3FGYA

Crystal structure of a ntf2-like protein (bxe_b1094) from burkholderia xenovorans lb400 at 1.59 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
GMSTQENVQIVKDFFAAMGRGDKKGLLAVSAEDIEWIIPGEWPLAGTHRGHAALAALLQKASEMVEISYPEPPEFVAQGERVLVVGFATGRVKSTNRTFEDDWVFAITVRKSKVTSIREYIDTLALARATNFNAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function. (YP_554211.1) from BURKHOLDERIA XENOVORANS LB400 at 1.59 A resolution
rcsb
source organism Burkholderia xenovorans lb400
molecule tags Unknown function
total genus 38
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3fgyA00
3T8NA 4XDVA 5IG4A 3G0KA 5AIIA 3FLJA 3GZRA 3JUQA 1GY6A 3DUKA 3M8CA 3B8LA 3H3HA 3EBTA 4Q53A 3NUVA 5KP1A 5AIHA 4WWUC 4WYKB 2BNGA 1GYBA 4U13A 2UX0A 3OXAA 4K1VA 5CF2A 5IERA 3SOYA 4HM3B 4HZBB 2BMQB 1UUVB 3E99A 4FCMA 2GBXB 3B7CA 3NBRA 8CHOA 5KP3A 1QMAA 4HM4B 3MKIA 3FKAA 1O7WB 3EX9A 1GY7A 3EN8A 1HKXA 4OUQA 1JN5A 3FF0A 5EVHA 1OF5B 1BUQA 3NXJA 5FW5A 1S5AA 4LGQA 3GZYB 1ZX2A 1NDOB 1DMMA 3OWYA 4WP5A 3ER7A 1OHSA 1ASKA 3S5CA 3F8XA 1OGXA 1W02A 1OH0A 3F7SA 1Q40B 2HMMB 2QIYA 1GS3A 3RGRA 3OV4A 3JUNA 2F86B 2XRXB 4R1KA 2K54A 4HM2B 3VGNA 2GBWB 5IG5A 2INXA 5JPUA 6STDA 3EF8A 4XDWA 4HZ9B 3JUPA 2HMLB 4H3UA 3MG1A 3CNMA 3KKGA 3HZPA 2HMNB 3OWUA 1Z1SA 3LYGA 2HMKB 1O7PB 5D81A 2F99A 2XSHB 5CK6A 2RFRA 5AEUB 3KSPA 3GRDA 4HVNA 3NM2A 1O7HB 1ZO2A 4X2OA 2QGUA 4XB5A 3OWSA 2IMJA 1AR0A 3K0ZA 1DMNA 4HM5B 1JB2A 2YFJB 5DRVA 1EG9B 2PZVA 5TGNA 2I9WA 3MSOA 5STDA 2YFLB 3F7XA 4KVHA 3FF2A 1E97A 1A2KA 4CDLA 4J8TA 3GZXB 3D9RA 1E3VA 3EN1B 2HMOB 3EC9A 1JKGB 7STDA 3K7CA 1Q42A 1UUWB 1OCVA 1ULIB 3NHXA 2B24B 4WYKA 4XBYA 3DXOA 4I4KA 3B4PA 4HKVB 2STDA 3DMCA 4R9LA 1GY5A 5IENA 4HM6B 5AI1A 1QJGA 1NWWA 2RCDA 1ISKA 3HX8A 2BMRB 3FZWA 5IF6A 3SOAA 4IIAA 5CLKA 5IG3A 3F14A 3FH1A 2CKFB 1W6YA 3BB9A 5AEWB 1OF5A 2XSOB 3EBYA 4MJDA 1K41A 3JUMA 1JKGA 3MG3A 5IEOA 3G16A 1IDPA 4GB5A 3CU3A 3UNLA 3KZTA 1JN5B 3MYTA 1E3RA 1Q40A 1SJWA 2CHCA 2R4IA 3B4OA 3OX9A 3RGAA 3A76A 2W2CA 2BMOB 1O7MB 4ORLA 4R9KA 5HGRA 3Q90A 3EHCA 3CPOA 4RZMA 5AIGA 4HM7B 3F8HA 2Z7AA 1W01A 4STDA 2XR8B 2Z76A 5BXQA 3G8ZA 1OPYA 3UJMA 5CF1A 2B1XB 1OGZA 5AIFA 3T8UA 1STDA 4K1UA 4HJLB 3VSYA 5BVBA 4N3VA 1TUHA 4HM8B 1TP6A 3LZAA 2OWPA 1WQLB 1O7NB 5DREA 3DM8A 1JB4A 1VZZA 2A15A 3WMDA 1C7HA 3NV0B 3H51A 3MG2A 1EA2A 4LMIA 3F40A 3JUOA 4XBXA 4L8PA 5KP4A 3CNXA 1OUNA 3GZBA 3FGYA 5IEPA 5CXOA 1CQSA 3I0YA 3F9SA 4X2HA 3GWRA 3HK4A 4OVMA 1NU3A 4XM4A 4XBTA 3FSDA 3BLZA 2Z77A 1OHOA 5D83A 5D82A 5JPPA 2HMJB 2GEXA 3STDA 3ECFA 4J9AA 3EJVA 3SEDA 2YFIB 4L8OA 3DZLA 1OHPA 1JB5A 2GXFA 4FCJA 3KE7A 4HM0B 2F98A 1W00A 1O7GB 3NV0A 3ROBA 5G2GA 2RGQA 4LEHA 4HM1B 4PEJA 1DMQA 4L7KA 2JQ5A 2GEYA 1ULJB 5IG0A 3IPTA 3MHEA 3EQQB 1U5OA
chains in the Genus database with same CATH superfamily
2AAEA 3PXMA 4BIRA 3T8NA 4XDVA 3U1WA 2ZL8A 2E2UA 5IG4A 3G0KA 5AIIA 2LYXA 3FLJA 1WNHA 2F5WA 3SLUA 3GZRA 3JUQA 1W2ZA 1GY6A 4EBGA 3DUKA 2KXGA 3CCS3 3AGOA 2BO9B 3M8CA 3FG3A 1I8VA 3AGNA 3B8LA 4LSOA 3UL5A 3H3HA 4GHOA 2CG1A 3CME3 1QAKA 3EBTA 4DKIA 2UUGC 4TX4A 4Q53A 1RMSA 3NUVA 1BOXA 4NPBA 5KP1A 1BNFA 5AIHA 3AHSA 4WWUC 3SXXA 4WYKB 2CC3A 3IMAB 2BNGA 1GYBA 1X1YA 1LOVA 3SVAA 5HOHA 2IUKA 1LXEA 4MMXB 4U13A 5M1AA 4EYCA 5IW9A 1SARA 2H0GA 1B2XA 1TJDA 2BU4A 2UX0A 2W56A 1JBRA 3OXAA 4K1VA 2F4YA 2OTL3 1DE3A 3FCSB 4MEIA 1I2EA 5CF2A 3KN4A 4O8SA 3KFQC 5IERA 1IV9A 1G0TA 1BIRA 1M1K4 2GSPA 1RRHA 2W6JH 3SOYA 1MOLA 4HM3B 1MWUA 5JBSA 4HZBB 2BMQB 3X42A 1FW7A 1RGGA 2CIUA 1US1A 1BRIA 1N8QA 1UUVB 3DGOA 1MGRA 3S28A 3E99A 1JBTA 1IQ8A 4FCMA 2W0QA 1N9EA 2GBXB 3BIRA 1RHLA 2KF5A 1ZS7A 1RTUA 1KQS2 1PYLA 3A5EA 1TFOA 2R41A 3B7CA 3U97A 3NBRA 8CHOA 5KP3A 1QMAA 4HM4B 3MKIA 4K90B 3FKAA 1IQXA 1O7WB 3EX9A 2KF3A 6GSPA 3HIGA 1GY7A 3EN8A 1V58A 1HKXA 2H0IA 2WOFA 9RNTA 4OUQA 1RSNA 1JN5A 3FF0A 3K63A 3FG4A 5EVHA 1YIT3 1OF5B 1BUQA 1N5HA 3NXJA 5FW5A 3ALAA 1LOXA 2CFWA 4FMCA 1S5AA 3DGMA 1BRGA 3LMLA 1Q824 1BUJA 2CG0A 3K5TA 1M904 4LGQA 2IA7A 2Y74A 1WTHA 3GZYB 1ZX2A 1NDOB 1DMMA 1FZUA 1UDII 1IVWA 3OWYA 4WP5A 3ER7A 3D79A 4CPKA 1OHSA 1ASKA 1RN7A 1V57A 3FG1A 2K3DA 3WR2A 3S5CA 1FGMA 3F8XA 1UCIA 1X1UA 1OGXA 1BNRA 4RBNA 1W02A 1OH0A 1TFKA 2P38A 1T2HA 3F7SA 4KFFA 1I0XA 1JZOA 1V74A 1FGTA 1Q40B 1FGQA 1W2B2 1A2VA 4BTYA 1IU7A 1LNIA 3V99A 2HMMB 2QIYA 3S67A 1RRLA 1GS3A 1RGFA 3LXUX 3RGRA 3OV4A 4ILFA 1IYYA 1SPUA 3JUNA 3BNBA 1STFI 1UCJA 2F86B 3KSED 4HAAA 2XRXB 4R1KA 6RNTA 4N6OB 2QEX3 2CK3H 2K54A 1MWRA 4HM2B 3VGNA 3TDGA 2CFLA 1B21A 2GBWB 5IG5A 4LYLB 1B2SA 2INXA 3CC73 5JPUA 6STDA 3EF8A 3ZG5A 1R4CA 3NQYA 1EKMA 2CFDA 2XGNA 4XDWA 5GSPA 2BHMA 3RDEA 1B3SA 1KSIA 4BTXA 4G1MB 4HZ9B 1RNBA 1LOYA 3DGNA 3LTDA 1FGOA 2BT3A 1WMOA 3JUPA 3S27A 2HMLB 4H3UA 3MG1A 3CNMA 3NBBA 3KKGA 3HZPA 1BRJA 1BNIA 1BRKA 1K28A 5FGOA 3ZFZA 7RNTA 1VQ73 4J5GA 2HMNB 1FYSA 3OWUA 1K9M4 2C11A 1YGWA 1Z1SA 2O9UX 4IPBA 3LYGA 2HMKB 1O7PB 2FNQA 1LVNA 3L0RA 1W7CA 3J7Yd 2JDIH 4KFEA 3DH2A 5D81A 4CCVA 4AKYA 1UCLA 2F99A 2OCTA 2XSHB 1VQM3 5CK6A 1EUIC 3LT9A 1FA3A 2RFRA 3LTAA 1GOYA 3N9HA 5M19A 5AEUB 1UW1A 1WMNA 2K0MA 1VQ43 2YX9A 1RNTA 1IVUA 3BU4A 4BL2A 3KSPA 1JBSA 1FUTA 3GRDA 1KD14 1NB3I 4HVNA 3NM2A 1O7HB 1MWSA 5M18A 3KCHA 1RGLA 1ZO2A 3CD63 4X2OA 3CXC2 2QGUA 1MNLA 4XB5A 1DETA 2L4VA 2IMJA 3OWSA 8RNTA 1AR0A 5BIRA 2V1LA 1GMPA 3GSPA 3K0ZA 3BNDA 2E2VA 1DMNA 2KRTA 3MPHA 2CWUA 4K61A 4FMAA 4HM5B 3WA3A 2M7OA 4R80A 1BSDA 3JVCA 1BGSA 3CCM3 2F56A 1JB2A 1CYVA 2YFJB 5DRVA 1TIJA 1EG9B 2PZVA 5TGNA 2I9WA 3MSOA 1OACA 5STDA 1RN4A 2L1SA 1IT7A 1BNGA 2YFLB 3F7XA 5ELUA 2ZA4A 2WGQA 3UL6A 3MWZA 1A2PA 2XGLA 4KVHA 1F8NA 4N6TA 2E2TA 1YJN3 3K9MC 1TU5A 1IVXA 4MMZB 2WOHA 3FF2A 1E97A 1VQO3 2UGIA 1A2KA 1VQ63 4CDLA 4N6MA 1VQ83 4NHFA 1K8A4 1MWTA 4J8TA 3DY5A 1YVBI 3PS8A 2IUJA 2C10A 4EXRA 1IV7A 3GZXB 1D6UA 3IJEB 4RNZA 4BU4A 4HYZA 3EB8A 1AVKA 2CWTA 1SIHA 3D9RA 4QWTA 3CCJ3 1E3VA 3CCL3 1X1WA 3AHWA 1VQL3 3EN1B 1DYUA 3V92A 1I3FA 2HMOB 1TRQA 1EQKA 3EC9A 2FGTA 2KF4A 2IYJA 3D3LA 4CJNA 1I3IA 1RCLA 4FMDA 2SBLA 1BSBA 1JKGB 7STDA 1PY3A 3K7CA 1JNQA 5I97A 1N8R4 1Q42A 4MMYB 4O02B 1BRNL 1UUWB 1OCVA 5LC6A 3WA2X 1VQQA 1BNEA 1ULIB 3NHXA 5ELJA 1LQMB 2B24B 2FXTA 2GU3A 4WYKA 4XBYA 2P0MA 4RNTA 3DGYA 3CCV3 1QVG2 1RGAA 4N6NB 1VQP3 1UGIA 1M1XB 1TRPA 1AY7A 3X41A 3X3YA 1IK3A 1RKYA 3LTBA 4KZ1A 3BNEA 3HI7A 3DXOA 4I4KA 7GSPA 3T0UA 3B4PA 1YJW3 4HKVB 1K734 5G1LA 1B20A 2STDA 3DMCA 1GY5A 2CFKA 4R9LA 5IENA 1YGEA 1ZGXA 1EEJA 2GU1A 4HM6B 1CYUA 5AI1A 1UCKA 1RLSA 1QJGA 2W9QA 4KFDA 1NWWA 1YHQ3 1T5YA 2RCDA 3PCRA 4JRFA 1GOVA 3HX8A 3QK9A 2BIRA 2BMRB 3N54B 1BRHA 3UB1A 1ISKA 3FZWA 1ROVA 5IF6A 3SOAA 1Q7HA 5EEOA 1GD4A 4IIAA 3WOEB 5CLKA 3CCE3 5IG3A 1LRAA 3F14A 2W56B 1W4NA 2AADA 2Y73A 1Y4KA 4AKZA 1BNJA 1Q9EA 1YVSA 3FH1A 1GOUA 2CKFB 1T3BA 1W6YA 3BB9A 1G96A 1BSAA 5AEWB 1OF5A 1CEWI 1RGKA 2P0XA 3N8BA 2XSOB 3EBYA 4MJDA 1VQ53 4GSPA 3O8YA 4RNYA 1RGCA 4FCZA 1K41A 3JUMA 4H61A 5G1KA 1VQN3 2CH9A 1JZDA 2OQEC 1HZ1A 1WMPA 1JKGA 1RJOA 1PFPA 3MG3A 5AYSC 5IEOA 1Q7Y4 1BAOA 1BU4A 3D5GA 2F5MA 1JV2B 3G16A 2XF3A 4AEQA 4BTWA 1IDPA 4KT3B 1QALA 3G713 2Q07A 3CU3A 4GB5A 1AV4A 1NO3A 1UGHI 1UI8A 2XEPA 3UNLA 3I563 1AVLA 2XFTA 2CFGA 3KZTA 5EQLA 3D4AA 1JN5B 1RDSA 4FMBA 3MYTA 4N6UA 4J5KA 1RGEA 1AQZA 1LNHA 1U8CB 1E3RA 1MGWA 1Q40A 1SJWA 2CHCA 2MF7A 1GMQA 1T2IA 1A67A 3NM7A 4EW5A 3QRDA 2R4IA 1IT8A 3B4OA 3OX9A 1YJ93 3RGAA 2ZDJA 1NB5I 5BU4A 2D1WA 2KAAA 3EE1A 4BL3A 1B2MA 2OOVC 3A76A 2W2CA 2BMOB 1O7MB 1GSPA 2W03A 3LT8A 4ORLA 4R9KA 2OQEA 5HGRA 1Q814 3Q90A 3EHCA 3X3XA 1IQYA 4JF8A 3LOYA 3CPOA 4RZMA 5AIGA 4HM7B 3F8HA 3NQZA 4O3VA 2Z7AA 1C54A 1W01A 4STDA 3V98A 2XR8B 2Z76A 2RSXA 5BXQA 3CCQ3 2RNTA 3G8ZA 1D6ZA 2H0HA 3Q1CA 1VQK3 1S723 1J2BA 1OPYA 3NX0A 3UJMA 5CF1A 2W04A 3PCSA 2WGOA 3NBJA 2B1XB 2XFSA 1OGZA 1IVVA 1RCKA 3WDGB 5AIFA 3T8UA 2ML5A 2O3OA 2KF6A 1STDA 1FUSA 4K1UA 3G4S3 4EV5A 4HJLB 3VSYA 5BVBA 1G02A 1HU9A 2QA43 4N3VA 2C4BA 4WFOA 1TUHA 4HM8B 4I5QA 1TP6A 2D42A 2OOVA 3LZAA 2OWPA 1Q864 1YI23 1WQLB 3LTCA 1O7NB 3VF1A 2CWVA 3BNCA 5DREA 2CW9A 3DM8A 3ZG0A 1JB4A 1DVDA 1D6YA 1VZZA 2A15A 3WMDA 1C7HA 1KWIA 3NV0B 1I2GA 3WHOA 2KCDA 2ML6A 1U5OA 1RGHA 4N6V0 4ZM8A 1N9JA 3PGBA 1UUGB 1W6GA 3H51A 1EA2A 1DVCA 3MG2A 1FGRA 3F40A 4LMIA 4O2HA 2P09A 2Z6BA 4LZIA 3JUOA 1B2ZA 4XBXA 4L8PA 1YNVX 3D5IA 1JJ22 3URPA 1BSCA 3CC43 2LQVA 5KP4A 1ROAA 3AMOB 3SX1A 2WO0A 4FR9A 3CNXA 1NNVA 3Q3FA 1SIIA 1UI7A 1OUNA 3GZBA 3FGYA 5IEPA 1B2UA 5CXOA 3DGLA 1CQSA 1W5ZA 3I0YA 1B27A 3F9SA 1W6CA 3GWRA 4X2HA 3I553 2RBIA 5A0OB 3HK4A 4OVMA 1NU3A 4XM4A 4HBRA 3PZWA 2P05A 4XBTA 3FSDA 3BLZA 2IY2A 1GD3A 2Z77A 3WOFB 1OHOA 4EC6A 5D83A 5D82A 5JPPA 1BRSA 2CX1A 4EV2A 1NJI4 1QAFA 2HMJB 2GEXA 4WHAA 4NREA 3STDA 1FUWA 2HOHA 1BSEA 4OK0A 1A90A 3X3ZA 3HIIA 2CX0A 2J8XB 1QVF2 3ECFA 1GMRA 1PU4A 2PNCA 1I2FA 3PYJA 3X40A 4J9AA 3EJVA 3SEDA 3G6E3 3GAXA 4GL6A 1M9GA 1SQWA 2YFIB 1YIJ3 3OW22 4IT7A 4L8OA 3DZLA 3CCU3 1VQ93 2XH9A 1JB5A 1OHPA 2GXFA 4FCJA 3KE7A 3CCR3 3HOHA 4HM0B 3LH4A 2F98A 3WODG 1RN1A 1CH0A 1W00A 1L5GB 4N6LA 1O7GB 3KIIA 3NV0A 3ROBA 2W9PA 5G2GA 2RGQA 5RNTA 1I70A 2OTJ3 4HOHA 1LOWA 1JRQA 4HM1B 4LEHA 4PEJA 1BANA 1LQGC 1DMQA 1R4YA 3S29A 4L7KA 2JQ5A 2GEYA 1ULJB 3CMA3 3CC23 5IG0A 1KC84 3IPTA 2ZHXB 3AMOA 5AYRB 4R4KA 1I0VA 1HYFA 1N5PA 3MHEA 2MC8A 3SYUA 3CPW2 1BVIA 3RNTA 5LC7A 3EQQB 2SARA 1BNSA 3Q2PA 1TTOA 1X1XA
chains in the Genus database with same CATH topology
3PXMA 3T8NA 4XDVA 3U1WA 2ZL8A 2E2UA 5IG4A 3G0KA 5AIIA 2LYXA 3FLJA 1WNHA 3SLUA 3GZRA 3JUQA 1W2ZA 1GY6A 4EBGA 3DUKA 2KXGA 3CCS3 4LSOA 2BO9B 3M8CA 3FG3A 3B8LA 3UL5A 3H3HA 2CG1A 3CME3 1QAKA 3EBTA 4TX4A 4Q53A 3NUVA 5KP1A 5AIHA 4WWUC 3SXXA 4WYKB 2CC3A 3IMAB 2BNGA 1GYBA 3SVAA 2IUKA 1LXEA 4MMXB 4U13A 4EYCA 5IW9A 2W56A 2UX0A 3OXAA 4K1VA 2OTL3 3FCSB 4MEIA 5CF2A 3KN4A 4O8SA 3KFQC 5IERA 1IV9A 1M1K4 3SOYA 1RRHA 2W6JH 1MOLA 4HM3B 5JBSA 4HZBB 2BMQB 3X42A 2CIUA 1US1A 1N8QA 1UUVB 3DGOA 3S28A 3E99A 1IQ8A 4FCMA 2W0QA 1N9EA 2GBXB 1KQS2 1TFOA 3B7CA 3U97A 3NBRA 8CHOA 5KP3A 1QMAA 4HM4B 3MKIA 4K90B 3FKAA 1IQXA 1O7WB 3EX9A 3HIGA 1GY7A 3EN8A 1HKXA 2WOFA 4OUQA 1JN5A 3FF0A 3K63A 3FG4A 5EVHA 1YIT3 1OF5B 1BUQA 1N5HA 3NXJA 5FW5A 3ALAA 1LOXA 2CFWA 4FMCA 1S5AA 3DGMA 3LMLA 1Q824 2CG0A 3K5TA 1M904 4LGQA 2IA7A 2Y74A 1WTHA 3GZYB 1ZX2A 1NDOB 1DMMA 1IVWA 3OWYA 4WP5A 3ER7A 1OHSA 1ASKA 1RN7A 3FG1A 3S5CA 1FGMA 3F8XA 1OGXA 4RBNA 1W02A 1OH0A 1TFKA 2P38A 3F7SA 4KFFA 1V74A 1FGTA 1Q40B 1FGQA 1W2B2 1A2VA 4BTYA 1IU7A 3V99A 2HMMB 2QIYA 3S67A 1RRLA 1GS3A 3LXUX 3RGRA 3OV4A 1SPUA 3JUNA 3BNBA 1STFI 2F86B 3KSED 2XRXB 4R1KA 4N6OB 2QEX3 2CK3H 2K54A 4HM2B 3VGNA 3TDGA 2CFLA 2GBWB 5IG5A 2INXA 3CC73 5JPUA 6STDA 3EF8A 1R4CA 3NQYA 1EKMA 2CFDA 2XGNA 4XDWA 2BHMA 3RDEA 1KSIA 4BTXA 4G1MB 4HZ9B 3DGNA 3LTDA 1FGOA 2BT3A 1WMOA 3JUPA 3S27A 2HMLB 4H3UA 3MG1A 3CNMA 3NBBA 3KKGA 3HZPA 1K28A 5FGOA 1VQ73 2HMNB 3OWUA 1K9M4 2C11A 1Z1SA 2O9UX 4IPBA 3LYGA 2HMKB 1O7PB 2FNQA 1LVNA 3L0RA 1W7CA 3J7Yd 2JDIH 4KFEA 5D81A 4CCVA 4AKYA 2F99A 2OCTA 2XSHB 1VQM3 5CK6A 3LT9A 1FA3A 2RFRA 3LTAA 3N9HA 5AEUB 1UW1A 1WMNA 2K0MA 1VQ43 2YX9A 1IVUA 3KSPA 3GRDA 1KD14 1NB3I 4HVNA 3NM2A 1O7HB 3CD63 1ZO2A 4X2OA 3CXC2 2QGUA 1MNLA 4XB5A 3OWSA 2L4VA 2IMJA 1AR0A 2V1LA 3K0ZA 3BNDA 2E2VA 1DMNA 2KRTA 3MPHA 2CWUA 4K61A 4FMAA 4HM5B 3WA3A 2M7OA 4R80A 3JVCA 3CCM3 1JB2A 1CYVA 2YFJB 5DRVA 1TIJA 1EG9B 2PZVA 5TGNA 2I9WA 3MSOA 1OACA 5STDA 2YFLB 5ELUA 1IT7A 3F7XA 3UL6A 2WGQA 3MWZA 2XGLA 4KVHA 1F8NA 4N6TA 2E2TA 1YJN3 3K9MC 1TU5A 1IVXA 4MMZB 2WOHA 3FF2A 1E97A 1VQO3 1A2KA 1VQ63 4CDLA 4N6MA 1VQ83 4NHFA 1K8A4 4J8TA 3DY5A 1YVBI 3PS8A 2IUJA 2C10A 4EXRA 1IV7A 3GZXB 1D6UA 3IJEB 4RNZA 4HYZA 3EB8A 1AVKA 2CWTA 1SIHA 3D9RA 4QWTA 3CCJ3 1E3VA 3CCL3 1VQL3 3EN1B 1DYUA 3V92A 2HMOB 1EQKA 3EC9A 2FGTA 3D3LA 4FMDA 2SBLA 1JKGB 7STDA 3K7CA 1JNQA 5I97A 1N8R4 1Q42A 4MMYB 4O02B 1UUWB 1OCVA 5LC6A 3WA2X 1ULIB 3NHXA 5ELJA 2B24B 2FXTA 2GU3A 4WYKA 4XBYA 1QVG2 2P0MA 3CCV3 4N6NB 1VQP3 1M1XB 3X41A 3X3YA 1IK3A 1RKYA 3LTBA 4KZ1A 3BNEA 3HI7A 3DXOA 4I4KA 3T0UA 3B4PA 1YJW3 4HKVB 1K734 2STDA 3DMCA 4R9LA 1GY5A 2CFKA 5IENA 1YGEA 2GU1A 4HM6B 1CYUA 5AI1A 1QJGA 2W9QA 4KFDA 1NWWA 1YHQ3 1T5YA 2RCDA 3PCRA 4JRFA 1ISKA 3HX8A 3QK9A 2BMRB 3N54B 3UB1A 3FZWA 1ROVA 5IF6A 3SOAA 5EEOA 1GD4A 4IIAA 3WOEB 5CLKA 3CCE3 5IG3A 3F14A 2W56B 1W4NA 2Y73A 1Y4KA 4AKZA 3FH1A 2CKFB 1W6YA 3BB9A 1G96A 5AEWB 1OF5A 1CEWI 2P0XA 3N8BA 2XSOB 3EBYA 4MJDA 1VQ53 3O8YA 4RNYA 4FCZA 1K41A 3JUMA 4H61A 1VQN3 2CH9A 2OQEC 1WMPA 1JKGA 1RJOA 1PFPA 3MG3A 5AYSC 5IEOA 1Q7Y4 1JV2B 3G16A 2XF3A 4AEQA 4BTWA 1IDPA 1QALA 3G713 2Q07A 3CU3A 4GB5A 1AV4A 1NO3A 2XEPA 1UI8A 3UNLA 3I563 1AVLA 2XFTA 2CFGA 3KZTA 5EQLA 1JN5B 4FMBA 3MYTA 4N6UA 1LNHA 1E3RA 1Q40A 1U8CB 1SJWA 2CHCA 2MF7A 1A67A 3NM7A 3QRDA 2R4IA 1IT8A 3B4OA 3OX9A 1YJ93 3RGAA 2ZDJA 1NB5I 2D1WA 3EE1A 2OOVC 3A76A 2W2CA 2BMOB 1O7MB 2W03A 3LT8A 4ORLA 4R9KA 2OQEA 1Q814 5HGRA 3Q90A 3EHCA 3X3XA 1IQYA 4JF8A 3LOYA 3CPOA 4RZMA 5AIGA 4HM7B 3F8HA 3NQZA 4O3VA 2Z7AA 1W01A 4STDA 3V98A 2XR8B 2Z76A 2RSXA 5BXQA 3CCQ3 3G8ZA 3Q1CA 1D6ZA 1J2BA 1VQK3 1S723 1OPYA 3NX0A 3UJMA 5CF1A 2W04A 3PCSA 2WGOA 3NBJA 2XFSA 2B1XB 1IVVA 1OGZA 3WDGB 5AIFA 3T8UA 2ML5A 2O3OA 1STDA 3G4S3 4K1UA 4EV5A 4HJLB 3VSYA 5BVBA 1HU9A 2QA43 4N3VA 4WFOA 1TUHA 4HM8B 2OOVA 1TP6A 2D42A 3LZAA 2OWPA 1Q864 1YI23 1WQLB 3LTCA 1O7NB 3VF1A 2CWVA 3BNCA 5DREA 2CW9A 3DM8A 1DVDA 1JB4A 1D6YA 1VZZA 2A15A 3WMDA 1C7HA 1KWIA 3NV0B 2KCDA 2ML6A 4N6V0 4ZM8A 1N9JA 3PGBA 1W6GA 3H51A 3MG2A 1EA2A 1DVCA 4LMIA 1FGRA 3F40A 4O2HA 2P09A 2Z6BA 4LZIA 3JUOA 4XBXA 4L8PA 1JJ22 3CC43 2LQVA 5KP4A 1ROAA 3AMOB 3SX1A 2WO0A 4FR9A 3CNXA 1SIIA 1OUNA 3GZBA 3FGYA 5IEPA 5CXOA 3DGLA 1CQSA 1W5ZA 3I0YA 3F9SA 1W6CA 3GWRA 4X2HA 3I553 5A0OB 3HK4A 4OVMA 1NU3A 4XM4A 4HBRA 3PZWA 2P05A 4XBTA 3FSDA 3BLZA 1GD3A 2Z77A 3WOFB 1OHOA 4EC6A 5D83A 5D82A 5JPPA 4EV2A 1NJI4 1QAFA 2HMJB 2GEXA 4WHAA 4NREA 3STDA 1FUWA 1A90A 4OK0A 3X3ZA 3HIIA 1QVF2 3ECFA 1PU4A 2PNCA 3PYJA 3X40A 4J9AA 3EJVA 3SEDA 3G6E3 3GAXA 4GL6A 1M9GA 1SQWA 2YFIB 1YIJ3 3OW22 4IT7A 4L8OA 3DZLA 3CCU3 1VQ93 2XH9A 1JB5A 1OHPA 2GXFA 4FCJA 3KE7A 3CCR3 4HM0B 3LH4A 2F98A 3WODG 1W00A 1L5GB 4N6LA 1O7GB 3KIIA 3NV0A 3ROBA 2W9PA 5G2GA 2RGQA 2OTJ3 4LEHA 1JRQA 4HM1B 4PEJA 1DMQA 3S29A 4L7KA 2JQ5A 2GEYA 1ULJB 3CMA3 3CC23 5IG0A 1KC84 3IPTA 3AMOA 5AYRB 4R4KA 3MHEA 1N5PA 2MC8A 3CPW2 5LC7A 3EQQB 3Q2PA 1U5OA 1UI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T8N A;  4XDV A;  5IG4 A;  3G0K A;  5AII A;  3FLJ A;  3GZR A;  3JUQ A;  1GY6 A;  3DUK A;  3M8C A;  3B8L A;  3H3H A;  3EBT A;  4Q53 A;  3NUV A;  5KP1 A;  5AIH A;  4WWU C;  4WYK B;  2BNG A;  1GYB A;  4U13 A;  2UX0 A;  3OXA A;  4K1V A;  5CF2 A;  5IER A;  3SOY A;  4HM3 B;  4HZB B;  2BMQ B;  1UUV B;  3E99 A;  4FCM A;  2GBX B;  3B7C A;  3NBR A;  8CHO A;  5KP3 A;  1QMA A;  4HM4 B;  3MKI A;  3FKA A;  1O7W B;  3EX9 A;  1GY7 A;  3EN8 A;  1HKX A;  4OUQ A;  1JN5 A;  3FF0 A;  5EVH A;  1OF5 B;  1BUQ A;  3NXJ A;  5FW5 A;  1S5A A;  4LGQ A;  3GZY B;  1ZX2 A;  1NDO B;  1DMM A;  3OWY A;  4WP5 A;  3ER7 A;  1OHS A;  1ASK A;  3S5C A;  3F8X A;  1OGX A;  1W02 A;  1OH0 A;  3F7S A;  1Q40 B;  2HMM B;  2QIY A;  1GS3 A;  3RGR A;  3OV4 A;  3JUN A;  2F86 B;  2XRX B;  4R1K A;  2K54 A;  4HM2 B;  3VGN A;  2GBW B;  5IG5 A;  2INX A;  5JPU A;  6STD A;  3EF8 A;  4XDW A;  4HZ9 B;  3JUP A;  2HML B;  4H3U A;  3MG1 A;  3CNM A;  3KKG A;  3HZP A;  2HMN B;  3OWU A;  1Z1S A;  3LYG A;  2HMK B;  1O7P B;  5D81 A;  2F99 A;  2XSH B;  5CK6 A;  2RFR A;  5AEU B;  3KSP A;  3GRD A;  4HVN A;  3NM2 A;  1O7H B;  1ZO2 A;  4X2O A;  2QGU A;  4XB5 A;  3OWS A;  2IMJ A;  1AR0 A;  3K0Z A;  1DMN A;  4HM5 B;  1JB2 A;  2YFJ B;  5DRV A;  1EG9 B;  2PZV A;  5TGN A;  2I9W A;  3MSO A;  5STD A;  2YFL B;  3F7X A;  4KVH A;  3FF2 A;  1E97 A;  1A2K A;  4CDL A;  4J8T A;  3GZX B;  3D9R A;  1E3V A;  3EN1 B;  2HMO B;  3EC9 A;  1JKG B;  7STD A;  3K7C A;  1Q42 A;  1UUW B;  1OCV A;  1ULI B;  3NHX A;  2B24 B;  4WYK A;  4XBY A;  3DXO A;  4I4K A;  3B4P A;  4HKV B;  2STD A;  3DMC A;  4R9L A;  1GY5 A;  5IEN A;  4HM6 B;  5AI1 A;  1QJG A;  1NWW A;  2RCD A;  1ISK A;  3HX8 A;  2BMR B;  3FZW A;  5IF6 A;  3SOA A;  4IIA A;  5CLK A;  5IG3 A;  3F14 A;  3FH1 A;  2CKF B;  1W6Y A;  3BB9 A;  5AEW B;  1OF5 A;  2XSO B;  3EBY A;  4MJD A;  1K41 A;  3JUM A;  1JKG A;  3MG3 A;  5IEO A;  3G16 A;  1IDP A;  4GB5 A;  3CU3 A;  3UNL A;  3KZT A;  1JN5 B;  3MYT A;  1E3R A;  1Q40 A;  1SJW A;  2CHC A;  2R4I A;  3B4O A;  3OX9 A;  3RGA A;  3A76 A;  2W2C A;  2BMO B;  1O7M B;  4ORL A;  4R9K A;  5HGR A;  3Q90 A;  3EHC A;  3CPO A;  4RZM A;  5AIG A;  4HM7 B;  3F8H A;  2Z7A A;  1W01 A;  4STD A;  2XR8 B;  2Z76 A;  5BXQ A;  3G8Z A;  1OPY A;  3UJM A;  5CF1 A;  2B1X B;  1OGZ A;  5AIF A;  3T8U A;  1STD A;  4K1U A;  4HJL B;  3VSY A;  5BVB A;  4N3V A;  1TUH A;  4HM8 B;  1TP6 A;  3LZA A;  2OWP A;  1WQL B;  1O7N B;  5DRE A;  3DM8 A;  1JB4 A;  1VZZ A;  2A15 A;  3WMD A;  1C7H A;  3NV0 B;  3H51 A;  3MG2 A;  1EA2 A;  4LMI A;  3F40 A;  3JUO A;  4XBX A;  4L8P A;  5KP4 A;  3CNX A;  1OUN A;  3GZB A;  3FGY A;  5IEP A;  5CXO A;  1CQS A;  3I0Y A;  3F9S A;  4X2H A;  3GWR A;  3HK4 A;  4OVM A;  1NU3 A;  4XM4 A;  4XBT A;  3FSD A;  3BLZ A;  2Z77 A;  1OHO A;  5D83 A;  5D82 A;  5JPP A;  2HMJ B;  2GEX A;  3STD A;  3ECF A;  4J9A A;  3EJV A;  3SED A;  2YFI B;  4L8O A;  3DZL A;  1OHP A;  1JB5 A;  2GXF A;  4FCJ A;  3KE7 A;  4HM0 B;  2F98 A;  1W00 A;  1O7G B;  3NV0 A;  3ROB A;  5G2G A;  2RGQ A;  4LEH A;  4HM1 B;  4PEJ A;  1DMQ A;  4L7K A;  2JQ5 A;  2GEY A;  1ULJ B;  5IG0 A;  3IPT A;  3MHE A;  3EQQ B;  1U5O A; 
#chains in the Genus database with same CATH topology
 2AAE A;  3PXM A;  4BIR A;  3T8N A;  4XDV A;  3U1W A;  2ZL8 A;  2E2U A;  5IG4 A;  3G0K A;  5AII A;  2LYX A;  3FLJ A;  1WNH A;  2F5W A;  3SLU A;  3GZR A;  3JUQ A;  1W2Z A;  1GY6 A;  4EBG A;  3DUK A;  2KXG A;  3CCS 3;  3AGO A;  2BO9 B;  3M8C A;  3FG3 A;  1I8V A;  3AGN A;  3B8L A;  4LSO A;  3UL5 A;  3H3H A;  4GHO A;  2CG1 A;  3CME 3;  1QAK A;  3EBT A;  4DKI A;  2UUG C;  4TX4 A;  4Q53 A;  1RMS A;  3NUV A;  1BOX A;  4NPB A;  5KP1 A;  1BNF A;  5AIH A;  3AHS A;  4WWU C;  3SXX A;  4WYK B;  2CC3 A;  3IMA B;  2BNG A;  1GYB A;  1X1Y A;  1LOV A;  3SVA A;  5HOH A;  2IUK A;  1LXE A;  4MMX B;  4U13 A;  5M1A A;  4EYC A;  5IW9 A;  1SAR A;  2H0G A;  1B2X A;  1TJD A;  2BU4 A;  2UX0 A;  2W56 A;  1JBR A;  3OXA A;  4K1V A;  2F4Y A;  2OTL 3;  1DE3 A;  3FCS B;  4MEI A;  1I2E A;  5CF2 A;  3KN4 A;  4O8S A;  3KFQ C;  5IER A;  1IV9 A;  1G0T A;  1BIR A;  1M1K 4;  2GSP A;  1RRH A;  2W6J H;  3SOY A;  1MOL A;  4HM3 B;  1MWU A;  5JBS A;  4HZB B;  2BMQ B;  3X42 A;  1FW7 A;  1RGG A;  2CIU A;  1US1 A;  1BRI A;  1N8Q A;  1UUV B;  3DGO A;  1MGR A;  3S28 A;  3E99 A;  1JBT A;  1IQ8 A;  4FCM A;  2W0Q A;  1N9E A;  2GBX B;  3BIR A;  1RHL A;  2KF5 A;  1ZS7 A;  1RTU A;  1KQS 2;  1PYL A;  3A5E A;  1TFO A;  2R41 A;  3B7C A;  3U97 A;  3NBR A;  8CHO A;  5KP3 A;  1QMA A;  4HM4 B;  3MKI A;  4K90 B;  3FKA A;  1IQX A;  1O7W B;  3EX9 A;  2KF3 A;  6GSP A;  3HIG A;  1GY7 A;  3EN8 A;  1V58 A;  1HKX A;  2H0I A;  2WOF A;  9RNT A;  4OUQ A;  1RSN A;  1JN5 A;  3FF0 A;  3K63 A;  3FG4 A;  5EVH A;  1YIT 3;  1OF5 B;  1BUQ A;  1N5H A;  3NXJ A;  5FW5 A;  3ALA A;  1LOX A;  2CFW A;  4FMC A;  1S5A A;  3DGM A;  1BRG A;  3LML A;  1Q82 4;  1BUJ A;  2CG0 A;  3K5T A;  1M90 4;  4LGQ A;  2IA7 A;  2Y74 A;  1WTH A;  3GZY B;  1ZX2 A;  1NDO B;  1DMM A;  1FZU A;  1UDI I;  1IVW A;  3OWY A;  4WP5 A;  3ER7 A;  3D79 A;  4CPK A;  1OHS A;  1ASK A;  1RN7 A;  1V57 A;  3FG1 A;  2K3D A;  3WR2 A;  3S5C A;  1FGM A;  3F8X A;  1UCI A;  1X1U A;  1OGX A;  1BNR A;  4RBN A;  1W02 A;  1OH0 A;  1TFK A;  2P38 A;  1T2H A;  3F7S A;  4KFF A;  1I0X A;  1JZO A;  1V74 A;  1FGT A;  1Q40 B;  1FGQ A;  1W2B 2;  1A2V A;  4BTY A;  1IU7 A;  1LNI A;  3V99 A;  2HMM B;  2QIY A;  3S67 A;  1RRL A;  1GS3 A;  1RGF A;  3LXU X;  3RGR A;  3OV4 A;  4ILF A;  1IYY A;  1SPU A;  3JUN A;  3BNB A;  1STF I;  1UCJ A;  2F86 B;  3KSE D;  4HAA A;  2XRX B;  4R1K A;  6RNT A;  4N6O B;  2QEX 3;  2CK3 H;  2K54 A;  1MWR A;  4HM2 B;  3VGN A;  3TDG A;  2CFL A;  1B21 A;  2GBW B;  5IG5 A;  4LYL B;  1B2S A;  2INX A;  3CC7 3;  5JPU A;  6STD A;  3EF8 A;  3ZG5 A;  1R4C A;  3NQY A;  1EKM A;  2CFD A;  2XGN A;  4XDW A;  5GSP A;  2BHM A;  3RDE A;  1B3S A;  1KSI A;  4BTX A;  4G1M B;  4HZ9 B;  1RNB A;  1LOY A;  3DGN A;  3LTD A;  1FGO A;  2BT3 A;  1WMO A;  3JUP A;  3S27 A;  2HML B;  4H3U A;  3MG1 A;  3CNM A;  3NBB A;  3KKG A;  3HZP A;  1BRJ A;  1BNI A;  1BRK A;  1K28 A;  5FGO A;  3ZFZ A;  7RNT A;  1VQ7 3;  4J5G A;  2HMN B;  1FYS A;  3OWU A;  1K9M 4;  2C11 A;  1YGW A;  1Z1S A;  2O9U X;  4IPB A;  3LYG A;  2HMK B;  1O7P B;  2FNQ A;  1LVN A;  3L0R A;  1W7C A;  3J7Y d;  2JDI H;  4KFE A;  3DH2 A;  5D81 A;  4CCV A;  4AKY A;  1UCL A;  2F99 A;  2OCT A;  2XSH B;  1VQM 3;  5CK6 A;  1EUI C;  3LT9 A;  1FA3 A;  2RFR A;  3LTA A;  1GOY A;  3N9H A;  5M19 A;  5AEU B;  1UW1 A;  1WMN A;  2K0M A;  1VQ4 3;  2YX9 A;  1RNT A;  1IVU A;  3BU4 A;  4BL2 A;  3KSP A;  1JBS A;  1FUT A;  3GRD A;  1KD1 4;  1NB3 I;  4HVN A;  3NM2 A;  1O7H B;  1MWS A;  5M18 A;  3KCH A;  1RGL A;  1ZO2 A;  3CD6 3;  4X2O A;  3CXC 2;  2QGU A;  1MNL A;  4XB5 A;  1DET A;  2L4V A;  2IMJ A;  3OWS A;  8RNT A;  1AR0 A;  5BIR A;  2V1L A;  1GMP A;  3GSP A;  3K0Z A;  3BND A;  2E2V A;  1DMN A;  2KRT A;  3MPH A;  2CWU A;  4K61 A;  4FMA A;  4HM5 B;  3WA3 A;  2M7O A;  4R80 A;  1BSD A;  3JVC A;  1BGS A;  3CCM 3;  2F56 A;  1JB2 A;  1CYV A;  2YFJ B;  5DRV A;  1TIJ A;  1EG9 B;  2PZV A;  5TGN A;  2I9W A;  3MSO A;  1OAC A;  5STD A;  1RN4 A;  2L1S A;  1IT7 A;  1BNG A;  2YFL B;  3F7X A;  5ELU A;  2ZA4 A;  2WGQ A;  3UL6 A;  3MWZ A;  1A2P A;  2XGL A;  4KVH A;  1F8N A;  4N6T A;  2E2T A;  1YJN 3;  3K9M C;  1TU5 A;  1IVX A;  4MMZ B;  2WOH A;  3FF2 A;  1E97 A;  1VQO 3;  2UGI A;  1A2K A;  1VQ6 3;  4CDL A;  4N6M A;  1VQ8 3;  4NHF A;  1K8A 4;  1MWT A;  4J8T A;  3DY5 A;  1YVB I;  3PS8 A;  2IUJ A;  2C10 A;  4EXR A;  1IV7 A;  3GZX B;  1D6U A;  3IJE B;  4RNZ A;  4BU4 A;  4HYZ A;  3EB8 A;  1AVK A;  2CWT A;  1SIH A;  3D9R A;  4QWT A;  3CCJ 3;  1E3V A;  3CCL 3;  1X1W A;  3AHW A;  1VQL 3;  3EN1 B;  1DYU A;  3V92 A;  1I3F A;  2HMO B;  1TRQ A;  1EQK A;  3EC9 A;  2FGT A;  2KF4 A;  2IYJ A;  3D3L A;  4CJN A;  1I3I A;  1RCL A;  4FMD A;  2SBL A;  1BSB A;  1JKG B;  7STD A;  1PY3 A;  3K7C A;  1JNQ A;  5I97 A;  1N8R 4;  1Q42 A;  4MMY B;  4O02 B;  1BRN L;  1UUW B;  1OCV A;  5LC6 A;  3WA2 X;  1VQQ A;  1BNE A;  1ULI B;  3NHX A;  5ELJ A;  1LQM B;  2B24 B;  2FXT A;  2GU3 A;  4WYK A;  4XBY A;  2P0M A;  4RNT A;  3DGY A;  3CCV 3;  1QVG 2;  1RGA A;  4N6N B;  1VQP 3;  1UGI A;  1M1X B;  1TRP A;  1AY7 A;  3X41 A;  3X3Y A;  1IK3 A;  1RKY A;  3LTB A;  4KZ1 A;  3BNE A;  3HI7 A;  3DXO A;  4I4K A;  7GSP A;  3T0U A;  3B4P A;  1YJW 3;  4HKV B;  1K73 4;  5G1L A;  1B20 A;  2STD A;  3DMC A;  1GY5 A;  2CFK A;  4R9L A;  5IEN A;  1YGE A;  1ZGX A;  1EEJ A;  2GU1 A;  4HM6 B;  1CYU A;  5AI1 A;  1UCK A;  1RLS A;  1QJG A;  2W9Q A;  4KFD A;  1NWW A;  1YHQ 3;  1T5Y A;  2RCD A;  3PCR A;  4JRF A;  1GOV A;  3HX8 A;  3QK9 A;  2BIR A;  2BMR B;  3N54 B;  1BRH A;  3UB1 A;  1ISK A;  3FZW A;  1ROV A;  5IF6 A;  3SOA A;  1Q7H A;  5EEO A;  1GD4 A;  4IIA A;  3WOE B;  5CLK A;  3CCE 3;  5IG3 A;  1LRA A;  3F14 A;  2W56 B;  1W4N A;  2AAD A;  2Y73 A;  1Y4K A;  4AKZ A;  1BNJ A;  1Q9E A;  1YVS A;  3FH1 A;  1GOU A;  2CKF B;  1T3B A;  1W6Y A;  3BB9 A;  1G96 A;  1BSA A;  5AEW B;  1OF5 A;  1CEW I;  1RGK A;  2P0X A;  3N8B A;  2XSO B;  3EBY A;  4MJD A;  1VQ5 3;  4GSP A;  3O8Y A;  4RNY A;  1RGC A;  4FCZ A;  1K41 A;  3JUM A;  4H61 A;  5G1K A;  1VQN 3;  2CH9 A;  1JZD A;  2OQE C;  1HZ1 A;  1WMP A;  1JKG A;  1RJO A;  1PFP A;  3MG3 A;  5AYS C;  5IEO A;  1Q7Y 4;  1BAO A;  1BU4 A;  3D5G A;  2F5M A;  1JV2 B;  3G16 A;  2XF3 A;  4AEQ A;  4BTW A;  1IDP A;  4KT3 B;  1QAL A;  3G71 3;  2Q07 A;  3CU3 A;  4GB5 A;  1AV4 A;  1NO3 A;  1UGH I;  1UI8 A;  2XEP A;  3UNL A;  3I56 3;  1AVL A;  2XFT A;  2CFG A;  3KZT A;  5EQL A;  3D4A A;  1JN5 B;  1RDS A;  4FMB A;  3MYT A;  4N6U A;  4J5K A;  1RGE A;  1AQZ A;  1LNH A;  1U8C B;  1E3R A;  1MGW A;  1Q40 A;  1SJW A;  2CHC A;  2MF7 A;  1GMQ A;  1T2I A;  1A67 A;  3NM7 A;  4EW5 A;  3QRD A;  2R4I A;  1IT8 A;  3B4O A;  3OX9 A;  1YJ9 3;  3RGA A;  2ZDJ A;  1NB5 I;  5BU4 A;  2D1W A;  2KAA A;  3EE1 A;  4BL3 A;  1B2M A;  2OOV C;  3A76 A;  2W2C A;  2BMO B;  1O7M B;  1GSP A;  2W03 A;  3LT8 A;  4ORL A;  4R9K A;  2OQE A;  5HGR A;  1Q81 4;  3Q90 A;  3EHC A;  3X3X A;  1IQY A;  4JF8 A;  3LOY A;  3CPO A;  4RZM A;  5AIG A;  4HM7 B;  3F8H A;  3NQZ A;  4O3V A;  2Z7A A;  1C54 A;  1W01 A;  4STD A;  3V98 A;  2XR8 B;  2Z76 A;  2RSX A;  5BXQ A;  3CCQ 3;  2RNT A;  3G8Z A;  1D6Z A;  2H0H A;  3Q1C A;  1VQK 3;  1S72 3;  1J2B A;  1OPY A;  3NX0 A;  3UJM A;  5CF1 A;  2W04 A;  3PCS A;  2WGO A;  3NBJ A;  2B1X B;  2XFS A;  1OGZ A;  1IVV A;  1RCK A;  3WDG B;  5AIF A;  3T8U A;  2ML5 A;  2O3O A;  2KF6 A;  1STD A;  1FUS A;  4K1U A;  3G4S 3;  4EV5 A;  4HJL B;  3VSY A;  5BVB A;  1G02 A;  1HU9 A;  2QA4 3;  4N3V A;  2C4B A;  4WFO A;  1TUH A;  4HM8 B;  4I5Q A;  1TP6 A;  2D42 A;  2OOV A;  3LZA A;  2OWP A;  1Q86 4;  1YI2 3;  1WQL B;  3LTC A;  1O7N B;  3VF1 A;  2CWV A;  3BNC A;  5DRE A;  2CW9 A;  3DM8 A;  3ZG0 A;  1JB4 A;  1DVD A;  1D6Y A;  1VZZ A;  2A15 A;  3WMD A;  1C7H A;  1KWI A;  3NV0 B;  1I2G A;  3WHO A;  2KCD A;  2ML6 A;  1U5O A;  1RGH A;  4N6V 0;  4ZM8 A;  1N9J A;  3PGB A;  1UUG B;  1W6G A;  3H51 A;  1EA2 A;  1DVC A;  3MG2 A;  1FGR A;  3F40 A;  4LMI A;  4O2H A;  2P09 A;  2Z6B A;  4LZI A;  3JUO A;  1B2Z A;  4XBX A;  4L8P A;  1YNV X;  3D5I A;  1JJ2 2;  3URP A;  1BSC A;  3CC4 3;  2LQV A;  5KP4 A;  1ROA A;  3AMO B;  3SX1 A;  2WO0 A;  4FR9 A;  3CNX A;  1NNV A;  3Q3F A;  1SII A;  1UI7 A;  1OUN A;  3GZB A;  3FGY A;  5IEP A;  1B2U A;  5CXO A;  3DGL A;  1CQS A;  1W5Z A;  3I0Y A;  1B27 A;  3F9S A;  1W6C A;  3GWR A;  4X2H A;  3I55 3;  2RBI A;  5A0O B;  3HK4 A;  4OVM A;  1NU3 A;  4XM4 A;  4HBR A;  3PZW A;  2P05 A;  4XBT A;  3FSD A;  3BLZ A;  2IY2 A;  1GD3 A;  2Z77 A;  3WOF B;  1OHO A;  4EC6 A;  5D83 A;  5D82 A;  5JPP A;  1BRS A;  2CX1 A;  4EV2 A;  1NJI 4;  1QAF A;  2HMJ B;  2GEX A;  4WHA A;  4NRE A;  3STD A;  1FUW A;  2HOH A;  1BSE A;  4OK0 A;  1A90 A;  3X3Z A;  3HII A;  2CX0 A;  2J8X B;  1QVF 2;  3ECF A;  1GMR A;  1PU4 A;  2PNC A;  1I2F A;  3PYJ A;  3X40 A;  4J9A A;  3EJV A;  3SED A;  3G6E 3;  3GAX A;  4GL6 A;  1M9G A;  1SQW A;  2YFI B;  1YIJ 3;  3OW2 2;  4IT7 A;  4L8O A;  3DZL A;  3CCU 3;  1VQ9 3;  2XH9 A;  1JB5 A;  1OHP A;  2GXF A;  4FCJ A;  3KE7 A;  3CCR 3;  3HOH A;  4HM0 B;  3LH4 A;  2F98 A;  3WOD G;  1RN1 A;  1CH0 A;  1W00 A;  1L5G B;  4N6L A;  1O7G B;  3KII A;  3NV0 A;  3ROB A;  2W9P A;  5G2G A;  2RGQ A;  5RNT A;  1I70 A;  2OTJ 3;  4HOH A;  1LOW A;  1JRQ A;  4HM1 B;  4LEH A;  4PEJ A;  1BAN A;  1LQG C;  1DMQ A;  1R4Y A;  3S29 A;  4L7K A;  2JQ5 A;  2GEY A;  1ULJ B;  3CMA 3;  3CC2 3;  5IG0 A;  1KC8 4;  3IPT A;  2ZHX B;  3AMO A;  5AYR B;  4R4K A;  1I0V A;  1HYF A;  1N5P A;  3MHE A;  2MC8 A;  3SYU A;  3CPW 2;  1BVI A;  3RNT A;  5LC7 A;  3EQQ B;  2SAR A;  1BNS A;  3Q2P A;  1TTO A;  1X1X A; 
#chains in the Genus database with same CATH homology
 3PXM A;  3T8N A;  4XDV A;  3U1W A;  2ZL8 A;  2E2U A;  5IG4 A;  3G0K A;  5AII A;  2LYX A;  3FLJ A;  1WNH A;  3SLU A;  3GZR A;  3JUQ A;  1W2Z A;  1GY6 A;  4EBG A;  3DUK A;  2KXG A;  3CCS 3;  4LSO A;  2BO9 B;  3M8C A;  3FG3 A;  3B8L A;  3UL5 A;  3H3H A;  2CG1 A;  3CME 3;  1QAK A;  3EBT A;  4TX4 A;  4Q53 A;  3NUV A;  5KP1 A;  5AIH A;  4WWU C;  3SXX A;  4WYK B;  2CC3 A;  3IMA B;  2BNG A;  1GYB A;  3SVA A;  2IUK A;  1LXE A;  4MMX B;  4U13 A;  4EYC A;  5IW9 A;  2W56 A;  2UX0 A;  3OXA A;  4K1V A;  2OTL 3;  3FCS B;  4MEI A;  5CF2 A;  3KN4 A;  4O8S A;  3KFQ C;  5IER A;  1IV9 A;  1M1K 4;  3SOY A;  1RRH A;  2W6J H;  1MOL A;  4HM3 B;  5JBS A;  4HZB B;  2BMQ B;  3X42 A;  2CIU A;  1US1 A;  1N8Q A;  1UUV B;  3DGO A;  3S28 A;  3E99 A;  1IQ8 A;  4FCM A;  2W0Q A;  1N9E A;  2GBX B;  1KQS 2;  1TFO A;  3B7C A;  3U97 A;  3NBR A;  8CHO A;  5KP3 A;  1QMA A;  4HM4 B;  3MKI A;  4K90 B;  3FKA A;  1IQX A;  1O7W B;  3EX9 A;  3HIG A;  1GY7 A;  3EN8 A;  1HKX A;  2WOF A;  4OUQ A;  1JN5 A;  3FF0 A;  3K63 A;  3FG4 A;  5EVH A;  1YIT 3;  1OF5 B;  1BUQ A;  1N5H A;  3NXJ A;  5FW5 A;  3ALA A;  1LOX A;  2CFW A;  4FMC A;  1S5A A;  3DGM A;  3LML A;  1Q82 4;  2CG0 A;  3K5T A;  1M90 4;  4LGQ A;  2IA7 A;  2Y74 A;  1WTH A;  3GZY B;  1ZX2 A;  1NDO B;  1DMM A;  1IVW A;  3OWY A;  4WP5 A;  3ER7 A;  1OHS A;  1ASK A;  1RN7 A;  3FG1 A;  3S5C A;  1FGM A;  3F8X A;  1OGX A;  4RBN A;  1W02 A;  1OH0 A;  1TFK A;  2P38 A;  3F7S A;  4KFF A;  1V74 A;  1FGT A;  1Q40 B;  1FGQ A;  1W2B 2;  1A2V A;  4BTY A;  1IU7 A;  3V99 A;  2HMM B;  2QIY A;  3S67 A;  1RRL A;  1GS3 A;  3LXU X;  3RGR A;  3OV4 A;  1SPU A;  3JUN A;  3BNB A;  1STF I;  2F86 B;  3KSE D;  2XRX B;  4R1K A;  4N6O B;  2QEX 3;  2CK3 H;  2K54 A;  4HM2 B;  3VGN A;  3TDG A;  2CFL A;  2GBW B;  5IG5 A;  2INX A;  3CC7 3;  5JPU A;  6STD A;  3EF8 A;  1R4C A;  3NQY A;  1EKM A;  2CFD A;  2XGN A;  4XDW A;  2BHM A;  3RDE A;  1KSI A;  4BTX A;  4G1M B;  4HZ9 B;  3DGN A;  3LTD A;  1FGO A;  2BT3 A;  1WMO A;  3JUP A;  3S27 A;  2HML B;  4H3U A;  3MG1 A;  3CNM A;  3NBB A;  3KKG A;  3HZP A;  1K28 A;  5FGO A;  1VQ7 3;  2HMN B;  3OWU A;  1K9M 4;  2C11 A;  1Z1S A;  2O9U X;  4IPB A;  3LYG A;  2HMK B;  1O7P B;  2FNQ A;  1LVN A;  3L0R A;  1W7C A;  3J7Y d;  2JDI H;  4KFE A;  5D81 A;  4CCV A;  4AKY A;  2F99 A;  2OCT A;  2XSH B;  1VQM 3;  5CK6 A;  3LT9 A;  1FA3 A;  2RFR A;  3LTA A;  3N9H A;  5AEU B;  1UW1 A;  1WMN A;  2K0M A;  1VQ4 3;  2YX9 A;  1IVU A;  3KSP A;  3GRD A;  1KD1 4;  1NB3 I;  4HVN A;  3NM2 A;  1O7H B;  3CD6 3;  1ZO2 A;  4X2O A;  3CXC 2;  2QGU A;  1MNL A;  4XB5 A;  3OWS A;  2L4V A;  2IMJ A;  1AR0 A;  2V1L A;  3K0Z A;  3BND A;  2E2V A;  1DMN A;  2KRT A;  3MPH A;  2CWU A;  4K61 A;  4FMA A;  4HM5 B;  3WA3 A;  2M7O A;  4R80 A;  3JVC A;  3CCM 3;  1JB2 A;  1CYV A;  2YFJ B;  5DRV A;  1TIJ A;  1EG9 B;  2PZV A;  5TGN A;  2I9W A;  3MSO A;  1OAC A;  5STD A;  2YFL B;  5ELU A;  1IT7 A;  3F7X A;  3UL6 A;  2WGQ A;  3MWZ A;  2XGL A;  4KVH A;  1F8N A;  4N6T A;  2E2T A;  1YJN 3;  3K9M C;  1TU5 A;  1IVX A;  4MMZ B;  2WOH A;  3FF2 A;  1E97 A;  1VQO 3;  1A2K A;  1VQ6 3;  4CDL A;  4N6M A;  1VQ8 3;  4NHF A;  1K8A 4;  4J8T A;  3DY5 A;  1YVB I;  3PS8 A;  2IUJ A;  2C10 A;  4EXR A;  1IV7 A;  3GZX B;  1D6U A;  3IJE B;  4RNZ A;  4HYZ A;  3EB8 A;  1AVK A;  2CWT A;  1SIH A;  3D9R A;  4QWT A;  3CCJ 3;  1E3V A;  3CCL 3;  1VQL 3;  3EN1 B;  1DYU A;  3V92 A;  2HMO B;  1EQK A;  3EC9 A;  2FGT A;  3D3L A;  4FMD A;  2SBL A;  1JKG B;  7STD A;  3K7C A;  1JNQ A;  5I97 A;  1N8R 4;  1Q42 A;  4MMY B;  4O02 B;  1UUW B;  1OCV A;  5LC6 A;  3WA2 X;  1ULI B;  3NHX A;  5ELJ A;  2B24 B;  2FXT A;  2GU3 A;  4WYK A;  4XBY A;  1QVG 2;  2P0M A;  3CCV 3;  4N6N B;  1VQP 3;  1M1X B;  3X41 A;  3X3Y A;  1IK3 A;  1RKY A;  3LTB A;  4KZ1 A;  3BNE A;  3HI7 A;  3DXO A;  4I4K A;  3T0U A;  3B4P A;  1YJW 3;  4HKV B;  1K73 4;  2STD A;  3DMC A;  4R9L A;  1GY5 A;  2CFK A;  5IEN A;  1YGE A;  2GU1 A;  4HM6 B;  1CYU A;  5AI1 A;  1QJG A;  2W9Q A;  4KFD A;  1NWW A;  1YHQ 3;  1T5Y A;  2RCD A;  3PCR A;  4JRF A;  1ISK A;  3HX8 A;  3QK9 A;  2BMR B;  3N54 B;  3UB1 A;  3FZW A;  1ROV A;  5IF6 A;  3SOA A;  5EEO A;  1GD4 A;  4IIA A;  3WOE B;  5CLK A;  3CCE 3;  5IG3 A;  3F14 A;  2W56 B;  1W4N A;  2Y73 A;  1Y4K A;  4AKZ A;  3FH1 A;  2CKF B;  1W6Y A;  3BB9 A;  1G96 A;  5AEW B;  1OF5 A;  1CEW I;  2P0X A;  3N8B A;  2XSO B;  3EBY A;  4MJD A;  1VQ5 3;  3O8Y A;  4RNY A;  4FCZ A;  1K41 A;  3JUM A;  4H61 A;  1VQN 3;  2CH9 A;  2OQE C;  1WMP A;  1JKG A;  1RJO A;  1PFP A;  3MG3 A;  5AYS C;  5IEO A;  1Q7Y 4;  1JV2 B;  3G16 A;  2XF3 A;  4AEQ A;  4BTW A;  1IDP A;  1QAL A;  3G71 3;  2Q07 A;  3CU3 A;  4GB5 A;  1AV4 A;  1NO3 A;  2XEP A;  1UI8 A;  3UNL A;  3I56 3;  1AVL A;  2XFT A;  2CFG A;  3KZT A;  5EQL A;  1JN5 B;  4FMB A;  3MYT A;  4N6U A;  1LNH A;  1E3R A;  1Q40 A;  1U8C B;  1SJW A;  2CHC A;  2MF7 A;  1A67 A;  3NM7 A;  3QRD A;  2R4I A;  1IT8 A;  3B4O A;  3OX9 A;  1YJ9 3;  3RGA A;  2ZDJ A;  1NB5 I;  2D1W A;  3EE1 A;  2OOV C;  3A76 A;  2W2C A;  2BMO B;  1O7M B;  2W03 A;  3LT8 A;  4ORL A;  4R9K A;  2OQE A;  1Q81 4;  5HGR A;  3Q90 A;  3EHC A;  3X3X A;  1IQY A;  4JF8 A;  3LOY A;  3CPO A;  4RZM A;  5AIG A;  4HM7 B;  3F8H A;  3NQZ A;  4O3V A;  2Z7A A;  1W01 A;  4STD A;  3V98 A;  2XR8 B;  2Z76 A;  2RSX A;  5BXQ A;  3CCQ 3;  3G8Z A;  3Q1C A;  1D6Z A;  1J2B A;  1VQK 3;  1S72 3;  1OPY A;  3NX0 A;  3UJM A;  5CF1 A;  2W04 A;  3PCS A;  2WGO A;  3NBJ A;  2XFS A;  2B1X B;  1IVV A;  1OGZ A;  3WDG B;  5AIF A;  3T8U A;  2ML5 A;  2O3O A;  1STD A;  3G4S 3;  4K1U A;  4EV5 A;  4HJL B;  3VSY A;  5BVB A;  1HU9 A;  2QA4 3;  4N3V A;  4WFO A;  1TUH A;  4HM8 B;  2OOV A;  1TP6 A;  2D42 A;  3LZA A;  2OWP A;  1Q86 4;  1YI2 3;  1WQL B;  3LTC A;  1O7N B;  3VF1 A;  2CWV A;  3BNC A;  5DRE A;  2CW9 A;  3DM8 A;  1DVD A;  1JB4 A;  1D6Y A;  1VZZ A;  2A15 A;  3WMD A;  1C7H A;  1KWI A;  3NV0 B;  2KCD A;  2ML6 A;  4N6V 0;  4ZM8 A;  1N9J A;  3PGB A;  1W6G A;  3H51 A;  3MG2 A;  1EA2 A;  1DVC A;  4LMI A;  1FGR A;  3F40 A;  4O2H A;  2P09 A;  2Z6B A;  4LZI A;  3JUO A;  4XBX A;  4L8P A;  1JJ2 2;  3CC4 3;  2LQV A;  5KP4 A;  1ROA A;  3AMO B;  3SX1 A;  2WO0 A;  4FR9 A;  3CNX A;  1SII A;  1OUN A;  3GZB A;  3FGY A;  5IEP A;  5CXO A;  3DGL A;  1CQS A;  1W5Z A;  3I0Y A;  3F9S A;  1W6C A;  3GWR A;  4X2H A;  3I55 3;  5A0O B;  3HK4 A;  4OVM A;  1NU3 A;  4XM4 A;  4HBR A;  3PZW A;  2P05 A;  4XBT A;  3FSD A;  3BLZ A;  1GD3 A;  2Z77 A;  3WOF B;  1OHO A;  4EC6 A;  5D83 A;  5D82 A;  5JPP A;  4EV2 A;  1NJI 4;  1QAF A;  2HMJ B;  2GEX A;  4WHA A;  4NRE A;  3STD A;  1FUW A;  1A90 A;  4OK0 A;  3X3Z A;  3HII A;  1QVF 2;  3ECF A;  1PU4 A;  2PNC A;  3PYJ A;  3X40 A;  4J9A A;  3EJV A;  3SED A;  3G6E 3;  3GAX A;  4GL6 A;  1M9G A;  1SQW A;  2YFI B;  1YIJ 3;  3OW2 2;  4IT7 A;  4L8O A;  3DZL A;  3CCU 3;  1VQ9 3;  2XH9 A;  1JB5 A;  1OHP A;  2GXF A;  4FCJ A;  3KE7 A;  3CCR 3;  4HM0 B;  3LH4 A;  2F98 A;  3WOD G;  1W00 A;  1L5G B;  4N6L A;  1O7G B;  3KII A;  3NV0 A;  3ROB A;  2W9P A;  5G2G A;  2RGQ A;  2OTJ 3;  4LEH A;  1JRQ A;  4HM1 B;  4PEJ A;  1DMQ A;  3S29 A;  4L7K A;  2JQ5 A;  2GEY A;  1ULJ B;  3CMA 3;  3CC2 3;  5IG0 A;  1KC8 4;  3IPT A;  3AMO A;  5AYR B;  4R4K A;  3MHE A;  1N5P A;  2MC8 A;  3CPW 2;  5LC7 A;  3EQQ B;  3Q2P A;  1U5O A;  1UI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...