3FGYA

Crystal structure of a ntf2-like protein (bxe_b1094) from burkholderia xenovorans lb400 at 1.59 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
GMSTQENVQIVKDFFAAMGRGDKKGLLAVSAEDIEWIIPGEWPLAGTHRGHAALAALLQKASEMVEISYPEPPEFVAQGERVLVVGFATGRVKSTNRTFEDDWVFAITVRKSKVTSIREYIDTLALARATNFNAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function. (YP_554211.1) from BURKHOLDERIA XENOVORANS LB400 at 1.59 A resolution
rcsb
source organism Burkholderia xenovorans lb400
total genus 38
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3fgyA00
1DMMA 5AIGA 4XBTA 4K1UA 3NXJA 2RGQA 5KP1A 1W00A 1Q40B 2PZVA 2XR8B 3OWUA 1STDA 3I0YA 3CPOA 1OGXA 1QMAA 3K0ZA 3VSYA 2F99A 3MG2A 4XB5A 2B24B 3JUNA 4LEHA 5IENA 3EBTA 2HMMB 3MSOA 2YFIB 1E3RA 4KVHA 3BLZA 1E97A 3EN8A 1Q42A 4L8OA 4U13A 4OUQA 3OWSA 1AR0A 4X2OA 4L7KA 3F9SA 3MG1A 5BXQA 5IEPA 3B7CA 3HK4A 4RZMA 3MG3A 3Q90A 1ZO2A 3DXOA 5FW5A 4HM7B 2CHCA 2IMJA 4HM0B 3KKGA 3RGAA 4HM3B 4IIAA 3SEDA 3LYGA 4LMIA 4HM6B 1W6YA 4HVNA 3OWYA 3NUVA 2CKFB 3FH1A 3S5CA 3F7SA 5EVHA 3KZTA 3JUOA 4R9KA 1DMQA 1ULJB 2JQ5A 1NU3A 3UJMA 5AIIA 5JPUA 1SJWA 3B8LA 3HZPA 5CF1A 3MKIA 4STDA 3GWRA 5STDA 1GYBA 4HJLB 3EQQB 5D81A 3H51A 4XDWA 2F98A 1U5OA 1JB5A 6STDA 4WWUC 2XSHB 3EN1B 1OH0A 3FGYA 5D83A 5TGNA 3E99A 3STDA 4HM5B 3B4OA 2HMNB 2F86B 2GBWB 1IDPA 3D9RA 5BVBA 1VZZA 2YFLB 3G0KA 3ER7A 3MHEA 3RGRA 4HM4B 3GZYB 4MJDA 4X2HA 1OUNA 2HMKB 3F8XA 1JB4A 3G16A 1O7PB 2BNGA 3KE7A 1GY7A 3NHXA 3F40A 5DREA 3FSDA 4HM2B 2RFRA 1EG9B 3CNMA 3NV0A 4HZ9B 3G8ZA 4ORLA 4XM4A 5HGRA 2Z77A 4OVMA 2YFJB 1BUQA 1EA2A 3JUQA 4LGQA 5G2GA 4J9AA 1W02A 5AEWB 4L8PA 1OHPA 2GEYA 4Q53A 3NBRA 2QIYA 3FF2A 3EBYA 5IG5A 4XDVA 3FZWA 3CNXA 4H3UA 2HMLB 3EX9A 2QGUA 1DMNA 2UX0A 8CHOA 1W01A 3H3HA 3EC9A 4J8TA 3T8NA 1GY6A 3OV4A 5CXOA 3T8UA 3SOAA 3ROBA 4I4KA 1OF5A 3B4PA 2BMOB 3IPTA 4GB5A 4WP5A 5AIHA 4WYKA 1ASKA 3DMCA 4HKVB 1JKGA 5AIFA 4FCJA 4K1VA 3WMDA 3F14A 2XRXB 3FF0A 1NWWA 2GBXB 1GS3A 3GZBA 3BB9A 2BMRB 1OHSA 2INXA 1OCVA 1GY5A 2OWPA 1UUWB 5DRVA 4WYKB 2RCDA 3EF8A 2XSOB 3ECFA 1ULIB 4R1KA 1JKGB 2Z76A 4HM8B 3HX8A 7STDA 1TUHA 1ISKA 4FCMA 3DUKA 1JN5A 3M8CA 4HM1B 2GXFA 3F8HA 3CU3A 5CLKA 1Z1SA 5AEUB 3FKAA 3JUPA 2R4IA 5CK6A 2STDA 5IG4A 2BMQB 3JUMA 1OGZA 1NDOB 4XBYA 2I9WA 2A15A 3GZXB 5IF6A 4XBXA 2B1XB 1WQLB 1JN5B 1HKXA 1ZX2A 1CQSA 1E3VA 3LZAA 5AI1A 3NV0B 5KP3A 5KP4A 4CDLA 5JPPA 1JB2A 2GEXA 2K54A 2HMJB 1OPYA 1QJGA 1OHOA 3GZRA 3OX9A 2HMOB 3NM2A 4N3VA 3DM8A 3FLJA 3VGNA 3DZLA 1O7HB 3MYTA 3SOYA 5CF2A 4R9LA 5IEOA 1O7NB 5IERA 3K7CA 3KSPA 2Z7AA 1A2KA 3UNLA 1UUVB 1TP6A 3EHCA 5D82A 3GRDA 1K41A 1Q40A 1C7HA 1O7WB 3F7XA 3EJVA 5IG0A 3OXAA 5IG3A 1OF5B 1O7MB 4HZBB 4PEJA 1S5AA 3A76A 1O7GB 2W2CA
chains in the Genus database with same CATH superfamily
1CEWI 7RNTA 1DMMA 2OTL3 2CFDA 2FGTA 5AIGA 4XBTA 1BNIA 4K1UA 1FGRA 3NXJA 3G6E3 2RGQA 7GSPA 4JF8A 2K3DA 5KP1A 1A2PA 1W00A 3DGYA 4IPBA 1EQKA 4FMCA 1Q40B 2L4VA 1FUTA 1SQWA 2PZVA 1JNQA 2XR8B 2RNTA 1IT7A 5JBSA 2RBIA 3OWUA 2KF4A 1B2ZA 1BRSA 2E2TA 3PCSA 1STDA 1FGTA 1A2VA 3I0YA 2KAAA 4KFFA 3CPOA 1OGXA 1QMAA 1UUGB 3K0ZA 3QK9A 4RNZA 1B3SA 1UCIA 4KZ1A 4FR9A 3VSYA 1IK3A 4BTYA 2MC8A 1ROVA 1I0XA 2F99A 3O8YA 4BL3A 3MG2A 4XB5A 2B24B 3DGMA 1IV7A 3JUNA 3RDEA 4LEHA 1FGMA 3SX1A 5IENA 1FGOA 1SIIA 2SARA 1G02A 6RNTA 3SLUA 3EBTA 1N5HA 1TFKA 2HMMB 3FG1A 2F5WA 3D5IA 5ELUA 1MWUA 1VQ83 3MSOA 3WDGB 2YFIB 3WHOA 1E3RA 4KVHA 1BRNL 2W03A 2C10A 4KFEA 3BLZA 2PNCA 3PZWA 1E97A 3PS8A 2OOVA 2O3OA 5AYSC 2F5MA 1MWSA 2OQEC 3EN8A 1Q42A 1AVKA 1RNTA 4DKIA 1GMRA 1D6ZA 3CXC2 2GU3A 4L8OA 4U13A 4OUQA 1Q814 1B20A 3OWSA 3PXMA 1PFPA 2ZA4A 1AR0A 1BRIA 4X2OA 4L7KA 4OK0A 3F9SA 3MG1A 4EXRA 5BXQA 3V98A 5IEPA 2YX9A 3B7CA 1RSNA 3HK4A 4N6OB 4RZMA 2BO9B 3MG3A 4LYLB 1RTUA 1AY7A 3Q90A 5M1AA 1ZO2A 1M904 2CFKA 1B21A 2WGQA 3DGNA 3S28A 2CX1A 4EYCA 2Y73A 1SPUA 3N54B 2BIRA 3DXOA 2BT3A 4HM7B 5FW5A 2CHCA 2IMJA 3LXUX 1A67A 4HM0B 3KKGA 1RHLA 3X40A 1B2MA 1WMPA 3RGAA 1SARA 2KXGA 1TFOA 4WFOA 1YIJ3 1K8A4 4HM3B 2W6JH 1BRHA 4NHFA 1JBTA 1RKYA 4IIAA 3SEDA 3LYGA 3I553 3U1WA 3CME3 1PYLA 3CCQ3 1IQYA 1LQGC 1FUSA 4LMIA 1VQ53 4HM6B 2CWTA 1UDII 1W6YA 2KCDA 4HVNA 4FCZA 5A0OB 1W2ZA 3OWYA 3NUVA 2CKFB 2OTJ3 1QAFA 3FH1A 5I97A 1BUJA 2IUJA 3S5CA 3F7SA 1DVDA 1I70A 3EB8A 4FMDA 1U8CB 2ML6A 1BRKA 2IY2A 5EVHA 1GMPA 3KZTA 3JUOA 4NPBA 4R9KA 3D5GA 3T0UA 3UL6A 1DMQA 1ULJB 1VQ63 2V1LA 2JQ5A 3BNEA 3FCSB 1NU3A 1JBSA 4AKZA 1IYYA 1WMNA 2QA43 1BNRA 2OCTA 1W6GA 3UJMA 3D79A 1MWRA 6GSPA 5AIIA 5JPUA 3I563 1SJWA 3B8LA 3HZPA 5CF1A 3MKIA 1MGWA 4STDA 5IW9A 1RGEA 1BRJA 1BAOA 1WNHA 3N9HA 4N6V0 3GWRA 3SYUA 1BNEA 5STDA 3MWZA 4RBNA 1GYBA 4HJLB 2P0XA 1GMQA 1RGKA 3EQQB 1UI7A 5D81A 3H51A 2E2VA 4XDWA 3CCS3 1MWTA 2F98A 2CK3H 4LSOA 1D6UA 1U5OA 1UCLA 1VQ73 3GSPA 1JB5A 3CCM3 4ILFA 2R41A 6STDA 1NJI4 1I2FA 4WWUC 3KSED 9RNTA 3X3XA 1BSBA 2D42A 2XSHB 5BIRA 1BANA 2SBLA 3BNBA 1OH0A 3EN1B 3WOFB 1IVVA 3KCHA 3FGYA 5D83A 3AGNA 3IJEB 1FW7A 3FG3A 5TGNA 1IQ8A 2C11A 4GL6A 2CG0A 3E99A 1W6CA 3STDA 2IYJA 4HM5B 3B4OA 4N6MA 1YNVX 1T3BA 2HMNB 2F86B 1EEJA 2GBWB 3G4S3 1BU4A 1VQ43 3LTAA 1IDPA 3D9RA 1RJOA 2LYXA 1K734 1HU9A 3PGBA 1IT8A 1FZUA 3S29A 3CPW2 5BVBA 2F56A 3NQZA 1VZZA 1GD3A 1LQMB 2CIUA 2YFLB 3KFQC 5G1KA 3G0KA 4EV2A 3AMOA 3S27A 3K63A 3JVCA 1F8NA 3ER7A 1MOLA 3LTDA 3MHEA 4HM4B 3RGRA 3X3YA 3GZYB 3V92A 2W9QA 4MJDA 4X2HA 5M18A 1VQN3 1OUNA 1TIJA 1IU7A 1DVCA 1I3FA 2HMKB 3F8XA 3NX0A 4CJNA 1JB4A 3U97A 4BTXA 1FUWA 2W04A 3G16A 1D6YA 1O7PB 4MEIA 2BNGA 3KE7A 1YI23 1A90A 1KQS2 1GY7A 3NHXA 1UGHI 1IQXA 1UCKA 3F40A 1GD4A 1B2XA 1TJDA 2CFLA 3FSDA 5DREA 5BU4A 2BHMA 3CCU3 1LNIA 3LTBA 1NO3A 4HM2B 1X1XA 2RFRA 1EUIC 1EG9B 2Z6BA 3CNMA 2JDIH 3NV0A 4HZ9B 3G8ZA 3UL5A 2CFWA 1BSDA 4ORLA 4XM4A 1BSCA 2P05A 3AMOB 3X42A 2IUKA 5HGRA 1TRQA 2Z77A 4OVMA 2YFJB 1BNJA 1BUQA 1EA2A 3JUQA 4LGQA 4KFDA 3V99A 2XGNA 5G2GA 2QEX3 3PCRA 1QALA 4J9AA 1W02A 2XF3A 5AEWB 4L8PA 1G96A 1OHPA 4O3VA 2GSPA 2GEYA 4Q53A 3NBRA 2GU1A 1HZ1A 1MGRA 1PY3A 2QIYA 3FF2A 4I5QA 1BIRA 3EBYA 4EC6A 4MMYB 4XDVA 5IG5A 3FZWA 4R80A 3CNXA 4H3UA 2HMLB 1LOVA 1G0TA 1RDSA 1B2SA 3BNDA 3EX9A 3QRDA 1JZDA 1VQQA 1BRGA 4HAAA 3SVAA 2KF5A 3N8BA 2W56A 2QGUA 1DMNA 1DETA 2UX0A 4QWTA 3X3ZA 8CHOA 1W01A 4R4KA 1Q824 3CD63 3H3HA 1V57A 3G713 2Y74A 3K9MC 1IVXA 4BTWA 3EC9A 3TDGA 1RLSA 1ZS7A 1Q9EA 4J8TA 3CCJ3 4HYZA 1GY6A 3T8NA 3OV4A 2H0IA 5CXOA 4AKYA 1UI8A 1KSIA 4G1MB 3SOAA 3T8UA 4O8SA 3ROBA 3WODG 1VQ93 1FA3A 1LOWA 3Q3FA 4HBRA 5M19A 4I4KA 5ELJA 1OF5A 3B4PA 2BMOB 3IPTA 2WOHA 4GB5A 4WP5A 5AIHA 1QVG2 4WYKA 1ASKA 3DMCA 3LMLA 2FNQA 2P09A 4O02B 3D3LA 2OOVC 1BGSA 3WA3A 3WR2A 1GOUA 1JKGA 3EE1A 2UGIA 4HKVB 4K90B 5AIFA 4FCJA 1I8VA 2L1SA 4MMXB 4J5KA 1N5PA 4K1VA 4KT3B 2W56B 1M1K4 1RCKA 1BNFA 4J5GA 1GOYA 4NREA 3WMDA 1BVIA 3F14A 1NB5I 1HYFA 2XRXB 3FF0A 4BL2A 1RNBA 1NWWA 2WGOA 4CCVA 1JJ22 3LTCA 2GBXB 1DE3A 1GS3A 1AQZA 3GZBA 1V74A 1M1XB 4GHOA 3BB9A 2OQEA 4N6TA 2Q07A 1VQK3 2BMRB 2IA7A 3URPA 4IT7A 1OHSA 1IV9A 2INXA 1OCVA 1GY5A 1NNVA 1CH0A 2CH9A 2OWPA 1UUWB 1B2UA 1K9M4 2XH9A 1DYUA 4WYKB 2CWUA 5DRVA 1YHQ3 2RCDA 1YVSA 1STFI 1LOXA 3EF8A 2P0MA 2XSOB 2XFTA 1SIHA 3ECFA 3Q1CA 1VQM3 1ULIB 4R1KA 1VQL3 1JKGB 2WOFA 5GSPA 1RRHA 2CFGA 1IVWA 1W5ZA 4CPKA 2XEPA 1FGQA 2Z76A 1N9EA 1X1WA 1N9JA 2K0MA 4HM8B 3CCE3 3HX8A 7STDA 1RRLA 1TUHA 4N6NB 4ZM8A 1OACA 1ISKA 1LNHA 1UW1A 1JZOA 4FMAA 3CC23 3NQYA 4FCMA 3VF1A 2ZHXB 3CCV3 2HOHA 1KD14 3A5EA 4HOHA 3DUKA 3AHSA 3MPHA 1I2GA 1R4CA 5LC6A 4AEQA 1JN5A 1QVF2 3HOHA 3ZG0A 3M8CA 4HM1B 1YIT3 2P38A 1W7CA 2ML5A 1J2BA 2H0GA 4FMBA 1RN4A 2GXFA 2O9UX 3F8HA 3CU3A 5CLKA 1Z1SA 1BSAA 3FKAA 3GAXA 5AEUB 1VQP3 8RNTA 3JUPA 3UB1A 1EKMA 3ALAA 4LZIA 2R4IA 4WHAA 3CC73 4RNTA 5FGOA 5CK6A 1JRQA 1FYSA 1YGEA 2CX0A 1RGLA 2STDA 3AHWA 3HI7A 2FXTA 5IG4A 4O2HA 1AVLA 2BMQB 3JUMA 1KWIA 1OGZA 3LOYA 4EW5A 1NDOB 4XBYA 2I9WA 1KC84 5EEOA 5AYRB 1Q864 4MMZB 1YVBI 2A15A 2ZL8A 3GZXB 4N6LA 2WO0A 2CW9A 3J7Yd 3NBBA 5IF6A 4XBXA 3X41A 4EV5A 2B1XB 1WQLB 3DGLA 2CG1A 1JBRA 1JN5B 1YJ93 1BNSA 1CYUA 1HKXA 4RNYA 4TX4A 1ZX2A 3K5TA 1RN7A 4GSPA 1CQSA 3HIIA 4K61A 3RNTA 1YJW3 1E3VA 3D4AA 3LZAA 2KF6A 1LOYA 3CC43 1RGGA 5AI1A 1ZGXA 3NV0B 5KP3A 5KP4A 4CDLA 1I3IA 3BIRA 5JPPA 2LQVA 1S723 1JB2A 4BU4A 4EBGA 1IVUA 2BU4A 2GEXA 2K54A 2HMJB 1OPYA 1QJGA 3KIIA 3SXXA 1OHOA 3ZFZA 2F4YA 5G1LA 3GZRA 3CCR3 3OX9A 1CYVA 1TTOA 3DY5A 2HMOB 1US1A 1RMSA 3NM2A 1TU5A 1VQO3 4N3VA 1R4YA 1WTHA 5LC7A 3WA2X 1RGCA 3DM8A 1T2HA 2C4BA 1UCJA 1JV2B 1W4NA 2W0QA 1LXEA 3FLJA 3VGNA 3DZLA 2ZDJA 1O7HB 3LT9A 3MYTA 1Q7HA 3SOYA 1QAKA 3NM7A 1V58A 3DGOA 2D1WA 1GOVA 1RGHA 1M9GA 1T5YA 3CMA3 3BU4A 3IMAB 3FG4A 5CF2A 4R9LA 1WMOA 2CC3A 3Q2PA 5IEOA 5HOHA 1N8R4 1O7NB 1N8QA 5IERA 1GSPA 3PYJA 3K7CA 1I2EA 2MF7A 1BSEA 1BOXA 1RN1A 3BNCA 1MNLA 2XFSA 3KSPA 2Z7AA 1A2KA 1RGFA 5EQLA 1TP6A 1UUVB 2J8XB 3UNLA 2XGLA 2KF3A 3EHCA 2CWVA 2AAEA 2M7OA 5D82A 3NBJA 1B27A 3AGOA 3GRDA 1LVNA 3LH4A 1K41A 1Q40A 4H61A 2H0HA 3HIGA 4N6UA 3S67A 1PU4A 1C7HA 1O7WB 1C54A 1BNGA 2E2UA 3DH2A 1NB3I 3F7XA 1X1YA 3EJVA 1YJN3 5IG0A 3L0RA 2W9PA 3OXAA 1L5GB 1T2IA 1OF5B 5IG3A 3CCL3 5RNTA 3WOEB 1ROAA 3OW22 1X1UA 1K28A 2UUGC 2AADA 1O7MB 1Y4KA 1RGAA 2KRTA 3KN4A 3LT8A 4JRFA 3ZG5A 1LRAA 1W2B2 1RCLA 4BIRA 1I0VA 4HZBB 4PEJA 1S5AA 1UGIA 1YGWA 3A76A 1Q7Y4 1AV4A 1TRPA 1O7GB 2RSXA 2W2CA
chains in the Genus database with same CATH topology
1CEWI 1DMMA 2OTL3 2CFDA 2FGTA 5AIGA 4XBTA 4K1UA 1FGRA 3NXJA 3G6E3 2RGQA 4JF8A 5KP1A 1W00A 4IPBA 1EQKA 4FMCA 1Q40B 2L4VA 1SQWA 2PZVA 1JNQA 2XR8B 1IT7A 5JBSA 3OWUA 2E2TA 3PCSA 1STDA 1FGTA 1A2VA 3I0YA 4KFFA 3CPOA 1OGXA 1QMAA 3K0ZA 3QK9A 4RNZA 4KZ1A 4FR9A 3VSYA 1IK3A 4BTYA 2MC8A 1ROVA 2F99A 3O8YA 3MG2A 4XB5A 2B24B 3DGMA 1IV7A 3JUNA 3RDEA 4LEHA 1FGMA 3SX1A 5IENA 1FGOA 1SIIA 1VQM3 3SLUA 3EBTA 1N5HA 1TFKA 2HMMB 3FG1A 5ELUA 1VQ83 3MSOA 3WDGB 2YFIB 1E3RA 4KVHA 2W03A 2C10A 4KFEA 3BLZA 2PNCA 3PZWA 1E97A 3PS8A 2OOVA 2O3OA 5AYSC 2OQEC 3EN8A 1Q42A 1AVKA 3CXC2 1D6ZA 2GU3A 4L8OA 4U13A 4OUQA 1Q814 3OWSA 3PXMA 1PFPA 1AR0A 4X2OA 4L7KA 4OK0A 3F9SA 3MG1A 4EXRA 5BXQA 3V98A 5IEPA 2YX9A 3B7CA 3HK4A 4N6OB 4RZMA 2BO9B 3MG3A 3Q90A 1ZO2A 1M904 2CFKA 2WGQA 3DGNA 3S28A 4EYCA 2Y73A 1SPUA 3N54B 3DXOA 2BT3A 4HM7B 5FW5A 2CHCA 2IMJA 3LXUX 1A67A 4HM0B 3KKGA 3X40A 1WMPA 3RGAA 2KXGA 1TFOA 4WFOA 1YIJ3 1K8A4 4HM3B 2W6JH 4NHFA 1RKYA 4IIAA 3SEDA 3LYGA 3I553 3U1WA 3CME3 3CCQ3 1IQYA 1VQ53 4LMIA 4HM6B 2CWTA 1W6YA 2KCDA 4HVNA 4FCZA 5A0OB 1W2ZA 3OWYA 3NUVA 2CKFB 2OTJ3 1QAFA 3FH1A 5I97A 2IUJA 3S5CA 3F7SA 1DVDA 3EB8A 4FMDA 1U8CB 2ML6A 5EVHA 3KZTA 3JUOA 4R9KA 3UL6A 3T0UA 1VQ63 1DMQA 1ULJB 2V1LA 2JQ5A 3BNEA 3FCSB 1NU3A 4AKZA 1WMNA 2QA43 2OCTA 1W6GA 3UJMA 5AIIA 5JPUA 3I563 1SJWA 3B8LA 3HZPA 5CF1A 3MKIA 4STDA 5IW9A 3N9HA 1WNHA 4N6V0 3GWRA 5STDA 3MWZA 4RBNA 1GYBA 4HJLB 2P0XA 3EQQB 1UI7A 5D81A 3H51A 2E2VA 4XDWA 3CCS3 2F98A 2CK3H 4LSOA 1D6UA 1U5OA 1VQ73 1JB5A 3CCM3 6STDA 1NJI4 4WWUC 3KSED 3X3XA 2D42A 2XSHB 2SBLA 3EN1B 3BNBA 1OH0A 3WOFB 1IVVA 3FGYA 5D83A 3IJEB 3FG3A 5TGNA 1IQ8A 2C11A 4GL6A 2CG0A 3E99A 1W6CA 3STDA 4HM5B 3B4OA 4N6MA 2HMNB 3G4S3 2F86B 1VQ43 2GBWB 3LTAA 1IDPA 3D9RA 1RJOA 2LYXA 1K734 1HU9A 3PGBA 1IT8A 3CPW2 3S29A 5BVBA 3NQZA 1VZZA 1GD3A 2CIUA 2YFLB 3KFQC 4EV2A 3G0KA 3AMOA 3S27A 3K63A 3JVCA 1F8NA 3ER7A 1MOLA 3LTDA 3MHEA 4HM4B 3RGRA 3X3YA 3GZYB 3V92A 2W9QA 4MJDA 4X2HA 1VQN3 1OUNA 1TIJA 1IU7A 1DVCA 2HMKB 3NX0A 3F8XA 1JB4A 3U97A 4BTXA 2W04A 3G16A 1D6YA 1O7PB 4MEIA 2BNGA 3KE7A 1YI23 1A90A 1KQS2 1GY7A 3NHXA 1IQXA 3F40A 1GD4A 2CFLA 3FSDA 5DREA 2BHMA 3CCU3 3LTBA 1NO3A 4HM2B 2RFRA 1EG9B 2Z6BA 3CNMA 2JDIH 3NV0A 4HZ9B 3G8ZA 3UL5A 2CFWA 4ORLA 4XM4A 2P05A 3AMOB 3X42A 2IUKA 5HGRA 2Z77A 4OVMA 2YFJB 1BUQA 1EA2A 3JUQA 4LGQA 4KFDA 3V99A 2XGNA 5G2GA 2QEX3 3PCRA 1QALA 4J9AA 1W02A 2XF3A 5AEWB 4L8PA 1G96A 1OHPA 4O3VA 2GEYA 4Q53A 3NBRA 2GU1A 2QIYA 3FF2A 3EBYA 4EC6A 4MMYB 4XDVA 5IG5A 3FZWA 4R80A 3CNXA 4H3UA 2HMLB 3BNDA 3EX9A 3QRDA 3SVAA 3N8BA 2W56A 2QGUA 1DMNA 2UX0A 4QWTA 3X3ZA 8CHOA 1W01A 4R4KA 1Q824 3CD63 3H3HA 3G713 2Y74A 3K9MC 1IVXA 4BTWA 3EC9A 3TDGA 4J8TA 3CCJ3 4HYZA 1GY6A 3T8NA 3OV4A 5CXOA 4AKYA 1UI8A 1KSIA 4G1MB 3SOAA 3T8UA 4O8SA 3ROBA 3WODG 1VQ93 1FA3A 4HBRA 4I4KA 5ELJA 1OF5A 3B4PA 2BMOB 3IPTA 2WOHA 4GB5A 4WP5A 5AIHA 1QVG2 4WYKA 1ASKA 3DMCA 3LMLA 2FNQA 2P09A 4O02B 3D3LA 2OOVC 3WA3A 1Q864 4HKVB 1JKGA 3EE1A 4K90B 5AIFA 4FCJA 4MMXB 1N5PA 4K1VA 1M1K4 2W56B 4NREA 3WMDA 3F14A 1NB5I 2XRXB 3FF0A 1NWWA 2WGOA 4CCVA 1JJ22 3LTCA 2GBXB 1GS3A 3GZBA 1V74A 1M1XB 2OQEA 3BB9A 4N6TA 2Q07A 1VQK3 2BMRB 2IA7A 4IT7A 1OHSA 1IV9A 2INXA 1OCVA 1GY5A 2CH9A 2OWPA 1UUWB 1K9M4 2XH9A 1DYUA 4WYKB 2CWUA 5DRVA 1YHQ3 2RCDA 3EF8A 1STFI 1LOXA 2P0MA 2XSOB 2XFTA 1SIHA 3ECFA 3Q1CA 1ULIB 4R1KA 1VQL3 1JKGB 2WOFA 1RRHA 2CFGA 1IVWA 1W5ZA 2XEPA 1FGQA 2Z76A 1N9EA 2K0MA 1N9JA 4HM8B 3CCE3 3HX8A 7STDA 1RRLA 1TUHA 4N6NB 4ZM8A 1OACA 1ISKA 1LNHA 1UW1A 3CC23 4FMAA 3NQYA 4FCMA 3VF1A 3CCV3 1KD14 3DUKA 3MPHA 1R4CA 5LC6A 4AEQA 1JN5A 1QVF2 3M8CA 4HM1B 1YIT3 2P38A 1W7CA 2ML5A 1J2BA 4FMBA 2GXFA 2O9UX 3F8HA 3CU3A 5CLKA 1Z1SA 3GAXA 3FKAA 5AEUB 1VQP3 1FUWA 3JUPA 3UB1A 1EKMA 3ALAA 4LZIA 2R4IA 4WHAA 3CC73 5FGOA 5CK6A 1JRQA 1YGEA 2STDA 3HI7A 2FXTA 5IG4A 4O2HA 1AVLA 2BMQB 3JUMA 1KWIA 1OGZA 3LOYA 1NDOB 4XBYA 2I9WA 1KC84 5EEOA 5AYRB 4MMZB 1YVBI 2A15A 2ZL8A 3GZXB 4N6LA 2WO0A 2CW9A 3J7Yd 3NBBA 5IF6A 4XBXA 3X41A 4EV5A 2B1XB 1WQLB 3DGLA 2CG1A 1JN5B 1YJ93 1CYUA 1HKXA 4RNYA 4TX4A 1ZX2A 3K5TA 1RN7A 1CQSA 3HIIA 4K61A 1YJW3 1E3VA 3LZAA 3CC43 5AI1A 3NV0B 5KP3A 5KP4A 4CDLA 5JPPA 2LQVA 1S723 1JB2A 4EBGA 1IVUA 2GEXA 2K54A 2HMJB 1OPYA 1QJGA 3KIIA 3SXXA 1OHOA 3CCR3 3GZRA 3OX9A 1CYVA 3DY5A 2HMOB 1US1A 3NM2A 1TU5A 1VQO3 4N3VA 1WTHA 5LC7A 3WA2X 3DM8A 1W4NA 1JV2B 3FLJA 2W0QA 1LXEA 3VGNA 3DZLA 2ZDJA 1O7HB 3LT9A 3MYTA 3SOYA 1QAKA 3NM7A 3DGOA 2D1WA 1M9GA 1T5YA 3CMA3 3IMAB 3FG4A 5CF2A 4R9LA 1WMOA 2CC3A 3Q2PA 5IEOA 1N8R4 1O7NB 1N8QA 5IERA 3PYJA 3K7CA 2MF7A 3BNCA 1MNLA 2XFSA 3KSPA 2Z7AA 1A2KA 5EQLA 3UNLA 1TP6A 1UUVB 2XGLA 3EHCA 2CWVA 2M7OA 5D82A 3NBJA 3GRDA 1LVNA 3LH4A 1K41A 1Q40A 4H61A 3HIGA 4N6UA 3S67A 1PU4A 1C7HA 1O7WB 2E2UA 1NB3I 3F7XA 3EJVA 1YJN3 5IG0A 3L0RA 2W9PA 3OXAA 1L5GB 5IG3A 1OF5B 3CCL3 3WOEB 1ROAA 3OW22 1K28A 2KRTA 1O7MB 1Y4KA 3KN4A 3LT8A 4JRFA 1W2B2 4HZBB 1Q7Y4 4PEJA 1S5AA 3A76A 1AV4A 1O7GB 2RSXA 2W2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DMM A;  5AIG A;  4XBT A;  4K1U A;  3NXJ A;  2RGQ A;  5KP1 A;  1W00 A;  1Q40 B;  2PZV A;  2XR8 B;  3OWU A;  1STD A;  3I0Y A;  3CPO A;  1OGX A;  1QMA A;  3K0Z A;  3VSY A;  2F99 A;  3MG2 A;  4XB5 A;  2B24 B;  3JUN A;  4LEH A;  5IEN A;  3EBT A;  2HMM B;  3MSO A;  2YFI B;  1E3R A;  4KVH A;  3BLZ A;  1E97 A;  3EN8 A;  1Q42 A;  4L8O A;  4U13 A;  4OUQ A;  3OWS A;  1AR0 A;  4X2O A;  4L7K A;  3F9S A;  3MG1 A;  5BXQ A;  5IEP A;  3B7C A;  3HK4 A;  4RZM A;  3MG3 A;  3Q90 A;  1ZO2 A;  3DXO A;  5FW5 A;  4HM7 B;  2CHC A;  2IMJ A;  4HM0 B;  3KKG A;  3RGA A;  4HM3 B;  4IIA A;  3SED A;  3LYG A;  4LMI A;  4HM6 B;  1W6Y A;  4HVN A;  3OWY A;  3NUV A;  2CKF B;  3FH1 A;  3S5C A;  3F7S A;  5EVH A;  3KZT A;  3JUO A;  4R9K A;  1DMQ A;  1ULJ B;  2JQ5 A;  1NU3 A;  3UJM A;  5AII A;  5JPU A;  1SJW A;  3B8L A;  3HZP A;  5CF1 A;  3MKI A;  4STD A;  3GWR A;  5STD A;  1GYB A;  4HJL B;  3EQQ B;  5D81 A;  3H51 A;  4XDW A;  2F98 A;  1U5O A;  1JB5 A;  6STD A;  4WWU C;  2XSH B;  3EN1 B;  1OH0 A;  3FGY A;  5D83 A;  5TGN A;  3E99 A;  3STD A;  4HM5 B;  3B4O A;  2HMN B;  2F86 B;  2GBW B;  1IDP A;  3D9R A;  5BVB A;  1VZZ A;  2YFL B;  3G0K A;  3ER7 A;  3MHE A;  3RGR A;  4HM4 B;  3GZY B;  4MJD A;  4X2H A;  1OUN A;  2HMK B;  3F8X A;  1JB4 A;  3G16 A;  1O7P B;  2BNG A;  3KE7 A;  1GY7 A;  3NHX A;  3F40 A;  5DRE A;  3FSD A;  4HM2 B;  2RFR A;  1EG9 B;  3CNM A;  3NV0 A;  4HZ9 B;  3G8Z A;  4ORL A;  4XM4 A;  5HGR A;  2Z77 A;  4OVM A;  2YFJ B;  1BUQ A;  1EA2 A;  3JUQ A;  4LGQ A;  5G2G A;  4J9A A;  1W02 A;  5AEW B;  4L8P A;  1OHP A;  2GEY A;  4Q53 A;  3NBR A;  2QIY A;  3FF2 A;  3EBY A;  5IG5 A;  4XDV A;  3FZW A;  3CNX A;  4H3U A;  2HML B;  3EX9 A;  2QGU A;  1DMN A;  2UX0 A;  8CHO A;  1W01 A;  3H3H A;  3EC9 A;  4J8T A;  3T8N A;  1GY6 A;  3OV4 A;  5CXO A;  3T8U A;  3SOA A;  3ROB A;  4I4K A;  1OF5 A;  3B4P A;  2BMO B;  3IPT A;  4GB5 A;  4WP5 A;  5AIH A;  4WYK A;  1ASK A;  3DMC A;  4HKV B;  1JKG A;  5AIF A;  4FCJ A;  4K1V A;  3WMD A;  3F14 A;  2XRX B;  3FF0 A;  1NWW A;  2GBX B;  1GS3 A;  3GZB A;  3BB9 A;  2BMR B;  1OHS A;  2INX A;  1OCV A;  1GY5 A;  2OWP A;  1UUW B;  5DRV A;  4WYK B;  2RCD A;  3EF8 A;  2XSO B;  3ECF A;  1ULI B;  4R1K A;  1JKG B;  2Z76 A;  4HM8 B;  3HX8 A;  7STD A;  1TUH A;  1ISK A;  4FCM A;  3DUK A;  1JN5 A;  3M8C A;  4HM1 B;  2GXF A;  3F8H A;  3CU3 A;  5CLK A;  1Z1S A;  5AEU B;  3FKA A;  3JUP A;  2R4I A;  5CK6 A;  2STD A;  5IG4 A;  2BMQ B;  3JUM A;  1OGZ A;  1NDO B;  4XBY A;  2I9W A;  2A15 A;  3GZX B;  5IF6 A;  4XBX A;  2B1X B;  1WQL B;  1JN5 B;  1HKX A;  1ZX2 A;  1CQS A;  1E3V A;  3LZA A;  5AI1 A;  3NV0 B;  5KP3 A;  5KP4 A;  4CDL A;  5JPP A;  1JB2 A;  2GEX A;  2K54 A;  2HMJ B;  1OPY A;  1QJG A;  1OHO A;  3GZR A;  3OX9 A;  2HMO B;  3NM2 A;  4N3V A;  3DM8 A;  3FLJ A;  3VGN A;  3DZL A;  1O7H B;  3MYT A;  3SOY A;  5CF2 A;  4R9L A;  5IEO A;  1O7N B;  5IER A;  3K7C A;  3KSP A;  2Z7A A;  1A2K A;  3UNL A;  1UUV B;  1TP6 A;  3EHC A;  5D82 A;  3GRD A;  1K41 A;  1Q40 A;  1C7H A;  1O7W B;  3F7X A;  3EJV A;  5IG0 A;  3OXA A;  5IG3 A;  1OF5 B;  1O7M B;  4HZB B;  4PEJ A;  1S5A A;  3A76 A;  1O7G B;  2W2C A; 
#chains in the Genus database with same CATH topology
 1CEW I;  7RNT A;  1DMM A;  2OTL 3;  2CFD A;  2FGT A;  5AIG A;  4XBT A;  1BNI A;  4K1U A;  1FGR A;  3NXJ A;  3G6E 3;  2RGQ A;  7GSP A;  4JF8 A;  2K3D A;  5KP1 A;  1A2P A;  1W00 A;  3DGY A;  4IPB A;  1EQK A;  4FMC A;  1Q40 B;  2L4V A;  1FUT A;  1SQW A;  2PZV A;  1JNQ A;  2XR8 B;  2RNT A;  1IT7 A;  5JBS A;  2RBI A;  3OWU A;  2KF4 A;  1B2Z A;  1BRS A;  2E2T A;  3PCS A;  1STD A;  1FGT A;  1A2V A;  3I0Y A;  2KAA A;  4KFF A;  3CPO A;  1OGX A;  1QMA A;  1UUG B;  3K0Z A;  3QK9 A;  4RNZ A;  1B3S A;  1UCI A;  4KZ1 A;  4FR9 A;  3VSY A;  1IK3 A;  4BTY A;  2MC8 A;  1ROV A;  1I0X A;  2F99 A;  3O8Y A;  4BL3 A;  3MG2 A;  4XB5 A;  2B24 B;  3DGM A;  1IV7 A;  3JUN A;  3RDE A;  4LEH A;  1FGM A;  3SX1 A;  5IEN A;  1FGO A;  1SII A;  2SAR A;  1G02 A;  6RNT A;  3SLU A;  3EBT A;  1N5H A;  1TFK A;  2HMM B;  3FG1 A;  2F5W A;  3D5I A;  5ELU A;  1MWU A;  1VQ8 3;  3MSO A;  3WDG B;  2YFI B;  3WHO A;  1E3R A;  4KVH A;  1BRN L;  2W03 A;  2C10 A;  4KFE A;  3BLZ A;  2PNC A;  3PZW A;  1E97 A;  3PS8 A;  2OOV A;  2O3O A;  5AYS C;  2F5M A;  1MWS A;  2OQE C;  3EN8 A;  1Q42 A;  1AVK A;  1RNT A;  4DKI A;  1GMR A;  1D6Z A;  3CXC 2;  2GU3 A;  4L8O A;  4U13 A;  4OUQ A;  1Q81 4;  1B20 A;  3OWS A;  3PXM A;  1PFP A;  2ZA4 A;  1AR0 A;  1BRI A;  4X2O A;  4L7K A;  4OK0 A;  3F9S A;  3MG1 A;  4EXR A;  5BXQ A;  3V98 A;  5IEP A;  2YX9 A;  3B7C A;  1RSN A;  3HK4 A;  4N6O B;  4RZM A;  2BO9 B;  3MG3 A;  4LYL B;  1RTU A;  1AY7 A;  3Q90 A;  5M1A A;  1ZO2 A;  1M90 4;  2CFK A;  1B21 A;  2WGQ A;  3DGN A;  3S28 A;  2CX1 A;  4EYC A;  2Y73 A;  1SPU A;  3N54 B;  2BIR A;  3DXO A;  2BT3 A;  4HM7 B;  5FW5 A;  2CHC A;  2IMJ A;  3LXU X;  1A67 A;  4HM0 B;  3KKG A;  1RHL A;  3X40 A;  1B2M A;  1WMP A;  3RGA A;  1SAR A;  2KXG A;  1TFO A;  4WFO A;  1YIJ 3;  1K8A 4;  4HM3 B;  2W6J H;  1BRH A;  4NHF A;  1JBT A;  1RKY A;  4IIA A;  3SED A;  3LYG A;  3I55 3;  3U1W A;  3CME 3;  1PYL A;  3CCQ 3;  1IQY A;  1LQG C;  1FUS A;  4LMI A;  1VQ5 3;  4HM6 B;  2CWT A;  1UDI I;  1W6Y A;  2KCD A;  4HVN A;  4FCZ A;  5A0O B;  1W2Z A;  3OWY A;  3NUV A;  2CKF B;  2OTJ 3;  1QAF A;  3FH1 A;  5I97 A;  1BUJ A;  2IUJ A;  3S5C A;  3F7S A;  1DVD A;  1I70 A;  3EB8 A;  4FMD A;  1U8C B;  2ML6 A;  1BRK A;  2IY2 A;  5EVH A;  1GMP A;  3KZT A;  3JUO A;  4NPB A;  4R9K A;  3D5G A;  3T0U A;  3UL6 A;  1DMQ A;  1ULJ B;  1VQ6 3;  2V1L A;  2JQ5 A;  3BNE A;  3FCS B;  1NU3 A;  1JBS A;  4AKZ A;  1IYY A;  1WMN A;  2QA4 3;  1BNR A;  2OCT A;  1W6G A;  3UJM A;  3D79 A;  1MWR A;  6GSP A;  5AII A;  5JPU A;  3I56 3;  1SJW A;  3B8L A;  3HZP A;  5CF1 A;  3MKI A;  1MGW A;  4STD A;  5IW9 A;  1RGE A;  1BRJ A;  1BAO A;  1WNH A;  3N9H A;  4N6V 0;  3GWR A;  3SYU A;  1BNE A;  5STD A;  3MWZ A;  4RBN A;  1GYB A;  4HJL B;  2P0X A;  1GMQ A;  1RGK A;  3EQQ B;  1UI7 A;  5D81 A;  3H51 A;  2E2V A;  4XDW A;  3CCS 3;  1MWT A;  2F98 A;  2CK3 H;  4LSO A;  1D6U A;  1U5O A;  1UCL A;  1VQ7 3;  3GSP A;  1JB5 A;  3CCM 3;  4ILF A;  2R41 A;  6STD A;  1NJI 4;  1I2F A;  4WWU C;  3KSE D;  9RNT A;  3X3X A;  1BSB A;  2D42 A;  2XSH B;  5BIR A;  1BAN A;  2SBL A;  3BNB A;  1OH0 A;  3EN1 B;  3WOF B;  1IVV A;  3KCH A;  3FGY A;  5D83 A;  3AGN A;  3IJE B;  1FW7 A;  3FG3 A;  5TGN A;  1IQ8 A;  2C11 A;  4GL6 A;  2CG0 A;  3E99 A;  1W6C A;  3STD A;  2IYJ A;  4HM5 B;  3B4O A;  4N6M A;  1YNV X;  1T3B A;  2HMN B;  2F86 B;  1EEJ A;  2GBW B;  3G4S 3;  1BU4 A;  1VQ4 3;  3LTA A;  1IDP A;  3D9R A;  1RJO A;  2LYX A;  1K73 4;  1HU9 A;  3PGB A;  1IT8 A;  1FZU A;  3S29 A;  3CPW 2;  5BVB A;  2F56 A;  3NQZ A;  1VZZ A;  1GD3 A;  1LQM B;  2CIU A;  2YFL B;  3KFQ C;  5G1K A;  3G0K A;  4EV2 A;  3AMO A;  3S27 A;  3K63 A;  3JVC A;  1F8N A;  3ER7 A;  1MOL A;  3LTD A;  3MHE A;  4HM4 B;  3RGR A;  3X3Y A;  3GZY B;  3V92 A;  2W9Q A;  4MJD A;  4X2H A;  5M18 A;  1VQN 3;  1OUN A;  1TIJ A;  1IU7 A;  1DVC A;  1I3F A;  2HMK B;  3F8X A;  3NX0 A;  4CJN A;  1JB4 A;  3U97 A;  4BTX A;  1FUW A;  2W04 A;  3G16 A;  1D6Y A;  1O7P B;  4MEI A;  2BNG A;  3KE7 A;  1YI2 3;  1A90 A;  1KQS 2;  1GY7 A;  3NHX A;  1UGH I;  1IQX A;  1UCK A;  3F40 A;  1GD4 A;  1B2X A;  1TJD A;  2CFL A;  3FSD A;  5DRE A;  5BU4 A;  2BHM A;  3CCU 3;  1LNI A;  3LTB A;  1NO3 A;  4HM2 B;  1X1X A;  2RFR A;  1EUI C;  1EG9 B;  2Z6B A;  3CNM A;  2JDI H;  3NV0 A;  4HZ9 B;  3G8Z A;  3UL5 A;  2CFW A;  1BSD A;  4ORL A;  4XM4 A;  1BSC A;  2P05 A;  3AMO B;  3X42 A;  2IUK A;  5HGR A;  1TRQ A;  2Z77 A;  4OVM A;  2YFJ B;  1BNJ A;  1BUQ A;  1EA2 A;  3JUQ A;  4LGQ A;  4KFD A;  3V99 A;  2XGN A;  5G2G A;  2QEX 3;  3PCR A;  1QAL A;  4J9A A;  1W02 A;  2XF3 A;  5AEW B;  4L8P A;  1G96 A;  1OHP A;  4O3V A;  2GSP A;  2GEY A;  4Q53 A;  3NBR A;  2GU1 A;  1HZ1 A;  1MGR A;  1PY3 A;  2QIY A;  3FF2 A;  4I5Q A;  1BIR A;  3EBY A;  4EC6 A;  4MMY B;  4XDV A;  5IG5 A;  3FZW A;  4R80 A;  3CNX A;  4H3U A;  2HML B;  1LOV A;  1G0T A;  1RDS A;  1B2S A;  3BND A;  3EX9 A;  3QRD A;  1JZD A;  1VQQ A;  1BRG A;  4HAA A;  3SVA A;  2KF5 A;  3N8B A;  2W56 A;  2QGU A;  1DMN A;  1DET A;  2UX0 A;  4QWT A;  3X3Z A;  8CHO A;  1W01 A;  4R4K A;  1Q82 4;  3CD6 3;  3H3H A;  1V57 A;  3G71 3;  2Y74 A;  3K9M C;  1IVX A;  4BTW A;  3EC9 A;  3TDG A;  1RLS A;  1ZS7 A;  1Q9E A;  4J8T A;  3CCJ 3;  4HYZ A;  1GY6 A;  3T8N A;  3OV4 A;  2H0I A;  5CXO A;  4AKY A;  1UI8 A;  1KSI A;  4G1M B;  3SOA A;  3T8U A;  4O8S A;  3ROB A;  3WOD G;  1VQ9 3;  1FA3 A;  1LOW A;  3Q3F A;  4HBR A;  5M19 A;  4I4K A;  5ELJ A;  1OF5 A;  3B4P A;  2BMO B;  3IPT A;  2WOH A;  4GB5 A;  4WP5 A;  5AIH A;  1QVG 2;  4WYK A;  1ASK A;  3DMC A;  3LML A;  2FNQ A;  2P09 A;  4O02 B;  3D3L A;  2OOV C;  1BGS A;  3WA3 A;  3WR2 A;  1GOU A;  1JKG A;  3EE1 A;  2UGI A;  4HKV B;  4K90 B;  5AIF A;  4FCJ A;  1I8V A;  2L1S A;  4MMX B;  4J5K A;  1N5P A;  4K1V A;  4KT3 B;  2W56 B;  1M1K 4;  1RCK A;  1BNF A;  4J5G A;  1GOY A;  4NRE A;  3WMD A;  1BVI A;  3F14 A;  1NB5 I;  1HYF A;  2XRX B;  3FF0 A;  4BL2 A;  1RNB A;  1NWW A;  2WGO A;  4CCV A;  1JJ2 2;  3LTC A;  2GBX B;  1DE3 A;  1GS3 A;  1AQZ A;  3GZB A;  1V74 A;  1M1X B;  4GHO A;  3BB9 A;  2OQE A;  4N6T A;  2Q07 A;  1VQK 3;  2BMR B;  2IA7 A;  3URP A;  4IT7 A;  1OHS A;  1IV9 A;  2INX A;  1OCV A;  1GY5 A;  1NNV A;  1CH0 A;  2CH9 A;  2OWP A;  1UUW B;  1B2U A;  1K9M 4;  2XH9 A;  1DYU A;  4WYK B;  2CWU A;  5DRV A;  1YHQ 3;  2RCD A;  1YVS A;  1STF I;  1LOX A;  3EF8 A;  2P0M A;  2XSO B;  2XFT A;  1SIH A;  3ECF A;  3Q1C A;  1VQM 3;  1ULI B;  4R1K A;  1VQL 3;  1JKG B;  2WOF A;  5GSP A;  1RRH A;  2CFG A;  1IVW A;  1W5Z A;  4CPK A;  2XEP A;  1FGQ A;  2Z76 A;  1N9E A;  1X1W A;  1N9J A;  2K0M A;  4HM8 B;  3CCE 3;  3HX8 A;  7STD A;  1RRL A;  1TUH A;  4N6N B;  4ZM8 A;  1OAC A;  1ISK A;  1LNH A;  1UW1 A;  1JZO A;  4FMA A;  3CC2 3;  3NQY A;  4FCM A;  3VF1 A;  2ZHX B;  3CCV 3;  2HOH A;  1KD1 4;  3A5E A;  4HOH A;  3DUK A;  3AHS A;  3MPH A;  1I2G A;  1R4C A;  5LC6 A;  4AEQ A;  1JN5 A;  1QVF 2;  3HOH A;  3ZG0 A;  3M8C A;  4HM1 B;  1YIT 3;  2P38 A;  1W7C A;  2ML5 A;  1J2B A;  2H0G A;  4FMB A;  1RN4 A;  2GXF A;  2O9U X;  3F8H A;  3CU3 A;  5CLK A;  1Z1S A;  1BSA A;  3FKA A;  3GAX A;  5AEU B;  1VQP 3;  8RNT A;  3JUP A;  3UB1 A;  1EKM A;  3ALA A;  4LZI A;  2R4I A;  4WHA A;  3CC7 3;  4RNT A;  5FGO A;  5CK6 A;  1JRQ A;  1FYS A;  1YGE A;  2CX0 A;  1RGL A;  2STD A;  3AHW A;  3HI7 A;  2FXT A;  5IG4 A;  4O2H A;  1AVL A;  2BMQ B;  3JUM A;  1KWI A;  1OGZ A;  3LOY A;  4EW5 A;  1NDO B;  4XBY A;  2I9W A;  1KC8 4;  5EEO A;  5AYR B;  1Q86 4;  4MMZ B;  1YVB I;  2A15 A;  2ZL8 A;  3GZX B;  4N6L A;  2WO0 A;  2CW9 A;  3J7Y d;  3NBB A;  5IF6 A;  4XBX A;  3X41 A;  4EV5 A;  2B1X B;  1WQL B;  3DGL A;  2CG1 A;  1JBR A;  1JN5 B;  1YJ9 3;  1BNS A;  1CYU A;  1HKX A;  4RNY A;  4TX4 A;  1ZX2 A;  3K5T A;  1RN7 A;  4GSP A;  1CQS A;  3HII A;  4K61 A;  3RNT A;  1YJW 3;  1E3V A;  3D4A A;  3LZA A;  2KF6 A;  1LOY A;  3CC4 3;  1RGG A;  5AI1 A;  1ZGX A;  3NV0 B;  5KP3 A;  5KP4 A;  4CDL A;  1I3I A;  3BIR A;  5JPP A;  2LQV A;  1S72 3;  1JB2 A;  4BU4 A;  4EBG A;  1IVU A;  2BU4 A;  2GEX A;  2K54 A;  2HMJ B;  1OPY A;  1QJG A;  3KII A;  3SXX A;  1OHO A;  3ZFZ A;  2F4Y A;  5G1L A;  3GZR A;  3CCR 3;  3OX9 A;  1CYV A;  1TTO A;  3DY5 A;  2HMO B;  1US1 A;  1RMS A;  3NM2 A;  1TU5 A;  1VQO 3;  4N3V A;  1R4Y A;  1WTH A;  5LC7 A;  3WA2 X;  1RGC A;  3DM8 A;  1T2H A;  2C4B A;  1UCJ A;  1JV2 B;  1W4N A;  2W0Q A;  1LXE A;  3FLJ A;  3VGN A;  3DZL A;  2ZDJ A;  1O7H B;  3LT9 A;  3MYT A;  1Q7H A;  3SOY A;  1QAK A;  3NM7 A;  1V58 A;  3DGO A;  2D1W A;  1GOV A;  1RGH A;  1M9G A;  1T5Y A;  3CMA 3;  3BU4 A;  3IMA B;  3FG4 A;  5CF2 A;  4R9L A;  1WMO A;  2CC3 A;  3Q2P A;  5IEO A;  5HOH A;  1N8R 4;  1O7N B;  1N8Q A;  5IER A;  1GSP A;  3PYJ A;  3K7C A;  1I2E A;  2MF7 A;  1BSE A;  1BOX A;  1RN1 A;  3BNC A;  1MNL A;  2XFS A;  3KSP A;  2Z7A A;  1A2K A;  1RGF A;  5EQL A;  1TP6 A;  1UUV B;  2J8X B;  3UNL A;  2XGL A;  2KF3 A;  3EHC A;  2CWV A;  2AAE A;  2M7O A;  5D82 A;  3NBJ A;  1B27 A;  3AGO A;  3GRD A;  1LVN A;  3LH4 A;  1K41 A;  1Q40 A;  4H61 A;  2H0H A;  3HIG A;  4N6U A;  3S67 A;  1PU4 A;  1C7H A;  1O7W B;  1C54 A;  1BNG A;  2E2U A;  3DH2 A;  1NB3 I;  3F7X A;  1X1Y A;  3EJV A;  1YJN 3;  5IG0 A;  3L0R A;  2W9P A;  3OXA A;  1L5G B;  1T2I A;  1OF5 B;  5IG3 A;  3CCL 3;  5RNT A;  3WOE B;  1ROA A;  3OW2 2;  1X1U A;  1K28 A;  2UUG C;  2AAD A;  1O7M B;  1Y4K A;  1RGA A;  2KRT A;  3KN4 A;  3LT8 A;  4JRF A;  3ZG5 A;  1LRA A;  1W2B 2;  1RCL A;  4BIR A;  1I0V A;  4HZB B;  4PEJ A;  1S5A A;  1UGI A;  1YGW A;  3A76 A;  1Q7Y 4;  1AV4 A;  1TRP A;  1O7G B;  2RSX A;  2W2C A; 
#chains in the Genus database with same CATH homology
 1CEW I;  1DMM A;  2OTL 3;  2CFD A;  2FGT A;  5AIG A;  4XBT A;  4K1U A;  1FGR A;  3NXJ A;  3G6E 3;  2RGQ A;  4JF8 A;  5KP1 A;  1W00 A;  4IPB A;  1EQK A;  4FMC A;  1Q40 B;  2L4V A;  1SQW A;  2PZV A;  1JNQ A;  2XR8 B;  1IT7 A;  5JBS A;  3OWU A;  2E2T A;  3PCS A;  1STD A;  1FGT A;  1A2V A;  3I0Y A;  4KFF A;  3CPO A;  1OGX A;  1QMA A;  3K0Z A;  3QK9 A;  4RNZ A;  4KZ1 A;  4FR9 A;  3VSY A;  1IK3 A;  4BTY A;  2MC8 A;  1ROV A;  2F99 A;  3O8Y A;  3MG2 A;  4XB5 A;  2B24 B;  3DGM A;  1IV7 A;  3JUN A;  3RDE A;  4LEH A;  1FGM A;  3SX1 A;  5IEN A;  1FGO A;  1SII A;  1VQM 3;  3SLU A;  3EBT A;  1N5H A;  1TFK A;  2HMM B;  3FG1 A;  5ELU A;  1VQ8 3;  3MSO A;  3WDG B;  2YFI B;  1E3R A;  4KVH A;  2W03 A;  2C10 A;  4KFE A;  3BLZ A;  2PNC A;  3PZW A;  1E97 A;  3PS8 A;  2OOV A;  2O3O A;  5AYS C;  2OQE C;  3EN8 A;  1Q42 A;  1AVK A;  3CXC 2;  1D6Z A;  2GU3 A;  4L8O A;  4U13 A;  4OUQ A;  1Q81 4;  3OWS A;  3PXM A;  1PFP A;  1AR0 A;  4X2O A;  4L7K A;  4OK0 A;  3F9S A;  3MG1 A;  4EXR A;  5BXQ A;  3V98 A;  5IEP A;  2YX9 A;  3B7C A;  3HK4 A;  4N6O B;  4RZM A;  2BO9 B;  3MG3 A;  3Q90 A;  1ZO2 A;  1M90 4;  2CFK A;  2WGQ A;  3DGN A;  3S28 A;  4EYC A;  2Y73 A;  1SPU A;  3N54 B;  3DXO A;  2BT3 A;  4HM7 B;  5FW5 A;  2CHC A;  2IMJ A;  3LXU X;  1A67 A;  4HM0 B;  3KKG A;  3X40 A;  1WMP A;  3RGA A;  2KXG A;  1TFO A;  4WFO A;  1YIJ 3;  1K8A 4;  4HM3 B;  2W6J H;  4NHF A;  1RKY A;  4IIA A;  3SED A;  3LYG A;  3I55 3;  3U1W A;  3CME 3;  3CCQ 3;  1IQY A;  1VQ5 3;  4LMI A;  4HM6 B;  2CWT A;  1W6Y A;  2KCD A;  4HVN A;  4FCZ A;  5A0O B;  1W2Z A;  3OWY A;  3NUV A;  2CKF B;  2OTJ 3;  1QAF A;  3FH1 A;  5I97 A;  2IUJ A;  3S5C A;  3F7S A;  1DVD A;  3EB8 A;  4FMD A;  1U8C B;  2ML6 A;  5EVH A;  3KZT A;  3JUO A;  4R9K A;  3UL6 A;  3T0U A;  1VQ6 3;  1DMQ A;  1ULJ B;  2V1L A;  2JQ5 A;  3BNE A;  3FCS B;  1NU3 A;  4AKZ A;  1WMN A;  2QA4 3;  2OCT A;  1W6G A;  3UJM A;  5AII A;  5JPU A;  3I56 3;  1SJW A;  3B8L A;  3HZP A;  5CF1 A;  3MKI A;  4STD A;  5IW9 A;  3N9H A;  1WNH A;  4N6V 0;  3GWR A;  5STD A;  3MWZ A;  4RBN A;  1GYB A;  4HJL B;  2P0X A;  3EQQ B;  1UI7 A;  5D81 A;  3H51 A;  2E2V A;  4XDW A;  3CCS 3;  2F98 A;  2CK3 H;  4LSO A;  1D6U A;  1U5O A;  1VQ7 3;  1JB5 A;  3CCM 3;  6STD A;  1NJI 4;  4WWU C;  3KSE D;  3X3X A;  2D42 A;  2XSH B;  2SBL A;  3EN1 B;  3BNB A;  1OH0 A;  3WOF B;  1IVV A;  3FGY A;  5D83 A;  3IJE B;  3FG3 A;  5TGN A;  1IQ8 A;  2C11 A;  4GL6 A;  2CG0 A;  3E99 A;  1W6C A;  3STD A;  4HM5 B;  3B4O A;  4N6M A;  2HMN B;  3G4S 3;  2F86 B;  1VQ4 3;  2GBW B;  3LTA A;  1IDP A;  3D9R A;  1RJO A;  2LYX A;  1K73 4;  1HU9 A;  3PGB A;  1IT8 A;  3CPW 2;  3S29 A;  5BVB A;  3NQZ A;  1VZZ A;  1GD3 A;  2CIU A;  2YFL B;  3KFQ C;  4EV2 A;  3G0K A;  3AMO A;  3S27 A;  3K63 A;  3JVC A;  1F8N A;  3ER7 A;  1MOL A;  3LTD A;  3MHE A;  4HM4 B;  3RGR A;  3X3Y A;  3GZY B;  3V92 A;  2W9Q A;  4MJD A;  4X2H A;  1VQN 3;  1OUN A;  1TIJ A;  1IU7 A;  1DVC A;  2HMK B;  3NX0 A;  3F8X A;  1JB4 A;  3U97 A;  4BTX A;  2W04 A;  3G16 A;  1D6Y A;  1O7P B;  4MEI A;  2BNG A;  3KE7 A;  1YI2 3;  1A90 A;  1KQS 2;  1GY7 A;  3NHX A;  1IQX A;  3F40 A;  1GD4 A;  2CFL A;  3FSD A;  5DRE A;  2BHM A;  3CCU 3;  3LTB A;  1NO3 A;  4HM2 B;  2RFR A;  1EG9 B;  2Z6B A;  3CNM A;  2JDI H;  3NV0 A;  4HZ9 B;  3G8Z A;  3UL5 A;  2CFW A;  4ORL A;  4XM4 A;  2P05 A;  3AMO B;  3X42 A;  2IUK A;  5HGR A;  2Z77 A;  4OVM A;  2YFJ B;  1BUQ A;  1EA2 A;  3JUQ A;  4LGQ A;  4KFD A;  3V99 A;  2XGN A;  5G2G A;  2QEX 3;  3PCR A;  1QAL A;  4J9A A;  1W02 A;  2XF3 A;  5AEW B;  4L8P A;  1G96 A;  1OHP A;  4O3V A;  2GEY A;  4Q53 A;  3NBR A;  2GU1 A;  2QIY A;  3FF2 A;  3EBY A;  4EC6 A;  4MMY B;  4XDV A;  5IG5 A;  3FZW A;  4R80 A;  3CNX A;  4H3U A;  2HML B;  3BND A;  3EX9 A;  3QRD A;  3SVA A;  3N8B A;  2W56 A;  2QGU A;  1DMN A;  2UX0 A;  4QWT A;  3X3Z A;  8CHO A;  1W01 A;  4R4K A;  1Q82 4;  3CD6 3;  3H3H A;  3G71 3;  2Y74 A;  3K9M C;  1IVX A;  4BTW A;  3EC9 A;  3TDG A;  4J8T A;  3CCJ 3;  4HYZ A;  1GY6 A;  3T8N A;  3OV4 A;  5CXO A;  4AKY A;  1UI8 A;  1KSI A;  4G1M B;  3SOA A;  3T8U A;  4O8S A;  3ROB A;  3WOD G;  1VQ9 3;  1FA3 A;  4HBR A;  4I4K A;  5ELJ A;  1OF5 A;  3B4P A;  2BMO B;  3IPT A;  2WOH A;  4GB5 A;  4WP5 A;  5AIH A;  1QVG 2;  4WYK A;  1ASK A;  3DMC A;  3LML A;  2FNQ A;  2P09 A;  4O02 B;  3D3L A;  2OOV C;  3WA3 A;  1Q86 4;  4HKV B;  1JKG A;  3EE1 A;  4K90 B;  5AIF A;  4FCJ A;  4MMX B;  1N5P A;  4K1V A;  1M1K 4;  2W56 B;  4NRE A;  3WMD A;  3F14 A;  1NB5 I;  2XRX B;  3FF0 A;  1NWW A;  2WGO A;  4CCV A;  1JJ2 2;  3LTC A;  2GBX B;  1GS3 A;  3GZB A;  1V74 A;  1M1X B;  2OQE A;  3BB9 A;  4N6T A;  2Q07 A;  1VQK 3;  2BMR B;  2IA7 A;  4IT7 A;  1OHS A;  1IV9 A;  2INX A;  1OCV A;  1GY5 A;  2CH9 A;  2OWP A;  1UUW B;  1K9M 4;  2XH9 A;  1DYU A;  4WYK B;  2CWU A;  5DRV A;  1YHQ 3;  2RCD A;  3EF8 A;  1STF I;  1LOX A;  2P0M A;  2XSO B;  2XFT A;  1SIH A;  3ECF A;  3Q1C A;  1ULI B;  4R1K A;  1VQL 3;  1JKG B;  2WOF A;  1RRH A;  2CFG A;  1IVW A;  1W5Z A;  2XEP A;  1FGQ A;  2Z76 A;  1N9E A;  2K0M A;  1N9J A;  4HM8 B;  3CCE 3;  3HX8 A;  7STD A;  1RRL A;  1TUH A;  4N6N B;  4ZM8 A;  1OAC A;  1ISK A;  1LNH A;  1UW1 A;  3CC2 3;  4FMA A;  3NQY A;  4FCM A;  3VF1 A;  3CCV 3;  1KD1 4;  3DUK A;  3MPH A;  1R4C A;  5LC6 A;  4AEQ A;  1JN5 A;  1QVF 2;  3M8C A;  4HM1 B;  1YIT 3;  2P38 A;  1W7C A;  2ML5 A;  1J2B A;  4FMB A;  2GXF A;  2O9U X;  3F8H A;  3CU3 A;  5CLK A;  1Z1S A;  3GAX A;  3FKA A;  5AEU B;  1VQP 3;  1FUW A;  3JUP A;  3UB1 A;  1EKM A;  3ALA A;  4LZI A;  2R4I A;  4WHA A;  3CC7 3;  5FGO A;  5CK6 A;  1JRQ A;  1YGE A;  2STD A;  3HI7 A;  2FXT A;  5IG4 A;  4O2H A;  1AVL A;  2BMQ B;  3JUM A;  1KWI A;  1OGZ A;  3LOY A;  1NDO B;  4XBY A;  2I9W A;  1KC8 4;  5EEO A;  5AYR B;  4MMZ B;  1YVB I;  2A15 A;  2ZL8 A;  3GZX B;  4N6L A;  2WO0 A;  2CW9 A;  3J7Y d;  3NBB A;  5IF6 A;  4XBX A;  3X41 A;  4EV5 A;  2B1X B;  1WQL B;  3DGL A;  2CG1 A;  1JN5 B;  1YJ9 3;  1CYU A;  1HKX A;  4RNY A;  4TX4 A;  1ZX2 A;  3K5T A;  1RN7 A;  1CQS A;  3HII A;  4K61 A;  1YJW 3;  1E3V A;  3LZA A;  3CC4 3;  5AI1 A;  3NV0 B;  5KP3 A;  5KP4 A;  4CDL A;  5JPP A;  2LQV A;  1S72 3;  1JB2 A;  4EBG A;  1IVU A;  2GEX A;  2K54 A;  2HMJ B;  1OPY A;  1QJG A;  3KII A;  3SXX A;  1OHO A;  3CCR 3;  3GZR A;  3OX9 A;  1CYV A;  3DY5 A;  2HMO B;  1US1 A;  3NM2 A;  1TU5 A;  1VQO 3;  4N3V A;  1WTH A;  5LC7 A;  3WA2 X;  3DM8 A;  1W4N A;  1JV2 B;  3FLJ A;  2W0Q A;  1LXE A;  3VGN A;  3DZL A;  2ZDJ A;  1O7H B;  3LT9 A;  3MYT A;  3SOY A;  1QAK A;  3NM7 A;  3DGO A;  2D1W A;  1M9G A;  1T5Y A;  3CMA 3;  3IMA B;  3FG4 A;  5CF2 A;  4R9L A;  1WMO A;  2CC3 A;  3Q2P A;  5IEO A;  1N8R 4;  1O7N B;  1N8Q A;  5IER A;  3PYJ A;  3K7C A;  2MF7 A;  3BNC A;  1MNL A;  2XFS A;  3KSP A;  2Z7A A;  1A2K A;  5EQL A;  3UNL A;  1TP6 A;  1UUV B;  2XGL A;  3EHC A;  2CWV A;  2M7O A;  5D82 A;  3NBJ A;  3GRD A;  1LVN A;  3LH4 A;  1K41 A;  1Q40 A;  4H61 A;  3HIG A;  4N6U A;  3S67 A;  1PU4 A;  1C7H A;  1O7W B;  2E2U A;  1NB3 I;  3F7X A;  3EJV A;  1YJN 3;  5IG0 A;  3L0R A;  2W9P A;  3OXA A;  1L5G B;  5IG3 A;  1OF5 B;  3CCL 3;  3WOE B;  1ROA A;  3OW2 2;  1K28 A;  2KRT A;  1O7M B;  1Y4K A;  3KN4 A;  3LT8 A;  4JRF A;  1W2B 2;  4HZB B;  1Q7Y 4;  4PEJ A;  1S5A A;  3A76 A;  1AV4 A;  1O7G B;  2RSX A;  2W2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...