1VQO3

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vqo300
3CD63 3CCQ3 1Q814 3CCM3 3CCV3 1VQ83 1NJI4 1K9M4 1VQN3 1VQ73 1VQP3 3CC43 3I553 1S723 3G713 3CCJ3 1VQO3 3CC73 1YJ93 1KC84 1K8A4 1VQ43 3CME3 3CCE3 1VQL3 1N8R4 1W2B2 1Q7Y4 3OW22 3G6E3 1K734 1QVF2 3CXC2 2OTL3 1Q864 3I563 3CCR3 3CCU3 1YIJ3 2QA43 1YJW3 1VQ53 3CCL3 1YI23 2QEX3 1VQ63 1YHQ3 1M1K4 1KQS2 3CC23 1JJ22 3CCS3 1M904 3CPW2 3G4S3 2OTJ3 1YJN3 1VQ93 3CMA3 1YIT3 1Q824 1KD14 1VQK3 1QVG2 1VQM3
chains in the Genus database with same CATH superfamily
3MG2A 4MMXB 4XDVA 3ZG5A 1NJI4 1VQN3 2YFIB 2XF3A 1ZO2A 1B2MA 1BSEA 1C54A 4HVNA 1BNGA 5TGNA 3S28A 3ZG0A 3H51A 3JUOA 3HIGA 1W7CA 1HZ1A 5G2GA 1AV4A 3F14A 1VQL3 3X42A 5I97A 1IVWA 1S5AA 3FZWA 3BB9A 3D5IA 2GEXA 3MG3A 3N9HA 5A0OB 1FUWA 3OV4A 4OK0A 3HOHA 5FGOA 1RGFA 2GBWB 1QVF2 1FZUA 1PYLA 2IUKA 3EQQB 1ISKA 2CIUA 1M1K4 3MHEA 1A2PA 4WHAA 3S29A 1RGAA 3Q3FA 3BNCA 5ELJA 2CH9A 1OF5B 1RRLA 2HMKB 1B2ZA 1IT7A 3CD63 4LMIA 2HMMB 1V57A 5CF2A 1ROVA 9RNTA 1T5YA 2W04A 1HKXA 3FF2A 1K28A 2JDIH 2RCDA 3CCJ3 1MOLA 3EX9A 1FUSA 5IEPA 1RDSA 4K90B 3D3LA 4EC6A 3GSPA 5AYSC 4EV2A 1O7GB 1T3BA 2CWTA 3GZBA 3L0RA 2I9WA 4LGQA 3WA3A 1RRHA 1Q864 1BNFA 1BRIA 1NO3A 5IEOA 3KSPA 1V74A 4IPBA 1TJDA 1RGEA 1SJWA 1RN4A 4FMBA 1GOYA 1RSNA 3WOEB 1IU7A 1FGRA 1PY3A 2CW9A 2CHCA 1EG9B 2P05A 3T0UA 1BNJA 1OHPA 4FMDA 4CPKA 3N54B 1QAKA 2F5MA 1JN5B 1VQP3 5M1AA 5AYRB 1LOYA 1VQO3 2FNQA 1JBRA 3LTBA 1NB3I 2E2VA 4R80A 3CCE3 1N8R4 2L1SA 2XGLA 1AQZA 1GY7A 2CWVA 2LQVA 2B1XB 1HYFA 1B20A 3M8CA 3S27A 3DUKA 3KCHA 1TP6A 4HAAA 2BMOB 2CG1A 1IDPA 3RGRA 3QRDA 1G02A 2K0MA 1I0VA 2XR8B 3LZAA 4N6UA 2ZDJA 3F40A 1DMQA 1B27A 3GZXB 1DMNA 3DXOA 2YFLB 1JJ22 1US1A 1TRQA 2J8XB 1ZX2A 3ECFA 2RFRA 1W2ZA 3PXMA 3VF1A 2W56B 5IG3A 3WOFB 7STDA 3PZWA 1VQM3 1Q814 2B24B 2STDA 1O7NB 3IJEB 3NBBA 4EW5A 3CCM3 3U97A 4O3VA 4HM0B 3SOAA 1G96A 2Y73A 3HX8A 1LNHA 5AIHA 1KC84 3CC73 1T2HA 1FGTA 1FA3A 4QWTA 1VQQA 2O3OA 3E99A 4MMZB 3G0KA 3HI7A 3F9SA 4FMCA 5EVHA 3S67A 1W00A 1JZDA 3I563 1SARA 2A15A 1STFI 1B2XA 3MWZA 4K61A 4HM3B 1MNLA 1KQS2 4XM4A 4LZIA 3NM2A 1RJOA 4O2HA 3EB8A 3G4S3 4RBNA 1UGHI 5D81A 4BIRA 2KF3A 2P09A 3CPOA 1ULJB 1CEWI 1NDOB 2L4VA 2RSXA 4TX4A 5IERA 3FCSB 1LQMB 4L7KA 1M1XB 4X2OA 1E3RA 1WMOA 3WR2A 1OGZA 3KZTA 2SARA 4NHFA 1LOVA 1A2KA 2F86B 3PS8A 1JBSA 1TRPA 5RNTA 1GMRA 3Q90A 1W2B2 1O7PB 1JV2B 4HM1B 1SPUA 5JPPA 1WMNA 3KE7A 5DRVA 1BUQA 3HK4A 3IPTA 5GSPA 4HYZA 2WGQA 1YI23 4IIAA 3O8YA 1BOXA 2SBLA 2XSHB 4KVHA 1DE3A 1JKGA 2ZHXB 1FYSA 2W9PA 3CCS3 1EA2A 3DGOA 1A90A 1RN1A 3CU3A 4L8OA 1VQ93 1A2VA 1BSCA 1X1UA 3A5EA 1PU4A 1SQWA 2WOHA 1CH0A 1UI7A 1TFKA 1N5HA 1Q40A 2CK3H 1BANA 4LEHA 2XFSA 1F8NA 3WA2X 1X1WA 1W4NA 3SYUA 2K3DA 3FG4A 3LT8A 3CME3 3MYTA 1BAOA 3V98A 3NV0A 1NB5I 2GSPA 2WOFA 4FMAA 2P38A 6STDA 3CCR3 1RHLA 2GXFA 2W0QA 3MKIA 1VQ53 2Y74A 5KP4A 3T8NA 2XEPA 4WP5A 3GRDA 4KFDA 3RGAA 1J2BA 1G0TA 2MF7A 4XDWA 3I0YA 5EEOA 1YIT3 1BRNL 3EN8A 3DGMA 1YVBI 1ZS7A 4K1VA 5BIRA 2E2TA 1SIIA 3RDEA 3CCQ3 2V1LA 2UUGC 2UX0A 3SVAA 1IT8A 3SX1A 2IMJA 1EEJA 2CFGA 4N3VA 2W9QA 3EBYA 1W6YA 2WO0A 3SXXA 4RNTA 3X3ZA 1K8A4 1C7HA 3FGYA 3SOYA 5M19A 1X1YA 1GY5A 1UCKA 4J9AA 4LYLB 1Q7Y4 3OW22 1QAFA 1GMPA 3VGNA 3BNDA 3B4OA 1BSDA 1AVKA 3LXUX 2IA7A 1GOUA 2YFJB 1BNEA 1D6ZA 4GL6A 2OOVA 1R4CA 2Q07A 3JUNA 1VQ63 4HM6B 1LQGC 2YX9A 1GYBA 3DGNA 3DMCA 5LC7A 3NBRA 3CNXA 4J5KA 1TU5A 2W6JH 3CCV3 1OUNA 2C4BA 3UL6A 4ILFA 4WFOA 1UCLA 1VQ73 2QIYA 2M7OA 3B4PA 2BNGA 1B2SA 3GWRA 3GAXA 3NUVA 1RNTA 1RKYA 3KN4A 2CFWA 2O9UX 1KSIA 2BMRB 3NBJA 1ROAA 5CXOA 1JBTA 1IV9A 1I3IA 4I5QA 5AEWB 3NXJA 2MC8A 2FXTA 1MWTA 2ZA4A 3T8UA 1DVCA 4WYKA 1LRAA 5JPUA 2QEX3 1B3SA 1EQKA 3KFQC 3NX0A 1Q7HA 5AI1A 1VZZA 3JUQA 4HZBB 2XFTA 1M904 1UUGB 4XBXA 4MEIA 1B21A 2CWUA 2LYXA 1I2FA 2Z77A 1V58A 6GSPA 4EV5A 5HOHA 1NU3A 2KAAA 2PNCA 3X3XA 1FW7A 4FCZA 1LNIA 4GHOA 3RNTA 3AMOA 4U13A 1UCJA 1BSBA 1U5OA 1D6UA 1JZOA 2XRXB 3F8HA 1YJ93 3KSED 2F5WA 3NQYA 4HKVB 4N6V0 1BGSA 3JUMA 3TDGA 4FR9A 3S5CA 1QMAA 1I3FA 3D4AA 2D1WA 3IMAB 3JVCA 3D5GA 2AADA 1UGIA 2BHMA 2WGOA 3LYGA 1IK3A 3UL5A 1YJW3 1AR0A 2UGIA 1JB5A 4N6OB 5BVBA 4STDA 5EQLA 3F7XA 1O7WB 4N6NB 2BT3A 4OUQA 4AKYA 5M18A 3CC23 2CFDA 1WNHA 2OTJ3 1RGLA 3KKGA 1KD14 1ULIB 4R9KA 3V92A 4G1MB 3DZLA 1RTUA 4HBRA 3EHCA 3G16A 3CC43 5G1KA 1I2GA 5G1LA 3LMLA 3B8LA 4H61A 3ER7A 1AY7A 4N6TA 2ML6A 1IQYA 3NM7A 4X2HA 2JQ5A 2QGUA 3N8BA 1ASKA 3OWSA 3LH4A 1VQ43 5D83A 3X3YA 3FG3A 4O8SA 3URPA 1N9EA 4RNYA 3CNMA 3G6E3 3WHOA 2AAEA 1IQ8A 3NQZA 3LT9A 4KFEA 1X1XA 2XGNA 2GEYA 2OQEA 3BNBA 3H3HA 5IENA 4H3UA 2BIRA 2CC3A 4BTYA 1WMPA 1RGHA 2INXA 2Z6BA 5HGRA 5CK6A 3G8ZA 1YGEA 2GU3A 1O7MB 4HM4B 2GBXB 4AKZA 1M9GA 4JF8A 3CMA3 2P0MA 4BL2A 1VQK3 3AHSA 1DYUA 4KFFA 1MGWA 1MWUA 3GZYB 4EBGA 1RNBA 1K9M4 2CX0A 2Z7AA 1OACA 1W6CA 1YGWA 3DGLA 3DH2A 1I0XA 1R4YA 3WMDA 5IG4A 1CYVA 3G713 2F99A 1BVIA 3DGYA 4R4KA 7RNTA 3AGOA 3FF0A 2KF6A 3FKAA 5IW9A 3VSYA 1JB4A 1AVLA 3U1WA 3BU4A 1T2IA 1BRJA 1Q42A 4HM2B 1GSPA 1LXEA 3UJMA 3CCL3 1JKGB 5AIGA 4CDLA 2W03A 1GD4A 3OX9A 1DETA 4R9LA 4RZMA 4EYCA 3OWUA 1RLSA 1UUVB 4JRFA 1JB2A 1WTHA 1GMQA 1BRGA 1E97A 1RN7A 2C11A 1Q40B 1OF5A 2HMJB 3DY5A 4HZ9B 4BU4A 2CKFB 1FGOA 1KWIA 4BTXA 4ZM8A 1N5PA 1DMMA 1IV7A 3I553 1RGKA 1QJGA 2PZVA 2E2UA 3NV0B 3EF8A 5BU4A 2KF5A 1W01A 4R1KA 2FGTA 3B7CA 2BMQB 3OWYA 1YIJ3 3MPHA 2QA43 5BXQA 5AEUB 5AIFA 3LTAA 4RNZA 3EC9A 3UB1A 1MWRA 3Q1CA 3LTDA 4HM8B 1PFPA 1IVUA 3EE1A 5ELUA 3V99A 1Q824 3FH1A 1WQLB 1TIJA 1BSAA 1STDA 1QALA 1DVDA 4NPBA 4L8PA 3UNLA 1FGMA 4AEQA 1BRKA 1RGCA 1I2EA 4HJLB 1LOWA 1RCLA 1YNVX 1OPYA 1I70A 1GS3A 3BIRA 4PEJA 5D82A 2C10A 1JN5A 3X41A 2H0HA 5FW5A 2KF4A 5LC6A 2XH9A 1UW1A 2BU4A 5JBSA 2Z76A 1YVSA 3QK9A 1FGQA 1MWSA 3CXC2 1Q9EA 6RNTA 4MJDA 2OCTA 2HOHA 3ALAA 3PCRA 1BUJA 2RGQA 2P0XA 3FSDA 1OGXA 1YHQ3 1SIHA 1LOXA 2OOVC 1I8VA 4J5GA 4XB5A 1IVXA 2F56A 2H0GA 1IYYA 2K54A 3ZFZA 2KCDA 1JNQA 2CFLA 1UUWB 3D9RA 3MG1A 1IQXA 4N6MA 1E3VA 2W56A 4CCVA 4DKIA 1VQ83 1A67A 1N9JA 5IG5A 1CYUA 1IVVA 1HU9A 1D6YA 1RGGA 1N8QA 1OHOA 1BNRA 4GB5A 1EKMA 4J8TA 2H0IA 2ZL8A 3AHWA 2KXGA 1W5ZA 3JUPA 4FCJA 4CJNA 4K1UA 3ROBA 4IT7A 4HM5B 3EN1B 8CHOA 5STDA 3MSOA 4WYKB 5DREA 2RNTA 1TFOA 2XSOB 2RBIA 2IUJA 5KP1A 1BNSA 4NREA 4BTWA 1BU4A 1JRQA 7GSPA 3X40A 1UI8A 3STDA 1RCKA 1BRSA 1Y4KA 4MMYB 2BO9B 1YJN3 2GU1A 3F8XA 4EXRA 1W02A 1L5GB 4KT3B 3PGBA 2F98A 3AMOB 1FUTA 3FG1A 4XBYA 3NHXA 1OH0A 2R41A 4HOHA 3WDGB 3GZRA 1K41A 3FLJA 1Z1SA 4Q53A 1LVNA 2OWPA 1BRHA 1UDII 1BNIA 3K0ZA 4FCMA 4ORLA 5IG0A 1MGRA 1K734 2KRTA 3K5TA 3J7Yd 2OTL3 3CCU3 1OCVA 2CG0A 1RMSA 2IY2A 3EBTA 3BLZA 1NWWA 3KIIA 3A76A 3OXAA 3PYJA 1GY6A 2IYJA 4O02B 4LSOA 3HIIA 3CPW2 1GD3A 2CFKA 2F4YA 2HMLB 5IF6A 1QVG2 2W2CA 2HMNB 1BIRA 3LOYA 2CX1A 8RNTA 5CLKA 3BNEA 1UCIA 1S723 4KZ1A 3DM8A 4WWUC 2ML5A 2R4IA 3K7CA 1B2UA 3EJVA 3K63A 3WODG 5CF1A 1CQSA 4HM7B 3SLUA 4BL3A 1GOVA 4OVMA 3K9MC 4I4KA 4N6LA 4XBTA 1ZGXA 1TTOA 1W6GA 1U8CB 3F7SA 2OQEC 3D79A 3PCSA 4GSPA 3HZPA 3LTCA 2HMOB 1OHSA 3SEDA 1NNVA 5AIIA 1O7HB 3Q2PA 1TUHA 5KP3A 3AGNA 2D42A 1EUIC
chains in the Genus database with same CATH topology
3MG2A 4MMXB 4XDVA 1NJI4 1VQN3 2YFIB 2XF3A 1ZO2A 4HVNA 5TGNA 3S28A 3H51A 3JUOA 3HIGA 1W7CA 5G2GA 1AV4A 3F14A 1VQL3 3X42A 5I97A 1IVWA 1S5AA 3FZWA 3BB9A 3MG3A 2GEXA 3N9HA 5A0OB 1FUWA 3OV4A 4OK0A 5FGOA 2GBWB 1QVF2 2IUKA 3EQQB 1ISKA 2CIUA 1M1K4 3MHEA 4WHAA 3S29A 3BNCA 5ELJA 2CH9A 1OF5B 1RRLA 2HMKB 1IT7A 3CD63 4LMIA 2HMMB 5CF2A 1ROVA 2W04A 1T5YA 1HKXA 3FF2A 1K28A 2JDIH 2RCDA 3CCJ3 1MOLA 3EX9A 5IEPA 4K90B 3D3LA 4EC6A 5AYSC 4EV2A 1O7GB 2CWTA 3GZBA 3L0RA 4LGQA 2I9WA 3WA3A 1Q864 1RRHA 1NO3A 5IEOA 3KSPA 1V74A 4IPBA 1SJWA 4FMBA 3WOEB 1IU7A 1FGRA 2CW9A 2CHCA 1EG9B 2P05A 3T0UA 1OHPA 4FMDA 3N54B 1QAKA 1JN5B 1VQP3 5AYRB 1VQO3 2FNQA 3LTBA 1NB3I 2E2VA 4R80A 3CCE3 1N8R4 2XGLA 1GY7A 2CWVA 2LQVA 2B1XB 3M8CA 3S27A 3DUKA 1TP6A 2BMOB 2CG1A 1IDPA 3RGRA 3QRDA 2K0MA 2XR8B 3LZAA 4N6UA 2ZDJA 3F40A 1DMQA 3GZXB 1DMNA 3DXOA 2YFLB 1JJ22 1US1A 3ECFA 1ZX2A 2RFRA 1W2ZA 3PXMA 3VF1A 2W56B 5IG3A 3WOFB 7STDA 3PZWA 1VQM3 1Q814 2STDA 2B24B 1O7NB 3IJEB 3NBBA 3CCM3 3U97A 4O3VA 4HM0B 3SOAA 1G96A 2Y73A 3HX8A 1LNHA 5AIHA 1KC84 3CC73 1FGTA 1FA3A 4QWTA 2O3OA 3E99A 4MMZB 3G0KA 3HI7A 3F9SA 4FMCA 5EVHA 3S67A 1W00A 3I563 2A15A 1STFI 3MWZA 4K61A 4HM3B 1MNLA 1KQS2 4XM4A 4LZIA 3NM2A 1RJOA 4O2HA 3EB8A 3G4S3 4RBNA 5D81A 2P09A 3CPOA 1ULJB 1CEWI 2RSXA 2L4VA 1NDOB 4TX4A 5IERA 3FCSB 4L7KA 1M1XB 4X2OA 1E3RA 1WMOA 1OGZA 3KZTA 4NHFA 1A2KA 2F86B 3PS8A 3Q90A 1W2B2 1O7PB 1JV2B 4HM1B 1SPUA 5JPPA 1WMNA 3KE7A 5DRVA 1BUQA 3HK4A 3IPTA 4HYZA 2WGQA 1YI23 4IIAA 3O8YA 2SBLA 2XSHB 4KVHA 1JKGA 2W9PA 3CCS3 1EA2A 3DGOA 1A90A 3CU3A 4L8OA 1VQ93 1A2VA 1PU4A 1SQWA 2WOHA 1UI7A 1TFKA 1N5HA 1Q40A 2CK3H 4LEHA 2XFSA 1F8NA 3WA2X 1W4NA 3FG4A 3LT8A 3CME3 3MYTA 3V98A 3NV0A 1NB5I 2WOFA 4FMAA 2P38A 6STDA 3CCR3 2GXFA 2W0QA 3MKIA 1VQ53 2Y74A 5KP4A 3T8NA 2XEPA 4WP5A 3GRDA 4KFDA 3RGAA 1J2BA 2MF7A 4XDWA 3I0YA 5EEOA 1YIT3 3EN8A 3DGMA 1YVBI 4K1VA 3CCQ3 2E2TA 1SIIA 3RDEA 2V1LA 2UX0A 3SVAA 3SX1A 1IT8A 2IMJA 2CFGA 4N3VA 2W9QA 3EBYA 1W6YA 2WO0A 3SXXA 3X3ZA 1K8A4 1C7HA 3FGYA 3SOYA 1GY5A 4J9AA 1Q7Y4 1QAFA 3VGNA 3BNDA 3B4OA 1AVKA 3LXUX 2IA7A 2YFJB 1VQ63 1D6ZA 4GL6A 2OOVA 1R4CA 2Q07A 3JUNA 4HM6B 2YX9A 1GYBA 3DGNA 3DMCA 5LC7A 3NBRA 3CNXA 1TU5A 2W6JH 3CCV3 1OUNA 3UL6A 4WFOA 1VQ73 2QIYA 2M7OA 3B4PA 2BNGA 3GWRA 3GAXA 3NUVA 1RKYA 3KN4A 2CFWA 2O9UX 1KSIA 2BMRB 3NBJA 1ROAA 5CXOA 1IV9A 5AEWB 3NXJA 2MC8A 2FXTA 3T8UA 1DVCA 4WYKA 5JPUA 2QEX3 1EQKA 3KFQC 3NX0A 5AI1A 1VZZA 3JUQA 4HZBB 2XFTA 1M904 4XBXA 4MEIA 2CWUA 2LYXA 2Z77A 4EV5A 1NU3A 2PNCA 3X3XA 4FCZA 3AMOA 4U13A 1U5OA 1D6UA 2XRXB 3F8HA 1YJ93 3KSED 3NQYA 4HKVB 4N6V0 3JUMA 3TDGA 4FR9A 3S5CA 1QMAA 4XBTA 3IMAB 2D1WA 3JVCA 3OW22 1IK3A 2BHMA 2WGOA 3LYGA 3UL5A 1YJW3 1AR0A 1JB5A 4N6OB 5BVBA 4STDA 5EQLA 3F7XA 1O7WB 4N6NB 2BT3A 4OUQA 3CC23 2CFDA 1WNHA 2OTJ3 3KKGA 1KD14 1ULIB 4R9KA 3V92A 4G1MB 3DZLA 4HBRA 3EHCA 3G16A 3CC43 4AKYA 3LMLA 3B8LA 4H61A 3ER7A 4N6TA 4X2HA 2ML6A 1IQYA 3NM7A 1VQ43 2JQ5A 2QGUA 3N8BA 1ASKA 3OWSA 3LH4A 5D83A 3X3YA 3FG3A 4O8SA 1N9EA 4RNYA 3CNMA 3G6E3 1IQ8A 3NQZA 3LT9A 4KFEA 2XGNA 2GEYA 2OQEA 3BNBA 3H3HA 5IENA 4H3UA 2CC3A 4BTYA 1WMPA 2INXA 2Z6BA 5HGRA 5CK6A 3G8ZA 1YGEA 2GU3A 1O7MB 4HM4B 2GBXB 4AKZA 1M9GA 4JF8A 3CMA3 2P0MA 1VQK3 1DYUA 4KFFA 3GZYB 4EBGA 1K9M4 2Z7AA 1OACA 1W6CA 3DGLA 3WMDA 3G713 5IG4A 1CYVA 2F99A 4R4KA 3FF0A 3FKAA 5IW9A 3VSYA 1JB4A 1AVLA 3U1WA 4HM2B 1Q42A 1LXEA 3UJMA 3CCL3 1JKGB 5AIGA 4CDLA 2W03A 1GD4A 3OX9A 4R9LA 4RZMA 4EYCA 3OWUA 1UUVB 4JRFA 1JB2A 1WTHA 1E97A 1RN7A 5IF6A 2C11A 1Q40B 1OF5A 2HMJB 3DY5A 4HZ9B 2CKFB 1FGOA 1KWIA 4BTXA 4ZM8A 1N5PA 1DMMA 1IV7A 3I553 1QJGA 2PZVA 2E2UA 3NV0B 3EF8A 1W01A 4R1KA 2FGTA 3B7CA 2BMQB 3OWYA 1YIJ3 3MPHA 2QA43 5BXQA 5AEUB 5AIFA 3LTAA 4RNZA 3EC9A 3UB1A 3Q1CA 3LTDA 4HM8B 1PFPA 1IVUA 3EE1A 5ELUA 3V99A 1Q824 3FH1A 1WQLB 1TIJA 1STDA 1QALA 1DVDA 4L8PA 3UNLA 1FGMA 4AEQA 4HJLB 5D82A 1OPYA 1GS3A 4PEJA 2C10A 1JN5A 3X41A 5FW5A 5LC6A 2XH9A 1UW1A 5JBSA 2Z76A 3QK9A 1FGQA 3CXC2 4MJDA 2OCTA 3ALAA 3PCRA 2RGQA 2P0XA 3FSDA 1OGXA 1YHQ3 1SIHA 1LOXA 2OOVC 4XB5A 1IVXA 2K54A 2KCDA 1JNQA 2CFLA 1UUWB 3D9RA 3MG1A 1IQXA 4N6MA 1E3VA 2W56A 4CCVA 1VQ83 1A67A 1N9JA 5IG5A 1CYUA 1IVVA 1HU9A 1D6YA 1N8QA 1OHOA 4GB5A 1EKMA 4J8TA 2ZL8A 4FCJA 2KXGA 1W5ZA 3JUPA 4K1UA 3ROBA 4IT7A 4HM5B 3EN1B 8CHOA 5STDA 3MSOA 4WYKB 5DREA 1TFOA 2XSOB 2IUJA 5KP1A 4NREA 4BTWA 1JRQA 3X40A 1UI8A 3STDA 1Y4KA 4MMYB 2BO9B 1YJN3 2GU1A 3F8XA 4EXRA 1W02A 1L5GB 3PGBA 2F98A 3AMOB 3FG1A 4XBYA 3NHXA 1OH0A 3WDGB 3GZRA 1K41A 3FLJA 1Z1SA 4Q53A 1LVNA 2OWPA 4FCMA 4ORLA 3K0ZA 5IG0A 1K734 2KRTA 3K5TA 3J7Yd 2OTL3 3CCU3 1OCVA 2CG0A 3EBTA 3BLZA 1NWWA 3KIIA 3A76A 3OXAA 3PYJA 1GY6A 4O02B 4LSOA 3HIIA 3CPW2 1GD3A 2CFKA 2HMLB 1QVG2 2W2CA 2HMNB 3LOYA 5CLKA 3BNEA 1S723 4KZ1A 3DM8A 4WWUC 2ML5A 2R4IA 3K7CA 3EJVA 3K63A 3WODG 5CF1A 1CQSA 4HM7B 3SLUA 4OVMA 3K9MC 4I4KA 4N6LA 1W6GA 1U8CB 3F7SA 2OQEC 3PCSA 3HZPA 3LTCA 2HMOB 1OHSA 3SEDA 5AIIA 1O7HB 3Q2PA 1TUHA 5KP3A 2D42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 3;  3CCQ 3;  1Q81 4;  3CCM 3;  3CCV 3;  1VQ8 3;  1NJI 4;  1K9M 4;  1VQN 3;  1VQ7 3;  1VQP 3;  3CC4 3;  3I55 3;  1S72 3;  3G71 3;  3CCJ 3;  1VQO 3;  3CC7 3;  1YJ9 3;  1KC8 4;  1K8A 4;  1VQ4 3;  3CME 3;  3CCE 3;  1VQL 3;  1N8R 4;  1W2B 2;  1Q7Y 4;  3OW2 2;  3G6E 3;  1K73 4;  1QVF 2;  3CXC 2;  2OTL 3;  1Q86 4;  3I56 3;  3CCR 3;  3CCU 3;  1YIJ 3;  2QA4 3;  1YJW 3;  1VQ5 3;  3CCL 3;  1YI2 3;  2QEX 3;  1VQ6 3;  1YHQ 3;  1M1K 4;  1KQS 2;  3CC2 3;  1JJ2 2;  3CCS 3;  1M90 4;  3CPW 2;  3G4S 3;  2OTJ 3;  1YJN 3;  1VQ9 3;  3CMA 3;  1YIT 3;  1Q82 4;  1KD1 4;  1VQK 3;  1QVG 2;  1VQM 3; 
#chains in the Genus database with same CATH topology
 3MG2 A;  4MMX B;  4XDV A;  3ZG5 A;  1NJI 4;  1VQN 3;  2YFI B;  2XF3 A;  1ZO2 A;  1B2M A;  1BSE A;  1C54 A;  4HVN A;  1BNG A;  5TGN A;  3S28 A;  3ZG0 A;  3H51 A;  3JUO A;  3HIG A;  1W7C A;  1HZ1 A;  5G2G A;  1AV4 A;  3F14 A;  1VQL 3;  3X42 A;  5I97 A;  1IVW A;  1S5A A;  3FZW A;  3BB9 A;  3D5I A;  2GEX A;  3MG3 A;  3N9H A;  5A0O B;  1FUW A;  3OV4 A;  4OK0 A;  3HOH A;  5FGO A;  1RGF A;  2GBW B;  1QVF 2;  1FZU A;  1PYL A;  2IUK A;  3EQQ B;  1ISK A;  2CIU A;  1M1K 4;  3MHE A;  1A2P A;  4WHA A;  3S29 A;  1RGA A;  3Q3F A;  3BNC A;  5ELJ A;  2CH9 A;  1OF5 B;  1RRL A;  2HMK B;  1B2Z A;  1IT7 A;  3CD6 3;  4LMI A;  2HMM B;  1V57 A;  5CF2 A;  1ROV A;  9RNT A;  1T5Y A;  2W04 A;  1HKX A;  3FF2 A;  1K28 A;  2JDI H;  2RCD A;  3CCJ 3;  1MOL A;  3EX9 A;  1FUS A;  5IEP A;  1RDS A;  4K90 B;  3D3L A;  4EC6 A;  3GSP A;  5AYS C;  4EV2 A;  1O7G B;  1T3B A;  2CWT A;  3GZB A;  3L0R A;  2I9W A;  4LGQ A;  3WA3 A;  1RRH A;  1Q86 4;  1BNF A;  1BRI A;  1NO3 A;  5IEO A;  3KSP A;  1V74 A;  4IPB A;  1TJD A;  1RGE A;  1SJW A;  1RN4 A;  4FMB A;  1GOY A;  1RSN A;  3WOE B;  1IU7 A;  1FGR A;  1PY3 A;  2CW9 A;  2CHC A;  1EG9 B;  2P05 A;  3T0U A;  1BNJ A;  1OHP A;  4FMD A;  4CPK A;  3N54 B;  1QAK A;  2F5M A;  1JN5 B;  1VQP 3;  5M1A A;  5AYR B;  1LOY A;  1VQO 3;  2FNQ A;  1JBR A;  3LTB A;  1NB3 I;  2E2V A;  4R80 A;  3CCE 3;  1N8R 4;  2L1S A;  2XGL A;  1AQZ A;  1GY7 A;  2CWV A;  2LQV A;  2B1X B;  1HYF A;  1B20 A;  3M8C A;  3S27 A;  3DUK A;  3KCH A;  1TP6 A;  4HAA A;  2BMO B;  2CG1 A;  1IDP A;  3RGR A;  3QRD A;  1G02 A;  2K0M A;  1I0V A;  2XR8 B;  3LZA A;  4N6U A;  2ZDJ A;  3F40 A;  1DMQ A;  1B27 A;  3GZX B;  1DMN A;  3DXO A;  2YFL B;  1JJ2 2;  1US1 A;  1TRQ A;  2J8X B;  1ZX2 A;  3ECF A;  2RFR A;  1W2Z A;  3PXM A;  3VF1 A;  2W56 B;  5IG3 A;  3WOF B;  7STD A;  3PZW A;  1VQM 3;  1Q81 4;  2B24 B;  2STD A;  1O7N B;  3IJE B;  3NBB A;  4EW5 A;  3CCM 3;  3U97 A;  4O3V A;  4HM0 B;  3SOA A;  1G96 A;  2Y73 A;  3HX8 A;  1LNH A;  5AIH A;  1KC8 4;  3CC7 3;  1T2H A;  1FGT A;  1FA3 A;  4QWT A;  1VQQ A;  2O3O A;  3E99 A;  4MMZ B;  3G0K A;  3HI7 A;  3F9S A;  4FMC A;  5EVH A;  3S67 A;  1W00 A;  1JZD A;  3I56 3;  1SAR A;  2A15 A;  1STF I;  1B2X A;  3MWZ A;  4K61 A;  4HM3 B;  1MNL A;  1KQS 2;  4XM4 A;  4LZI A;  3NM2 A;  1RJO A;  4O2H A;  3EB8 A;  3G4S 3;  4RBN A;  1UGH I;  5D81 A;  4BIR A;  2KF3 A;  2P09 A;  3CPO A;  1ULJ B;  1CEW I;  1NDO B;  2L4V A;  2RSX A;  4TX4 A;  5IER A;  3FCS B;  1LQM B;  4L7K A;  1M1X B;  4X2O A;  1E3R A;  1WMO A;  3WR2 A;  1OGZ A;  3KZT A;  2SAR A;  4NHF A;  1LOV A;  1A2K A;  2F86 B;  3PS8 A;  1JBS A;  1TRP A;  5RNT A;  1GMR A;  3Q90 A;  1W2B 2;  1O7P B;  1JV2 B;  4HM1 B;  1SPU A;  5JPP A;  1WMN A;  3KE7 A;  5DRV A;  1BUQ A;  3HK4 A;  3IPT A;  5GSP A;  4HYZ A;  2WGQ A;  1YI2 3;  4IIA A;  3O8Y A;  1BOX A;  2SBL A;  2XSH B;  4KVH A;  1DE3 A;  1JKG A;  2ZHX B;  1FYS A;  2W9P A;  3CCS 3;  1EA2 A;  3DGO A;  1A90 A;  1RN1 A;  3CU3 A;  4L8O A;  1VQ9 3;  1A2V A;  1BSC A;  1X1U A;  3A5E A;  1PU4 A;  1SQW A;  2WOH A;  1CH0 A;  1UI7 A;  1TFK A;  1N5H A;  1Q40 A;  2CK3 H;  1BAN A;  4LEH A;  2XFS A;  1F8N A;  3WA2 X;  1X1W A;  1W4N A;  3SYU A;  2K3D A;  3FG4 A;  3LT8 A;  3CME 3;  3MYT A;  1BAO A;  3V98 A;  3NV0 A;  1NB5 I;  2GSP A;  2WOF A;  4FMA A;  2P38 A;  6STD A;  3CCR 3;  1RHL A;  2GXF A;  2W0Q A;  3MKI A;  1VQ5 3;  2Y74 A;  5KP4 A;  3T8N A;  2XEP A;  4WP5 A;  3GRD A;  4KFD A;  3RGA A;  1J2B A;  1G0T A;  2MF7 A;  4XDW A;  3I0Y A;  5EEO A;  1YIT 3;  1BRN L;  3EN8 A;  3DGM A;  1YVB I;  1ZS7 A;  4K1V A;  5BIR A;  2E2T A;  1SII A;  3RDE A;  3CCQ 3;  2V1L A;  2UUG C;  2UX0 A;  3SVA A;  1IT8 A;  3SX1 A;  2IMJ A;  1EEJ A;  2CFG A;  4N3V A;  2W9Q A;  3EBY A;  1W6Y A;  2WO0 A;  3SXX A;  4RNT A;  3X3Z A;  1K8A 4;  1C7H A;  3FGY A;  3SOY A;  5M19 A;  1X1Y A;  1GY5 A;  1UCK A;  4J9A A;  4LYL B;  1Q7Y 4;  3OW2 2;  1QAF A;  1GMP A;  3VGN A;  3BND A;  3B4O A;  1BSD A;  1AVK A;  3LXU X;  2IA7 A;  1GOU A;  2YFJ B;  1BNE A;  1D6Z A;  4GL6 A;  2OOV A;  1R4C A;  2Q07 A;  3JUN A;  1VQ6 3;  4HM6 B;  1LQG C;  2YX9 A;  1GYB A;  3DGN A;  3DMC A;  5LC7 A;  3NBR A;  3CNX A;  4J5K A;  1TU5 A;  2W6J H;  3CCV 3;  1OUN A;  2C4B A;  3UL6 A;  4ILF A;  4WFO A;  1UCL A;  1VQ7 3;  2QIY A;  2M7O A;  3B4P A;  2BNG A;  1B2S A;  3GWR A;  3GAX A;  3NUV A;  1RNT A;  1RKY A;  3KN4 A;  2CFW A;  2O9U X;  1KSI A;  2BMR B;  3NBJ A;  1ROA A;  5CXO A;  1JBT A;  1IV9 A;  1I3I A;  4I5Q A;  5AEW B;  3NXJ A;  2MC8 A;  2FXT A;  1MWT A;  2ZA4 A;  3T8U A;  1DVC A;  4WYK A;  1LRA A;  5JPU A;  2QEX 3;  1B3S A;  1EQK A;  3KFQ C;  3NX0 A;  1Q7H A;  5AI1 A;  1VZZ A;  3JUQ A;  4HZB B;  2XFT A;  1M90 4;  1UUG B;  4XBX A;  4MEI A;  1B21 A;  2CWU A;  2LYX A;  1I2F A;  2Z77 A;  1V58 A;  6GSP A;  4EV5 A;  5HOH A;  1NU3 A;  2KAA A;  2PNC A;  3X3X A;  1FW7 A;  4FCZ A;  1LNI A;  4GHO A;  3RNT A;  3AMO A;  4U13 A;  1UCJ A;  1BSB A;  1U5O A;  1D6U A;  1JZO A;  2XRX B;  3F8H A;  1YJ9 3;  3KSE D;  2F5W A;  3NQY A;  4HKV B;  4N6V 0;  1BGS A;  3JUM A;  3TDG A;  4FR9 A;  3S5C A;  1QMA A;  1I3F A;  3D4A A;  2D1W A;  3IMA B;  3JVC A;  3D5G A;  2AAD A;  1UGI A;  2BHM A;  2WGO A;  3LYG A;  1IK3 A;  3UL5 A;  1YJW 3;  1AR0 A;  2UGI A;  1JB5 A;  4N6O B;  5BVB A;  4STD A;  5EQL A;  3F7X A;  1O7W B;  4N6N B;  2BT3 A;  4OUQ A;  4AKY A;  5M18 A;  3CC2 3;  2CFD A;  1WNH A;  2OTJ 3;  1RGL A;  3KKG A;  1KD1 4;  1ULI B;  4R9K A;  3V92 A;  4G1M B;  3DZL A;  1RTU A;  4HBR A;  3EHC A;  3G16 A;  3CC4 3;  5G1K A;  1I2G A;  5G1L A;  3LML A;  3B8L A;  4H61 A;  3ER7 A;  1AY7 A;  4N6T A;  2ML6 A;  1IQY A;  3NM7 A;  4X2H A;  2JQ5 A;  2QGU A;  3N8B A;  1ASK A;  3OWS A;  3LH4 A;  1VQ4 3;  5D83 A;  3X3Y A;  3FG3 A;  4O8S A;  3URP A;  1N9E A;  4RNY A;  3CNM A;  3G6E 3;  3WHO A;  2AAE A;  1IQ8 A;  3NQZ A;  3LT9 A;  4KFE A;  1X1X A;  2XGN A;  2GEY A;  2OQE A;  3BNB A;  3H3H A;  5IEN A;  4H3U A;  2BIR A;  2CC3 A;  4BTY A;  1WMP A;  1RGH A;  2INX A;  2Z6B A;  5HGR A;  5CK6 A;  3G8Z A;  1YGE A;  2GU3 A;  1O7M B;  4HM4 B;  2GBX B;  4AKZ A;  1M9G A;  4JF8 A;  3CMA 3;  2P0M A;  4BL2 A;  1VQK 3;  3AHS A;  1DYU A;  4KFF A;  1MGW A;  1MWU A;  3GZY B;  4EBG A;  1RNB A;  1K9M 4;  2CX0 A;  2Z7A A;  1OAC A;  1W6C A;  1YGW A;  3DGL A;  3DH2 A;  1I0X A;  1R4Y A;  3WMD A;  5IG4 A;  1CYV A;  3G71 3;  2F99 A;  1BVI A;  3DGY A;  4R4K A;  7RNT A;  3AGO A;  3FF0 A;  2KF6 A;  3FKA A;  5IW9 A;  3VSY A;  1JB4 A;  1AVL A;  3U1W A;  3BU4 A;  1T2I A;  1BRJ A;  1Q42 A;  4HM2 B;  1GSP A;  1LXE A;  3UJM A;  3CCL 3;  1JKG B;  5AIG A;  4CDL A;  2W03 A;  1GD4 A;  3OX9 A;  1DET A;  4R9L A;  4RZM A;  4EYC A;  3OWU A;  1RLS A;  1UUV B;  4JRF A;  1JB2 A;  1WTH A;  1GMQ A;  1BRG A;  1E97 A;  1RN7 A;  2C11 A;  1Q40 B;  1OF5 A;  2HMJ B;  3DY5 A;  4HZ9 B;  4BU4 A;  2CKF B;  1FGO A;  1KWI A;  4BTX A;  4ZM8 A;  1N5P A;  1DMM A;  1IV7 A;  3I55 3;  1RGK A;  1QJG A;  2PZV A;  2E2U A;  3NV0 B;  3EF8 A;  5BU4 A;  2KF5 A;  1W01 A;  4R1K A;  2FGT A;  3B7C A;  2BMQ B;  3OWY A;  1YIJ 3;  3MPH A;  2QA4 3;  5BXQ A;  5AEU B;  5AIF A;  3LTA A;  4RNZ A;  3EC9 A;  3UB1 A;  1MWR A;  3Q1C A;  3LTD A;  4HM8 B;  1PFP A;  1IVU A;  3EE1 A;  5ELU A;  3V99 A;  1Q82 4;  3FH1 A;  1WQL B;  1TIJ A;  1BSA A;  1STD A;  1QAL A;  1DVD A;  4NPB A;  4L8P A;  3UNL A;  1FGM A;  4AEQ A;  1BRK A;  1RGC A;  1I2E A;  4HJL B;  1LOW A;  1RCL A;  1YNV X;  1OPY A;  1I70 A;  1GS3 A;  3BIR A;  4PEJ A;  5D82 A;  2C10 A;  1JN5 A;  3X41 A;  2H0H A;  5FW5 A;  2KF4 A;  5LC6 A;  2XH9 A;  1UW1 A;  2BU4 A;  5JBS A;  2Z76 A;  1YVS A;  3QK9 A;  1FGQ A;  1MWS A;  3CXC 2;  1Q9E A;  6RNT A;  4MJD A;  2OCT A;  2HOH A;  3ALA A;  3PCR A;  1BUJ A;  2RGQ A;  2P0X A;  3FSD A;  1OGX A;  1YHQ 3;  1SIH A;  1LOX A;  2OOV C;  1I8V A;  4J5G A;  4XB5 A;  1IVX A;  2F56 A;  2H0G A;  1IYY A;  2K54 A;  3ZFZ A;  2KCD A;  1JNQ A;  2CFL A;  1UUW B;  3D9R A;  3MG1 A;  1IQX A;  4N6M A;  1E3V A;  2W56 A;  4CCV A;  4DKI A;  1VQ8 3;  1A67 A;  1N9J A;  5IG5 A;  1CYU A;  1IVV A;  1HU9 A;  1D6Y A;  1RGG A;  1N8Q A;  1OHO A;  1BNR A;  4GB5 A;  1EKM A;  4J8T A;  2H0I A;  2ZL8 A;  3AHW A;  2KXG A;  1W5Z A;  3JUP A;  4FCJ A;  4CJN A;  4K1U A;  3ROB A;  4IT7 A;  4HM5 B;  3EN1 B;  8CHO A;  5STD A;  3MSO A;  4WYK B;  5DRE A;  2RNT A;  1TFO A;  2XSO B;  2RBI A;  2IUJ A;  5KP1 A;  1BNS A;  4NRE A;  4BTW A;  1BU4 A;  1JRQ A;  7GSP A;  3X40 A;  1UI8 A;  3STD A;  1RCK A;  1BRS A;  1Y4K A;  4MMY B;  2BO9 B;  1YJN 3;  2GU1 A;  3F8X A;  4EXR A;  1W02 A;  1L5G B;  4KT3 B;  3PGB A;  2F98 A;  3AMO B;  1FUT A;  3FG1 A;  4XBY A;  3NHX A;  1OH0 A;  2R41 A;  4HOH A;  3WDG B;  3GZR A;  1K41 A;  3FLJ A;  1Z1S A;  4Q53 A;  1LVN A;  2OWP A;  1BRH A;  1UDI I;  1BNI A;  3K0Z A;  4FCM A;  4ORL A;  5IG0 A;  1MGR A;  1K73 4;  2KRT A;  3K5T A;  3J7Y d;  2OTL 3;  3CCU 3;  1OCV A;  2CG0 A;  1RMS A;  2IY2 A;  3EBT A;  3BLZ A;  1NWW A;  3KII A;  3A76 A;  3OXA A;  3PYJ A;  1GY6 A;  2IYJ A;  4O02 B;  4LSO A;  3HII A;  3CPW 2;  1GD3 A;  2CFK A;  2F4Y A;  2HML B;  5IF6 A;  1QVG 2;  2W2C A;  2HMN B;  1BIR A;  3LOY A;  2CX1 A;  8RNT A;  5CLK A;  3BNE A;  1UCI A;  1S72 3;  4KZ1 A;  3DM8 A;  4WWU C;  2ML5 A;  2R4I A;  3K7C A;  1B2U A;  3EJV A;  3K63 A;  3WOD G;  5CF1 A;  1CQS A;  4HM7 B;  3SLU A;  4BL3 A;  1GOV A;  4OVM A;  3K9M C;  4I4K A;  4N6L A;  4XBT A;  1ZGX A;  1TTO A;  1W6G A;  1U8C B;  3F7S A;  2OQE C;  3D79 A;  3PCS A;  4GSP A;  3HZP A;  3LTC A;  2HMO B;  1OHS A;  3SED A;  1NNV A;  5AII A;  1O7H B;  3Q2P A;  1TUH A;  5KP3 A;  3AGN A;  2D42 A;  1EUI C; 
#chains in the Genus database with same CATH homology
 3MG2 A;  4MMX B;  4XDV A;  1NJI 4;  1VQN 3;  2YFI B;  2XF3 A;  1ZO2 A;  4HVN A;  5TGN A;  3S28 A;  3H51 A;  3JUO A;  3HIG A;  1W7C A;  5G2G A;  1AV4 A;  3F14 A;  1VQL 3;  3X42 A;  5I97 A;  1IVW A;  1S5A A;  3FZW A;  3BB9 A;  3MG3 A;  2GEX A;  3N9H A;  5A0O B;  1FUW A;  3OV4 A;  4OK0 A;  5FGO A;  2GBW B;  1QVF 2;  2IUK A;  3EQQ B;  1ISK A;  2CIU A;  1M1K 4;  3MHE A;  4WHA A;  3S29 A;  3BNC A;  5ELJ A;  2CH9 A;  1OF5 B;  1RRL A;  2HMK B;  1IT7 A;  3CD6 3;  4LMI A;  2HMM B;  5CF2 A;  1ROV A;  2W04 A;  1T5Y A;  1HKX A;  3FF2 A;  1K28 A;  2JDI H;  2RCD A;  3CCJ 3;  1MOL A;  3EX9 A;  5IEP A;  4K90 B;  3D3L A;  4EC6 A;  5AYS C;  4EV2 A;  1O7G B;  2CWT A;  3GZB A;  3L0R A;  4LGQ A;  2I9W A;  3WA3 A;  1Q86 4;  1RRH A;  1NO3 A;  5IEO A;  3KSP A;  1V74 A;  4IPB A;  1SJW A;  4FMB A;  3WOE B;  1IU7 A;  1FGR A;  2CW9 A;  2CHC A;  1EG9 B;  2P05 A;  3T0U A;  1OHP A;  4FMD A;  3N54 B;  1QAK A;  1JN5 B;  1VQP 3;  5AYR B;  1VQO 3;  2FNQ A;  3LTB A;  1NB3 I;  2E2V A;  4R80 A;  3CCE 3;  1N8R 4;  2XGL A;  1GY7 A;  2CWV A;  2LQV A;  2B1X B;  3M8C A;  3S27 A;  3DUK A;  1TP6 A;  2BMO B;  2CG1 A;  1IDP A;  3RGR A;  3QRD A;  2K0M A;  2XR8 B;  3LZA A;  4N6U A;  2ZDJ A;  3F40 A;  1DMQ A;  3GZX B;  1DMN A;  3DXO A;  2YFL B;  1JJ2 2;  1US1 A;  3ECF A;  1ZX2 A;  2RFR A;  1W2Z A;  3PXM A;  3VF1 A;  2W56 B;  5IG3 A;  3WOF B;  7STD A;  3PZW A;  1VQM 3;  1Q81 4;  2STD A;  2B24 B;  1O7N B;  3IJE B;  3NBB A;  3CCM 3;  3U97 A;  4O3V A;  4HM0 B;  3SOA A;  1G96 A;  2Y73 A;  3HX8 A;  1LNH A;  5AIH A;  1KC8 4;  3CC7 3;  1FGT A;  1FA3 A;  4QWT A;  2O3O A;  3E99 A;  4MMZ B;  3G0K A;  3HI7 A;  3F9S A;  4FMC A;  5EVH A;  3S67 A;  1W00 A;  3I56 3;  2A15 A;  1STF I;  3MWZ A;  4K61 A;  4HM3 B;  1MNL A;  1KQS 2;  4XM4 A;  4LZI A;  3NM2 A;  1RJO A;  4O2H A;  3EB8 A;  3G4S 3;  4RBN A;  5D81 A;  2P09 A;  3CPO A;  1ULJ B;  1CEW I;  2RSX A;  2L4V A;  1NDO B;  4TX4 A;  5IER A;  3FCS B;  4L7K A;  1M1X B;  4X2O A;  1E3R A;  1WMO A;  1OGZ A;  3KZT A;  4NHF A;  1A2K A;  2F86 B;  3PS8 A;  3Q90 A;  1W2B 2;  1O7P B;  1JV2 B;  4HM1 B;  1SPU A;  5JPP A;  1WMN A;  3KE7 A;  5DRV A;  1BUQ A;  3HK4 A;  3IPT A;  4HYZ A;  2WGQ A;  1YI2 3;  4IIA A;  3O8Y A;  2SBL A;  2XSH B;  4KVH A;  1JKG A;  2W9P A;  3CCS 3;  1EA2 A;  3DGO A;  1A90 A;  3CU3 A;  4L8O A;  1VQ9 3;  1A2V A;  1PU4 A;  1SQW A;  2WOH A;  1UI7 A;  1TFK A;  1N5H A;  1Q40 A;  2CK3 H;  4LEH A;  2XFS A;  1F8N A;  3WA2 X;  1W4N A;  3FG4 A;  3LT8 A;  3CME 3;  3MYT A;  3V98 A;  3NV0 A;  1NB5 I;  2WOF A;  4FMA A;  2P38 A;  6STD A;  3CCR 3;  2GXF A;  2W0Q A;  3MKI A;  1VQ5 3;  2Y74 A;  5KP4 A;  3T8N A;  2XEP A;  4WP5 A;  3GRD A;  4KFD A;  3RGA A;  1J2B A;  2MF7 A;  4XDW A;  3I0Y A;  5EEO A;  1YIT 3;  3EN8 A;  3DGM A;  1YVB I;  4K1V A;  3CCQ 3;  2E2T A;  1SII A;  3RDE A;  2V1L A;  2UX0 A;  3SVA A;  3SX1 A;  1IT8 A;  2IMJ A;  2CFG A;  4N3V A;  2W9Q A;  3EBY A;  1W6Y A;  2WO0 A;  3SXX A;  3X3Z A;  1K8A 4;  1C7H A;  3FGY A;  3SOY A;  1GY5 A;  4J9A A;  1Q7Y 4;  1QAF A;  3VGN A;  3BND A;  3B4O A;  1AVK A;  3LXU X;  2IA7 A;  2YFJ B;  1VQ6 3;  1D6Z A;  4GL6 A;  2OOV A;  1R4C A;  2Q07 A;  3JUN A;  4HM6 B;  2YX9 A;  1GYB A;  3DGN A;  3DMC A;  5LC7 A;  3NBR A;  3CNX A;  1TU5 A;  2W6J H;  3CCV 3;  1OUN A;  3UL6 A;  4WFO A;  1VQ7 3;  2QIY A;  2M7O A;  3B4P A;  2BNG A;  3GWR A;  3GAX A;  3NUV A;  1RKY A;  3KN4 A;  2CFW A;  2O9U X;  1KSI A;  2BMR B;  3NBJ A;  1ROA A;  5CXO A;  1IV9 A;  5AEW B;  3NXJ A;  2MC8 A;  2FXT A;  3T8U A;  1DVC A;  4WYK A;  5JPU A;  2QEX 3;  1EQK A;  3KFQ C;  3NX0 A;  5AI1 A;  1VZZ A;  3JUQ A;  4HZB B;  2XFT A;  1M90 4;  4XBX A;  4MEI A;  2CWU A;  2LYX A;  2Z77 A;  4EV5 A;  1NU3 A;  2PNC A;  3X3X A;  4FCZ A;  3AMO A;  4U13 A;  1U5O A;  1D6U A;  2XRX B;  3F8H A;  1YJ9 3;  3KSE D;  3NQY A;  4HKV B;  4N6V 0;  3JUM A;  3TDG A;  4FR9 A;  3S5C A;  1QMA A;  4XBT A;  3IMA B;  2D1W A;  3JVC A;  3OW2 2;  1IK3 A;  2BHM A;  2WGO A;  3LYG A;  3UL5 A;  1YJW 3;  1AR0 A;  1JB5 A;  4N6O B;  5BVB A;  4STD A;  5EQL A;  3F7X A;  1O7W B;  4N6N B;  2BT3 A;  4OUQ A;  3CC2 3;  2CFD A;  1WNH A;  2OTJ 3;  3KKG A;  1KD1 4;  1ULI B;  4R9K A;  3V92 A;  4G1M B;  3DZL A;  4HBR A;  3EHC A;  3G16 A;  3CC4 3;  4AKY A;  3LML A;  3B8L A;  4H61 A;  3ER7 A;  4N6T A;  4X2H A;  2ML6 A;  1IQY A;  3NM7 A;  1VQ4 3;  2JQ5 A;  2QGU A;  3N8B A;  1ASK A;  3OWS A;  3LH4 A;  5D83 A;  3X3Y A;  3FG3 A;  4O8S A;  1N9E A;  4RNY A;  3CNM A;  3G6E 3;  1IQ8 A;  3NQZ A;  3LT9 A;  4KFE A;  2XGN A;  2GEY A;  2OQE A;  3BNB A;  3H3H A;  5IEN A;  4H3U A;  2CC3 A;  4BTY A;  1WMP A;  2INX A;  2Z6B A;  5HGR A;  5CK6 A;  3G8Z A;  1YGE A;  2GU3 A;  1O7M B;  4HM4 B;  2GBX B;  4AKZ A;  1M9G A;  4JF8 A;  3CMA 3;  2P0M A;  1VQK 3;  1DYU A;  4KFF A;  3GZY B;  4EBG A;  1K9M 4;  2Z7A A;  1OAC A;  1W6C A;  3DGL A;  3WMD A;  3G71 3;  5IG4 A;  1CYV A;  2F99 A;  4R4K A;  3FF0 A;  3FKA A;  5IW9 A;  3VSY A;  1JB4 A;  1AVL A;  3U1W A;  4HM2 B;  1Q42 A;  1LXE A;  3UJM A;  3CCL 3;  1JKG B;  5AIG A;  4CDL A;  2W03 A;  1GD4 A;  3OX9 A;  4R9L A;  4RZM A;  4EYC A;  3OWU A;  1UUV B;  4JRF A;  1JB2 A;  1WTH A;  1E97 A;  1RN7 A;  5IF6 A;  2C11 A;  1Q40 B;  1OF5 A;  2HMJ B;  3DY5 A;  4HZ9 B;  2CKF B;  1FGO A;  1KWI A;  4BTX A;  4ZM8 A;  1N5P A;  1DMM A;  1IV7 A;  3I55 3;  1QJG A;  2PZV A;  2E2U A;  3NV0 B;  3EF8 A;  1W01 A;  4R1K A;  2FGT A;  3B7C A;  2BMQ B;  3OWY A;  1YIJ 3;  3MPH A;  2QA4 3;  5BXQ A;  5AEU B;  5AIF A;  3LTA A;  4RNZ A;  3EC9 A;  3UB1 A;  3Q1C A;  3LTD A;  4HM8 B;  1PFP A;  1IVU A;  3EE1 A;  5ELU A;  3V99 A;  1Q82 4;  3FH1 A;  1WQL B;  1TIJ A;  1STD A;  1QAL A;  1DVD A;  4L8P A;  3UNL A;  1FGM A;  4AEQ A;  4HJL B;  5D82 A;  1OPY A;  1GS3 A;  4PEJ A;  2C10 A;  1JN5 A;  3X41 A;  5FW5 A;  5LC6 A;  2XH9 A;  1UW1 A;  5JBS A;  2Z76 A;  3QK9 A;  1FGQ A;  3CXC 2;  4MJD A;  2OCT A;  3ALA A;  3PCR A;  2RGQ A;  2P0X A;  3FSD A;  1OGX A;  1YHQ 3;  1SIH A;  1LOX A;  2OOV C;  4XB5 A;  1IVX A;  2K54 A;  2KCD A;  1JNQ A;  2CFL A;  1UUW B;  3D9R A;  3MG1 A;  1IQX A;  4N6M A;  1E3V A;  2W56 A;  4CCV A;  1VQ8 3;  1A67 A;  1N9J A;  5IG5 A;  1CYU A;  1IVV A;  1HU9 A;  1D6Y A;  1N8Q A;  1OHO A;  4GB5 A;  1EKM A;  4J8T A;  2ZL8 A;  4FCJ A;  2KXG A;  1W5Z A;  3JUP A;  4K1U A;  3ROB A;  4IT7 A;  4HM5 B;  3EN1 B;  8CHO A;  5STD A;  3MSO A;  4WYK B;  5DRE A;  1TFO A;  2XSO B;  2IUJ A;  5KP1 A;  4NRE A;  4BTW A;  1JRQ A;  3X40 A;  1UI8 A;  3STD A;  1Y4K A;  4MMY B;  2BO9 B;  1YJN 3;  2GU1 A;  3F8X A;  4EXR A;  1W02 A;  1L5G B;  3PGB A;  2F98 A;  3AMO B;  3FG1 A;  4XBY A;  3NHX A;  1OH0 A;  3WDG B;  3GZR A;  1K41 A;  3FLJ A;  1Z1S A;  4Q53 A;  1LVN A;  2OWP A;  4FCM A;  4ORL A;  3K0Z A;  5IG0 A;  1K73 4;  2KRT A;  3K5T A;  3J7Y d;  2OTL 3;  3CCU 3;  1OCV A;  2CG0 A;  3EBT A;  3BLZ A;  1NWW A;  3KII A;  3A76 A;  3OXA A;  3PYJ A;  1GY6 A;  4O02 B;  4LSO A;  3HII A;  3CPW 2;  1GD3 A;  2CFK A;  2HML B;  1QVG 2;  2W2C A;  2HMN B;  3LOY A;  5CLK A;  3BNE A;  1S72 3;  4KZ1 A;  3DM8 A;  4WWU C;  2ML5 A;  2R4I A;  3K7C A;  3EJV A;  3K63 A;  3WOD G;  5CF1 A;  1CQS A;  4HM7 B;  3SLU A;  4OVM A;  3K9M C;  4I4K A;  4N6L A;  1W6G A;  1U8C B;  3F7S A;  2OQE C;  3PCS A;  3HZP A;  3LTC A;  2HMO B;  1OHS A;  3SED A;  5AII A;  1O7H B;  3Q2P A;  1TUH A;  5KP3 A;  2D42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...