU7A 1US1A 3SLUA 1SPUA 3JUOA 1WMOA 4IIAA 4O02B 3F8XA 1OCVA 1IK3A 1F8NA 2ML6A 3CCV3 4R1KA 1DMNA 2F86B 4ZM8A 3K0ZA 4HM8B 1YJW3 1FA3A 1RRHA 4U13A 4XBTA 1N9JA 1A67A 3S29A 3MG1A 4NREA 1Q40B 3JUNA 1JV2B 5EVHA 3NM7A 4HM6B 3F14A 1TFKA 3RGRA 4ORLA 1N9EA 3CD63 3UNLA 1WMNA 4EBGA 4K1UA 1Q864 1W6YA 1VQ53 2XF3A 2OCTA 1O7PB 3HIIA 3LMLA 4L8PA 5AYRB 1FGTA 3U1WA 1JKGA 3WA3A 3S27A 2OOVC 2L4VA 4RNYA 4LGQA 3AMOB 4WFOA 2HMNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRT A;  3JVC A;  3K63 A; 
#chains in the Genus database with same CATH topology
 1LQM B;  2CH9 A;  2Y73 A;  3CCE 3;  1JBS A;  1HKX A;  1RDS A;  2IY2 A;  1UGH I;  1TUH A;  3EN1 B;  3EX9 A;  1BNS A;  2P0X A;  2W2C A;  1OH0 A;  4FCZ A;  2CWT A;  1X1X A;  4X2O A;  2GU3 A;  3B8L A;  1QMA A;  1OGX A;  2ZA4 A;  1RCL A;  1LOY A;  3TDG A;  5FW5 A;  3HI7 A;  3BIR A;  4BL3 A;  6GSP A;  4MJD A;  3CCU 3;  2CFL A;  2F56 A;  3UB1 A;  1M90 4;  1Q81 4;  1EKM A;  1IYY A;  3K7C A;  4AKZ A;  1U8C B;  5IF6 A;  1CYV A;  2XFT A;  1PU4 A;  2QIY A;  4FCM A;  1TFO A;  3S28 A;  3OX9 A;  3CCS 3;  3J7Y d;  2BHM A;  1JRQ A;  5IG3 A;  3CNM A;  4J9A A;  1I3F A;  2HMK B;  4HM0 B;  1JJ2 2;  1O7H B;  1V58 A;  2KCD A;  3DH2 A;  3CXC 2;  2CC3 A;  2GSP A;  1FGR A;  1RGG A;  1YGW A;  2K54 A;  2IMJ A;  2OQE A;  1IVW A;  2W6J H;  3ER7 A;  3CC2 3;  3BB9 A;  3V98 A;  3MG2 A;  3ZG5 A;  2CX1 A;  1VQL 3;  2HML B;  1AVK A;  1RRL A;  1N5P A;  3G0K A;  1GOY A;  1Q9E A;  3ZG0 A;  3DGY A;  1B2X A;  1DVC A;  2PZV A;  3NM2 A;  1JB4 A;  1KC8 4;  1X1U A;  3EBT A;  5I97 A;  4BL2 A;  7GSP A;  1TU5 A;  2W9Q A;  3UL5 A;  2AAE A;  5ELJ A;  2W9P A;  2RSX A;  1ZX2 A;  1RKY A;  3GZX B;  2XRX B;  3EQQ B;  1ROV A;  3KFQ C;  1V57 A;  1PFP A;  1QAL A;  5BVB A;  1RSN A;  2CKF B;  1I0X A;  1WNH A;  3OWS A;  1CEW I;  4OUQ A;  2BMQ B;  3IJE B;  3SX1 A;  5KP1 A;  3PS8 A;  1NNV A;  1EQK A;  1A2V A;  1W4N A;  3NV0 B;  5KP3 A;  2KF4 A;  3SYU A;  1M1K 4;  4DKI A;  2V1L A;  4HM4 B;  2QEX 3;  3CCJ 3;  3KSP A;  3D5G A;  3F8H A;  3FG3 A;  4L7K A;  4XBX A;  1CQS A;  1RGC A;  1IQY A;  1S72 3;  1V74 A;  1QJG A;  3B7C A;  2K0M A;  3K5T A;  2W56 B;  3SOY A;  1S5A A;  4KFE A;  2P09 A;  3KKG A;  1DMM A;  3X41 A;  1TRP A;  1GOV A;  1O7N B;  8RNT A;  4XDW A;  1FUW A;  3RGA A;  3T0U A;  3X3X A;  1NB3 I;  1TP6 A;  1NJI 4;  2SAR A;  3NX0 A;  5DRV A;  3ZFZ A;  5KP4 A;  1VQN 3;  1Q7H A;  3BNE A;  4HZ9 B;  3LYG A;  2XFS A;  2CFG A;  3CCR 3;  1IQX A;  1JN5 B;  2KF6 A;  1UW1 A;  5LC6 A;  1AVL A;  1E3R A;  1W2B 2;  3CME 3;  1PYL A;  1D6Z A;  2AAD A;  2HMO B;  2ZDJ A;  3EC9 A;  1A2K A;  3A76 A;  3OV4 A;  4BTX A;  5IG5 A;  3KCH A;  5EQL A;  3HZP A;  4FMA A;  2CWU A;  5DRE A;  3CCQ 3;  2RCD A;  2C4B A;  1BNI A;  3O8Y A;  3F9S A;  1TJD A;  1UI8 A;  5CK6 A;  1ULJ B;  1RGH A;  1VQK 3;  1DET A;  1LVN A;  2BNG A;  2XSH B;  1NDO B;  1YJN 3;  4R4K A;  1R4Y A;  3MYT A;  1KD1 4;  5IEO A;  1GMQ A;  5AEW B;  1RGE A;  1LNI A;  3WMD A;  1FYS A;  1JBT A;  3F40 A;  3VF1 A;  2RFR A;  4GB5 A;  4EV2 A;  1BOX A;  3X3Z A;  1RN4 A;  2IYJ A;  2INX A;  3FGY A;  1OUN A;  1FUS A;  3DXO A;  2Y74 A;  1I0V A;  2IUK A;  1ZGX A;  4WWU C;  5BIR A;  1VQ7 3;  3SED A;  3AMO A;  1JBR A;  1DE3 A;  1TTO A;  3NUV A;  3JUQ A;  4FMB A;  4IPB A;  3OWY A;  4LEH A;  1WTH A;  4HM5 B;  1YI2 3;  4N6T A;  5IER A;  3F7S A;  3PYJ A;  3BU4 A;  1SQW A;  3CCM 3;  2CHC A;  1KWI A;  5A0O B;  1E97 A;  5AIH A;  1MGW A;  1STD A;  4J5K A;  4MMX B;  2QA4 3;  3CMA 3;  1RN7 A;  3GZY B;  2RNT A;  4HAA A;  2P0M A;  4FR9 A;  1N8Q A;  3ECF A;  1TRQ A;  2CIU A;  2UGI A;  1HYF A;  2GXF A;  1UGI A;  1B2U A;  2BU4 A;  1B2Z A;  4R80 A;  3EB8 A;  4RBN A;  1G02 A;  4N6N B;  1N5H A;  3UJM A;  5AEU B;  3LTA A;  3CCL 3;  1SII A;  1FUT A;  1BU4 A;  1UI7 A;  2ML5 A;  1RNB A;  1T5Y A;  4EYC A;  4N6L A;  5D82 A;  3X40 A;  2WOH A;  3PZW A;  1VQQ A;  1NB5 I;  2IA7 A;  3FF0 A;  1I2G A;  2BMR B;  2GEX A;  2JDI H;  3EN8 A;  3G8Z A;  1JZD A;  2E2T A;  4KFD A;  4R9K A;  4NHF A;  4BTW A;  3NBR A;  3G71 3;  3CU3 A;  4RZM A;  5D83 A;  3DGO A;  3HIG A;  3FZW A;  3V92 A;  4N6V 0;  3VGN A;  2HMN B;  2GEY A;  3DMC A;  5M18 A;  3LT8 A;  1VQ9 3;  2OQE C;  3WOF B;  9RNT A;  1UCJ A;  1MOL A;  5G1L A;  3RDE A;  5IEP A;  1JKG B;  4K61 A;  3NXJ A;  1VQM 3;  2FNQ A;  1X1W A;  1U5O A;  5IG0 A;  2WGQ A;  3KZT A;  1ZO2 A;  1A2P A;  1IVU A;  1BSD A;  1PY3 A;  3EHC A;  1MWS A;  2XEP A;  3BND A;  1UCK A;  3WA2 X;  1UDI I;  3LTC A;  3AHW A;  3OWU A;  1WMP A;  3K9M C;  3T8N A;  1RTU A;  8CHO A;  2J8X B;  1AQZ A;  3KSE D;  5CLK A;  5GSP A;  2E2V A;  2ZL8 A;  1LQG C;  4BTY A;  2F98 A;  1SIH A;  1X1Y A;  2A15 A;  2STD A;  1UCI A;  1T2H A;  3HOH A;  1ASK A;  4K1V A;  1IT8 A;  3DUK A;  3LTD A;  1STF I;  1W02 A;  3WDG B;  2ZHX B;  2F4Y A;  2GBX B;  2E2U A;  5CXO A;  2W56 A;  4EV5 A;  4HZB B;  1N8R 4;  3STD A;  3QK9 A;  4EW5 A;  3KE7 A;  4HBR A;  2OTL 3;  1CH0 A;  1QAK A;  3K63 A;  2P38 A;  1BNJ A;  1NU3 A;  2O9U X;  4EXR A;  1VQ6 3;  1K8A 4;  3DGM A;  2BO9 B;  2WOF A;  4PEJ A;  1RGA A;  5JPP A;  1RGF A;  1MGR A;  1OF5 B;  4OVM A;  2XR8 B;  3I0Y A;  1QVG 2;  2CFK A;  5FGO A;  1BIR A;  5M1A A;  5CF2 A;  1VZZ A;  2BT3 A;  1BRI A;  1BSC A;  1Y4K A;  4JRF A;  1GY7 A;  3HX8 A;  2IUJ A;  2D42 A;  5AIF A;  1LRA A;  4HM1 B;  2XH9 A;  3IMA B;  3ROB A;  4HM7 B;  4WYK B;  3N54 B;  4KVH A;  3EF8 A;  5TGN A;  4GHO A;  1MWU A;  2RGQ A;  3X42 A;  2KXG A;  3B4P A;  3BNB A;  3DY5 A;  1RGK A;  3NBJ A;  1DVD A;  3G16 A;  4MEI A;  2F99 A;  4G1M B;  4HOH A;  1AV4 A;  4HM3 B;  1BRJ A;  1HU9 A;  1I8V A;  3AHS A;  2XGL A;  3SXX A;  2CX0 A;  5G2G A;  2CFD A;  1VQ8 3;  1GS3 A;  1W01 A;  2B1X B;  2CWV A;  4L8O A;  3Q90 A;  5HGR A;  1Q40 A;  1BNR A;  1RN1 A;  3EBY A;  3GRD A;  4I4K A;  3S67 A;  1K41 A;  1O7G B;  1YVS A;  3D5I A;  1E3V A;  4MMY B;  1RHL A;  1ROA A;  2YX9 A;  1MNL A;  2P05 A;  1GSP A;  1BNE A;  3FG4 A;  3CC4 3;  2YFL B;  1IDP A;  3KN4 A;  3E99 A;  4TX4 A;  3EJV A;  1GD3 A;  3MPH A;  4FMC A;  3KII A;  4H3U A;  4QWT A;  3EE1 A;  1OHP A;  3FSD A;  1OAC A;  2LQV A;  1K28 A;  4CJN A;  3G4S 3;  1Q7Y 4;  5STD A;  3NQY A;  4XDV A;  2FXT A;  1L5G B;  1Z1S A;  1YGE A;  1RCK A;  3NQZ A;  4N6U A;  3H3H A;  4AKY A;  3LT9 A;  4R9L A;  4X2H A;  2RBI A;  1FGO A;  1DMQ A;  2MF7 A;  1NWW A;  1BGS A;  3U97 A;  4H61 A;  1B2S A;  3Q2P A;  4N6O B;  3FKA A;  2BMO B;  1W6G A;  1G0T A;  1GY5 A;  4BU4 A;  2QGU A;  1VQO 3;  3I56 3;  2YFJ B;  4HM2 B;  3BNC A;  2BIR A;  5JBS A;  1LXE A;  1JNQ A;  5M19 A;  1BRK A;  3PGB A;  1JB2 A;  3PXM A;  2F5W A;  2H0G A;  2UX0 A;  3D4A A;  4WHA A;  1A90 A;  4NPB A;  3FH1 A;  3H51 A;  3WOD G;  3LZA A;  2CW9 A;  2CG1 A;  6RNT A;  1AY7 A;  1YJ9 3;  1W2Z A;  4XM4 A;  2I9W A;  1D6U A;  1BAN A;  3F7X A;  3S5C A;  1GMR A;  6STD A;  3FG1 A;  1FZU A;  1M9G A;  2LYX A;  1C54 A;  2WO0 A;  3Q3F A;  3WOE B;  2PNC A;  1Q82 4;  2OTJ 3;  1VQP 3;  3FLJ A;  4N3V A;  3VSY A;  4J8T A;  5IW9 A;  4J5G A;  1VQ4 3;  4ILF A;  4BIR A;  3JUP A;  3NHX A;  4HVN A;  3DGL A;  5BU4 A;  2C10 A;  3LXU X;  2W0Q A;  4N6M A;  3X3Y A;  1BRS A;  1IT7 A;  1UCL A;  3SOA A;  1W6C A;  1SJW A;  3JVC A;  3D79 A;  2CK3 H;  2R41 A;  2R4I A;  4O2H A;  5IEN A;  1BUJ A;  2F5M A;  4RNT A;  2OOV A;  3SVA A;  2Z77 A;  1O7M B;  1T3B A;  3I55 3;  1KQS 2;  1EA2 A;  1SAR A;  1WQL B;  1UUV B;  1R4C A;  2JQ5 A;  3DZL A;  1OGZ A;  4MMZ B;  5ELU A;  2K3D A;  2KAA A;  2H0I A;  3UL6 A;  1K9M 4;  1JZO A;  1ULI B;  2XSO B;  2KRT A;  2M7O A;  3HK4 A;  4GL6 A;  4JF8 A;  4LSO A;  3FCS B;  3WR2 A;  1I3I A;  1IV9 A;  1OHO A;  1RJO A;  5AII A;  3NV0 A;  1I2E A;  2Q07 A;  2L1S A;  3DM8 A;  1IVX A;  1OF5 A;  5D81 A;  1AR0 A;  3N9H A;  1TIJ A;  1EG9 B;  2GBW B;  3B4O A;  4AEQ A;  1K73 4;  1BUQ A;  1CYU A;  1UUW B;  1YIJ 3;  2W04 A;  3MG3 A;  3CC7 3;  3CNX A;  3D3L A;  4EC6 A;  4Q53 A;  3G6E 3;  3OXA A;  4HJL B;  2KF5 A;  2MC8 A;  5IG4 A;  2GU1 A;  3FF2 A;  1IV7 A;  4WYK A;  2OWP A;  2KF3 A;  3LOY A;  4I5Q A;  1YNV X;  4KT3 B;  1GMP A;  5BXQ A;  2HMM B;  3AGN A;  1FGQ A;  1J2B A;  4O8S A;  2CFW A;  3PCR A;  3CPW 2;  1FGM A;  1GYB A;  4XBY A;  5LC7 A;  2HMJ B;  1BRN L;  1GY6 A;  1OPY A;  3CPO A;  3OW2 2;  1LOW A;  1C7H A;  1LNH A;  1JN5 A;  1RMS A;  4KZ1 A;  1W7C A;  1QAF A;  1B21 A;  4XB5 A;  5HOH A;  2XGN A;  2Z7A A;  3GZR A;  1MWR A;  3QRD A;  4K90 B;  2C11 A;  2CG0 A;  4KFF A;  1M1X B;  1OHS A;  1LOX A;  3LTB A;  5AI1 A;  3IPT A;  4CPK A;  3L0R A;  5JPU A;  3N8B A;  1NO3 A;  1B3S A;  4CCV A;  1BNG A;  1YVB I;  4IT7 A;  1BRH A;  1B20 A;  1IVV A;  1DYU A;  1ZS7 A;  3PCS A;  1BAO A;  3GZB A;  1B27 A;  1T2I A;  3M8C A;  1KSI A;  1W00 A;  2SBL A;  1RGL A;  5AYS C;  1G96 A;  1BVI A;  1GD4 A;  2H0H A;  4FMD A;  4WP5 A;  5CF1 A;  2FGT A;  2B24 B;  1I2F A;  3NBB A;  3GWR A;  5AIG A;  2Z6B A;  1BRG A;  1W5Z A;  2WGO A;  3MWZ A;  4HYZ A;  7STD A;  4CDL A;  1BNF A;  5EEO A;  3Q1C A;  1BSB A;  4HKV B;  1QVF 2;  3MKI A;  1LOV A;  3MHE A;  3A5E A;  3LH4 A;  2O3O A;  1D6Y A;  1Q42 A;  2W03 A;  1JB5 A;  3BLZ A;  1ISK A;  1UUG B;  3V99 A;  1EUI C;  4FCJ A;  4LMI A;  4STD A;  3D9R A;  4O3V A;  1I70 A;  3MSO A;  3GAX A;  4RNZ A;  3ALA A;  3JUM A;  2Z76 A;  2YFI B;  2D1W A;  1IQ8 A;  4OK0 A;  4LZI A;  3DGN A;  1O7W B;  3T8U A;  1YHQ 3;  1IU7 A;  1US1 A;  3SLU A;  2UUG C;  1BSA A;  1SPU A;  3JUO A;  1WMO A;  4IIA A;  4O02 B;  7RNT A;  1RNT A;  3F8X A;  1OCV A;  1IK3 A;  1F8N A;  2ML6 A;  3CCV 3;  1HZ1 A;  4R1K A;  1DMN A;  2F86 B;  4ZM8 A;  3RNT A;  3WHO A;  3K0Z A;  5RNT A;  4HM8 B;  1YJW 3;  1FA3 A;  1RRH A;  4U13 A;  4XBT A;  1N9J A;  1FW7 A;  1A67 A;  3S29 A;  3MG1 A;  3URP A;  4NRE A;  1B2M A;  1Q40 B;  3JUN A;  1MWT A;  2HOH A;  1YIT 3;  1JV2 B;  5EVH A;  3NM7 A;  1GOU A;  4HM6 B;  3F14 A;  1TFK A;  3RGR A;  4ORL A;  1N9E A;  3CD6 3;  5G1K A;  3UNL A;  1WMN A;  4EBG A;  4K1U A;  4LYL B;  1Q86 4;  1W6Y A;  1VQ5 3;  1RLS A;  4GSP A;  2XF3 A;  2OCT A;  1O7P B;  3AGO A;  3GSP A;  3HII A;  3LML A;  1FGT A;  4L8P A;  5AYR B;  3U1W A;  1JKG A;  3WA3 A;  3S27 A;  1BSE A;  2OOV C;  2L4V A;  4RNY A;  4LGQ A;  3AMO B;  4WFO A;  1EEJ A; 
#chains in the Genus database with same CATH homology
 2CH9 A;  2Y73 A;  3CCE 3;  1HKX A;  1TUH A;  3EN1 B;  3EX9 A;  2P0X A;  2W2C A;  1OH0 A;  4FCZ A;  2CWT A;  4X2O A;  2GU3 A;  3B8L A;  1QMA A;  1OGX A;  3TDG A;  5FW5 A;  3HI7 A;  4MJD A;  3CCU 3;  2CFL A;  3UB1 A;  1M90 4;  1Q81 4;  1EKM A;  3K7C A;  4AKZ A;  1U8C B;  5IF6 A;  1CYV A;  2XFT A;  1PU4 A;  2QIY A;  4FCM A;  1TFO A;  3S28 A;  3OX9 A;  3CCS 3;  3J7Y d;  2BHM A;  1JRQ A;  5IG3 A;  3CNM A;  4J9A A;  2HMK B;  4HM0 B;  1JJ2 2;  1O7H B;  2KCD A;  3CXC 2;  2CC3 A;  1FGR A;  2K54 A;  2IMJ A;  2OQE A;  1IVW A;  2W6J H;  3ER7 A;  3CC2 3;  3BB9 A;  3V98 A;  3MG2 A;  1VQL 3;  2HML B;  1AVK A;  1RRL A;  1N5P A;  3G0K A;  1DVC A;  2PZV A;  3NM2 A;  1JB4 A;  1KC8 4;  3EBT A;  5I97 A;  1TU5 A;  2W9Q A;  3UL5 A;  5ELJ A;  2W9P A;  2RSX A;  1ZX2 A;  1RKY A;  3GZX B;  2XRX B;  3EQQ B;  1ROV A;  3KFQ C;  1PFP A;  1QAL A;  5BVB A;  2CKF B;  1WNH A;  3OWS A;  1CEW I;  4OUQ A;  2BMQ B;  3IJE B;  3SX1 A;  5KP1 A;  3PS8 A;  1EQK A;  1A2V A;  1W4N A;  3NV0 B;  5KP3 A;  1M1K 4;  2V1L A;  4HM4 B;  2QEX 3;  3CCJ 3;  3KSP A;  3F8H A;  3FG3 A;  4L7K A;  4XBX A;  1CQS A;  1IQY A;  1V74 A;  1QJG A;  3B7C A;  2K0M A;  3K5T A;  2W56 B;  3SOY A;  1S5A A;  4KFE A;  2P09 A;  3KKG A;  1DMM A;  3X41 A;  1O7N B;  4XDW A;  1FUW A;  3RGA A;  3T0U A;  3X3X A;  1NB3 I;  1TP6 A;  1NJI 4;  3NX0 A;  5DRV A;  1VQN 3;  5KP4 A;  4HZ9 B;  3BNE A;  3LYG A;  2XFS A;  2CFG A;  3CCR 3;  1IQX A;  1JN5 B;  1UW1 A;  5LC6 A;  1AVL A;  1E3R A;  1W2B 2;  3CME 3;  1D6Z A;  2ZDJ A;  2HMO B;  3EC9 A;  4BTX A;  1A2K A;  3A76 A;  3OV4 A;  5IG5 A;  1YIT 3;  5EQL A;  3HZP A;  4FMA A;  2CWU A;  5DRE A;  3CCQ 3;  2RCD A;  3O8Y A;  3F9S A;  1UI8 A;  5CK6 A;  1ULJ B;  1VQK 3;  1YJN 3;  1LVN A;  2BNG A;  2XSH B;  1NDO B;  4R4K A;  3MYT A;  1KD1 4;  5IEO A;  5AEW B;  3WMD A;  3F40 A;  3VF1 A;  2RFR A;  4GB5 A;  4EV2 A;  3X3Z A;  2INX A;  3FGY A;  1OUN A;  3DXO A;  2Y74 A;  2IUK A;  4WWU C;  1VQ7 3;  3SED A;  3AMO A;  3NUV A;  3JUQ A;  4FMB A;  4IPB A;  3OWY A;  4LEH A;  1WTH A;  4HM5 B;  1YI2 3;  4N6T A;  5IER A;  3F7S A;  3PYJ A;  1SQW A;  3CCM 3;  2CHC A;  1KWI A;  5A0O B;  1E97 A;  5AIH A;  1STD A;  2QA4 3;  4MMX B;  3CMA 3;  1RN7 A;  3GZY B;  2P0M A;  4FR9 A;  1N8Q A;  3ECF A;  2CIU A;  2GXF A;  4RBN A;  4R80 A;  3EB8 A;  5AEU B;  4N6N B;  1N5H A;  3UJM A;  3CCL 3;  3LTA A;  1SII A;  1UI7 A;  2ML5 A;  1T5Y A;  4EYC A;  4N6L A;  5D82 A;  3X40 A;  2WOH A;  3PZW A;  1NB5 I;  2IA7 A;  3FF0 A;  2BMR B;  2JDI H;  2GEX A;  3EN8 A;  3G8Z A;  4KFD A;  4R9K A;  2E2T A;  4NHF A;  4BTW A;  3NBR A;  3G71 3;  3CU3 A;  4RZM A;  5D83 A;  3DGO A;  3HIG A;  3FZW A;  3V92 A;  4N6V 0;  3VGN A;  2GEY A;  3DMC A;  3LT8 A;  1VQ9 3;  2OQE C;  3WOF B;  1MOL A;  3RDE A;  5IEP A;  1JKG B;  4K61 A;  3NXJ A;  1VQM 3;  2FNQ A;  1U5O A;  5IG0 A;  2WGQ A;  3KZT A;  1ZO2 A;  1IVU A;  3EHC A;  2XEP A;  3BND A;  3WA2 X;  3LTC A;  3T8N A;  3OWU A;  1WMP A;  3K9M C;  8CHO A;  3KSE D;  5CLK A;  4BTY A;  2E2V A;  2ZL8 A;  2F98 A;  1SIH A;  2A15 A;  2STD A;  1ASK A;  4K1V A;  1IT8 A;  3DUK A;  3LTD A;  1STF I;  1W02 A;  3WDG B;  2GBX B;  2E2U A;  5CXO A;  2W56 A;  4EV5 A;  4HZB B;  1N8R 4;  3STD A;  3QK9 A;  3KE7 A;  4HBR A;  2OTL 3;  3K63 A;  1QAK A;  2P38 A;  1NU3 A;  2O9U X;  4EXR A;  1VQ6 3;  1K8A 4;  3DGM A;  2BO9 B;  2WOF A;  4PEJ A;  5JPP A;  1OF5 B;  4OVM A;  2XR8 B;  3I0Y A;  1QVG 2;  2CFK A;  5FGO A;  5CF2 A;  1VZZ A;  2BT3 A;  1Y4K A;  4JRF A;  1GY7 A;  3HX8 A;  2IUJ A;  2D42 A;  5AIF A;  4HM1 B;  2XH9 A;  3IMA B;  3ROB A;  4HM7 B;  4WYK B;  3N54 B;  4KVH A;  3EF8 A;  5TGN A;  2RGQ A;  3X42 A;  2KXG A;  3B4P A;  3BNB A;  3DY5 A;  3NBJ A;  1DVD A;  3G16 A;  4MEI A;  2F99 A;  4G1M B;  1AV4 A;  4HM3 B;  1HU9 A;  3SXX A;  2XGL A;  5G2G A;  2CFD A;  1VQ8 3;  1GS3 A;  1W01 A;  2B1X B;  2CWV A;  4L8O A;  3Q90 A;  5HGR A;  1Q40 A;  3EBY A;  3GRD A;  4I4K A;  3S67 A;  1K41 A;  1O7G B;  1E3V A;  4MMY B;  1ROA A;  2YX9 A;  1MNL A;  2P05 A;  3FG4 A;  3CC4 3;  2YFL B;  1IDP A;  3KN4 A;  3E99 A;  4TX4 A;  3EJV A;  1GD3 A;  3MPH A;  4FMC A;  3KII A;  4H3U A;  4QWT A;  3EE1 A;  1OHP A;  3FSD A;  1OAC A;  2LQV A;  1K28 A;  3G4S 3;  1Q7Y 4;  5STD A;  3NQY A;  4XDV A;  2FXT A;  1L5G B;  1Z1S A;  1YGE A;  3NQZ A;  4N6U A;  3H3H A;  4AKY A;  3LT9 A;  4R9L A;  4X2H A;  1FGO A;  1DMQ A;  2MF7 A;  1NWW A;  3U97 A;  4H61 A;  3Q2P A;  4N6O B;  3FKA A;  2BMO B;  1W6G A;  1GY5 A;  2QGU A;  1VQO 3;  3I56 3;  2YFJ B;  4HM2 B;  3BNC A;  5JBS A;  1LXE A;  1JNQ A;  3PGB A;  1JB2 A;  3PXM A;  2UX0 A;  4WHA A;  1A90 A;  3FH1 A;  3H51 A;  3WOD G;  3LZA A;  2CW9 A;  2CG1 A;  1YJ9 3;  1W2Z A;  4XM4 A;  2I9W A;  1D6U A;  3F7X A;  3S5C A;  6STD A;  3FG1 A;  1M9G A;  2LYX A;  2WO0 A;  3WOE B;  2PNC A;  1Q82 4;  2OTJ 3;  1VQP 3;  3FLJ A;  4N3V A;  3VSY A;  4J8T A;  5IW9 A;  1VQ4 3;  3JUP A;  3NHX A;  4HVN A;  3DGL A;  2C10 A;  3LXU X;  2W0Q A;  4N6M A;  3X3Y A;  1IT7 A;  3SOA A;  1W6C A;  1SJW A;  3JVC A;  2CK3 H;  2R4I A;  4O2H A;  5IEN A;  2OOV A;  3SVA A;  2Z77 A;  1O7M B;  3I55 3;  1KQS 2;  1EA2 A;  3DZL A;  1UUV B;  1WQL B;  1R4C A;  2JQ5 A;  4MMZ B;  1OGZ A;  5ELU A;  3UL6 A;  1K9M 4;  1ULI B;  2XSO B;  2KRT A;  2M7O A;  3HK4 A;  4GL6 A;  4JF8 A;  4LSO A;  3FCS B;  1IV9 A;  1OHO A;  1RJO A;  5AII A;  3NV0 A;  2Q07 A;  3DM8 A;  1IVX A;  1OF5 A;  5D81 A;  1AR0 A;  3N9H A;  2GBW B;  3B4O A;  1TIJ A;  1EG9 B;  4AEQ A;  1K73 4;  1CYU A;  1UUW B;  1YIJ 3;  2W04 A;  3MG3 A;  3CC7 3;  3CNX A;  3D3L A;  4EC6 A;  4Q53 A;  3G6E 3;  3OXA A;  4HJL B;  2MC8 A;  5IG4 A;  2GU1 A;  3FF2 A;  1IV7 A;  4WYK A;  2OWP A;  3LOY A;  5BXQ A;  2HMM B;  1J2B A;  1FGQ A;  4O8S A;  2CFW A;  3PCR A;  3CPW 2;  1FGM A;  1GYB A;  4XBY A;  5LC7 A;  2HMJ B;  1GY6 A;  1OPY A;  3CPO A;  3OW2 2;  1LNH A;  1C7H A;  4KZ1 A;  1JN5 A;  1W7C A;  1QAF A;  4XB5 A;  2XGN A;  2Z7A A;  3GZR A;  3QRD A;  4K90 B;  2C11 A;  2CG0 A;  4KFF A;  1M1X B;  1OHS A;  1LOX A;  3LTB A;  5AI1 A;  3IPT A;  1BUQ A;  3L0R A;  5JPU A;  3N8B A;  1NO3 A;  4CCV A;  1S72 3;  1YVB I;  4IT7 A;  1IVV A;  1DYU A;  3PCS A;  3GZB A;  3M8C A;  1KSI A;  1W00 A;  2SBL A;  5AYS C;  1G96 A;  1GD4 A;  4FMD A;  4WP5 A;  5CF1 A;  2FGT A;  2B24 B;  3NBB A;  3GWR A;  5AIG A;  2Z6B A;  1W5Z A;  2WGO A;  3MWZ A;  4HYZ A;  7STD A;  4CDL A;  5EEO A;  3Q1C A;  4HKV B;  1QVF 2;  3MKI A;  3MHE A;  3LH4 A;  2O3O A;  1D6Y A;  1Q42 A;  2W03 A;  1JB5 A;  3BLZ A;  1ISK A;  3V99 A;  4LMI A;  4FCJ A;  4STD A;  3D9R A;  4O3V A;  3MSO A;  3GAX A;  4RNZ A;  3ALA A;  3JUM A;  2Z76 A;  2YFI B;  2D1W A;  1IQ8 A;  4OK0 A;  4LZI A;  3DGN A;  1O7W B;  3T8U A;  1YHQ 3;  1IU7 A;  1US1 A;  3SLU A;  1SPU A;  3JUO A;  1WMO A;  4IIA A;  4O02 B;  3F8X A;  1OCV A;  1IK3 A;  1F8N A;  2ML6 A;  3CCV 3;  4R1K A;  1DMN A;  2F86 B;  4ZM8 A;  3K0Z A;  4HM8 B;  1YJW 3;  1FA3 A;  1RRH A;  4U13 A;  4XBT A;  1N9J A;  1A67 A;  3S29 A;  3MG1 A;  4NRE A;  1Q40 B;  3JUN A;  1JV2 B;  5EVH A;  3NM7 A;  4HM6 B;  3F14 A;  1TFK A;  3RGR A;  4ORL A;  1N9E A;  3CD6 3;  3UNL A;  1WMN A;  4EBG A;  4K1U A;  1Q86 4;  1W6Y A;  1VQ5 3;  2XF3 A;  2OCT A;  1O7P B;  3HII A;  3LML A;  4L8P A;  5AYR B;  1FGT A;  3U1W A;  1JKG A;  3WA3 A;  3S27 A;  2OOV C;  2L4V A;  4RNY A;  4LGQ A;  3AMO B;  4WFO A;  2HMN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...