1RGGA

Hydrolase, guanyloribonuclease
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (guanyloribonuclease)
molecule keywords RIBONUCLEASE
publication title Ribonuclease from Streptomyces aureofaciens at atomic resolution.
pubmed doi rcsb
total genus 22
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1995-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rggA00
1B2XA 1GOYA 2AADA 5GSPA 1RCKA 1RMSA 7GSPA 1JBTA 1I0XA 1BVIA 1FZUA 1LNIA 5BIRA 1AQZA 1PY3A 1MGWA 1BSDA 1BNFA 1B3SA 1BUJA 2F4YA 3HOHA 5BU4A 1A2PA 1JBSA 1BNJA 1TRPA 4GSPA 1BSAA 1BNIA 4J5GA 1BSBA 1RDSA 1BIRA 2ZA4A 2KF4A 1BRHA 1RHLA 3DH2A 1I2GA 1RN4A 2BU4A 2F56A 2HOHA 4GHOA 3WR2A 3D4AA 1FUTA 1BRNL 1UCIA 3GSPA 1BRKA 1FW7A 1FUSA 4RNTA 1TTOA 1C54A 1BNGA 1TRQA 1SARA 1BOXA 3SYUA 1DE3A 3AHSA 1BRJA 1RGEA 1I2EA 2KF5A 1I3FA 1BSEA 1X1XA 1BGSA 5HOHA 1T2HA 1FYSA 1PYLA 3RNTA 1Q9EA 1GMQA 1I2FA 3BIRA 1X1UA 3BU4A 1BNEA 1RN1A 1BSCA 1CH0A 4HAAA 1UCJA 1RGGA 1ZGXA 1GSPA 3KCHA 7RNTA 6RNTA 1UCLA 1RGCA 3AHWA 1RGAA 2RBIA 1LOVA 1I3IA 1RSNA 1RNBA 1LOYA 4BU4A 2KF6A 1B20A 1GOUA 5RNTA 4BIRA 1RTUA 8RNTA 1MGRA 6GSPA 1BNRA 2RNTA 1RGLA 1BRSA 1RGHA 1GMRA 4HOHA 1G02A 3Q3FA 1RGFA 1RNTA 1B2UA 3D5IA 1YGWA 1BU4A 1GMPA 2F5WA 3DGYA 1YNVX 2KF3A 1X1WA 1AY7A 1LOWA 1YVSA 1BRGA 1HZ1A 2F5MA 3WHOA 1DETA 1B2MA 1LRAA 1B21A 1RGKA 2SARA 2BIRA 1BRIA 1HYFA 3AGNA 1T2IA 4J5KA 1BNSA 1IYYA 9RNTA 2C4BA 1X1YA 1I8VA 2GSPA 1RLSA 1UCKA 2KAAA 1B27A 1I0VA 1BAOA 2AAEA 3URPA 3D5GA 3A5EA 1I70A 1GOVA 3AGOA 1B2SA 1JBRA 1B2ZA 1BANA 1R4YA 1RCLA
chains in the Genus database with same CATH superfamily
3JVCA 1G0TA 3HIGA 5GSPA 1SIHA 2OWPA 2FNQA 2OOVC 2SBLA 3CNMA 5G1KA 7GSPA 1IK3A 1K734 3CC43 2XSOB 4XBYA 4CCVA 3Q1CA 4HVNA 1K41A 1PY3A 1BSDA 1CQSA 1GYBA 1ULJB 5EQLA 3CCJ3 2Q07A 4OVMA 6STDA 1BUJA 2RGQA 4I4KA 1KD14 2UGIA 1JZOA 1UW1A 3CCV3 3UL6A 1BSAA 4J5GA 5IG4A 1M904 3M8CA 4FMBA 5TGNA 1OHSA 2ML6A 3D79A 5CF1A 1G96A 2CG1A 4NREA 2HMMB 1EEJA 2LQVA 2MF7A 2XEPA 3KSPA 3LOYA 4N6UA 3WOEB 2F56A 2IUKA 4FCZA 4LMIA 1ROAA 1W01A 1BRKA 1N9EA 4LEHA 3X42A 3CMA3 3BNEA 4HZ9B 1IVVA 1VQ43 1W00A 2CKFB 2FGTA 1FUSA 3EHCA 1TTOA 3FSDA 3PCSA 4RNTA 1BNGA 3CCE3 1C54A 1DE3A 1OUNA 4CJNA 1BRJA 3HX8A 3OWSA 1RGEA 4BL3A 5BXQA 4HBRA 2F98A 5IG5A 2YFJB 3G8ZA 3FGYA 5I97A 2CHCA 4JF8A 5FW5A 1PYLA 5STDA 3S27A 5D81A 3RNTA 4MJDA 3LYGA 1AVLA 2P38A 1IU7A 2GEXA 1UUWB 4N3VA 3VSYA 5IG0A 4BTWA 3OX9A 1JB5A 4KFEA 3CCS3 2CX0A 3VGNA 4L8OA 3IJEB 2OTJ3 1VQ53 1DVDA 1IDPA 1KSIA 1OPYA 2RBIA 4PEJA 2GBWB 1EUIC 3WA2X 3EBTA 5KP3A 1W6CA 3EF8A 1LOYA 2GBXB 4N6OB 4BU4A 3STDA 1OF5B 3DM8A 1F8NA 4HM0B 4N6NB 3LTCA 3NUVA 1VQ63 4OUQA 3NV0B 3DXOA 2PNCA 2CWVA 3NBRA 1RGFA 3D5IA 2IY2A 5AEWB 1BU4A 1C7HA 1GMPA 1W6YA 4K90B 3IPTA 4ORLA 2CH9A 1N5HA 5AI1A 1AY7A 1EKMA 4K1VA 4KVHA 1BRGA 2L4VA 3WHOA 1AR0A 3VF1A 5D83A 3EBYA 3EJVA 2F86B 3CC73 1K28A 3H3HA 2BIRA 1BRIA 1HYFA 1QVF2 3K63A 1BNSA 1MWSA 4IIAA 4EV2A 4BL2A 3RGAA 1NB5I 1V74A 1I8VA 3MWZA 2XF3A 4AKYA 2KAAA 2XFTA 4XDVA 1I0VA 1BAOA 5LC7A 1OHPA 3URPA 1RJOA 3GAXA 4GL6A 4R9LA 1R4CA 1BUQA 3S5CA 2R41A 1B2ZA 1PU4A 1SPUA 4IPBA 4ZM8A 1R4YA 3DGOA 4XDWA 1SJWA 8CHOA 3I563 2AADA 4N6V0 3BNBA 3MKIA 1W2ZA 5G2GA 1CEWI 3PXMA 1JBTA 1JB2A 1BVIA 3V98A 1UDII 1AQZA 2CC3A 3DY5A 4LSOA 2GEYA 3PYJA 3FG1A 3B4PA 1FGTA 2P0XA 4OK0A 3CCU3 2O3OA 3DZLA 3G6E3 3SOAA 1NB3I 1K8A4 1BNJA 1ROVA 2STDA 5AYSC 3EQQB 1QAKA 3BNDA 1BSBA 3OV4A 3CPW2 4RBNA 1YVBI 2UUGC 1U8CB 2ZA4A 3D3LA 3EC9A 5IENA 1IV7A 1KC84 1DMMA 4KT3B 1Q814 2W03A 3BNCA 3DGLA 3LZAA 4O8SA 1DVCA 4WP5A 3FF0A 1RKYA 3B7CA 4FCJA 1EA2A 3UJMA 5A0OB 1S723 1FW7A 3H51A 1HU9A 1UGIA 3S29A 3CCQ3 1ZS7A 2HMKB 3O8YA 3IMAB 1VQ93 1NO3A 3MG3A 3WMDA 4XM4A 3SX1A 1FGOA 1SIIA 2B1XB 4STDA 3G0KA 2OQEC 3K7CA 2D1WA 5EVHA 1E97A 1I2EA 3EN1B 3F14A 1Q40A 2CK3H 3ECFA 2QGUA 2BT3A 1A2KA 1X1XA 2BNGA 5AIHA 3SVAA 4L7KA 3CXC2 1JN5A 3X41A 5HOHA 1T2HA 1FYSA 1NDOB 1RRLA 2OTL3 2ML5A 5IW9A 1JNQA 5DREA 1JRQA 2CFWA 1DMNA 3KIIA 4HM6B 1I2FA 1RRHA 1M1XB 1X1UA 3SLUA 1BNEA 2IA7A 1E3VA 1W6GA 2PZVA 4X2HA 1LQMB 4EV5A 1UCJA 1RGGA 1ZGXA 1GSPA 3F9SA 3KCHA 3X40A 3ROBA 6RNTA 7RNTA 3F8XA 4J8TA 1LOVA 5AEUB 3FF2A 2I9WA 1W7CA 1UUGB 2UX0A 2KF6A 2WOFA 4RZMA 3EN8A 4BIRA 3ALAA 1MGRA 5ELUA 4R4KA 4CDLA 2CWUA 1BNRA 2RNTA 1NJI4 1GY6A 4R9KA 1RGLA 1OGXA 2XH9A 3PS8A 1GMRA 2R4IA 1G02A 1VQL3 4HJLB 4FR9A 4NHFA 4I5QA 4RNYA 1GD3A 4WHAA 5CXOA 1B2UA 2XFSA 3DMCA 1D6YA 4K61A 1GS3A 1ULIB 3CNXA 4FCMA 1AV4A 2F5WA 3V99A 4FMDA 2L1SA 3CME3 3HZPA 1A67A 3NM7A 2BMRB 3EB8A 4L8PA 1X1WA 2WGOA 1RN7A 3KFQC 1LOWA 2GXFA 1Q824 1YVSA 1MOLA 3GZXB 4O2HA 3FCSB 3HIIA 1J2BA 3JUQA 1VQ73 1DETA 4AEQA 3NX0A 1YGEA 1B21A 5JPUA 1A90A 1OACA 1JZDA 2H0IA 3N8BA 4J5KA 3J7Yd 1YJW3 1T5YA 3JUPA 9RNTA 2QA43 2C4BA 1DMQA 1X1YA 2Z77A 1KQS2 1K9M4 1RLSA 1UCKA 1B27A 1TP6A 2IUJA 3U97A 1WNHA 1UI8A 3QRDA 4N6MA 2AAEA 3CC23 3SOYA 3TDGA 2XGNA 1I70A 1GOVA 1B2SA 1JBRA 3K0ZA 1SQWA 5IG3A 2O9UX 1IT8A 2P0MA 2CG0A 3GZBA 1MWUA 1MWRA 1RCKA 2Z7AA 5KP4A 1RMSA 2A15A 2H0HA 3HI7A 3K9MC 3K5TA 3NBBA 1I0XA 2ZL8A 1UUVB 1FZUA 3ZFZA 5BIRA 3KN4A 1EG9B 2HMLB 4BTXA 2JDIH 4XB5A 4XBXA 4ILFA 3HK4A 1Q40B 1FGMA 3AMOA 3F7SA 3KZTA 1Y4KA 1UI7A 3D9RA 1JN5B 1IV9A 5ELJA 1Q7HA 1V57A 2F4YA 3HOHA 4MMYB 2MC8A 5BU4A 5IERA 5M19A 1NWWA 5JPPA 3BB9A 3F40A 4O3VA 4GSPA 1BNIA 1Q864 3KKGA 1RDSA 1BIRA 4LYLB 1VZZA 3FH1A 2BO9B 1VQ83 1RHLA 3DH2A 2P09A 2Z76A 3QK9A 3WR2A 2HOHA 3A76A 4GHOA 3T8UA 3D4AA 1FUTA 1UCIA 3GSPA 3KSED 3MG2A 5CLKA 3LMLA 2INXA 5G1LA 2BMQB 2KCDA 1L5GB 1YJ93 3GZYB 4HKVB 4IT7A 1TRQA 2XSHB 1SARA 4O02B 1BOXA 5FGOA 1KWIA 1A2VA 4RNZA 1WMPA 3AHSA 1E3RA 3MSOA 3UB1A 1TU5A 2KF5A 3NHXA 3LTDA 2LYXA 4HM7B 1I3FA 1PFPA 1BSEA 2Z6BA 4EXRA 3NQYA 1U5OA 2V1LA 5IEPA 3B8LA 4H61A 2XGLA 5CK6A 1IT7A 1TIJA 1Q9EA 1GMQA 1VQN3 3BIRA 3Q90A 2HMOB 2YX9A 4FMAA 3N54B 3G16A 1RN1A 2B24B 1CYUA 3I553 4XBTA 1BSCA 2H0GA 4FMCA 5M18A 4HAAA 3N9HA 3MYTA 1ASKA 1LOXA 1EQKA 3AHWA 1RGAA 1VQM3 1OGZA 1JV2B 2W6JH 1US1A 4LZIA 1I3IA 1QALA 2RCDA 4GB5A 2JQ5A 1RSNA 4BTYA 5AIFA 2W56A 5RNTA 4NPBA 1V58A 1RTUA 3CD63 4WYKA 2CX1A 1TFOA 1VQQA 4Q53A 1IVXA 2FXTA 2OOVA 1CYVA 3Q3FA 3U1WA 2C11A 1GY5A 2D42A 1O7GB 3OWYA 3KE7A 5EEOA 1IVWA 1VQK3 1JKGA 1YNVX 1O7WB 2W0QA 2KF3A 2CFGA 1OHOA 1N9JA 5D82A 4X2OA 2GU1A 4HM4B 1WMNA 1HZ1A 1D6UA 5AIIA 1IQXA 4K1UA 3AMOB 1O7HB 3MG1A 4N6LA 2E2TA 2QEX3 1LRAA 1B2MA 3WOFB 2KXGA 3ER7A 1RGKA 3GRDA 5M1AA 2K0MA 3FG4A 3UL5A 3G713 3LXUX 1IYYA 1T2IA 1FGRA 1YI23 2CWTA 2GSPA 3CPOA 3FKAA 2XRXB 5LC6A 2GU3A 1OCVA 3T8NA 4AKZA 3WODG 3A5EA 1S5AA 3WDGB 1HKXA 1O7PB 4LGQA 1AVKA 1M1K4 1Q42A 2ZDJA 4HYZA 3F7XA 4EC6A 2W9QA 1RCLA 3LH4A 3FLJA 2F99A 1B2XA 1GOYA 2HMJB 3EE1A 3JUNA 4WWUC 4HM2B 1YIJ3 4HM1B 3UNLA 1LNIA 1Q7Y4 1GD4A 1MGWA 1QAFA 3NBJA 5DRVA 1N5PA 5BVBA 1BNFA 1B3SA 1IQ8A 2E2VA 1A2PA 1JBSA 4TX4A 3BLZA 2W2CA 1TRPA 2OCTA 3RGRA 4J9AA 3S67A 3CCM3 2HMNB 5IF6A 3L0RA 3ZG0A 2IMJA 2KF4A 1BRHA 2ZHXB 3SXXA 2WO0A 1YIT3 1MNLA 1I2GA 1RN4A 2BU4A 4MMZB 1UGHI 1N8QA 4EBGA 1O7MB 2RFRA 1N8R4 1QMAA 2WGQA 5HGRA 1BRNL 2J8XB 2BHMA 1IQYA 3LT9A 3X3YA 4KFDA 1TFKA 1GY7A 4H3UA 3SYUA 3PCRA 2RSXA 2W56B 4MMXB 4WYKB 2E2UA 1TJDA 3B4OA 3GWRA 4EW5A 1LXEA 5AYRB 2IYJA 1MWTA 4HM8B 4WFOA 5JBSA 1BGSA 4JRFA 4U13A 3X3ZA 4KZ1A 1VQP3 3DGNA 3OWUA 1LNHA 1FA3A 3JUMA 3CCL3 1VQO3 1JKGB 2XR8B 4KFFA 3EX9A 1YHQ3 3BU4A 3CCR3 4R1KA 3DGMA 1NNVA 1DYUA 3JUOA 4N6TA 5IEOA 1CH0A 2W04A 3DUKA 1D6ZA 2CW9A 2YFIB 1FGQA 1UCLA 1RGCA 1WQLB 7STDA 1QJGA 2Y73A 4G1MB 3NQZA 4R80A 3NM2A 1RNBA 4HZBB 2QIYA 1STDA 3V92A 1B20A 1GOUA 4QWTA 3G4S3 2CFDA 1FUWA 8RNTA 2K54A 3GZRA 2CFKA 4HM3B 6GSPA 3NXJA 1Z1SA 2YFLB 3OW22 1W2B2 1BRSA 1ISKA 1W4NA 1RGHA 1WTHA 4HOHA 1O7NB 1NU3A 2P05A 3FG3A 1RNTA 1TUHA 2Y74A 1T3BA 3PGBA 5KP1A 1YGWA 3CU3A 3SEDA 1W02A 3DGYA 3S28A 3PZWA 4MEIA 4EYCA 3ZG5A 3LT8A 1QVG2 2W9PA 1OH0A 2WOHA 3RDEA 2F5MA 1ZO2A 3I0YA 2M7OA 4HM5B 3OXAA 1JJ22 3LTAA 3X3XA 2SARA 1LQGC 1STFI 2K3DA 1JB4A 5CF2A 5AIGA 3AGNA 1M9GA 3WA3A 1IVUA 2KRTA 3T0UA 3FZWA 3MPHA 3MHEA 1OF5A 2C10A 2CFLA 3E99A 3D5GA 2BMOB 1WMOA 3NV0A 1YJN3 3F8HA 1W5ZA 4CPKA 3AGOA 4DKIA 1BANA 2OQEA 3LTBA 1ZX2A 3Q2PA 2CIUA 1LVNA
chains in the Genus database with same CATH topology
1B2XA 1GOYA 2AADA 5GSPA 1RCKA 1RMSA 7GSPA 1JBTA 1I0XA 1BVIA 1FZUA 1LNIA 5BIRA 1AQZA 1PY3A 1MGWA 1BSDA 1BNFA 1B3SA 1BUJA 2F4YA 3HOHA 5BU4A 1A2PA 1JBSA 1BNJA 1TRPA 4GSPA 1BSAA 1BNIA 4J5GA 1BSBA 1RDSA 1BIRA 2ZA4A 2KF4A 1BRHA 1RHLA 3DH2A 1I2GA 1RN4A 2BU4A 2F56A 2HOHA 4GHOA 3WR2A 3D4AA 1FUTA 1BRNL 1UCIA 3GSPA 1BRKA 1FW7A 1FUSA 4RNTA 1TTOA 1C54A 1BNGA 1TRQA 1SARA 1BOXA 3SYUA 1DE3A 3AHSA 1BRJA 1RGEA 1I2EA 2KF5A 1I3FA 1BSEA 1X1XA 1BGSA 5HOHA 1T2HA 1FYSA 1PYLA 3RNTA 1Q9EA 1GMQA 1I2FA 3BIRA 1X1UA 3BU4A 1BNEA 1RN1A 1BSCA 1CH0A 4HAAA 1UCJA 1RGGA 1ZGXA 1GSPA 3KCHA 7RNTA 6RNTA 1UCLA 1RGCA 3AHWA 1RGAA 2RBIA 1LOVA 1I3IA 1RSNA 1RNBA 1LOYA 4BU4A 2KF6A 1B20A 1GOUA 5RNTA 4BIRA 1RTUA 8RNTA 1MGRA 6GSPA 1BNRA 2RNTA 1RGLA 1BRSA 1RGHA 1GMRA 4HOHA 1G02A 3Q3FA 1RGFA 1RNTA 1B2UA 3D5IA 1YGWA 1BU4A 1GMPA 2F5WA 3DGYA 1YNVX 2KF3A 1X1WA 1AY7A 1LOWA 1YVSA 1BRGA 1HZ1A 2F5MA 3WHOA 1DETA 1B2MA 1LRAA 1B21A 1RGKA 2SARA 2BIRA 1BRIA 1HYFA 3AGNA 1T2IA 4J5KA 1BNSA 1IYYA 9RNTA 2C4BA 1X1YA 1I8VA 2GSPA 1RLSA 1UCKA 2KAAA 1B27A 1I0VA 1BAOA 2AAEA 3URPA 3D5GA 3A5EA 1I70A 1GOVA 3AGOA 1B2SA 1JBRA 1B2ZA 1BANA 1R4YA 1RCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2X A;  1GOY A;  2AAD A;  5GSP A;  1RCK A;  1RMS A;  7GSP A;  1JBT A;  1I0X A;  1BVI A;  1FZU A;  1LNI A;  5BIR A;  1AQZ A;  1PY3 A;  1MGW A;  1BSD A;  1BNF A;  1B3S A;  1BUJ A;  2F4Y A;  3HOH A;  5BU4 A;  1A2P A;  1JBS A;  1BNJ A;  1TRP A;  4GSP A;  1BSA A;  1BNI A;  4J5G A;  1BSB A;  1RDS A;  1BIR A;  2ZA4 A;  2KF4 A;  1BRH A;  1RHL A;  3DH2 A;  1I2G A;  1RN4 A;  2BU4 A;  2F56 A;  2HOH A;  4GHO A;  3WR2 A;  3D4A A;  1FUT A;  1BRN L;  1UCI A;  3GSP A;  1BRK A;  1FW7 A;  1FUS A;  4RNT A;  1TTO A;  1C54 A;  1BNG A;  1TRQ A;  1SAR A;  1BOX A;  3SYU A;  1DE3 A;  3AHS A;  1BRJ A;  1RGE A;  1I2E A;  2KF5 A;  1I3F A;  1BSE A;  1X1X A;  1BGS A;  5HOH A;  1T2H A;  1FYS A;  1PYL A;  3RNT A;  1Q9E A;  1GMQ A;  1I2F A;  3BIR A;  1X1U A;  3BU4 A;  1BNE A;  1RN1 A;  1BSC A;  1CH0 A;  4HAA A;  1UCJ A;  1RGG A;  1ZGX A;  1GSP A;  3KCH A;  7RNT A;  6RNT A;  1UCL A;  1RGC A;  3AHW A;  1RGA A;  2RBI A;  1LOV A;  1I3I A;  1RSN A;  1RNB A;  1LOY A;  4BU4 A;  2KF6 A;  1B20 A;  1GOU A;  5RNT A;  4BIR A;  1RTU A;  8RNT A;  1MGR A;  6GSP A;  1BNR A;  2RNT A;  1RGL A;  1BRS A;  1RGH A;  1GMR A;  4HOH A;  1G02 A;  3Q3F A;  1RGF A;  1RNT A;  1B2U A;  3D5I A;  1YGW A;  1BU4 A;  1GMP A;  2F5W A;  3DGY A;  1YNV X;  2KF3 A;  1X1W A;  1AY7 A;  1LOW A;  1YVS A;  1BRG A;  1HZ1 A;  2F5M A;  3WHO A;  1DET A;  1B2M A;  1LRA A;  1B21 A;  1RGK A;  2SAR A;  2BIR A;  1BRI A;  1HYF A;  3AGN A;  1T2I A;  4J5K A;  1BNS A;  1IYY A;  9RNT A;  2C4B A;  1X1Y A;  1I8V A;  2GSP A;  1RLS A;  1UCK A;  2KAA A;  1B27 A;  1I0V A;  1BAO A;  2AAE A;  3URP A;  3D5G A;  3A5E A;  1I70 A;  1GOV A;  3AGO A;  1B2S A;  1JBR A;  1B2Z A;  1BAN A;  1R4Y A;  1RCL A; 
#chains in the Genus database with same CATH topology
 3JVC A;  1G0T A;  3HIG A;  5GSP A;  1SIH A;  2OWP A;  2FNQ A;  2OOV C;  2SBL A;  3CNM A;  5G1K A;  7GSP A;  1IK3 A;  1K73 4;  3CC4 3;  2XSO B;  4XBY A;  4CCV A;  3Q1C A;  4HVN A;  1K41 A;  1PY3 A;  1BSD A;  1CQS A;  1GYB A;  1ULJ B;  5EQL A;  3CCJ 3;  2Q07 A;  4OVM A;  6STD A;  1BUJ A;  2RGQ A;  4I4K A;  1KD1 4;  2UGI A;  1JZO A;  1UW1 A;  3CCV 3;  3UL6 A;  1BSA A;  4J5G A;  5IG4 A;  1M90 4;  3M8C A;  4FMB A;  5TGN A;  1OHS A;  2ML6 A;  3D79 A;  5CF1 A;  1G96 A;  2CG1 A;  4NRE A;  2HMM B;  1EEJ A;  2LQV A;  2MF7 A;  2XEP A;  3KSP A;  3LOY A;  4N6U A;  3WOE B;  2F56 A;  2IUK A;  4FCZ A;  4LMI A;  1ROA A;  1W01 A;  1BRK A;  1N9E A;  4LEH A;  3X42 A;  3CMA 3;  3BNE A;  4HZ9 B;  1IVV A;  1VQ4 3;  1W00 A;  2CKF B;  2FGT A;  1FUS A;  3EHC A;  1TTO A;  3FSD A;  3PCS A;  4RNT A;  1BNG A;  3CCE 3;  1C54 A;  1DE3 A;  1OUN A;  4CJN A;  1BRJ A;  3HX8 A;  3OWS A;  1RGE A;  4BL3 A;  5BXQ A;  4HBR A;  2F98 A;  5IG5 A;  2YFJ B;  3G8Z A;  3FGY A;  5I97 A;  2CHC A;  4JF8 A;  5FW5 A;  1PYL A;  5STD A;  3S27 A;  5D81 A;  3RNT A;  4MJD A;  3LYG A;  1AVL A;  2P38 A;  1IU7 A;  2GEX A;  1UUW B;  4N3V A;  3VSY A;  5IG0 A;  4BTW A;  3OX9 A;  1JB5 A;  4KFE A;  3CCS 3;  2CX0 A;  3VGN A;  4L8O A;  3IJE B;  2OTJ 3;  1VQ5 3;  1DVD A;  1IDP A;  1KSI A;  1OPY A;  2RBI A;  4PEJ A;  2GBW B;  1EUI C;  3WA2 X;  3EBT A;  5KP3 A;  1W6C A;  3EF8 A;  1LOY A;  2GBX B;  4N6O B;  4BU4 A;  3STD A;  1OF5 B;  3DM8 A;  1F8N A;  4HM0 B;  4N6N B;  3LTC A;  3NUV A;  1VQ6 3;  4OUQ A;  3NV0 B;  3DXO A;  2PNC A;  2CWV A;  3NBR A;  1RGF A;  3D5I A;  2IY2 A;  5AEW B;  1BU4 A;  1C7H A;  1GMP A;  1W6Y A;  4K90 B;  3IPT A;  4ORL A;  2CH9 A;  1N5H A;  5AI1 A;  1AY7 A;  1EKM A;  4K1V A;  4KVH A;  1BRG A;  2L4V A;  3WHO A;  1AR0 A;  3VF1 A;  5D83 A;  3EBY A;  3EJV A;  2F86 B;  3CC7 3;  1K28 A;  3H3H A;  2BIR A;  1BRI A;  1HYF A;  1QVF 2;  3K63 A;  1BNS A;  1MWS A;  4IIA A;  4EV2 A;  4BL2 A;  3RGA A;  1NB5 I;  1V74 A;  1I8V A;  3MWZ A;  2XF3 A;  4AKY A;  2KAA A;  2XFT A;  4XDV A;  1I0V A;  1BAO A;  5LC7 A;  1OHP A;  3URP A;  1RJO A;  3GAX A;  4GL6 A;  4R9L A;  1R4C A;  1BUQ A;  3S5C A;  2R41 A;  1B2Z A;  1PU4 A;  1SPU A;  4IPB A;  4ZM8 A;  1R4Y A;  3DGO A;  4XDW A;  1SJW A;  8CHO A;  3I56 3;  2AAD A;  4N6V 0;  3BNB A;  3MKI A;  1W2Z A;  5G2G A;  1CEW I;  3PXM A;  1JBT A;  1JB2 A;  1BVI A;  3V98 A;  1UDI I;  1AQZ A;  2CC3 A;  3DY5 A;  4LSO A;  2GEY A;  3PYJ A;  3FG1 A;  3B4P A;  1FGT A;  2P0X A;  4OK0 A;  3CCU 3;  2O3O A;  3DZL A;  3G6E 3;  3SOA A;  1NB3 I;  1K8A 4;  1BNJ A;  1ROV A;  2STD A;  5AYS C;  3EQQ B;  1QAK A;  3BND A;  1BSB A;  3OV4 A;  3CPW 2;  4RBN A;  1YVB I;  2UUG C;  1U8C B;  2ZA4 A;  3D3L A;  3EC9 A;  5IEN A;  1IV7 A;  1KC8 4;  1DMM A;  4KT3 B;  1Q81 4;  2W03 A;  3BNC A;  3DGL A;  3LZA A;  4O8S A;  1DVC A;  4WP5 A;  3FF0 A;  1RKY A;  3B7C A;  4FCJ A;  1EA2 A;  3UJM A;  5A0O B;  1S72 3;  1FW7 A;  3H51 A;  1HU9 A;  1UGI A;  3S29 A;  3CCQ 3;  1ZS7 A;  2HMK B;  3O8Y A;  3IMA B;  1VQ9 3;  1NO3 A;  3MG3 A;  3WMD A;  4XM4 A;  3SX1 A;  1FGO A;  1SII A;  2B1X B;  4STD A;  3G0K A;  2OQE C;  3K7C A;  2D1W A;  5EVH A;  1E97 A;  1I2E A;  3EN1 B;  3F14 A;  1Q40 A;  2CK3 H;  3ECF A;  2QGU A;  2BT3 A;  1A2K A;  1X1X A;  2BNG A;  5AIH A;  3SVA A;  4L7K A;  3CXC 2;  1JN5 A;  3X41 A;  5HOH A;  1T2H A;  1FYS A;  1NDO B;  1RRL A;  2OTL 3;  2ML5 A;  5IW9 A;  1JNQ A;  5DRE A;  1JRQ A;  2CFW A;  1DMN A;  3KII A;  4HM6 B;  1I2F A;  1RRH A;  1M1X B;  1X1U A;  3SLU A;  1BNE A;  2IA7 A;  1E3V A;  1W6G A;  2PZV A;  4X2H A;  1LQM B;  4EV5 A;  1UCJ A;  1RGG A;  1ZGX A;  1GSP A;  3F9S A;  3KCH A;  3X40 A;  3ROB A;  6RNT A;  7RNT A;  3F8X A;  4J8T A;  1LOV A;  5AEU B;  3FF2 A;  2I9W A;  1W7C A;  1UUG B;  2UX0 A;  2KF6 A;  2WOF A;  4RZM A;  3EN8 A;  4BIR A;  3ALA A;  1MGR A;  5ELU A;  4R4K A;  4CDL A;  2CWU A;  1BNR A;  2RNT A;  1NJI 4;  1GY6 A;  4R9K A;  1RGL A;  1OGX A;  2XH9 A;  3PS8 A;  1GMR A;  2R4I A;  1G02 A;  1VQL 3;  4HJL B;  4FR9 A;  4NHF A;  4I5Q A;  4RNY A;  1GD3 A;  4WHA A;  5CXO A;  1B2U A;  2XFS A;  3DMC A;  1D6Y A;  4K61 A;  1GS3 A;  1ULI B;  3CNX A;  4FCM A;  1AV4 A;  2F5W A;  3V99 A;  4FMD A;  2L1S A;  3CME 3;  3HZP A;  1A67 A;  3NM7 A;  2BMR B;  3EB8 A;  4L8P A;  1X1W A;  2WGO A;  1RN7 A;  3KFQ C;  1LOW A;  2GXF A;  1Q82 4;  1YVS A;  1MOL A;  3GZX B;  4O2H A;  3FCS B;  3HII A;  1J2B A;  3JUQ A;  1VQ7 3;  1DET A;  4AEQ A;  3NX0 A;  1YGE A;  1B21 A;  5JPU A;  1A90 A;  1OAC A;  1JZD A;  2H0I A;  3N8B A;  4J5K A;  3J7Y d;  1YJW 3;  1T5Y A;  3JUP A;  9RNT A;  2QA4 3;  2C4B A;  1DMQ A;  1X1Y A;  2Z77 A;  1KQS 2;  1K9M 4;  1RLS A;  1UCK A;  1B27 A;  1TP6 A;  2IUJ A;  3U97 A;  1WNH A;  1UI8 A;  3QRD A;  4N6M A;  2AAE A;  3CC2 3;  3SOY A;  3TDG A;  2XGN A;  1I70 A;  1GOV A;  1B2S A;  1JBR A;  3K0Z A;  1SQW A;  5IG3 A;  2O9U X;  1IT8 A;  2P0M A;  2CG0 A;  3GZB A;  1MWU A;  1MWR A;  1RCK A;  2Z7A A;  5KP4 A;  1RMS A;  2A15 A;  2H0H A;  3HI7 A;  3K9M C;  3K5T A;  3NBB A;  1I0X A;  2ZL8 A;  1UUV B;  1FZU A;  3ZFZ A;  5BIR A;  3KN4 A;  1EG9 B;  2HML B;  4BTX A;  2JDI H;  4XB5 A;  4XBX A;  4ILF A;  3HK4 A;  1Q40 B;  1FGM A;  3AMO A;  3F7S A;  3KZT A;  1Y4K A;  1UI7 A;  3D9R A;  1JN5 B;  1IV9 A;  5ELJ A;  1Q7H A;  1V57 A;  2F4Y A;  3HOH A;  4MMY B;  2MC8 A;  5BU4 A;  5IER A;  5M19 A;  1NWW A;  5JPP A;  3BB9 A;  3F40 A;  4O3V A;  4GSP A;  1BNI A;  1Q86 4;  3KKG A;  1RDS A;  1BIR A;  4LYL B;  1VZZ A;  3FH1 A;  2BO9 B;  1VQ8 3;  1RHL A;  3DH2 A;  2P09 A;  2Z76 A;  3QK9 A;  3WR2 A;  2HOH A;  3A76 A;  4GHO A;  3T8U A;  3D4A A;  1FUT A;  1UCI A;  3GSP A;  3KSE D;  3MG2 A;  5CLK A;  3LML A;  2INX A;  5G1L A;  2BMQ B;  2KCD A;  1L5G B;  1YJ9 3;  3GZY B;  4HKV B;  4IT7 A;  1TRQ A;  2XSH B;  1SAR A;  4O02 B;  1BOX A;  5FGO A;  1KWI A;  1A2V A;  4RNZ A;  1WMP A;  3AHS A;  1E3R A;  3MSO A;  3UB1 A;  1TU5 A;  2KF5 A;  3NHX A;  3LTD A;  2LYX A;  4HM7 B;  1I3F A;  1PFP A;  1BSE A;  2Z6B A;  4EXR A;  3NQY A;  1U5O A;  2V1L A;  5IEP A;  3B8L A;  4H61 A;  2XGL A;  5CK6 A;  1IT7 A;  1TIJ A;  1Q9E A;  1GMQ A;  1VQN 3;  3BIR A;  3Q90 A;  2HMO B;  2YX9 A;  4FMA A;  3N54 B;  3G16 A;  1RN1 A;  2B24 B;  1CYU A;  3I55 3;  4XBT A;  1BSC A;  2H0G A;  4FMC A;  5M18 A;  4HAA A;  3N9H A;  3MYT A;  1ASK A;  1LOX A;  1EQK A;  3AHW A;  1RGA A;  1VQM 3;  1OGZ A;  1JV2 B;  2W6J H;  1US1 A;  4LZI A;  1I3I A;  1QAL A;  2RCD A;  4GB5 A;  2JQ5 A;  1RSN A;  4BTY A;  5AIF A;  2W56 A;  5RNT A;  4NPB A;  1V58 A;  1RTU A;  3CD6 3;  4WYK A;  2CX1 A;  1TFO A;  1VQQ A;  4Q53 A;  1IVX A;  2FXT A;  2OOV A;  1CYV A;  3Q3F A;  3U1W A;  2C11 A;  1GY5 A;  2D42 A;  1O7G B;  3OWY A;  3KE7 A;  5EEO A;  1IVW A;  1VQK 3;  1JKG A;  1YNV X;  1O7W B;  2W0Q A;  2KF3 A;  2CFG A;  1OHO A;  1N9J A;  5D82 A;  4X2O A;  2GU1 A;  4HM4 B;  1WMN A;  1HZ1 A;  1D6U A;  5AII A;  1IQX A;  4K1U A;  3AMO B;  1O7H B;  3MG1 A;  4N6L A;  2E2T A;  2QEX 3;  1LRA A;  1B2M A;  3WOF B;  2KXG A;  3ER7 A;  1RGK A;  3GRD A;  5M1A A;  2K0M A;  3FG4 A;  3UL5 A;  3G71 3;  3LXU X;  1IYY A;  1T2I A;  1FGR A;  1YI2 3;  2CWT A;  2GSP A;  3CPO A;  3FKA A;  2XRX B;  5LC6 A;  2GU3 A;  1OCV A;  3T8N A;  4AKZ A;  3WOD G;  3A5E A;  1S5A A;  3WDG B;  1HKX A;  1O7P B;  4LGQ A;  1AVK A;  1M1K 4;  1Q42 A;  2ZDJ A;  4HYZ A;  3F7X A;  4EC6 A;  2W9Q A;  1RCL A;  3LH4 A;  3FLJ A;  2F99 A;  1B2X A;  1GOY A;  2HMJ B;  3EE1 A;  3JUN A;  4WWU C;  4HM2 B;  1YIJ 3;  4HM1 B;  3UNL A;  1LNI A;  1Q7Y 4;  1GD4 A;  1MGW A;  1QAF A;  3NBJ A;  5DRV A;  1N5P A;  5BVB A;  1BNF A;  1B3S A;  1IQ8 A;  2E2V A;  1A2P A;  1JBS A;  4TX4 A;  3BLZ A;  2W2C A;  1TRP A;  2OCT A;  3RGR A;  4J9A A;  3S67 A;  3CCM 3;  2HMN B;  5IF6 A;  3L0R A;  3ZG0 A;  2IMJ A;  2KF4 A;  1BRH A;  2ZHX B;  3SXX A;  2WO0 A;  1YIT 3;  1MNL A;  1I2G A;  1RN4 A;  2BU4 A;  4MMZ B;  1UGH I;  1N8Q A;  4EBG A;  1O7M B;  2RFR A;  1N8R 4;  1QMA A;  2WGQ A;  5HGR A;  1BRN L;  2J8X B;  2BHM A;  1IQY A;  3LT9 A;  3X3Y A;  4KFD A;  1TFK A;  1GY7 A;  4H3U A;  3SYU A;  3PCR A;  2RSX A;  2W56 B;  4MMX B;  4WYK B;  2E2U A;  1TJD A;  3B4O A;  3GWR A;  4EW5 A;  1LXE A;  5AYR B;  2IYJ A;  1MWT A;  4HM8 B;  4WFO A;  5JBS A;  1BGS A;  4JRF A;  4U13 A;  3X3Z A;  4KZ1 A;  1VQP 3;  3DGN A;  3OWU A;  1LNH A;  1FA3 A;  3JUM A;  3CCL 3;  1VQO 3;  1JKG B;  2XR8 B;  4KFF A;  3EX9 A;  1YHQ 3;  3BU4 A;  3CCR 3;  4R1K A;  3DGM A;  1NNV A;  1DYU A;  3JUO A;  4N6T A;  5IEO A;  1CH0 A;  2W04 A;  3DUK A;  1D6Z A;  2CW9 A;  2YFI B;  1FGQ A;  1UCL A;  1RGC A;  1WQL B;  7STD A;  1QJG A;  2Y73 A;  4G1M B;  3NQZ A;  4R80 A;  3NM2 A;  1RNB A;  4HZB B;  2QIY A;  1STD A;  3V92 A;  1B20 A;  1GOU A;  4QWT A;  3G4S 3;  2CFD A;  1FUW A;  8RNT A;  2K54 A;  3GZR A;  2CFK A;  4HM3 B;  6GSP A;  3NXJ A;  1Z1S A;  2YFL B;  3OW2 2;  1W2B 2;  1BRS A;  1ISK A;  1W4N A;  1RGH A;  1WTH A;  4HOH A;  1O7N B;  1NU3 A;  2P05 A;  3FG3 A;  1RNT A;  1TUH A;  2Y74 A;  1T3B A;  3PGB A;  5KP1 A;  1YGW A;  3CU3 A;  3SED A;  1W02 A;  3DGY A;  3S28 A;  3PZW A;  4MEI A;  4EYC A;  3ZG5 A;  3LT8 A;  1QVG 2;  2W9P A;  1OH0 A;  2WOH A;  3RDE A;  2F5M A;  1ZO2 A;  3I0Y A;  2M7O A;  4HM5 B;  3OXA A;  1JJ2 2;  3LTA A;  3X3X A;  2SAR A;  1LQG C;  1STF I;  2K3D A;  1JB4 A;  5CF2 A;  5AIG A;  3AGN A;  1M9G A;  3WA3 A;  1IVU A;  2KRT A;  3T0U A;  3FZW A;  3MPH A;  3MHE A;  1OF5 A;  2C10 A;  2CFL A;  3E99 A;  3D5G A;  2BMO B;  1WMO A;  3NV0 A;  1YJN 3;  3F8H A;  1W5Z A;  4CPK A;  3AGO A;  4DKI A;  1BAN A;  2OQE A;  3LTB A;  1ZX2 A;  3Q2P A;  2CIU A;  1LVN A; 
#chains in the Genus database with same CATH homology
 1B2X A;  1GOY A;  2AAD A;  5GSP A;  1RCK A;  1RMS A;  7GSP A;  1JBT A;  1I0X A;  1BVI A;  1FZU A;  1LNI A;  5BIR A;  1AQZ A;  1PY3 A;  1MGW A;  1BSD A;  1BNF A;  1B3S A;  1BUJ A;  2F4Y A;  3HOH A;  5BU4 A;  1A2P A;  1JBS A;  1BNJ A;  1TRP A;  4GSP A;  1BSA A;  1BNI A;  4J5G A;  1BSB A;  1RDS A;  1BIR A;  2ZA4 A;  2KF4 A;  1BRH A;  1RHL A;  3DH2 A;  1I2G A;  1RN4 A;  2BU4 A;  2F56 A;  2HOH A;  4GHO A;  3WR2 A;  3D4A A;  1FUT A;  1BRN L;  1UCI A;  3GSP A;  1BRK A;  1FW7 A;  1FUS A;  4RNT A;  1TTO A;  1C54 A;  1BNG A;  1TRQ A;  1SAR A;  1BOX A;  3SYU A;  1DE3 A;  3AHS A;  1BRJ A;  1RGE A;  1I2E A;  2KF5 A;  1I3F A;  1BSE A;  1X1X A;  1BGS A;  5HOH A;  1T2H A;  1FYS A;  1PYL A;  3RNT A;  1Q9E A;  1GMQ A;  1I2F A;  3BIR A;  1X1U A;  3BU4 A;  1BNE A;  1RN1 A;  1BSC A;  1CH0 A;  4HAA A;  1UCJ A;  1RGG A;  1ZGX A;  1GSP A;  3KCH A;  7RNT A;  6RNT A;  1UCL A;  1RGC A;  3AHW A;  1RGA A;  2RBI A;  1LOV A;  1I3I A;  1RSN A;  1RNB A;  1LOY A;  4BU4 A;  2KF6 A;  1B20 A;  1GOU A;  5RNT A;  4BIR A;  1RTU A;  8RNT A;  1MGR A;  6GSP A;  1BNR A;  2RNT A;  1RGL A;  1BRS A;  1RGH A;  1GMR A;  4HOH A;  1G02 A;  3Q3F A;  1RGF A;  1RNT A;  1B2U A;  3D5I A;  1YGW A;  1BU4 A;  1GMP A;  2F5W A;  3DGY A;  1YNV X;  2KF3 A;  1X1W A;  1AY7 A;  1LOW A;  1YVS A;  1BRG A;  1HZ1 A;  2F5M A;  3WHO A;  1DET A;  1B2M A;  1LRA A;  1B21 A;  1RGK A;  2SAR A;  2BIR A;  1BRI A;  1HYF A;  3AGN A;  1T2I A;  4J5K A;  1BNS A;  1IYY A;  9RNT A;  2C4B A;  1X1Y A;  1I8V A;  2GSP A;  1RLS A;  1UCK A;  2KAA A;  1B27 A;  1I0V A;  1BAO A;  2AAE A;  3URP A;  3D5G A;  3A5E A;  1I70 A;  1GOV A;  3AGO A;  1B2S A;  1JBR A;  1B2Z A;  1BAN A;  1R4Y A;  1RCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...