3FGYA

Crystal structure of a ntf2-like protein (bxe_b1094) from burkholderia xenovorans lb400 at 1.59 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
GMSTQENVQIVKDFFAAMGRGDKKGLLAVSAEDIEWIIPGEWPLAGTHRGHAALAALLQKASEMVEISYPEPPEFVAQGERVLVVGFATGRVKSTNRTFEDDWVFAITVRKSKVTSIREYIDTLALARATNFNAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function. (YP_554211.1) from BURKHOLDERIA XENOVORANS LB400 at 1.59 A resolution
rcsb
source organism Burkholderia xenovorans lb400
molecule tags Unknown function
total genus 38
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3fgyA00
3EHCA 1GY7A 3OX9A 5EVHA 5STDA 3JUPA 3NXJA 4HZBB 3NM2A 5AI1A 2B1XB 1NU3A 1O7PB 4KVHA 1JB4A 3DMCA 3H51A 1QMAA 4L7KA 1NWWA 1JB5A 2OWPA 2UX0A 2RCDA 3BLZA 3HZPA 1W6YA 5TGNA 2HMLB 3K7CA 5KP3A 4STDA 3NV0A 2BMRB 1IDPA 1O7NB 3JUNA 4X2HA 3CU3A 3ECFA 3FH1A 2XR8B 4LEHA 4L8OA 4LGQA 5IEOA 3OWYA 1JKGA 1OGXA 4OVMA 2HMJB 1CQSA 3RGRA 3KZTA 3MSOA 3FKAA 1ZO2A 3JUMA 3F9SA 4ORLA 5AEUB 3FF2A 3DZLA 3JUOA 1W00A 4Q53A 1OF5A 3G0KA 3F8XA 3EN1B 3VSYA 2Z7AA 5AEWB 3BB9A 4N3VA 4FCJA 5JPUA 2IMJA 3SOYA 3STDA 2STDA 5CLKA 3KE7A 4HM7B 4H3UA 4U13A 1STDA 3RGAA 2GBXB 4XBXA 4X2OA 3VGNA 4HZ9B 1JN5B 1ULIB 1OHPA 3UNLA 3K0ZA 4WYKB 2YFIB 2R4IA 5DREA 1ZX2A 3F8HA 5D82A 2F98A 4XM4A 3ER7A 4R1KA 2CKFB 2HMOB 2B24B 5JPPA 1WQLB 1ULJB 2CHCA 3D9RA 3B4OA 1DMQA 3S5CA 3HX8A 1Q40B 3I0YA 1TP6A 3GZXB 3A76A 1VZZA 3CNXA 4MJDA 3LYGA 3GZYB 3H3HA 3GZBA 2YFJB 2Z76A 5AIFA 4XDVA 2Z77A 1OHSA 5KP4A 4XBYA 1E3RA 3JUQA 3Q90A 3MHEA 3M8CA 5G2GA 2A15A 1O7HB 1OH0A 5IENA 5D83A 4IIAA 4K1VA 5IF6A 1GYBA 2W2CA 6STDA 3EX9A 3MG1A 4WWUC 1TUHA 3OV4A 3FLJA 5CF1A 1O7WB 1BUQA 3GRDA 5AIHA 2GBWB 3DXOA 4FCMA 5HGRA 3WMDA 3EQQB 1DMNA 3UJMA 1UUWB 2QGUA 3CNMA 5CF2A 1W01A 5BVBA 2RGQA 4I4KA 4PEJA 1Z1SA 8CHOA 4R9KA 3DM8A 2HMMB 1C7HA 5CXOA 1O7GB 5AIIA 3FF0A 3OXAA 3KKGA 3E99A 3HK4A 4LMIA 3NBRA 1U5OA 3MG3A 1S5AA 2BMOB 2XSHB 3KSPA 2GEXA 5IG4A 3MG2A 1E97A 2HMNB 3MYTA 3F14A 4HJLB 2I9WA 2HMKB 1JN5A 1JB2A 1EG9B 4WYKA 3EN8A 1A2KA 5DRVA 4HM1B 2PZVA 3FZWA 4HM2B 3GWRA 3IPTA 4J8TA 3DUKA 4HKVB 4HM4B 2GEYA 4HM5B 3NUVA 3SEDA 5BXQA 5D81A 4HM0B 3B8LA 3EC9A 3NHXA 1AR0A 4L8PA 1GS3A 1OUNA 1Q40A 2K54A 1ISKA 2XRXB 3NV0B 2JQ5A 5FW5A 1GY6A 5IG0A 3MKIA 1OPYA 2RFRA 3F7XA 3G16A 2GXFA 5AIGA 1UUVB 3EF8A 3F7SA 1K41A 2YFLB 3G8ZA 1JKGB 3LZAA 4J9AA 3CPOA 3EBYA 3ROBA 5IERA 3B4PA 7STDA 3FSDA 1O7MB 2BNGA 4XB5A 5CK6A 3GZRA 1E3VA 4HM6B 1QJGA 4GB5A 2INXA 3T8NA 4WP5A 3B7CA 1OF5B 4OUQA 5IG5A 5IG3A 4CDLA 4R9LA 1Q42A 1OGZA 3OWUA 2F99A 2F86B 2BMQB 3SOAA 1OCVA 1SJWA 1OHOA 4HVNA 3T8UA 1ASKA 4RZMA 5IEPA 2QIYA 1GY5A 3FGYA 1NDOB 3F40A 2XSOB 3EBTA 3OWSA 4HM8B 4XBTA 4K1UA 1HKXA 1DMMA 4XDWA 1W02A 5KP1A 3EJVA 1EA2A 4HM3B
chains in the Genus database with same CATH superfamily
1BGSA 4WFOA 2CFKA 1I2FA 3EHCA 2WO0A 1BRIA 4EV2A 1GY7A 3NM7A 2CFWA 2FXTA 3OX9A 5EVHA 5STDA 3WR2A 4J5GA 3NQZA 3L0RA 3JUPA 3NXJA 1HU9A 2LQVA 3CC73 3K9MC 1HZ1A 1YNVX 3UL6A 3ZG5A 4HOHA 8RNTA 4OK0A 4LYLB 2KRTA 3MWZA 4HZBB 1G96A 3NM2A 3BNDA 5GSPA 4GSPA 2CWTA 2KXGA 5AI1A 5AYSC 1LOWA 2B1XB 1A67A 1NU3A 1O7PB 4KVHA 1I0XA 4RNYA 1QVG2 1W5ZA 3D3LA 2IUJA 1JB4A 1AY7A 2F5MA 1RNBA 3DMCA 3GSPA 3H51A 1QMAA 2CW9A 1RJOA 4BU4A 1X1WA 4L7KA 1NWWA 1JB5A 2OWPA 2UX0A 9RNTA 2CWVA 1EQKA 1QAKA 3DGMA 1M904 2CK3H 2P0MA 2RCDA 1IT7A 3BLZA 1LOXA 1NO3A 3HZPA 1SARA 1W6YA 4KFDA 2Y74A 3S27A 3S29A 5TGNA 2HMLB 1IV9A 3K7CA 3BNBA 2KCDA 1BSAA 5KP3A 2WOFA 2OOVC 4N6LA 4RNTA 1BVIA 1LQMB 4STDA 4EBGA 3PXMA 2XH9A 1JV2B 3NV0A 2FGTA 1GOUA 1SIHA 1IDPA 2BMRB 3D4AA 3DGLA 3AHWA 3X42A 1JBTA 3G4S3 4FMBA 1B2MA 1O7NB 1JJ22 1WTHA 3JUNA 1LRAA 4X2HA 3CU3A 3ECFA 1I2EA 1X1UA 1GOYA 3AMOB 3FH1A 1EUIC 2XR8B 1LOVA 3HI7A 4LEHA 4L8OA 4LGQA 3CMA3 4NREA 5IEOA 1W6CA 3CCU3 3OWYA 1JKGA 4ILFA 7GSPA 1WMOA 4JRFA 5AYRB 2CG0A 1OGXA 4OVMA 1BIRA 2W6JH 2HMJB 1D6YA 3PYJA 2IY2A 1VQ83 1FUWA 1CQSA 1KSIA 3RGRA 1RMSA 1Y4KA 3KZTA 3S28A 4O2HA 3MSOA 3N9HA 4K61A 3FKAA 4MMYB 4J5KA 1ZO2A 2Z6BA 1RGHA 2IA7A 3JUMA 3F9SA 4ORLA 3LT8A 1LOYA 4KFEA 2ZHXB 1NNVA 2F56A 3FF2A 1UDII 3DZLA 5AEUB 2UUGC 1VQ73 1FA3A 3JUOA 3CD63 1BSBA 1UI8A 1W00A 2WOHA 4Q53A 3RNTA 1TU5A 2QA43 1IQYA 1BRKA 2K0MA 3AGNA 3Q3FA 5G1KA 1OF5A 2P09A 2CH9A 3G0KA 1W4NA 2PNCA 3F8XA 3EN1B 3VSYA 1X1YA 3V92A 5FGOA 1N5PA 3ALAA 2Z7AA 3Q2PA 1KWIA 1GMPA 1RDSA 1DVCA 5AEWB 3BB9A 1GMQA 4N3VA 4FCJA 5JPUA 2IMJA 3SOYA 2D42A 3STDA 2STDA 1SQWA 3D5IA 3SYUA 5CLKA 4WHAA 1PU4A 5BIRA 1FZUA 4H61A 2K3DA 2RBIA 5G1LA 3KE7A 4HM7B 2ML5A 4BIRA 1B20A 1Q9EA 3HOHA 2KF5A 4H3UA 3N8BA 4U13A 1STDA 3RGAA 1JBRA 2GBXB 1BU4A 3NBJA 1RN4A 1SIIA 4XBXA 1YI23 1KD14 1MNLA 2GSPA 4X2OA 3VGNA 1D6UA 5A0OB 3KSED 1B27A 2W03A 4HZ9B 1JZDA 1JN5B 1ULIB 3KCHA 1Q7Y4 2UGIA 1N9JA 1OHPA 4BL3A 5LC6A 3UNLA 3K0ZA 4EXRA 1W2ZA 1GSPA 1W6GA 4WYKB 1G0TA 4BTWA 1DE3A 5ELUA 1IVVA 2YFIB 4FR9A 3O8YA 3DGNA 1M9GA 1RGKA 2R4IA 5DREA 1I3IA 1ZX2A 3F8HA 5D82A 2F98A 1RRHA 1AQZA 3WOEB 4CPKA 3X3XA 1RGLA 4K90B 3UL5A 1LNHA 2E2UA 1RSNA 2J8XB 3ER7A 4R1KA 3KN4A 2CKFB 4XM4A 5M18A 1MOLA 1RGEA 2E2VA 2OCTA 2XGLA 3NBBA 3J7Yd 3Q1CA 2W56A 1MWTA 1N8R4 5M1AA 1VQL3 2HMOB 2B24B 3A5EA 1IV7A 3HIGA 5JPPA 1A2PA 1WQLB 1YIJ3 1ROAA 4EW5A 1ULJB 1DETA 2CHCA 3D9RA 4N6NB 1BNGA 2CFGA 2ZA4A 1DMQA 1LNIA 3B4OA 4R4KA 2KF4A 3S5CA 1VQM3 6RNTA 1BSCA 1Q40B 3HX8A 3I0YA 3WHOA 1US1A 1I3FA 1TP6A 3GZXB 1DVDA 1FGMA 4CCVA 1UCIA 3A76A 1B2ZA 1BSEA 1B2XA 3KFQC 1VZZA 4R80A 3CNXA 4MJDA 2OOVA 2CX0A 3LYGA 3GZYB 1VQ63 3H3HA 3GZBA 2YFJB 1N5HA 2Z76A 7RNTA 2OQEC 2GU3A 1WNHA 1FGOA 5AIFA 6GSPA 4XDVA 1WMNA 2Z77A 1MGRA 1OHSA 5KP4A 1VQ43 4XBYA 1E3RA 1BRNL 3JUQA 1RRLA 2BU4A 3Q90A 3TDGA 3MHEA 1YJN3 1VQN3 3M8CA 5G2GA 3UB1A 2A15A 1O7HB 2QEX3 2BIRA 1A90A 1OH0A 1BNIA 2Q07A 2SBLA 3LTDA 4EV5A 3RDEA 1UCJA 5D83A 5IENA 1UCLA 1LVNA 1TFOA 1AVLA 1PY3A 4IIAA 5M19A 1KQS2 4K1VA 3X40A 5IF6A 3WA3A 1YVBI 4GHOA 1BANA 1GYBA 2W2CA 3DGYA 4NHFA 6STDA 3EX9A 1NB3I 3MG1A 4G1MB 4WWUC 1VQ53 2H0IA 2FNQA 2CWUA 1N9EA 3AMOA 2RNTA 1K734 1G02A 1TUHA 3CCJ3 3OV4A 1YIT3 2F4YA 2E2TA 3FLJA 3X3YA 5CF1A 1O7WB 3S67A 1N8QA 2IUKA 1AV4A 1BUQA 3GRDA 1V58A 3FG3A 1YHQ3 2WGQA 1BRGA 5AIHA 2XEPA 4RBNA 2GBWB 1GMRA 3DXOA 1K28A 1YGEA 4FCMA 3AGOA 5HGRA 3URPA 3WMDA 3EQQB 1NJI4 1DMNA 2CC3A 3UJMA 3V99A 3G713 1UUWB 2QGUA 1FYSA 3CNMA 4I5QA 2W9PA 5CF2A 1W01A 1EEJA 5BVBA 1V74A 1RN1A 2W04A 2RGQA 1RNTA 2KF3A 1AVKA 2XFSA 5RNTA 4QWTA 1SPUA 1CYUA 3WOFB 4I4KA 3EB8A 4PEJA 3V98A 1Z1SA 4FCZA 4N6MA 3LTAA 1GD4A 1GD3A 8CHOA 4NPBA 4FMDA 4R9KA 4MMXB 3DM8A 3SXXA 1UI7A 3T0UA 2HMMB 3CC43 1BRJA 1C7HA 1RGCA 4IT7A 1UUGB 3PZWA 5CXOA 1O7GB 2C4BA 1TRQA 5AIIA 3SLUA 1VQ93 1RCKA 3LT9A 2D1WA 5HOHA 3FF0A 2CG1A 1VQK3 3N54B 1JBSA 3OXAA 3QK9A 3KKGA 3E99A 3HK4A 1W7CA 4LMIA 2BT3A 2M7OA 3NBRA 1U5OA 4KT3B 1BNRA 1B2SA 3MG3A 1S5AA 2BMOB 1RGGA 4KZ1A 2P0XA 2XSHB 3GAXA 3K5TA 3KSPA 2GEXA 2CFLA 5IG4A 3MG2A 3G6E3 3CME3 4ZM8A 1FUSA 1WMPA 1ZGXA 1E97A 4HAAA 1F8NA 4O02B 3DY5A 2HMNB 3CCS3 1TJDA 3MYTA 3F14A 4HJLB 4DKIA 2I9WA 1IYYA 1IQXA 4RNZA 2HMKB 5EQLA 1JN5A 1JZOA 1CEWI 2CIUA 1K9M4 2H0HA 3X41A 1GOVA 1IVWA 3BIRA 1JB2A 1I8VA 3X3ZA 1EG9B 2CFDA 1CH0A 1T3BA 1T5YA 3EN8A 1STFI 4FMCA 4MMZB 1CYVA 2YX9A 1A2KA 5DRVA 2SARA 4N6UA 4HM1B 2PZVA 3FZWA 4HM2B 1RTUA 3BU4A 1YJ93 3GWRA 4KFFA 4WYKA 1VQP3 3IPTA 2AADA 1BRHA 3AHSA 3DUKA 4J8TA 4HKVB 3ZG0A 4BL2A 5I97A 5EEOA 3PGBA 2V1LA 4HM4B 1K8A4 2ZDJA 1JNQA 1QAFA 1HYFA 1TFKA 1TIJA 1NB5I 2GEYA 1R4YA 3D5GA 1IK3A 4HM5B 2AAEA 3NUVA 3SEDA 2XFTA 4EYCA 5BXQA 1BNEA 1MWRA 3HIIA 5D81A 2ZL8A 1FUTA 2OQEA 4HM0B 4LSOA 3I553 3B8LA 3EC9A 2MF7A 2WGOA 3NHXA 1AR0A 1B3SA 2OTJ3 3KIIA 4L8PA 1Q814 3K63A 4HBRA 1UW1A 1GS3A 3WDGB 2O3OA 4MEIA 1OUNA 1Q40A 1U8CB 3LH4A 4CJNA 3MPHA 1UCKA 2K54A 1RKYA 3CCQ3 2XRXB 1ISKA 1C54A 3CCR3 4FMAA 3NV0B 2F5WA 2L1SA 2JQ5A 2O9UX 2GU1A 5BU4A 1RGAA 5FW5A 1Q824 1GY6A 2IYJA 5IG0A 3MKIA 1L5GB 1LXEA 3IMAB 4N6TA 1RHLA 1RLSA 1IU7A 1OPYA 2RFRA 3F7XA 3CCL3 3G16A 2GXFA 4LZIA 5AIGA 1UUVB 4GL6A 3CCM3 2Y73A 3EF8A 3D79A 4N6V0 3F7SA 1K41A 2YFLB 3G8ZA 4IPBA 1JKGB 1OACA 1BNSA 1I2GA 3LZAA 4J9AA 3LXUX 3CPOA 2KAAA 3EBYA 1FGRA 1YJW3 1UGHI 3ROBA 5IERA 3B4PA 1J2BA 2ML6A 1MWSA 3QRDA 7STDA 1MGWA 1O7MB 1X1XA 3FSDA 1IT8A 3U97A 2BNGA 5JBSA 1TRPA 1FGTA 4XB5A 1ROVA 1ZS7A 1EKMA 5CK6A 1BUJA 1M1XB 4BTXA 4AKZA 4AEQA 3GZRA 2MC8A 1V57A 1W2B2 2BHMA 1E3VA 1D6ZA 2P05A 4HM6B 3PCRA 1QJGA 4GB5A 2INXA 1FGQA 1VQQA 3T8NA 3CCV3 1BSDA 5IW9A 4WP5A 1FW7A 3B7CA 3U1WA 1OF5B 1Q864 1RN7A 5LC7A 4OUQA 1R4CA 5IG3A 3BNCA 4CDLA 5IG5A 2XGNA 3CXC2 4EC6A 3DH2A 4R9LA 3WODG 2OTL3 1T2IA 3LOYA 1PFPA 2H0GA 1JRQA 1RCLA 1M1K4 3EE1A 2HOHA 3CC23 1Q42A 1BRSA 3FG4A 1OGZA 3NX0A 2F99A 3OWUA 2F86B 1BNJA 3DGOA 1LQGC 2W9QA 3ZFZA 1RGFA 2C10A 4O8SA 4TX4A 3IJEB 2BMQB 2KF6A 3SOAA 1OCVA 1SJWA 1B21A 1YGWA 3WA2X 1OHOA 3LTCA 1I0VA 2C11A 3CCE3 2L4VA 1YVSA 4HVNA 3FCSB 3SX1A 3T8UA 1IQ8A 1ASKA 3BNEA 3LMLA 2QIYA 4RZMA 5IEPA 2LYXA 1IVXA 4JF8A 1BOXA 1GY5A 2BO9B 1A2VA 4HYZA 3I563 3OW22 1KC84 3FGYA 1NDOB 4O3VA 5ELJA 4BTYA 1I70A 1TTOA 3F40A 1UGIA 1QVF2 4N6OB 1BAOA 1IVUA 2XSOB 2RSXA 3EBTA 2R41A 3OWSA 1DYUA 4HM8B 4XBTA 1VQO3 4K1UA 2XF3A 1MWUA 1HKXA 1T2HA 1DMMA 3LTBA 1PYLA 3FG1A 1BNFA 1Q7HA 4XDWA 1W02A 1QALA 5KP1A 3VF1A 3PCSA 3PS8A 3NQYA 2W0QA 3EJVA 4AKYA 3CPW2 1B2UA 3JVCA 1EA2A 2W56B 4HM3B 1S723 2CX1A 2JDIH 2P38A 3SVAA
chains in the Genus database with same CATH topology
4WFOA 2CFKA 3EHCA 2WO0A 4EV2A 1GY7A 3NM7A 2CFWA 2FXTA 3OX9A 5EVHA 5STDA 3NQZA 3L0RA 3JUPA 3NXJA 1HU9A 2LQVA 3CC73 3K9MC 3UL6A 4OK0A 2KRTA 3MWZA 4HZBB 1G96A 3NM2A 3BNDA 2CWTA 2KXGA 5AI1A 5AYSC 2B1XB 1A67A 1NU3A 1O7PB 4KVHA 4RNYA 1QVG2 1W5ZA 3D3LA 2IUJA 1JB4A 3DMCA 3H51A 1QMAA 2CW9A 1RJOA 4L7KA 1NWWA 1JB5A 2OWPA 2UX0A 2CWVA 1EQKA 1QAKA 3DGMA 1M904 2CK3H 2P0MA 2RCDA 1IT7A 3BLZA 1LOXA 1NO3A 3HZPA 4KFDA 1W6YA 3S27A 2Y74A 3S29A 5TGNA 2HMLB 1IV9A 3K7CA 3BNBA 2KCDA 5KP3A 2WOFA 2OOVC 4N6LA 4STDA 4EBGA 3PXMA 2XH9A 1JV2B 3NV0A 2FGTA 1SIHA 2BMRB 1IDPA 3DGLA 3X42A 3G4S3 4FMBA 1O7NB 1JJ22 1WTHA 3JUNA 4X2HA 3CU3A 3ECFA 3AMOB 3FH1A 2XR8B 3HI7A 4LEHA 4L8OA 4LGQA 3CMA3 4NREA 5IEOA 1W6CA 3CCU3 3OWYA 1JKGA 1WMOA 4JRFA 5AYRB 2CG0A 1OGXA 4OVMA 2W6JH 2HMJB 1D6YA 3PYJA 1VQ83 1FUWA 1CQSA 1KSIA 3RGRA 3KZTA 1Y4KA 3S28A 4O2HA 3MSOA 3N9HA 4K61A 3FKAA 4MMYB 1ZO2A 2Z6BA 2IA7A 3JUMA 3F9SA 4ORLA 3LT8A 4KFEA 5AEUB 3FF2A 1FA3A 3DZLA 1VQ73 3JUOA 3CD63 1UI8A 1W00A 2WOHA 4Q53A 1TU5A 2QA43 1IQYA 2K0MA 1OF5A 2P09A 2CH9A 3G0KA 1W4NA 2PNCA 3F8XA 3EN1B 3VSYA 3V92A 5FGOA 1N5PA 3ALAA 2Z7AA 3Q2PA 1KWIA 1DVCA 5AEWB 3BB9A 4N3VA 4FCJA 5JPUA 2IMJA 3SOYA 2D42A 3STDA 2STDA 1SQWA 1PU4A 5CLKA 4WHAA 4H61A 3KE7A 4HM7B 2ML5A 4H3UA 3N8BA 4U13A 1STDA 3RGAA 2GBXB 3NBJA 1SIIA 1YI23 4XBXA 1KD14 1MNLA 4X2OA 5A0OB 3VGNA 1D6UA 3KSED 2W03A 4HZ9B 1Q7Y4 1JN5B 1ULIB 1N9JA 1OHPA 5LC6A 3UNLA 3K0ZA 4EXRA 1W2ZA 4WYKB 1W6GA 4BTWA 5ELUA 1IVVA 2YFIB 4FR9A 3O8YA 3DGNA 1M9GA 2R4IA 5DREA 1ZX2A 3F8HA 5D82A 2F98A 1RRHA 3WOEB 3X3XA 4K90B 3UL5A 1LNHA 2E2UA 4XM4A 3ER7A 4R1KA 3KN4A 2CKFB 1MOLA 2OCTA 2E2VA 2XGLA 3NBBA 3J7Yd 1N8R4 3Q1CA 2W56A 1VQL3 2HMOB 2B24B 1IV7A 3HIGA 5JPPA 1WQLB 1YIJ3 1ROAA 1ULJB 2CHCA 3D9RA 4N6NB 2CFGA 3B4OA 1DMQA 3S5CA 4R4KA 1VQM3 3HX8A 1Q40B 3I0YA 1US1A 1TP6A 3GZXB 1DVDA 1FGMA 4CCVA 3A76A 3KFQC 1VZZA 4R80A 3CNXA 4MJDA 2OOVA 3LYGA 3GZYB 1VQ63 3H3HA 3GZBA 2YFJB 1N5HA 2Z76A 2OQEC 2GU3A 1WNHA 1FGOA 5AIFA 4XDVA 1WMNA 2Z77A 1VQ43 1OHSA 5KP4A 4XBYA 1E3RA 3JUQA 1RRLA 3Q90A 1VQN3 3MHEA 1YJN3 3M8CA 5G2GA 3UB1A 2A15A 1O7HB 2QEX3 1A90A 1OH0A 2Q07A 2SBLA 3LTDA 4EV5A 3RDEA 5IENA 5D83A 1LVNA 1TFOA 1AVLA 4IIAA 1KQS2 4K1VA 3X40A 5IF6A 3WA3A 1YVBI 1GYBA 2W2CA 4NHFA 6STDA 1VQ53 3EX9A 1NB3I 3MG1A 4G1MB 4WWUC 2FNQA 2CWUA 1N9EA 3AMOA 1K734 1TUHA 3CCJ3 3OV4A 1YIT3 2E2TA 3FLJA 3X3YA 5CF1A 1O7WB 3S67A 1N8QA 2IUKA 1AV4A 1BUQA 3GRDA 3FG3A 1YHQ3 2WGQA 5AIHA 2XEPA 4RBNA 2GBWB 3DXOA 1K28A 1YGEA 4FCMA 5HGRA 3WMDA 3EQQB 1NJI4 1DMNA 2CC3A 3UJMA 3V99A 3G713 1UUWB 2QGUA 3CNMA 2W9PA 5CF2A 1W01A 5BVBA 1V74A 2W04A 2RGQA 1AVKA 2XFSA 4QWTA 1SPUA 1CYUA 3WOFB 4I4KA 3EB8A 4PEJA 3V98A 1Z1SA 4FCZA 4N6MA 3LTAA 1GD4A 1GD3A 8CHOA 4FMDA 4R9KA 4MMXB 3DM8A 3SXXA 1UI7A 3T0UA 2HMMB 3CC43 1C7HA 4IT7A 3PZWA 5CXOA 1O7GB 3SLUA 5AIIA 1VQ93 3LT9A 2D1WA 3FF0A 2CG1A 1VQK3 3N54B 3OXAA 3QK9A 3KKGA 3E99A 3HK4A 1W7CA 4LMIA 2BT3A 2M7OA 3NBRA 1U5OA 3MG3A 1S5AA 2BMOB 4KZ1A 2P0XA 2XSHB 3GAXA 3K5TA 3KSPA 2GEXA 2CFLA 5IG4A 3MG2A 3G6E3 3CME3 4ZM8A 1WMPA 4O02B 1E97A 1F8NA 3DY5A 2HMNB 3CCS3 3MYTA 3F14A 4HJLB 2I9WA 1IQXA 4RNZA 2HMKB 5EQLA 1JN5A 2CIUA 1CEWI 1K9M4 3X41A 1IVWA 1JB2A 3X3ZA 1EG9B 2CFDA 3EN8A 1T5YA 4FMCA 4MMZB 1STFI 4WYKA 3TDGA 2YX9A 1CYVA 1A2KA 5DRVA 4N6UA 4HM1B 2PZVA 3FZWA 4HM2B 1YJ93 3GWRA 4KFFA 1VQP3 3IPTA 4J8TA 5I97A 3DUKA 4HKVB 5EEOA 3PGBA 2V1LA 4HM4B 1K8A4 2ZDJA 1JNQA 1QAFA 1TFKA 1TIJA 1NB5I 2GEYA 1IK3A 4HM5B 3NUVA 3SEDA 2XFTA 4EYCA 5BXQA 5D81A 3HIIA 2ZL8A 2OQEA 4HM0B 4LSOA 3I553 3B8LA 3EC9A 2MF7A 2WGOA 3NHXA 1AR0A 2OTJ3 3KIIA 4L8PA 1Q814 3K63A 4HBRA 1UW1A 1GS3A 3WDGB 2O3OA 4MEIA 1OUNA 1Q40A 1U8CB 3LH4A 1RKYA 3MPHA 3CCQ3 2K54A 1ISKA 2XRXB 3CCR3 4FMAA 3NV0B 2JQ5A 2O9UX 2GU1A 5FW5A 1Q824 1GY6A 5IG0A 1L5GB 3MKIA 1LXEA 3IMAB 4N6TA 1IU7A 1OPYA 2RFRA 3F7XA 3CCL3 3G16A 2GXFA 4LZIA 5AIGA 1UUVB 4GL6A 3CCM3 2Y73A 3EF8A 4N6V0 3F7SA 1K41A 2YFLB 3G8ZA 4IPBA 1JKGB 1OACA 3LZAA 4J9AA 3LXUX 3CPOA 3EBYA 1FGRA 1YJW3 3ROBA 5IERA 3B4PA 1J2BA 2ML6A 3QRDA 7STDA 3FSDA 1O7MB 1IT8A 3U97A 2BNGA 5JBSA 1FGTA 4XB5A 1ROVA 5CK6A 1EKMA 1M1XB 4BTXA 4AKZA 4AEQA 3GZRA 2MC8A 1W2B2 2BHMA 1E3VA 1D6ZA 2P05A 4HM6B 3PCRA 1QJGA 4GB5A 2INXA 1FGQA 3CCV3 3T8NA 5IW9A 4WP5A 3B7CA 3U1WA 1OF5B 1Q864 1RN7A 5LC7A 4OUQA 1R4CA 5IG3A 3BNCA 4CDLA 5IG5A 2XGNA 3CXC2 4EC6A 4R9LA 3WODG 2OTL3 3LOYA 1PFPA 1JRQA 1M1K4 3EE1A 3CC23 1Q42A 3FG4A 1OGZA 3NX0A 2F99A 3OWUA 2F86B 3DGOA 2W9QA 2C10A 4O8SA 4TX4A 3IJEB 2BMQB 3SOAA 1OCVA 1SJWA 3WA2X 1OHOA 3LTCA 2C11A 3CCE3 2L4VA 4HVNA 3FCSB 3SX1A 3T8UA 1IQ8A 1ASKA 3BNEA 3LMLA 2QIYA 4RZMA 5IEPA 2LYXA 1IVXA 4JF8A 1GY5A 2BO9B 4HYZA 1A2VA 3I563 3OW22 1KC84 3FGYA 1NDOB 4O3VA 5ELJA 4BTYA 3F40A 1QVF2 4N6OB 1IVUA 2XSOB 2RSXA 3EBTA 3OWSA 1DYUA 4HM8B 4XBTA 1VQO3 4K1UA 2XF3A 1HKXA 1DMMA 3LTBA 3FG1A 4XDWA 1W02A 1QALA 5KP1A 3VF1A 3PCSA 3PS8A 3NQYA 2W0QA 3EJVA 4AKYA 3CPW2 3JVCA 1EA2A 2W56B 4HM3B 1S723 2JDIH 2P38A 3SVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHC A;  1GY7 A;  3OX9 A;  5EVH A;  5STD A;  3JUP A;  3NXJ A;  4HZB B;  3NM2 A;  5AI1 A;  2B1X B;  1NU3 A;  1O7P B;  4KVH A;  1JB4 A;  3DMC A;  3H51 A;  1QMA A;  4L7K A;  1NWW A;  1JB5 A;  2OWP A;  2UX0 A;  2RCD A;  3BLZ A;  3HZP A;  1W6Y A;  5TGN A;  2HML B;  3K7C A;  5KP3 A;  4STD A;  3NV0 A;  2BMR B;  1IDP A;  1O7N B;  3JUN A;  4X2H A;  3CU3 A;  3ECF A;  3FH1 A;  2XR8 B;  4LEH A;  4L8O A;  4LGQ A;  5IEO A;  3OWY A;  1JKG A;  1OGX A;  4OVM A;  2HMJ B;  1CQS A;  3RGR A;  3KZT A;  3MSO A;  3FKA A;  1ZO2 A;  3JUM A;  3F9S A;  4ORL A;  5AEU B;  3FF2 A;  3DZL A;  3JUO A;  1W00 A;  4Q53 A;  1OF5 A;  3G0K A;  3F8X A;  3EN1 B;  3VSY A;  2Z7A A;  5AEW B;  3BB9 A;  4N3V A;  4FCJ A;  5JPU A;  2IMJ A;  3SOY A;  3STD A;  2STD A;  5CLK A;  3KE7 A;  4HM7 B;  4H3U A;  4U13 A;  1STD A;  3RGA A;  2GBX B;  4XBX A;  4X2O A;  3VGN A;  4HZ9 B;  1JN5 B;  1ULI B;  1OHP A;  3UNL A;  3K0Z A;  4WYK B;  2YFI B;  2R4I A;  5DRE A;  1ZX2 A;  3F8H A;  5D82 A;  2F98 A;  4XM4 A;  3ER7 A;  4R1K A;  2CKF B;  2HMO B;  2B24 B;  5JPP A;  1WQL B;  1ULJ B;  2CHC A;  3D9R A;  3B4O A;  1DMQ A;  3S5C A;  3HX8 A;  1Q40 B;  3I0Y A;  1TP6 A;  3GZX B;  3A76 A;  1VZZ A;  3CNX A;  4MJD A;  3LYG A;  3GZY B;  3H3H A;  3GZB A;  2YFJ B;  2Z76 A;  5AIF A;  4XDV A;  2Z77 A;  1OHS A;  5KP4 A;  4XBY A;  1E3R A;  3JUQ A;  3Q90 A;  3MHE A;  3M8C A;  5G2G A;  2A15 A;  1O7H B;  1OH0 A;  5IEN A;  5D83 A;  4IIA A;  4K1V A;  5IF6 A;  1GYB A;  2W2C A;  6STD A;  3EX9 A;  3MG1 A;  4WWU C;  1TUH A;  3OV4 A;  3FLJ A;  5CF1 A;  1O7W B;  1BUQ A;  3GRD A;  5AIH A;  2GBW B;  3DXO A;  4FCM A;  5HGR A;  3WMD A;  3EQQ B;  1DMN A;  3UJM A;  1UUW B;  2QGU A;  3CNM A;  5CF2 A;  1W01 A;  5BVB A;  2RGQ A;  4I4K A;  4PEJ A;  1Z1S A;  8CHO A;  4R9K A;  3DM8 A;  2HMM B;  1C7H A;  5CXO A;  1O7G B;  5AII A;  3FF0 A;  3OXA A;  3KKG A;  3E99 A;  3HK4 A;  4LMI A;  3NBR A;  1U5O A;  3MG3 A;  1S5A A;  2BMO B;  2XSH B;  3KSP A;  2GEX A;  5IG4 A;  3MG2 A;  1E97 A;  2HMN B;  3MYT A;  3F14 A;  4HJL B;  2I9W A;  2HMK B;  1JN5 A;  1JB2 A;  1EG9 B;  4WYK A;  3EN8 A;  1A2K A;  5DRV A;  4HM1 B;  2PZV A;  3FZW A;  4HM2 B;  3GWR A;  3IPT A;  4J8T A;  3DUK A;  4HKV B;  4HM4 B;  2GEY A;  4HM5 B;  3NUV A;  3SED A;  5BXQ A;  5D81 A;  4HM0 B;  3B8L A;  3EC9 A;  3NHX A;  1AR0 A;  4L8P A;  1GS3 A;  1OUN A;  1Q40 A;  2K54 A;  1ISK A;  2XRX B;  3NV0 B;  2JQ5 A;  5FW5 A;  1GY6 A;  5IG0 A;  3MKI A;  1OPY A;  2RFR A;  3F7X A;  3G16 A;  2GXF A;  5AIG A;  1UUV B;  3EF8 A;  3F7S A;  1K41 A;  2YFL B;  3G8Z A;  1JKG B;  3LZA A;  4J9A A;  3CPO A;  3EBY A;  3ROB A;  5IER A;  3B4P A;  7STD A;  3FSD A;  1O7M B;  2BNG A;  4XB5 A;  5CK6 A;  3GZR A;  1E3V A;  4HM6 B;  1QJG A;  4GB5 A;  2INX A;  3T8N A;  4WP5 A;  3B7C A;  1OF5 B;  4OUQ A;  5IG5 A;  5IG3 A;  4CDL A;  4R9L A;  1Q42 A;  1OGZ A;  3OWU A;  2F99 A;  2F86 B;  2BMQ B;  3SOA A;  1OCV A;  1SJW A;  1OHO A;  4HVN A;  3T8U A;  1ASK A;  4RZM A;  5IEP A;  2QIY A;  1GY5 A;  3FGY A;  1NDO B;  3F40 A;  2XSO B;  3EBT A;  3OWS A;  4HM8 B;  4XBT A;  4K1U A;  1HKX A;  1DMM A;  4XDW A;  1W02 A;  5KP1 A;  3EJV A;  1EA2 A;  4HM3 B; 
#chains in the Genus database with same CATH topology
 1BGS A;  4WFO A;  2CFK A;  1I2F A;  3EHC A;  2WO0 A;  1BRI A;  4EV2 A;  1GY7 A;  3NM7 A;  2CFW A;  2FXT A;  3OX9 A;  5EVH A;  5STD A;  3WR2 A;  4J5G A;  3NQZ A;  3L0R A;  3JUP A;  3NXJ A;  1HU9 A;  2LQV A;  3CC7 3;  3K9M C;  1HZ1 A;  1YNV X;  3UL6 A;  3ZG5 A;  4HOH A;  8RNT A;  4OK0 A;  4LYL B;  2KRT A;  3MWZ A;  4HZB B;  1G96 A;  3NM2 A;  3BND A;  5GSP A;  4GSP A;  2CWT A;  2KXG A;  5AI1 A;  5AYS C;  1LOW A;  2B1X B;  1A67 A;  1NU3 A;  1O7P B;  4KVH A;  1I0X A;  4RNY A;  1QVG 2;  1W5Z A;  3D3L A;  2IUJ A;  1JB4 A;  1AY7 A;  2F5M A;  1RNB A;  3DMC A;  3GSP A;  3H51 A;  1QMA A;  2CW9 A;  1RJO A;  4BU4 A;  1X1W A;  4L7K A;  1NWW A;  1JB5 A;  2OWP A;  2UX0 A;  9RNT A;  2CWV A;  1EQK A;  1QAK A;  3DGM A;  1M90 4;  2CK3 H;  2P0M A;  2RCD A;  1IT7 A;  3BLZ A;  1LOX A;  1NO3 A;  3HZP A;  1SAR A;  1W6Y A;  4KFD A;  2Y74 A;  3S27 A;  3S29 A;  5TGN A;  2HML B;  1IV9 A;  3K7C A;  3BNB A;  2KCD A;  1BSA A;  5KP3 A;  2WOF A;  2OOV C;  4N6L A;  4RNT A;  1BVI A;  1LQM B;  4STD A;  4EBG A;  3PXM A;  2XH9 A;  1JV2 B;  3NV0 A;  2FGT A;  1GOU A;  1SIH A;  1IDP A;  2BMR B;  3D4A A;  3DGL A;  3AHW A;  3X42 A;  1JBT A;  3G4S 3;  4FMB A;  1B2M A;  1O7N B;  1JJ2 2;  1WTH A;  3JUN A;  1LRA A;  4X2H A;  3CU3 A;  3ECF A;  1I2E A;  1X1U A;  1GOY A;  3AMO B;  3FH1 A;  1EUI C;  2XR8 B;  1LOV A;  3HI7 A;  4LEH A;  4L8O A;  4LGQ A;  3CMA 3;  4NRE A;  5IEO A;  1W6C A;  3CCU 3;  3OWY A;  1JKG A;  4ILF A;  7GSP A;  1WMO A;  4JRF A;  5AYR B;  2CG0 A;  1OGX A;  4OVM A;  1BIR A;  2W6J H;  2HMJ B;  1D6Y A;  3PYJ A;  2IY2 A;  1VQ8 3;  1FUW A;  1CQS A;  1KSI A;  3RGR A;  1RMS A;  1Y4K A;  3KZT A;  3S28 A;  4O2H A;  3MSO A;  3N9H A;  4K61 A;  3FKA A;  4MMY B;  4J5K A;  1ZO2 A;  2Z6B A;  1RGH A;  2IA7 A;  3JUM A;  3F9S A;  4ORL A;  3LT8 A;  1LOY A;  4KFE A;  2ZHX B;  1NNV A;  2F56 A;  3FF2 A;  1UDI I;  3DZL A;  5AEU B;  2UUG C;  1VQ7 3;  1FA3 A;  3JUO A;  3CD6 3;  1BSB A;  1UI8 A;  1W00 A;  2WOH A;  4Q53 A;  3RNT A;  1TU5 A;  2QA4 3;  1IQY A;  1BRK A;  2K0M A;  3AGN A;  3Q3F A;  5G1K A;  1OF5 A;  2P09 A;  2CH9 A;  3G0K A;  1W4N A;  2PNC A;  3F8X A;  3EN1 B;  3VSY A;  1X1Y A;  3V92 A;  5FGO A;  1N5P A;  3ALA A;  2Z7A A;  3Q2P A;  1KWI A;  1GMP A;  1RDS A;  1DVC A;  5AEW B;  3BB9 A;  1GMQ A;  4N3V A;  4FCJ A;  5JPU A;  2IMJ A;  3SOY A;  2D42 A;  3STD A;  2STD A;  1SQW A;  3D5I A;  3SYU A;  5CLK A;  4WHA A;  1PU4 A;  5BIR A;  1FZU A;  4H61 A;  2K3D A;  2RBI A;  5G1L A;  3KE7 A;  4HM7 B;  2ML5 A;  4BIR A;  1B20 A;  1Q9E A;  3HOH A;  2KF5 A;  4H3U A;  3N8B A;  4U13 A;  1STD A;  3RGA A;  1JBR A;  2GBX B;  1BU4 A;  3NBJ A;  1RN4 A;  1SII A;  4XBX A;  1YI2 3;  1KD1 4;  1MNL A;  2GSP A;  4X2O A;  3VGN A;  1D6U A;  5A0O B;  3KSE D;  1B27 A;  2W03 A;  4HZ9 B;  1JZD A;  1JN5 B;  1ULI B;  3KCH A;  1Q7Y 4;  2UGI A;  1N9J A;  1OHP A;  4BL3 A;  5LC6 A;  3UNL A;  3K0Z A;  4EXR A;  1W2Z A;  1GSP A;  1W6G A;  4WYK B;  1G0T A;  4BTW A;  1DE3 A;  5ELU A;  1IVV A;  2YFI B;  4FR9 A;  3O8Y A;  3DGN A;  1M9G A;  1RGK A;  2R4I A;  5DRE A;  1I3I A;  1ZX2 A;  3F8H A;  5D82 A;  2F98 A;  1RRH A;  1AQZ A;  3WOE B;  4CPK A;  3X3X A;  1RGL A;  4K90 B;  3UL5 A;  1LNH A;  2E2U A;  1RSN A;  2J8X B;  3ER7 A;  4R1K A;  3KN4 A;  2CKF B;  4XM4 A;  5M18 A;  1MOL A;  1RGE A;  2E2V A;  2OCT A;  2XGL A;  3NBB A;  3J7Y d;  3Q1C A;  2W56 A;  1MWT A;  1N8R 4;  5M1A A;  1VQL 3;  2HMO B;  2B24 B;  3A5E A;  1IV7 A;  3HIG A;  5JPP A;  1A2P A;  1WQL B;  1YIJ 3;  1ROA A;  4EW5 A;  1ULJ B;  1DET A;  2CHC A;  3D9R A;  4N6N B;  1BNG A;  2CFG A;  2ZA4 A;  1DMQ A;  1LNI A;  3B4O A;  4R4K A;  2KF4 A;  3S5C A;  1VQM 3;  6RNT A;  1BSC A;  1Q40 B;  3HX8 A;  3I0Y A;  3WHO A;  1US1 A;  1I3F A;  1TP6 A;  3GZX B;  1DVD A;  1FGM A;  4CCV A;  1UCI A;  3A76 A;  1B2Z A;  1BSE A;  1B2X A;  3KFQ C;  1VZZ A;  4R80 A;  3CNX A;  4MJD A;  2OOV A;  2CX0 A;  3LYG A;  3GZY B;  1VQ6 3;  3H3H A;  3GZB A;  2YFJ B;  1N5H A;  2Z76 A;  7RNT A;  2OQE C;  2GU3 A;  1WNH A;  1FGO A;  5AIF A;  6GSP A;  4XDV A;  1WMN A;  2Z77 A;  1MGR A;  1OHS A;  5KP4 A;  1VQ4 3;  4XBY A;  1E3R A;  1BRN L;  3JUQ A;  1RRL A;  2BU4 A;  3Q90 A;  3TDG A;  3MHE A;  1YJN 3;  1VQN 3;  3M8C A;  5G2G A;  3UB1 A;  2A15 A;  1O7H B;  2QEX 3;  2BIR A;  1A90 A;  1OH0 A;  1BNI A;  2Q07 A;  2SBL A;  3LTD A;  4EV5 A;  3RDE A;  1UCJ A;  5D83 A;  5IEN A;  1UCL A;  1LVN A;  1TFO A;  1AVL A;  1PY3 A;  4IIA A;  5M19 A;  1KQS 2;  4K1V A;  3X40 A;  5IF6 A;  3WA3 A;  1YVB I;  4GHO A;  1BAN A;  1GYB A;  2W2C A;  3DGY A;  4NHF A;  6STD A;  3EX9 A;  1NB3 I;  3MG1 A;  4G1M B;  4WWU C;  1VQ5 3;  2H0I A;  2FNQ A;  2CWU A;  1N9E A;  3AMO A;  2RNT A;  1K73 4;  1G02 A;  1TUH A;  3CCJ 3;  3OV4 A;  1YIT 3;  2F4Y A;  2E2T A;  3FLJ A;  3X3Y A;  5CF1 A;  1O7W B;  3S67 A;  1N8Q A;  2IUK A;  1AV4 A;  1BUQ A;  3GRD A;  1V58 A;  3FG3 A;  1YHQ 3;  2WGQ A;  1BRG A;  5AIH A;  2XEP A;  4RBN A;  2GBW B;  1GMR A;  3DXO A;  1K28 A;  1YGE A;  4FCM A;  3AGO A;  5HGR A;  3URP A;  3WMD A;  3EQQ B;  1NJI 4;  1DMN A;  2CC3 A;  3UJM A;  3V99 A;  3G71 3;  1UUW B;  2QGU A;  1FYS A;  3CNM A;  4I5Q A;  2W9P A;  5CF2 A;  1W01 A;  1EEJ A;  5BVB A;  1V74 A;  1RN1 A;  2W04 A;  2RGQ A;  1RNT A;  2KF3 A;  1AVK A;  2XFS A;  5RNT A;  4QWT A;  1SPU A;  1CYU A;  3WOF B;  4I4K A;  3EB8 A;  4PEJ A;  3V98 A;  1Z1S A;  4FCZ A;  4N6M A;  3LTA A;  1GD4 A;  1GD3 A;  8CHO A;  4NPB A;  4FMD A;  4R9K A;  4MMX B;  3DM8 A;  3SXX A;  1UI7 A;  3T0U A;  2HMM B;  3CC4 3;  1BRJ A;  1C7H A;  1RGC A;  4IT7 A;  1UUG B;  3PZW A;  5CXO A;  1O7G B;  2C4B A;  1TRQ A;  5AII A;  3SLU A;  1VQ9 3;  1RCK A;  3LT9 A;  2D1W A;  5HOH A;  3FF0 A;  2CG1 A;  1VQK 3;  3N54 B;  1JBS A;  3OXA A;  3QK9 A;  3KKG A;  3E99 A;  3HK4 A;  1W7C A;  4LMI A;  2BT3 A;  2M7O A;  3NBR A;  1U5O A;  4KT3 B;  1BNR A;  1B2S A;  3MG3 A;  1S5A A;  2BMO B;  1RGG A;  4KZ1 A;  2P0X A;  2XSH B;  3GAX A;  3K5T A;  3KSP A;  2GEX A;  2CFL A;  5IG4 A;  3MG2 A;  3G6E 3;  3CME 3;  4ZM8 A;  1FUS A;  1WMP A;  1ZGX A;  1E97 A;  4HAA A;  1F8N A;  4O02 B;  3DY5 A;  2HMN B;  3CCS 3;  1TJD A;  3MYT A;  3F14 A;  4HJL B;  4DKI A;  2I9W A;  1IYY A;  1IQX A;  4RNZ A;  2HMK B;  5EQL A;  1JN5 A;  1JZO A;  1CEW I;  2CIU A;  1K9M 4;  2H0H A;  3X41 A;  1GOV A;  1IVW A;  3BIR A;  1JB2 A;  1I8V A;  3X3Z A;  1EG9 B;  2CFD A;  1CH0 A;  1T3B A;  1T5Y A;  3EN8 A;  1STF I;  4FMC A;  4MMZ B;  1CYV A;  2YX9 A;  1A2K A;  5DRV A;  2SAR A;  4N6U A;  4HM1 B;  2PZV A;  3FZW A;  4HM2 B;  1RTU A;  3BU4 A;  1YJ9 3;  3GWR A;  4KFF A;  4WYK A;  1VQP 3;  3IPT A;  2AAD A;  1BRH A;  3AHS A;  3DUK A;  4J8T A;  4HKV B;  3ZG0 A;  4BL2 A;  5I97 A;  5EEO A;  3PGB A;  2V1L A;  4HM4 B;  1K8A 4;  2ZDJ A;  1JNQ A;  1QAF A;  1HYF A;  1TFK A;  1TIJ A;  1NB5 I;  2GEY A;  1R4Y A;  3D5G A;  1IK3 A;  4HM5 B;  2AAE A;  3NUV A;  3SED A;  2XFT A;  4EYC A;  5BXQ A;  1BNE A;  1MWR A;  3HII A;  5D81 A;  2ZL8 A;  1FUT A;  2OQE A;  4HM0 B;  4LSO A;  3I55 3;  3B8L A;  3EC9 A;  2MF7 A;  2WGO A;  3NHX A;  1AR0 A;  1B3S A;  2OTJ 3;  3KII A;  4L8P A;  1Q81 4;  3K63 A;  4HBR A;  1UW1 A;  1GS3 A;  3WDG B;  2O3O A;  4MEI A;  1OUN A;  1Q40 A;  1U8C B;  3LH4 A;  4CJN A;  3MPH A;  1UCK A;  2K54 A;  1RKY A;  3CCQ 3;  2XRX B;  1ISK A;  1C54 A;  3CCR 3;  4FMA A;  3NV0 B;  2F5W A;  2L1S A;  2JQ5 A;  2O9U X;  2GU1 A;  5BU4 A;  1RGA A;  5FW5 A;  1Q82 4;  1GY6 A;  2IYJ A;  5IG0 A;  3MKI A;  1L5G B;  1LXE A;  3IMA B;  4N6T A;  1RHL A;  1RLS A;  1IU7 A;  1OPY A;  2RFR A;  3F7X A;  3CCL 3;  3G16 A;  2GXF A;  4LZI A;  5AIG A;  1UUV B;  4GL6 A;  3CCM 3;  2Y73 A;  3EF8 A;  3D79 A;  4N6V 0;  3F7S A;  1K41 A;  2YFL B;  3G8Z A;  4IPB A;  1JKG B;  1OAC A;  1BNS A;  1I2G A;  3LZA A;  4J9A A;  3LXU X;  3CPO A;  2KAA A;  3EBY A;  1FGR A;  1YJW 3;  1UGH I;  3ROB A;  5IER A;  3B4P A;  1J2B A;  2ML6 A;  1MWS A;  3QRD A;  7STD A;  1MGW A;  1O7M B;  1X1X A;  3FSD A;  1IT8 A;  3U97 A;  2BNG A;  5JBS A;  1TRP A;  1FGT A;  4XB5 A;  1ROV A;  1ZS7 A;  1EKM A;  5CK6 A;  1BUJ A;  1M1X B;  4BTX A;  4AKZ A;  4AEQ A;  3GZR A;  2MC8 A;  1V57 A;  1W2B 2;  2BHM A;  1E3V A;  1D6Z A;  2P05 A;  4HM6 B;  3PCR A;  1QJG A;  4GB5 A;  2INX A;  1FGQ A;  1VQQ A;  3T8N A;  3CCV 3;  1BSD A;  5IW9 A;  4WP5 A;  1FW7 A;  3B7C A;  3U1W A;  1OF5 B;  1Q86 4;  1RN7 A;  5LC7 A;  4OUQ A;  1R4C A;  5IG3 A;  3BNC A;  4CDL A;  5IG5 A;  2XGN A;  3CXC 2;  4EC6 A;  3DH2 A;  4R9L A;  3WOD G;  2OTL 3;  1T2I A;  3LOY A;  1PFP A;  2H0G A;  1JRQ A;  1RCL A;  1M1K 4;  3EE1 A;  2HOH A;  3CC2 3;  1Q42 A;  1BRS A;  3FG4 A;  1OGZ A;  3NX0 A;  2F99 A;  3OWU A;  2F86 B;  1BNJ A;  3DGO A;  1LQG C;  2W9Q A;  3ZFZ A;  1RGF A;  2C10 A;  4O8S A;  4TX4 A;  3IJE B;  2BMQ B;  2KF6 A;  3SOA A;  1OCV A;  1SJW A;  1B21 A;  1YGW A;  3WA2 X;  1OHO A;  3LTC A;  1I0V A;  2C11 A;  3CCE 3;  2L4V A;  1YVS A;  4HVN A;  3FCS B;  3SX1 A;  3T8U A;  1IQ8 A;  1ASK A;  3BNE A;  3LML A;  2QIY A;  4RZM A;  5IEP A;  2LYX A;  1IVX A;  4JF8 A;  1BOX A;  1GY5 A;  2BO9 B;  1A2V A;  4HYZ A;  3I56 3;  3OW2 2;  1KC8 4;  3FGY A;  1NDO B;  4O3V A;  5ELJ A;  4BTY A;  1I70 A;  1TTO A;  3F40 A;  1UGI A;  1QVF 2;  4N6O B;  1BAO A;  1IVU A;  2XSO B;  2RSX A;  3EBT A;  2R41 A;  3OWS A;  1DYU A;  4HM8 B;  4XBT A;  1VQO 3;  4K1U A;  2XF3 A;  1MWU A;  1HKX A;  1T2H A;  1DMM A;  3LTB A;  1PYL A;  3FG1 A;  1BNF A;  1Q7H A;  4XDW A;  1W02 A;  1QAL A;  5KP1 A;  3VF1 A;  3PCS A;  3PS8 A;  3NQY A;  2W0Q A;  3EJV A;  4AKY A;  3CPW 2;  1B2U A;  3JVC A;  1EA2 A;  2W56 B;  4HM3 B;  1S72 3;  2CX1 A;  2JDI H;  2P38 A;  3SVA A; 
#chains in the Genus database with same CATH homology
 4WFO A;  2CFK A;  3EHC A;  2WO0 A;  4EV2 A;  1GY7 A;  3NM7 A;  2CFW A;  2FXT A;  3OX9 A;  5EVH A;  5STD A;  3NQZ A;  3L0R A;  3JUP A;  3NXJ A;  1HU9 A;  2LQV A;  3CC7 3;  3K9M C;  3UL6 A;  4OK0 A;  2KRT A;  3MWZ A;  4HZB B;  1G96 A;  3NM2 A;  3BND A;  2CWT A;  2KXG A;  5AI1 A;  5AYS C;  2B1X B;  1A67 A;  1NU3 A;  1O7P B;  4KVH A;  4RNY A;  1QVG 2;  1W5Z A;  3D3L A;  2IUJ A;  1JB4 A;  3DMC A;  3H51 A;  1QMA A;  2CW9 A;  1RJO A;  4L7K A;  1NWW A;  1JB5 A;  2OWP A;  2UX0 A;  2CWV A;  1EQK A;  1QAK A;  3DGM A;  1M90 4;  2CK3 H;  2P0M A;  2RCD A;  1IT7 A;  3BLZ A;  1LOX A;  1NO3 A;  3HZP A;  4KFD A;  1W6Y A;  3S27 A;  2Y74 A;  3S29 A;  5TGN A;  2HML B;  1IV9 A;  3K7C A;  3BNB A;  2KCD A;  5KP3 A;  2WOF A;  2OOV C;  4N6L A;  4STD A;  4EBG A;  3PXM A;  2XH9 A;  1JV2 B;  3NV0 A;  2FGT A;  1SIH A;  2BMR B;  1IDP A;  3DGL A;  3X42 A;  3G4S 3;  4FMB A;  1O7N B;  1JJ2 2;  1WTH A;  3JUN A;  4X2H A;  3CU3 A;  3ECF A;  3AMO B;  3FH1 A;  2XR8 B;  3HI7 A;  4LEH A;  4L8O A;  4LGQ A;  3CMA 3;  4NRE A;  5IEO A;  1W6C A;  3CCU 3;  3OWY A;  1JKG A;  1WMO A;  4JRF A;  5AYR B;  2CG0 A;  1OGX A;  4OVM A;  2W6J H;  2HMJ B;  1D6Y A;  3PYJ A;  1VQ8 3;  1FUW A;  1CQS A;  1KSI A;  3RGR A;  3KZT A;  1Y4K A;  3S28 A;  4O2H A;  3MSO A;  3N9H A;  4K61 A;  3FKA A;  4MMY B;  1ZO2 A;  2Z6B A;  2IA7 A;  3JUM A;  3F9S A;  4ORL A;  3LT8 A;  4KFE A;  5AEU B;  3FF2 A;  1FA3 A;  3DZL A;  1VQ7 3;  3JUO A;  3CD6 3;  1UI8 A;  1W00 A;  2WOH A;  4Q53 A;  1TU5 A;  2QA4 3;  1IQY A;  2K0M A;  1OF5 A;  2P09 A;  2CH9 A;  3G0K A;  1W4N A;  2PNC A;  3F8X A;  3EN1 B;  3VSY A;  3V92 A;  5FGO A;  1N5P A;  3ALA A;  2Z7A A;  3Q2P A;  1KWI A;  1DVC A;  5AEW B;  3BB9 A;  4N3V A;  4FCJ A;  5JPU A;  2IMJ A;  3SOY A;  2D42 A;  3STD A;  2STD A;  1SQW A;  1PU4 A;  5CLK A;  4WHA A;  4H61 A;  3KE7 A;  4HM7 B;  2ML5 A;  4H3U A;  3N8B A;  4U13 A;  1STD A;  3RGA A;  2GBX B;  3NBJ A;  1SII A;  1YI2 3;  4XBX A;  1KD1 4;  1MNL A;  4X2O A;  5A0O B;  3VGN A;  1D6U A;  3KSE D;  2W03 A;  4HZ9 B;  1Q7Y 4;  1JN5 B;  1ULI B;  1N9J A;  1OHP A;  5LC6 A;  3UNL A;  3K0Z A;  4EXR A;  1W2Z A;  4WYK B;  1W6G A;  4BTW A;  5ELU A;  1IVV A;  2YFI B;  4FR9 A;  3O8Y A;  3DGN A;  1M9G A;  2R4I A;  5DRE A;  1ZX2 A;  3F8H A;  5D82 A;  2F98 A;  1RRH A;  3WOE B;  3X3X A;  4K90 B;  3UL5 A;  1LNH A;  2E2U A;  4XM4 A;  3ER7 A;  4R1K A;  3KN4 A;  2CKF B;  1MOL A;  2OCT A;  2E2V A;  2XGL A;  3NBB A;  3J7Y d;  1N8R 4;  3Q1C A;  2W56 A;  1VQL 3;  2HMO B;  2B24 B;  1IV7 A;  3HIG A;  5JPP A;  1WQL B;  1YIJ 3;  1ROA A;  1ULJ B;  2CHC A;  3D9R A;  4N6N B;  2CFG A;  3B4O A;  1DMQ A;  3S5C A;  4R4K A;  1VQM 3;  3HX8 A;  1Q40 B;  3I0Y A;  1US1 A;  1TP6 A;  3GZX B;  1DVD A;  1FGM A;  4CCV A;  3A76 A;  3KFQ C;  1VZZ A;  4R80 A;  3CNX A;  4MJD A;  2OOV A;  3LYG A;  3GZY B;  1VQ6 3;  3H3H A;  3GZB A;  2YFJ B;  1N5H A;  2Z76 A;  2OQE C;  2GU3 A;  1WNH A;  1FGO A;  5AIF A;  4XDV A;  1WMN A;  2Z77 A;  1VQ4 3;  1OHS A;  5KP4 A;  4XBY A;  1E3R A;  3JUQ A;  1RRL A;  3Q90 A;  1VQN 3;  3MHE A;  1YJN 3;  3M8C A;  5G2G A;  3UB1 A;  2A15 A;  1O7H B;  2QEX 3;  1A90 A;  1OH0 A;  2Q07 A;  2SBL A;  3LTD A;  4EV5 A;  3RDE A;  5IEN A;  5D83 A;  1LVN A;  1TFO A;  1AVL A;  4IIA A;  1KQS 2;  4K1V A;  3X40 A;  5IF6 A;  3WA3 A;  1YVB I;  1GYB A;  2W2C A;  4NHF A;  6STD A;  1VQ5 3;  3EX9 A;  1NB3 I;  3MG1 A;  4G1M B;  4WWU C;  2FNQ A;  2CWU A;  1N9E A;  3AMO A;  1K73 4;  1TUH A;  3CCJ 3;  3OV4 A;  1YIT 3;  2E2T A;  3FLJ A;  3X3Y A;  5CF1 A;  1O7W B;  3S67 A;  1N8Q A;  2IUK A;  1AV4 A;  1BUQ A;  3GRD A;  3FG3 A;  1YHQ 3;  2WGQ A;  5AIH A;  2XEP A;  4RBN A;  2GBW B;  3DXO A;  1K28 A;  1YGE A;  4FCM A;  5HGR A;  3WMD A;  3EQQ B;  1NJI 4;  1DMN A;  2CC3 A;  3UJM A;  3V99 A;  3G71 3;  1UUW B;  2QGU A;  3CNM A;  2W9P A;  5CF2 A;  1W01 A;  5BVB A;  1V74 A;  2W04 A;  2RGQ A;  1AVK A;  2XFS A;  4QWT A;  1SPU A;  1CYU A;  3WOF B;  4I4K A;  3EB8 A;  4PEJ A;  3V98 A;  1Z1S A;  4FCZ A;  4N6M A;  3LTA A;  1GD4 A;  1GD3 A;  8CHO A;  4FMD A;  4R9K A;  4MMX B;  3DM8 A;  3SXX A;  1UI7 A;  3T0U A;  2HMM B;  3CC4 3;  1C7H A;  4IT7 A;  3PZW A;  5CXO A;  1O7G B;  3SLU A;  5AII A;  1VQ9 3;  3LT9 A;  2D1W A;  3FF0 A;  2CG1 A;  1VQK 3;  3N54 B;  3OXA A;  3QK9 A;  3KKG A;  3E99 A;  3HK4 A;  1W7C A;  4LMI A;  2BT3 A;  2M7O A;  3NBR A;  1U5O A;  3MG3 A;  1S5A A;  2BMO B;  4KZ1 A;  2P0X A;  2XSH B;  3GAX A;  3K5T A;  3KSP A;  2GEX A;  2CFL A;  5IG4 A;  3MG2 A;  3G6E 3;  3CME 3;  4ZM8 A;  1WMP A;  4O02 B;  1E97 A;  1F8N A;  3DY5 A;  2HMN B;  3CCS 3;  3MYT A;  3F14 A;  4HJL B;  2I9W A;  1IQX A;  4RNZ A;  2HMK B;  5EQL A;  1JN5 A;  2CIU A;  1CEW I;  1K9M 4;  3X41 A;  1IVW A;  1JB2 A;  3X3Z A;  1EG9 B;  2CFD A;  3EN8 A;  1T5Y A;  4FMC A;  4MMZ B;  1STF I;  4WYK A;  3TDG A;  2YX9 A;  1CYV A;  1A2K A;  5DRV A;  4N6U A;  4HM1 B;  2PZV A;  3FZW A;  4HM2 B;  1YJ9 3;  3GWR A;  4KFF A;  1VQP 3;  3IPT A;  4J8T A;  5I97 A;  3DUK A;  4HKV B;  5EEO A;  3PGB A;  2V1L A;  4HM4 B;  1K8A 4;  2ZDJ A;  1JNQ A;  1QAF A;  1TFK A;  1TIJ A;  1NB5 I;  2GEY A;  1IK3 A;  4HM5 B;  3NUV A;  3SED A;  2XFT A;  4EYC A;  5BXQ A;  5D81 A;  3HII A;  2ZL8 A;  2OQE A;  4HM0 B;  4LSO A;  3I55 3;  3B8L A;  3EC9 A;  2MF7 A;  2WGO A;  3NHX A;  1AR0 A;  2OTJ 3;  3KII A;  4L8P A;  1Q81 4;  3K63 A;  4HBR A;  1UW1 A;  1GS3 A;  3WDG B;  2O3O A;  4MEI A;  1OUN A;  1Q40 A;  1U8C B;  3LH4 A;  1RKY A;  3MPH A;  3CCQ 3;  2K54 A;  1ISK A;  2XRX B;  3CCR 3;  4FMA A;  3NV0 B;  2JQ5 A;  2O9U X;  2GU1 A;  5FW5 A;  1Q82 4;  1GY6 A;  5IG0 A;  1L5G B;  3MKI A;  1LXE A;  3IMA B;  4N6T A;  1IU7 A;  1OPY A;  2RFR A;  3F7X A;  3CCL 3;  3G16 A;  2GXF A;  4LZI A;  5AIG A;  1UUV B;  4GL6 A;  3CCM 3;  2Y73 A;  3EF8 A;  4N6V 0;  3F7S A;  1K41 A;  2YFL B;  3G8Z A;  4IPB A;  1JKG B;  1OAC A;  3LZA A;  4J9A A;  3LXU X;  3CPO A;  3EBY A;  1FGR A;  1YJW 3;  3ROB A;  5IER A;  3B4P A;  1J2B A;  2ML6 A;  3QRD A;  7STD A;  3FSD A;  1O7M B;  1IT8 A;  3U97 A;  2BNG A;  5JBS A;  1FGT A;  4XB5 A;  1ROV A;  5CK6 A;  1EKM A;  1M1X B;  4BTX A;  4AKZ A;  4AEQ A;  3GZR A;  2MC8 A;  1W2B 2;  2BHM A;  1E3V A;  1D6Z A;  2P05 A;  4HM6 B;  3PCR A;  1QJG A;  4GB5 A;  2INX A;  1FGQ A;  3CCV 3;  3T8N A;  5IW9 A;  4WP5 A;  3B7C A;  3U1W A;  1OF5 B;  1Q86 4;  1RN7 A;  5LC7 A;  4OUQ A;  1R4C A;  5IG3 A;  3BNC A;  4CDL A;  5IG5 A;  2XGN A;  3CXC 2;  4EC6 A;  4R9L A;  3WOD G;  2OTL 3;  3LOY A;  1PFP A;  1JRQ A;  1M1K 4;  3EE1 A;  3CC2 3;  1Q42 A;  3FG4 A;  1OGZ A;  3NX0 A;  2F99 A;  3OWU A;  2F86 B;  3DGO A;  2W9Q A;  2C10 A;  4O8S A;  4TX4 A;  3IJE B;  2BMQ B;  3SOA A;  1OCV A;  1SJW A;  3WA2 X;  1OHO A;  3LTC A;  2C11 A;  3CCE 3;  2L4V A;  4HVN A;  3FCS B;  3SX1 A;  3T8U A;  1IQ8 A;  1ASK A;  3BNE A;  3LML A;  2QIY A;  4RZM A;  5IEP A;  2LYX A;  1IVX A;  4JF8 A;  1GY5 A;  2BO9 B;  4HYZ A;  1A2V A;  3I56 3;  3OW2 2;  1KC8 4;  3FGY A;  1NDO B;  4O3V A;  5ELJ A;  4BTY A;  3F40 A;  1QVF 2;  4N6O B;  1IVU A;  2XSO B;  2RSX A;  3EBT A;  3OWS A;  1DYU A;  4HM8 B;  4XBT A;  1VQO 3;  4K1U A;  2XF3 A;  1HKX A;  1DMM A;  3LTB A;  3FG1 A;  4XDW A;  1W02 A;  1QAL A;  5KP1 A;  3VF1 A;  3PCS A;  3PS8 A;  3NQY A;  2W0Q A;  3EJV A;  4AKY A;  3CPW 2;  3JVC A;  1EA2 A;  2W56 B;  4HM3 B;  1S72 3;  2JDI H;  2P38 A;  3SVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...