1VQO3

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vqo300
3CCS3 1YJW3 1Q7Y4 1M1K4 1VQ43 1VQ83 1VQL3 1YIT3 3CME3 1VQ93 1S723 1Q814 1K8A4 1QVF2 3CCU3 3CD63 1QVG2 3CCR3 3CCQ3 1YJN3 2OTL3 1VQ53 3CC73 3I553 1YIJ3 1VQP3 1VQM3 1VQK3 1JJ22 3CC43 3CCV3 3G6E3 3CCE3 3CCM3 2QA43 3OW22 3CCL3 3CCJ3 1NJI4 3I563 3G713 1VQ63 1K734 2OTJ3 1KC84 1K9M4 1VQ73 1YHQ3 1VQN3 3G4S3 1YJ93 1KQS2 3CC23 3CMA3 1M904 1W2B2 1Q824 2QEX3 1N8R4 3CPW2 1VQO3 1Q864 1YI23 3CXC2 1KD14
chains in the Genus database with same CATH superfamily
1NDOB 1RKYA 1Q7Y4 2CK3H 2PNCA 8RNTA 4JRFA 4FCMA 4HM4B 4N6NB 4X2HA 1S5AA 1RGKA 5IENA 1T5YA 1JKGA 5I97A 4HM1B 2XR8B 4IIAA 2CX1A 2UGIA 2KF5A 3GZYB 4STDA 3CC73 4J5KA 4NPBA 2BO9B 2Q07A 1RMSA 4N6V0 2QA43 1JKGB 2IMJA 2W03A 3FF0A 3PCSA 2CWTA 4AKYA 4L7KA 1AVLA 1TFKA 1YVBI 2P05A 3UL5A 3DGOA 1IYYA 1LOXA 1EG9B 3DXOA 1A67A 1Q824 2HMNB 3F40A 5TGNA 4HM0B 1VQO3 1Q864 2Z7AA 4WP5A 7GSPA 4FMCA 2CX0A 2JDIH 4ILFA 5D82A 3M8CA 3KCHA 1CH0A 5CLKA 4FMBA 1LNIA 2BMOB 4BL3A 4EXRA 1IV9A 1MNLA 1US1A 1W6GA 1M1XB 2C4BA 4J9AA 7RNTA 2K3DA 1RNBA 1UDII 2OOVA 4OK0A 1CYVA 5CF1A 3CCQ3 1B2UA 1WMOA 1ISKA 1EQKA 4N6OB 3X41A 4O8SA 4GB5A 1YIJ3 1VQP3 1VQK3 1TRQA 3AMOA 5CK6A 3CCM3 1FGMA 5AIFA 2HMLB 2KXGA 3NX0A 4RNZA 1UGHI 2WGOA 1VQ73 1K9M4 4ZM8A 1DE3A 3S27A 1D6UA 1F8NA 3AMOB 3T0UA 4PEJA 5EEOA 4ORLA 4AEQA 2W2CA 3T8NA 2P0MA 5CF2A 3LOYA 3D5GA 1JB5A 3HIIA 2RBIA 1BGSA 1IVWA 2KF4A 2IA7A 3NV0A 1C54A 2GXFA 2BT3A 3WDGB 5IG5A 4EV2A 3ER7A 1WTHA 2Z76A 4AKZA 2CH9A 3NV0B 1OHPA 4KT3B 3VF1A 2GU3A 3B4OA 3NHXA 5IEOA 1M9GA 3BNEA 3E99A 3FGYA 3JVCA 5KP4A 3CCL3 1JZOA 4MMXB 3FG3A 1O7NB 1RGEA 1BRHA 1ZGXA 1VQN3 5AIGA 2BMQB 1RN1A 2C10A 1JBRA 3U97A 3T8UA 4L8OA 1I2GA 4EC6A 1LOVA 3FKAA 3G8ZA 3N9HA 3ROBA 3FZWA 2XF3A 4FCJA 5LC6A 1K41A 4HOHA 5JBSA 3CPOA 1FGQA 1LRAA 5IW9A 2BNGA 3CCU3 1GMPA 1IT8A 1BANA 3OX9A 4MMYB 4DKIA 3H3HA 3Q1CA 5EVHA 5FGOA 1LOWA 3ALAA 3N54B 1IV7A 1B2XA 1D6ZA 1RGLA 2OOVC 3EQQB 3KE7A 1I0VA 4HM3B 3JUQA 4U13A 1AVKA 2KAAA 4R1KA 2P0XA 3SOYA 1O7MB 1BVIA 3KSED 3Q2PA 2H0IA 2XH9A 1UGIA 1OHSA 4BTXA 1N8R4 1OCVA 1IQXA 3EN1B 3MHEA 2GEYA 2XSHB 4KVHA 4HM6B 1GOVA 3B7CA 3KIIA 1X1YA 5IEPA 2L1SA 5ELUA 2K54A 4HBRA 6GSPA 2RCDA 5M1AA 4QWTA 2CC3A 2BMRB 3SEDA 1SIIA 4R9LA 1V74A 3F14A 1I2EA 3G16A 4R4KA 1W6CA 1QMAA 5A0OB 1IVUA 3QK9A 1FYSA 3OW22 4Q53A 2CWVA 4RBNA 3DGNA 2A15A 5HGRA 5BU4A 1C7HA 4IT7A 1E3VA 3D3LA 1SQWA 1RN4A 1V58A 1TTOA 3KKGA 5LC7A 1YGWA 3VSYA 1LQGC 1YNVX 3NM7A 2FXTA 3A76A 1GYBA 1MWSA 2E2VA 1BSCA 5AEUB 1BNIA 1YIT3 5KP3A 1VQ93 5JPPA 1K8A4 2ZA4A 3IPTA 4EV5A 4XM4A 2LQVA 2P38A 3PS8A 1T2HA 1BUQA 2WOHA 3WODG 1GD4A 1O7PB 2OTL3 1RGCA 2SARA 4TX4A 1Y4KA 2HMOB 1NWWA 3KN4A 4HM2B 4HZBB 1NJI4 3AHSA 3CU3A 1MGWA 1NO3A 3LH4A 4O3VA 1OACA 3MG3A 1RLSA 2Y73A 2K0MA 1RNTA 4WHAA 1L5GB 1BRKA 1UI7A 2RFRA 1NNVA 3BNBA 1DYUA 1TJDA 1SARA 1BRGA 2CWUA 3DH2A 3LZAA 3WA2X 1AR0A 2OCTA 3U1WA 1EUIC 3CCS3 2M7OA 4WYKA 3F8HA 4FR9A 4N6MA 1MWUA 3CME3 1S723 1TFOA 4N6TA 3X3YA 3URPA 2ZL8A 1QVF2 3CD63 3LT9A 1JZDA 1T3BA 4I5QA 3X42A 2YFIB 2HMMB 4WYKB 3CCR3 3D5IA 2F98A 3WHOA 1BSBA 4HAAA 6RNTA 3IMAB 3KSPA 3FH1A 1MWTA 1K734 1BNEA 1W6YA 2ZHXB 2XEPA 1KC84 1ULJB 1TUHA 3NBRA 1FUSA 1G96A 4K1VA 7STDA 3F7XA 1UUWB 4K90B 1I2FA 2F5WA 2YX9A 3EBYA 3F7SA 3OXAA 4RNYA 1IK3A 3RDEA 1BSDA 1N5PA 1B2SA 3WOFB 1B3SA 3JUNA 4XB5A 1GY5A 1VQL3 2Z77A 3ZG5A 1FGRA 3AGOA 1LOYA 1I0XA 1IQ8A 5G1KA 1AV4A 1DMNA 1OGXA 1PFPA 3JUMA 3NXJA 3EX9A 2CFKA 4XBTA 5FW5A 2E2TA 2OWPA 8CHOA 1Q42A 2W56A 3FG1A 3NBBA 1BRJA 5AYRB 3STDA 3G6E3 3CCV3 1T2IA 3Q90A 4LYLB 1A2KA 4XDWA 2CW9A 4KFFA 3X3ZA 3SXXA 3OV4A 1ROVA 4WFOA 2XRXB 4N3VA 2B1XB 2CFWA 2XFSA 3QRDA 4N6UA 3NQZA 1W02A 2SBLA 2W56B 3V92A 2J8XB 2IYJA 1ZO2A 5AIHA 3DY5A 2XSOB 1UCLA 3BU4A 3NUVA 4LEHA 3BB9A 1KWIA 1I3FA 4R9KA 3F9SA 3FLJA 4O2HA 2MC8A 1JB4A 3EC9A 3RGRA 4NHFA 1R4YA 3AHWA 3LXUX 1Q814 4CCVA 2WOFA 3S28A 3NBJA 1TRPA 1RRHA 2KF6A 1BU4A 1MWRA 3S5CA 1YJN3 1UCIA 2H0GA 3LTAA 4HM5B 1RRLA 4XBYA 3JUOA 1FW7A 1GMQA 4RNTA 3DMCA 4CDLA 5BIRA 3CCE3 2INXA 3GWRA 4J5GA 1DVDA 5D83A 4FMDA 3S29A 1RJOA 1OPYA 3I563 1A90A 1STFI 2CIUA 4N6LA 1IU7A 2F86B 3EB8A 1PU4A 2XGNA 3BIRA 1ASKA 3GZRA 3H51A 1SPUA 3O8YA 5AEWB 5G1LA 2PZVA 3MSOA 5JPUA 1M1K4 5EQLA 5KP1A 1BSAA 1AY7A 2QGUA 1DMMA 2CFGA 3CNMA 1Q7HA 2FNQA 3MWZA 1W5ZA 1BNJA 1QVG2 1UW1A 1K28A 1CQSA 3GRDA 5IG0A 2BU4A 1J2BA 3EHCA 1JB2A 1RHLA 1SIHA 3LTCA 3VGNA 4BTWA 1FZUA 1JBSA 3I0YA 3BLZA 1G0TA 3GZBA 1G02A 1ZX2A 4FMAA 2RSXA 1VQ63 1HYFA 3WOEB 3ZG0A 1FGOA 1W2ZA 2F56A 2W9PA 3B4PA 1GSPA 3DGMA 1YHQ3 1YJ93 3LT8A 1YGEA 1AQZA 1UI8A 2CHCA 2P09A 3HZPA 4L8PA 4OUQA 4KZ1A 1OHOA 1GY6A 3SLUA 3NM2A 1OH0A 3N8BA 3PGBA 4H3UA 5ELJA 2OQEA 3LTDA 1TU5A 3SYUA 2W04A 2ZDJA 3UNLA 3WMDA 4BU4A 1O7GB 1X1WA 1PY3A 1BRSA 3G0KA 1I8VA 2HMJB 4LGQA 3UL6A 4JF8A 1VQM3 3GSPA 3CC43 3L0RA 2IUKA 1OGZA 3DGLA 1A2PA 2UX0A 2RGQA 3K0ZA 2FGTA 1W4NA 2LYXA 1JV2B 2C11A 2XFTA 3EN8A 3D79A 3CC23 4HKVB 2QEX3 5HOHA 2V1LA 1CYUA 3MYTA 5CXOA 3CXC2 3SX1A 1VQ43 2H0HA 1RGGA 2W0QA 1Q40A 4XDVA 2KRTA 1UUGB 1MOLA 2ML6A 3FF2A 2WO0A 2GSPA 3GAXA 4HM7B 3DUKA 1BNGA 1LNHA 3WR2A 1W01A 1BNSA 1V57A 3MG2A 3KZTA 1JJ22 1JBTA 3SOAA 1Q40B 1N8QA 4K61A 4XBXA 1BAOA 2GEXA 4MEIA 3NQYA 3OWUA 3G713 4HVNA 1RCLA 3MKIA 1JN5A 3FCSB 4HJLB 4EW5A 1WMNA 3HK4A 2D42A 3EE1A 2KF3A 4WWUC 1IVVA 2KCDA 6STDA 1M904 3D9RA 3JUPA 5AI1A 5IF6A 3HIGA 3FG4A 1OF5A 5IG3A 4R80A 1TIJA 1IDPA 5M18A 1YJW3 1RDSA 1JN5B 3DM8A 4GSPA 4EBGA 1U5OA 2WGQA 4FCZA 1WMPA 4LZIA 1RGHA 3X3XA 3ZFZA 3A5EA 3OWYA 2STDA 1KSIA 1OF5B 1UUVB 2YFJB 5STDA 4BIRA 5BXQA 1BSEA 1GS3A 2OQEC 1VQ53 3K63A 5G2GA 1MGRA 2Y74A 1VQQA 3RNTA 1B20A 4HZ9B 1RN7A 1DETA 3Q3FA 1A2VA 1N5HA 4EYCA 1BNFA 1B21A 4H61A 4KFDA 4X2OA 5AIIA 1BIRA 1W2B2 3K7CA 3J7Yd 1FUTA 3TDGA 1YI23 1JRQA 4K1UA 4I4KA 1TP6A 1Q9EA 3PYJA 4GL6A 2MF7A 3EF8A 2I9WA 4O02B 1VQ83 1W00A 1RTUA 4BTYA 1WNHA 9RNTA 1FGTA 2E2UA 4HYZA 1UCKA 1VZZA 3PXMA 1FUWA 1D6YA 2D1WA 4MJDA 3F8XA 1E97A 5BVBA 3UB1A 1HZ1A 1OUNA 2W9QA 3LMLA 3I553 1NB5I 5M19A 1GOYA 1EA2A 1LXEA 1RGAA 3RGAA 1IT7A 3HX8A 1RCKA 1NU3A 2O9UX 2GBXB 2OTJ3 1FA3A 1PYLA 2B24B 2BHMA 3HOHA 3IJEB 3PZWA 5AYSC 1KQS2 3CMA3 2L4VA 1B27A 1BOXA 4CJNA 3ECFA 3UJMA 2F4YA 2AAEA 1GOUA 1KD14 3GZXB 5DREA 4RZMA 2CG1A 1N9JA 4OVMA 1EEJA 3S67A 5RNTA 1HKXA 5GSPA 3PCRA 1SJWA 3EBTA 2CFLA 1GMRA 3D4AA 1B2ZA 1X1XA 3K5TA 2GBWB 4G1MB 3X40A 1B2MA 1IVXA 1BNRA 5IG4A 1YVSA 2HOHA 3BNDA 3FSDA 3KFQC 3WA3A 2R41A 2HMKB 3LTBA 3LYGA 5IERA 3K9MC 4CPKA 1LQMB 2IUJA 3CCJ3 4IPBA 3DZLA 1JNQA 1U8CB 2CKFB 4HM8B 2W6JH 2RNTA 3DGYA 4J8TA 3G4S3 1HU9A 1BRNL 3EJVA 3HI7A 1QALA 1ROAA 2CG0A 1O7WB 4MMZB 1Z1SA 3CNXA 3V99A 4GHOA 3CPW2 2XGLA 1NB3I 2UUGC 3OWSA 2F99A 5DRVA 3B8LA 4NREA 1ULIB 1X1UA 3SVAA 1BRIA 3BNCA 1WQLB 1GD3A 1R4CA 1N9EA 2YFLB 1UCJA 2JQ5A 1QJGA 3MG1A 2CFDA 1E3RA 2IY2A 1RSNA 1I70A 1O7HB 1BUJA 1CEWI 2GU1A 2BIRA 1I3IA 4LSOA 1EKMA 2F5MA 1RGFA 2O3OA 2ML5A 4LMIA 1W7CA 2AADA 1ZS7A 2Z6BA 1DVCA 2R4IA 3AGNA 1DMQA 1STDA 5D81A 3V98A 3MPHA 2QIYA 1LVNA 1QAFA 4KFEA 1IQYA 4BL2A 1QAKA 1GY7A
chains in the Genus database with same CATH topology
1NDOB 1RKYA 1Q7Y4 2CK3H 2PNCA 4JRFA 4FCMA 4HM4B 4N6NB 4X2HA 1S5AA 5IENA 1T5YA 1JKGA 5I97A 4HM1B 2XR8B 4IIAA 3GZYB 4STDA 3CC73 2BO9B 2Q07A 2QA43 4N6V0 1JKGB 2IMJA 2W03A 3FF0A 3PCSA 2CWTA 4AKYA 4L7KA 1AVLA 1TFKA 1YVBI 2P05A 3UL5A 3DGOA 1LOXA 1EG9B 3DXOA 1A67A 1Q824 2HMNB 3F40A 5TGNA 4HM0B 1VQO3 1Q864 2Z7AA 4WP5A 4FMCA 5D82A 2JDIH 3M8CA 5CLKA 4FMBA 2BMOB 4EXRA 1IV9A 1MNLA 1US1A 1W6GA 1M1XB 4J9AA 2OOVA 4OK0A 1CYVA 5CF1A 3CCQ3 1WMOA 1ISKA 1EQKA 4N6OB 3X41A 4O8SA 4GB5A 1YIJ3 1VQP3 1VQK3 3AMOA 5CK6A 3CCM3 1FGMA 5AIFA 2HMLB 2KXGA 3NX0A 4RNZA 2WGOA 1K9M4 1VQ73 4ZM8A 3S27A 3AMOB 1D6UA 1F8NA 3T0UA 4PEJA 5EEOA 4ORLA 4AEQA 2W2CA 3T8NA 2P0MA 5CF2A 3LOYA 1JB5A 3HIIA 3NV0A 1IVWA 2IA7A 2GXFA 2BT3A 3WDGB 5IG5A 4EV2A 3ER7A 1WTHA 2Z76A 4AKZA 2CH9A 3NV0B 1OHPA 3VF1A 2GU3A 3B4OA 3NHXA 5IEOA 1M9GA 3BNEA 3E99A 3FGYA 3JVCA 5KP4A 3CCL3 4MMXB 3FG3A 1O7NB 1VQN3 5AIGA 2BMQB 2C10A 3U97A 3T8UA 4L8OA 4EC6A 3ROBA 3FKAA 3G8ZA 3N9HA 3FZWA 2XF3A 4FCJA 5LC6A 1K41A 5JBSA 3CPOA 1FGQA 5IW9A 2BNGA 3CCU3 1IT8A 3OX9A 4MMYB 3H3HA 3Q1CA 5EVHA 5FGOA 3ALAA 3N54B 1IV7A 1D6ZA 2OOVC 3EQQB 3KE7A 4HM3B 4U13A 3JUQA 1AVKA 4R1KA 2P0XA 3SOYA 1O7MB 3KSED 3Q2PA 2XH9A 1OHSA 4BTXA 1N8R4 1OCVA 1IQXA 3EN1B 3MHEA 2GEYA 2XSHB 4KVHA 4HM6B 3B7CA 3KIIA 5IEPA 5ELUA 2K54A 4HBRA 2RCDA 4QWTA 2CC3A 2BMRB 3SEDA 1SIIA 4R9LA 1V74A 3F14A 3G16A 4R4KA 1W6CA 1QMAA 5A0OB 1IVUA 3QK9A 3OW22 4Q53A 2CWVA 4RBNA 3DGNA 2A15A 5HGRA 1C7HA 4IT7A 1E3VA 3D3LA 1SQWA 3KKGA 5LC7A 3VSYA 3NM7A 2FXTA 3A76A 1GYBA 2E2VA 5AEUB 1YIT3 5KP3A 1VQ93 5JPPA 1K8A4 3IPTA 4EV5A 4XM4A 2LQVA 2P38A 3PS8A 1BUQA 2WOHA 3WODG 1GD4A 1O7PB 2OTL3 4TX4A 1Y4KA 2HMOB 1NWWA 3KN4A 4HM2B 4HZBB 1NJI4 3CU3A 1NO3A 3LH4A 4O3VA 1OACA 3MG3A 1L5GB 2Y73A 2K0MA 4WHAA 1UI7A 2RFRA 1J2BA 3BNBA 1DYUA 2CWUA 3LZAA 3WA2X 1AR0A 2OCTA 3U1WA 3CCS3 2M7OA 4WYKA 3F8HA 4FR9A 4N6MA 3CME3 1S723 1TFOA 4N6TA 3X3YA 2ZL8A 1QVF2 3CD63 3LT9A 3X42A 2YFIB 2HMMB 4WYKB 3CCR3 2F98A 3IMAB 3KSPA 3FH1A 1K734 1W6YA 1KC84 2XEPA 1ULJB 1TUHA 3NBRA 1G96A 4K1VA 7STDA 3F7XA 1UUWB 4K90B 4RNYA 1IK3A 2YX9A 3EBYA 3F7SA 3OXAA 3RDEA 1N5PA 3WOFB 3JUNA 4XB5A 1GY5A 1VQL3 2Z77A 1FGRA 1IQ8A 1AV4A 1DMNA 1OGXA 1PFPA 3JUMA 3NXJA 3EX9A 2CFKA 4XBTA 5FW5A 2E2TA 2OWPA 8CHOA 1Q42A 2W56A 3FG1A 3NBBA 5AYRB 3STDA 3G6E3 3CCV3 3Q90A 4XDWA 1A2KA 3X3ZA 2CW9A 4KFFA 3SXXA 3OV4A 1ROVA 4WFOA 2XRXB 4N3VA 2B1XB 2CFWA 2XFSA 3QRDA 4N6UA 3NQZA 1W02A 2SBLA 2W56B 3V92A 5AIHA 1ZO2A 3DY5A 2XSOB 3NUVA 4LEHA 3BB9A 1KWIA 4R9KA 3F9SA 3FLJA 4O2HA 2MC8A 1JB4A 3EC9A 3RGRA 4NHFA 3LXUX 1Q814 4CCVA 2WOFA 3S28A 3NBJA 1RRHA 3S5CA 1YJN3 3LTAA 4HM5B 1RRLA 4XBYA 3JUOA 4CDLA 3DMCA 3CCE3 2INXA 3GWRA 1DVDA 5D83A 4FMDA 3S29A 1RJOA 1OPYA 3I563 1A90A 1STFI 2CIUA 4N6LA 1IU7A 2F86B 3EB8A 1PU4A 2XGNA 3GZRA 1ASKA 3H51A 3O8YA 1SPUA 5AEWB 2PZVA 3MSOA 5JPUA 1M1K4 5EQLA 5KP1A 2QGUA 1DMMA 2CFGA 3CNMA 2FNQA 3MWZA 1W5ZA 1QVG2 1UW1A 1K28A 1CQSA 3GRDA 5IG0A 3EHCA 1JB2A 1SIHA 3LTCA 3VGNA 4BTWA 3I0YA 3BLZA 3GZBA 1ZX2A 4FMAA 2RSXA 1VQ63 3WOEB 1FGOA 1W2ZA 2W9PA 3B4PA 3DGMA 1YHQ3 1YJ93 3LT8A 1YGEA 2CHCA 1UI8A 2P09A 3HZPA 4L8PA 4OUQA 4KZ1A 1OHOA 1GY6A 3SLUA 3NM2A 1OH0A 3N8BA 3PGBA 4H3UA 5ELJA 2OQEA 3LTDA 1TU5A 2W04A 2ZDJA 3UNLA 3WMDA 1O7GB 3G0KA 2HMJB 4LGQA 3UL6A 4JF8A 1VQM3 3CC43 3L0RA 2IUKA 1OGZA 3DGLA 2UX0A 2RGQA 3K0ZA 2FGTA 1W4NA 2LYXA 1JV2B 2C11A 2XFTA 3EN8A 3CC23 4HKVB 2QEX3 2V1LA 1CYUA 3MYTA 5CXOA 3CXC2 3SX1A 1VQ43 2W0QA 1Q40A 4XDVA 2KRTA 1MOLA 2ML6A 3FF2A 2WO0A 3GAXA 4HM7B 3DUKA 1LNHA 1W01A 3MG2A 1JJ22 3KZTA 3SOAA 1Q40B 1N8QA 4K61A 4XBXA 2GEXA 4MEIA 3NQYA 3OWUA 3G713 4HVNA 3MKIA 1JN5A 3FCSB 4HJLB 1WMNA 3HK4A 2D42A 3EE1A 4WWUC 1IVVA 2KCDA 6STDA 1M904 3D9RA 3JUPA 5AI1A 5IF6A 3HIGA 3FG4A 1OF5A 5IG3A 4R80A 1TIJA 1IDPA 1YJW3 1JN5B 3DM8A 4EBGA 1U5OA 2WGQA 4FCZA 1WMPA 4LZIA 3X3XA 3OWYA 2STDA 1KSIA 1OF5B 1UUVB 2YFJB 5STDA 5BXQA 1GS3A 2OQEC 1VQ53 3K63A 5G2GA 2Y74A 4HZ9B 1RN7A 1A2VA 1N5HA 4EYCA 4H61A 4KFDA 4X2OA 5AIIA 1W2B2 3K7CA 3J7Yd 3TDGA 1YI23 1JRQA 4K1UA 4I4KA 1TP6A 3PYJA 4GL6A 2MF7A 3EF8A 2I9WA 4O02B 1VQ83 1W00A 4BTYA 1WNHA 1FGTA 2E2UA 4HYZA 1VZZA 3PXMA 1FUWA 1D6YA 2D1WA 4MJDA 3F8XA 1E97A 5BVBA 3UB1A 2W9QA 1OUNA 3LMLA 3I553 1NB5I 1EA2A 1LXEA 3RGAA 1IT7A 3HX8A 1NU3A 2O9UX 2GBXB 2OTJ3 1FA3A 2B24B 2BHMA 3IJEB 3PZWA 5AYSC 1KQS2 3CMA3 2L4VA 3ECFA 3UJMA 1KD14 3GZXB 5DREA 4RZMA 2CG1A 1N9JA 4OVMA 3S67A 1HKXA 3PCRA 1SJWA 3EBTA 2CFLA 3K5TA 4G1MB 2GBWB 3X40A 1IVXA 5IG4A 3FSDA 3BNDA 3KFQC 3WA3A 2HMKB 3LTBA 3LYGA 5IERA 3K9MC 2IUJA 3CCJ3 4IPBA 3DZLA 1JNQA 1U8CB 2CKFB 4HM8B 2W6JH 4J8TA 3G4S3 1HU9A 3EJVA 3HI7A 1QALA 1ROAA 2CG0A 1O7WB 4MMZB 1Z1SA 3CNXA 3V99A 3CPW2 2XGLA 1NB3I 3OWSA 2F99A 5DRVA 3B8LA 4NREA 1ULIB 3SVAA 3BNCA 1GD3A 1WQLB 1R4CA 2YFLB 1N9EA 2JQ5A 1QJGA 3MG1A 2CFDA 1E3RA 1O7HB 1CEWI 2GU1A 4LSOA 1EKMA 2O3OA 2ML5A 4LMIA 1W7CA 2Z6BA 1DVCA 2R4IA 1DMQA 1STDA 5D81A 3V98A 3MPHA 2QIYA 1LVNA 1QAFA 4KFEA 1IQYA 1QAKA 1GY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS 3;  1YJW 3;  1Q7Y 4;  1M1K 4;  1VQ4 3;  1VQ8 3;  1VQL 3;  1YIT 3;  3CME 3;  1VQ9 3;  1S72 3;  1Q81 4;  1K8A 4;  1QVF 2;  3CCU 3;  3CD6 3;  1QVG 2;  3CCR 3;  3CCQ 3;  1YJN 3;  2OTL 3;  1VQ5 3;  3CC7 3;  3I55 3;  1YIJ 3;  1VQP 3;  1VQM 3;  1VQK 3;  1JJ2 2;  3CC4 3;  3CCV 3;  3G6E 3;  3CCE 3;  3CCM 3;  2QA4 3;  3OW2 2;  3CCL 3;  3CCJ 3;  1NJI 4;  3I56 3;  3G71 3;  1VQ6 3;  1K73 4;  2OTJ 3;  1KC8 4;  1K9M 4;  1VQ7 3;  1YHQ 3;  1VQN 3;  3G4S 3;  1YJ9 3;  1KQS 2;  3CC2 3;  3CMA 3;  1M90 4;  1W2B 2;  1Q82 4;  2QEX 3;  1N8R 4;  3CPW 2;  1VQO 3;  1Q86 4;  1YI2 3;  3CXC 2;  1KD1 4; 
#chains in the Genus database with same CATH topology
 1NDO B;  1RKY A;  1Q7Y 4;  2CK3 H;  2PNC A;  8RNT A;  4JRF A;  4FCM A;  4HM4 B;  4N6N B;  4X2H A;  1S5A A;  1RGK A;  5IEN A;  1T5Y A;  1JKG A;  5I97 A;  4HM1 B;  2XR8 B;  4IIA A;  2CX1 A;  2UGI A;  2KF5 A;  3GZY B;  4STD A;  3CC7 3;  4J5K A;  4NPB A;  2BO9 B;  2Q07 A;  1RMS A;  4N6V 0;  2QA4 3;  1JKG B;  2IMJ A;  2W03 A;  3FF0 A;  3PCS A;  2CWT A;  4AKY A;  4L7K A;  1AVL A;  1TFK A;  1YVB I;  2P05 A;  3UL5 A;  3DGO A;  1IYY A;  1LOX A;  1EG9 B;  3DXO A;  1A67 A;  1Q82 4;  2HMN B;  3F40 A;  5TGN A;  4HM0 B;  1VQO 3;  1Q86 4;  2Z7A A;  4WP5 A;  7GSP A;  4FMC A;  2CX0 A;  2JDI H;  4ILF A;  5D82 A;  3M8C A;  3KCH A;  1CH0 A;  5CLK A;  4FMB A;  1LNI A;  2BMO B;  4BL3 A;  4EXR A;  1IV9 A;  1MNL A;  1US1 A;  1W6G A;  1M1X B;  2C4B A;  4J9A A;  7RNT A;  2K3D A;  1RNB A;  1UDI I;  2OOV A;  4OK0 A;  1CYV A;  5CF1 A;  3CCQ 3;  1B2U A;  1WMO A;  1ISK A;  1EQK A;  4N6O B;  3X41 A;  4O8S A;  4GB5 A;  1YIJ 3;  1VQP 3;  1VQK 3;  1TRQ A;  3AMO A;  5CK6 A;  3CCM 3;  1FGM A;  5AIF A;  2HML B;  2KXG A;  3NX0 A;  4RNZ A;  1UGH I;  2WGO A;  1VQ7 3;  1K9M 4;  4ZM8 A;  1DE3 A;  3S27 A;  1D6U A;  1F8N A;  3AMO B;  3T0U A;  4PEJ A;  5EEO A;  4ORL A;  4AEQ A;  2W2C A;  3T8N A;  2P0M A;  5CF2 A;  3LOY A;  3D5G A;  1JB5 A;  3HII A;  2RBI A;  1BGS A;  1IVW A;  2KF4 A;  2IA7 A;  3NV0 A;  1C54 A;  2GXF A;  2BT3 A;  3WDG B;  5IG5 A;  4EV2 A;  3ER7 A;  1WTH A;  2Z76 A;  4AKZ A;  2CH9 A;  3NV0 B;  1OHP A;  4KT3 B;  3VF1 A;  2GU3 A;  3B4O A;  3NHX A;  5IEO A;  1M9G A;  3BNE A;  3E99 A;  3FGY A;  3JVC A;  5KP4 A;  3CCL 3;  1JZO A;  4MMX B;  3FG3 A;  1O7N B;  1RGE A;  1BRH A;  1ZGX A;  1VQN 3;  5AIG A;  2BMQ B;  1RN1 A;  2C10 A;  1JBR A;  3U97 A;  3T8U A;  4L8O A;  1I2G A;  4EC6 A;  1LOV A;  3FKA A;  3G8Z A;  3N9H A;  3ROB A;  3FZW A;  2XF3 A;  4FCJ A;  5LC6 A;  1K41 A;  4HOH A;  5JBS A;  3CPO A;  1FGQ A;  1LRA A;  5IW9 A;  2BNG A;  3CCU 3;  1GMP A;  1IT8 A;  1BAN A;  3OX9 A;  4MMY B;  4DKI A;  3H3H A;  3Q1C A;  5EVH A;  5FGO A;  1LOW A;  3ALA A;  3N54 B;  1IV7 A;  1B2X A;  1D6Z A;  1RGL A;  2OOV C;  3EQQ B;  3KE7 A;  1I0V A;  4HM3 B;  3JUQ A;  4U13 A;  1AVK A;  2KAA A;  4R1K A;  2P0X A;  3SOY A;  1O7M B;  1BVI A;  3KSE D;  3Q2P A;  2H0I A;  2XH9 A;  1UGI A;  1OHS A;  4BTX A;  1N8R 4;  1OCV A;  1IQX A;  3EN1 B;  3MHE A;  2GEY A;  2XSH B;  4KVH A;  4HM6 B;  1GOV A;  3B7C A;  3KII A;  1X1Y A;  5IEP A;  2L1S A;  5ELU A;  2K54 A;  4HBR A;  6GSP A;  2RCD A;  5M1A A;  4QWT A;  2CC3 A;  2BMR B;  3SED A;  1SII A;  4R9L A;  1V74 A;  3F14 A;  1I2E A;  3G16 A;  4R4K A;  1W6C A;  1QMA A;  5A0O B;  1IVU A;  3QK9 A;  1FYS A;  3OW2 2;  4Q53 A;  2CWV A;  4RBN A;  3DGN A;  2A15 A;  5HGR A;  5BU4 A;  1C7H A;  4IT7 A;  1E3V A;  3D3L A;  1SQW A;  1RN4 A;  1V58 A;  1TTO A;  3KKG A;  5LC7 A;  1YGW A;  3VSY A;  1LQG C;  1YNV X;  3NM7 A;  2FXT A;  3A76 A;  1GYB A;  1MWS A;  2E2V A;  1BSC A;  5AEU B;  1BNI A;  1YIT 3;  5KP3 A;  1VQ9 3;  5JPP A;  1K8A 4;  2ZA4 A;  3IPT A;  4EV5 A;  4XM4 A;  2LQV A;  2P38 A;  3PS8 A;  1T2H A;  1BUQ A;  2WOH A;  3WOD G;  1GD4 A;  1O7P B;  2OTL 3;  1RGC A;  2SAR A;  4TX4 A;  1Y4K A;  2HMO B;  1NWW A;  3KN4 A;  4HM2 B;  4HZB B;  1NJI 4;  3AHS A;  3CU3 A;  1MGW A;  1NO3 A;  3LH4 A;  4O3V A;  1OAC A;  3MG3 A;  1RLS A;  2Y73 A;  2K0M A;  1RNT A;  4WHA A;  1L5G B;  1BRK A;  1UI7 A;  2RFR A;  1NNV A;  3BNB A;  1DYU A;  1TJD A;  1SAR A;  1BRG A;  2CWU A;  3DH2 A;  3LZA A;  3WA2 X;  1AR0 A;  2OCT A;  3U1W A;  1EUI C;  3CCS 3;  2M7O A;  4WYK A;  3F8H A;  4FR9 A;  4N6M A;  1MWU A;  3CME 3;  1S72 3;  1TFO A;  4N6T A;  3X3Y A;  3URP A;  2ZL8 A;  1QVF 2;  3CD6 3;  3LT9 A;  1JZD A;  1T3B A;  4I5Q A;  3X42 A;  2YFI B;  2HMM B;  4WYK B;  3CCR 3;  3D5I A;  2F98 A;  3WHO A;  1BSB A;  4HAA A;  6RNT A;  3IMA B;  3KSP A;  3FH1 A;  1MWT A;  1K73 4;  1BNE A;  1W6Y A;  2ZHX B;  2XEP A;  1KC8 4;  1ULJ B;  1TUH A;  3NBR A;  1FUS A;  1G96 A;  4K1V A;  7STD A;  3F7X A;  1UUW B;  4K90 B;  1I2F A;  2F5W A;  2YX9 A;  3EBY A;  3F7S A;  3OXA A;  4RNY A;  1IK3 A;  3RDE A;  1BSD A;  1N5P A;  1B2S A;  3WOF B;  1B3S A;  3JUN A;  4XB5 A;  1GY5 A;  1VQL 3;  2Z77 A;  3ZG5 A;  1FGR A;  3AGO A;  1LOY A;  1I0X A;  1IQ8 A;  5G1K A;  1AV4 A;  1DMN A;  1OGX A;  1PFP A;  3JUM A;  3NXJ A;  3EX9 A;  2CFK A;  4XBT A;  5FW5 A;  2E2T A;  2OWP A;  8CHO A;  1Q42 A;  2W56 A;  3FG1 A;  3NBB A;  1BRJ A;  5AYR B;  3STD A;  3G6E 3;  3CCV 3;  1T2I A;  3Q90 A;  4LYL B;  1A2K A;  4XDW A;  2CW9 A;  4KFF A;  3X3Z A;  3SXX A;  3OV4 A;  1ROV A;  4WFO A;  2XRX B;  4N3V A;  2B1X B;  2CFW A;  2XFS A;  3QRD A;  4N6U A;  3NQZ A;  1W02 A;  2SBL A;  2W56 B;  3V92 A;  2J8X B;  2IYJ A;  1ZO2 A;  5AIH A;  3DY5 A;  2XSO B;  1UCL A;  3BU4 A;  3NUV A;  4LEH A;  3BB9 A;  1KWI A;  1I3F A;  4R9K A;  3F9S A;  3FLJ A;  4O2H A;  2MC8 A;  1JB4 A;  3EC9 A;  3RGR A;  4NHF A;  1R4Y A;  3AHW A;  3LXU X;  1Q81 4;  4CCV A;  2WOF A;  3S28 A;  3NBJ A;  1TRP A;  1RRH A;  2KF6 A;  1BU4 A;  1MWR A;  3S5C A;  1YJN 3;  1UCI A;  2H0G A;  3LTA A;  4HM5 B;  1RRL A;  4XBY A;  3JUO A;  1FW7 A;  1GMQ A;  4RNT A;  3DMC A;  4CDL A;  5BIR A;  3CCE 3;  2INX A;  3GWR A;  4J5G A;  1DVD A;  5D83 A;  4FMD A;  3S29 A;  1RJO A;  1OPY A;  3I56 3;  1A90 A;  1STF I;  2CIU A;  4N6L A;  1IU7 A;  2F86 B;  3EB8 A;  1PU4 A;  2XGN A;  3BIR A;  1ASK A;  3GZR A;  3H51 A;  1SPU A;  3O8Y A;  5AEW B;  5G1L A;  2PZV A;  3MSO A;  5JPU A;  1M1K 4;  5EQL A;  5KP1 A;  1BSA A;  1AY7 A;  2QGU A;  1DMM A;  2CFG A;  3CNM A;  1Q7H A;  2FNQ A;  3MWZ A;  1W5Z A;  1BNJ A;  1QVG 2;  1UW1 A;  1K28 A;  1CQS A;  3GRD A;  5IG0 A;  2BU4 A;  1J2B A;  3EHC A;  1JB2 A;  1RHL A;  1SIH A;  3LTC A;  3VGN A;  4BTW A;  1FZU A;  1JBS A;  3I0Y A;  3BLZ A;  1G0T A;  3GZB A;  1G02 A;  1ZX2 A;  4FMA A;  2RSX A;  1VQ6 3;  1HYF A;  3WOE B;  3ZG0 A;  1FGO A;  1W2Z A;  2F56 A;  2W9P A;  3B4P A;  1GSP A;  3DGM A;  1YHQ 3;  1YJ9 3;  3LT8 A;  1YGE A;  1AQZ A;  1UI8 A;  2CHC A;  2P09 A;  3HZP A;  4L8P A;  4OUQ A;  4KZ1 A;  1OHO A;  1GY6 A;  3SLU A;  3NM2 A;  1OH0 A;  3N8B A;  3PGB A;  4H3U A;  5ELJ A;  2OQE A;  3LTD A;  1TU5 A;  3SYU A;  2W04 A;  2ZDJ A;  3UNL A;  3WMD A;  4BU4 A;  1O7G B;  1X1W A;  1PY3 A;  1BRS A;  3G0K A;  1I8V A;  2HMJ B;  4LGQ A;  3UL6 A;  4JF8 A;  1VQM 3;  3GSP A;  3CC4 3;  3L0R A;  2IUK A;  1OGZ A;  3DGL A;  1A2P A;  2UX0 A;  2RGQ A;  3K0Z A;  2FGT A;  1W4N A;  2LYX A;  1JV2 B;  2C11 A;  2XFT A;  3EN8 A;  3D79 A;  3CC2 3;  4HKV B;  2QEX 3;  5HOH A;  2V1L A;  1CYU A;  3MYT A;  5CXO A;  3CXC 2;  3SX1 A;  1VQ4 3;  2H0H A;  1RGG A;  2W0Q A;  1Q40 A;  4XDV A;  2KRT A;  1UUG B;  1MOL A;  2ML6 A;  3FF2 A;  2WO0 A;  2GSP A;  3GAX A;  4HM7 B;  3DUK A;  1BNG A;  1LNH A;  3WR2 A;  1W01 A;  1BNS A;  1V57 A;  3MG2 A;  3KZT A;  1JJ2 2;  1JBT A;  3SOA A;  1Q40 B;  1N8Q A;  4K61 A;  4XBX A;  1BAO A;  2GEX A;  4MEI A;  3NQY A;  3OWU A;  3G71 3;  4HVN A;  1RCL A;  3MKI A;  1JN5 A;  3FCS B;  4HJL B;  4EW5 A;  1WMN A;  3HK4 A;  2D42 A;  3EE1 A;  2KF3 A;  4WWU C;  1IVV A;  2KCD A;  6STD A;  1M90 4;  3D9R A;  3JUP A;  5AI1 A;  5IF6 A;  3HIG A;  3FG4 A;  1OF5 A;  5IG3 A;  4R80 A;  1TIJ A;  1IDP A;  5M18 A;  1YJW 3;  1RDS A;  1JN5 B;  3DM8 A;  4GSP A;  4EBG A;  1U5O A;  2WGQ A;  4FCZ A;  1WMP A;  4LZI A;  1RGH A;  3X3X A;  3ZFZ A;  3A5E A;  3OWY A;  2STD A;  1KSI A;  1OF5 B;  1UUV B;  2YFJ B;  5STD A;  4BIR A;  5BXQ A;  1BSE A;  1GS3 A;  2OQE C;  1VQ5 3;  3K63 A;  5G2G A;  1MGR A;  2Y74 A;  1VQQ A;  3RNT A;  1B20 A;  4HZ9 B;  1RN7 A;  1DET A;  3Q3F A;  1A2V A;  1N5H A;  4EYC A;  1BNF A;  1B21 A;  4H61 A;  4KFD A;  4X2O A;  5AII A;  1BIR A;  1W2B 2;  3K7C A;  3J7Y d;  1FUT A;  3TDG A;  1YI2 3;  1JRQ A;  4K1U A;  4I4K A;  1TP6 A;  1Q9E A;  3PYJ A;  4GL6 A;  2MF7 A;  3EF8 A;  2I9W A;  4O02 B;  1VQ8 3;  1W00 A;  1RTU A;  4BTY A;  1WNH A;  9RNT A;  1FGT A;  2E2U A;  4HYZ A;  1UCK A;  1VZZ A;  3PXM A;  1FUW A;  1D6Y A;  2D1W A;  4MJD A;  3F8X A;  1E97 A;  5BVB A;  3UB1 A;  1HZ1 A;  1OUN A;  2W9Q A;  3LML A;  3I55 3;  1NB5 I;  5M19 A;  1GOY A;  1EA2 A;  1LXE A;  1RGA A;  3RGA A;  1IT7 A;  3HX8 A;  1RCK A;  1NU3 A;  2O9U X;  2GBX B;  2OTJ 3;  1FA3 A;  1PYL A;  2B24 B;  2BHM A;  3HOH A;  3IJE B;  3PZW A;  5AYS C;  1KQS 2;  3CMA 3;  2L4V A;  1B27 A;  1BOX A;  4CJN A;  3ECF A;  3UJM A;  2F4Y A;  2AAE A;  1GOU A;  1KD1 4;  3GZX B;  5DRE A;  4RZM A;  2CG1 A;  1N9J A;  4OVM A;  1EEJ A;  3S67 A;  5RNT A;  1HKX A;  5GSP A;  3PCR A;  1SJW A;  3EBT A;  2CFL A;  1GMR A;  3D4A A;  1B2Z A;  1X1X A;  3K5T A;  2GBW B;  4G1M B;  3X40 A;  1B2M A;  1IVX A;  1BNR A;  5IG4 A;  1YVS A;  2HOH A;  3BND A;  3FSD A;  3KFQ C;  3WA3 A;  2R41 A;  2HMK B;  3LTB A;  3LYG A;  5IER A;  3K9M C;  4CPK A;  1LQM B;  2IUJ A;  3CCJ 3;  4IPB A;  3DZL A;  1JNQ A;  1U8C B;  2CKF B;  4HM8 B;  2W6J H;  2RNT A;  3DGY A;  4J8T A;  3G4S 3;  1HU9 A;  1BRN L;  3EJV A;  3HI7 A;  1QAL A;  1ROA A;  2CG0 A;  1O7W B;  4MMZ B;  1Z1S A;  3CNX A;  3V99 A;  4GHO A;  3CPW 2;  2XGL A;  1NB3 I;  2UUG C;  3OWS A;  2F99 A;  5DRV A;  3B8L A;  4NRE A;  1ULI B;  1X1U A;  3SVA A;  1BRI A;  3BNC A;  1WQL B;  1GD3 A;  1R4C A;  1N9E A;  2YFL B;  1UCJ A;  2JQ5 A;  1QJG A;  3MG1 A;  2CFD A;  1E3R A;  2IY2 A;  1RSN A;  1I70 A;  1O7H B;  1BUJ A;  1CEW I;  2GU1 A;  2BIR A;  1I3I A;  4LSO A;  1EKM A;  2F5M A;  1RGF A;  2O3O A;  2ML5 A;  4LMI A;  1W7C A;  2AAD A;  1ZS7 A;  2Z6B A;  1DVC A;  2R4I A;  3AGN A;  1DMQ A;  1STD A;  5D81 A;  3V98 A;  3MPH A;  2QIY A;  1LVN A;  1QAF A;  4KFE A;  1IQY A;  4BL2 A;  1QAK A;  1GY7 A; 
#chains in the Genus database with same CATH homology
 1NDO B;  1RKY A;  1Q7Y 4;  2CK3 H;  2PNC A;  4JRF A;  4FCM A;  4HM4 B;  4N6N B;  4X2H A;  1S5A A;  5IEN A;  1T5Y A;  1JKG A;  5I97 A;  4HM1 B;  2XR8 B;  4IIA A;  3GZY B;  4STD A;  3CC7 3;  2BO9 B;  2Q07 A;  2QA4 3;  4N6V 0;  1JKG B;  2IMJ A;  2W03 A;  3FF0 A;  3PCS A;  2CWT A;  4AKY A;  4L7K A;  1AVL A;  1TFK A;  1YVB I;  2P05 A;  3UL5 A;  3DGO A;  1LOX A;  1EG9 B;  3DXO A;  1A67 A;  1Q82 4;  2HMN B;  3F40 A;  5TGN A;  4HM0 B;  1VQO 3;  1Q86 4;  2Z7A A;  4WP5 A;  4FMC A;  5D82 A;  2JDI H;  3M8C A;  5CLK A;  4FMB A;  2BMO B;  4EXR A;  1IV9 A;  1MNL A;  1US1 A;  1W6G A;  1M1X B;  4J9A A;  2OOV A;  4OK0 A;  1CYV A;  5CF1 A;  3CCQ 3;  1WMO A;  1ISK A;  1EQK A;  4N6O B;  3X41 A;  4O8S A;  4GB5 A;  1YIJ 3;  1VQP 3;  1VQK 3;  3AMO A;  5CK6 A;  3CCM 3;  1FGM A;  5AIF A;  2HML B;  2KXG A;  3NX0 A;  4RNZ A;  2WGO A;  1K9M 4;  1VQ7 3;  4ZM8 A;  3S27 A;  3AMO B;  1D6U A;  1F8N A;  3T0U A;  4PEJ A;  5EEO A;  4ORL A;  4AEQ A;  2W2C A;  3T8N A;  2P0M A;  5CF2 A;  3LOY A;  1JB5 A;  3HII A;  3NV0 A;  1IVW A;  2IA7 A;  2GXF A;  2BT3 A;  3WDG B;  5IG5 A;  4EV2 A;  3ER7 A;  1WTH A;  2Z76 A;  4AKZ A;  2CH9 A;  3NV0 B;  1OHP A;  3VF1 A;  2GU3 A;  3B4O A;  3NHX A;  5IEO A;  1M9G A;  3BNE A;  3E99 A;  3FGY A;  3JVC A;  5KP4 A;  3CCL 3;  4MMX B;  3FG3 A;  1O7N B;  1VQN 3;  5AIG A;  2BMQ B;  2C10 A;  3U97 A;  3T8U A;  4L8O A;  4EC6 A;  3ROB A;  3FKA A;  3G8Z A;  3N9H A;  3FZW A;  2XF3 A;  4FCJ A;  5LC6 A;  1K41 A;  5JBS A;  3CPO A;  1FGQ A;  5IW9 A;  2BNG A;  3CCU 3;  1IT8 A;  3OX9 A;  4MMY B;  3H3H A;  3Q1C A;  5EVH A;  5FGO A;  3ALA A;  3N54 B;  1IV7 A;  1D6Z A;  2OOV C;  3EQQ B;  3KE7 A;  4HM3 B;  4U13 A;  3JUQ A;  1AVK A;  4R1K A;  2P0X A;  3SOY A;  1O7M B;  3KSE D;  3Q2P A;  2XH9 A;  1OHS A;  4BTX A;  1N8R 4;  1OCV A;  1IQX A;  3EN1 B;  3MHE A;  2GEY A;  2XSH B;  4KVH A;  4HM6 B;  3B7C A;  3KII A;  5IEP A;  5ELU A;  2K54 A;  4HBR A;  2RCD A;  4QWT A;  2CC3 A;  2BMR B;  3SED A;  1SII A;  4R9L A;  1V74 A;  3F14 A;  3G16 A;  4R4K A;  1W6C A;  1QMA A;  5A0O B;  1IVU A;  3QK9 A;  3OW2 2;  4Q53 A;  2CWV A;  4RBN A;  3DGN A;  2A15 A;  5HGR A;  1C7H A;  4IT7 A;  1E3V A;  3D3L A;  1SQW A;  3KKG A;  5LC7 A;  3VSY A;  3NM7 A;  2FXT A;  3A76 A;  1GYB A;  2E2V A;  5AEU B;  1YIT 3;  5KP3 A;  1VQ9 3;  5JPP A;  1K8A 4;  3IPT A;  4EV5 A;  4XM4 A;  2LQV A;  2P38 A;  3PS8 A;  1BUQ A;  2WOH A;  3WOD G;  1GD4 A;  1O7P B;  2OTL 3;  4TX4 A;  1Y4K A;  2HMO B;  1NWW A;  3KN4 A;  4HM2 B;  4HZB B;  1NJI 4;  3CU3 A;  1NO3 A;  3LH4 A;  4O3V A;  1OAC A;  3MG3 A;  1L5G B;  2Y73 A;  2K0M A;  4WHA A;  1UI7 A;  2RFR A;  1J2B A;  3BNB A;  1DYU A;  2CWU A;  3LZA A;  3WA2 X;  1AR0 A;  2OCT A;  3U1W A;  3CCS 3;  2M7O A;  4WYK A;  3F8H A;  4FR9 A;  4N6M A;  3CME 3;  1S72 3;  1TFO A;  4N6T A;  3X3Y A;  2ZL8 A;  1QVF 2;  3CD6 3;  3LT9 A;  3X42 A;  2YFI B;  2HMM B;  4WYK B;  3CCR 3;  2F98 A;  3IMA B;  3KSP A;  3FH1 A;  1K73 4;  1W6Y A;  1KC8 4;  2XEP A;  1ULJ B;  1TUH A;  3NBR A;  1G96 A;  4K1V A;  7STD A;  3F7X A;  1UUW B;  4K90 B;  4RNY A;  1IK3 A;  2YX9 A;  3EBY A;  3F7S A;  3OXA A;  3RDE A;  1N5P A;  3WOF B;  3JUN A;  4XB5 A;  1GY5 A;  1VQL 3;  2Z77 A;  1FGR A;  1IQ8 A;  1AV4 A;  1DMN A;  1OGX A;  1PFP A;  3JUM A;  3NXJ A;  3EX9 A;  2CFK A;  4XBT A;  5FW5 A;  2E2T A;  2OWP A;  8CHO A;  1Q42 A;  2W56 A;  3FG1 A;  3NBB A;  5AYR B;  3STD A;  3G6E 3;  3CCV 3;  3Q90 A;  4XDW A;  1A2K A;  3X3Z A;  2CW9 A;  4KFF A;  3SXX A;  3OV4 A;  1ROV A;  4WFO A;  2XRX B;  4N3V A;  2B1X B;  2CFW A;  2XFS A;  3QRD A;  4N6U A;  3NQZ A;  1W02 A;  2SBL A;  2W56 B;  3V92 A;  5AIH A;  1ZO2 A;  3DY5 A;  2XSO B;  3NUV A;  4LEH A;  3BB9 A;  1KWI A;  4R9K A;  3F9S A;  3FLJ A;  4O2H A;  2MC8 A;  1JB4 A;  3EC9 A;  3RGR A;  4NHF A;  3LXU X;  1Q81 4;  4CCV A;  2WOF A;  3S28 A;  3NBJ A;  1RRH A;  3S5C A;  1YJN 3;  3LTA A;  4HM5 B;  1RRL A;  4XBY A;  3JUO A;  4CDL A;  3DMC A;  3CCE 3;  2INX A;  3GWR A;  1DVD A;  5D83 A;  4FMD A;  3S29 A;  1RJO A;  1OPY A;  3I56 3;  1A90 A;  1STF I;  2CIU A;  4N6L A;  1IU7 A;  2F86 B;  3EB8 A;  1PU4 A;  2XGN A;  3GZR A;  1ASK A;  3H51 A;  3O8Y A;  1SPU A;  5AEW B;  2PZV A;  3MSO A;  5JPU A;  1M1K 4;  5EQL A;  5KP1 A;  2QGU A;  1DMM A;  2CFG A;  3CNM A;  2FNQ A;  3MWZ A;  1W5Z A;  1QVG 2;  1UW1 A;  1K28 A;  1CQS A;  3GRD A;  5IG0 A;  3EHC A;  1JB2 A;  1SIH A;  3LTC A;  3VGN A;  4BTW A;  3I0Y A;  3BLZ A;  3GZB A;  1ZX2 A;  4FMA A;  2RSX A;  1VQ6 3;  3WOE B;  1FGO A;  1W2Z A;  2W9P A;  3B4P A;  3DGM A;  1YHQ 3;  1YJ9 3;  3LT8 A;  1YGE A;  2CHC A;  1UI8 A;  2P09 A;  3HZP A;  4L8P A;  4OUQ A;  4KZ1 A;  1OHO A;  1GY6 A;  3SLU A;  3NM2 A;  1OH0 A;  3N8B A;  3PGB A;  4H3U A;  5ELJ A;  2OQE A;  3LTD A;  1TU5 A;  2W04 A;  2ZDJ A;  3UNL A;  3WMD A;  1O7G B;  3G0K A;  2HMJ B;  4LGQ A;  3UL6 A;  4JF8 A;  1VQM 3;  3CC4 3;  3L0R A;  2IUK A;  1OGZ A;  3DGL A;  2UX0 A;  2RGQ A;  3K0Z A;  2FGT A;  1W4N A;  2LYX A;  1JV2 B;  2C11 A;  2XFT A;  3EN8 A;  3CC2 3;  4HKV B;  2QEX 3;  2V1L A;  1CYU A;  3MYT A;  5CXO A;  3CXC 2;  3SX1 A;  1VQ4 3;  2W0Q A;  1Q40 A;  4XDV A;  2KRT A;  1MOL A;  2ML6 A;  3FF2 A;  2WO0 A;  3GAX A;  4HM7 B;  3DUK A;  1LNH A;  1W01 A;  3MG2 A;  1JJ2 2;  3KZT A;  3SOA A;  1Q40 B;  1N8Q A;  4K61 A;  4XBX A;  2GEX A;  4MEI A;  3NQY A;  3OWU A;  3G71 3;  4HVN A;  3MKI A;  1JN5 A;  3FCS B;  4HJL B;  1WMN A;  3HK4 A;  2D42 A;  3EE1 A;  4WWU C;  1IVV A;  2KCD A;  6STD A;  1M90 4;  3D9R A;  3JUP A;  5AI1 A;  5IF6 A;  3HIG A;  3FG4 A;  1OF5 A;  5IG3 A;  4R80 A;  1TIJ A;  1IDP A;  1YJW 3;  1JN5 B;  3DM8 A;  4EBG A;  1U5O A;  2WGQ A;  4FCZ A;  1WMP A;  4LZI A;  3X3X A;  3OWY A;  2STD A;  1KSI A;  1OF5 B;  1UUV B;  2YFJ B;  5STD A;  5BXQ A;  1GS3 A;  2OQE C;  1VQ5 3;  3K63 A;  5G2G A;  2Y74 A;  4HZ9 B;  1RN7 A;  1A2V A;  1N5H A;  4EYC A;  4H61 A;  4KFD A;  4X2O A;  5AII A;  1W2B 2;  3K7C A;  3J7Y d;  3TDG A;  1YI2 3;  1JRQ A;  4K1U A;  4I4K A;  1TP6 A;  3PYJ A;  4GL6 A;  2MF7 A;  3EF8 A;  2I9W A;  4O02 B;  1VQ8 3;  1W00 A;  4BTY A;  1WNH A;  1FGT A;  2E2U A;  4HYZ A;  1VZZ A;  3PXM A;  1FUW A;  1D6Y A;  2D1W A;  4MJD A;  3F8X A;  1E97 A;  5BVB A;  3UB1 A;  2W9Q A;  1OUN A;  3LML A;  3I55 3;  1NB5 I;  1EA2 A;  1LXE A;  3RGA A;  1IT7 A;  3HX8 A;  1NU3 A;  2O9U X;  2GBX B;  2OTJ 3;  1FA3 A;  2B24 B;  2BHM A;  3IJE B;  3PZW A;  5AYS C;  1KQS 2;  3CMA 3;  2L4V A;  3ECF A;  3UJM A;  1KD1 4;  3GZX B;  5DRE A;  4RZM A;  2CG1 A;  1N9J A;  4OVM A;  3S67 A;  1HKX A;  3PCR A;  1SJW A;  3EBT A;  2CFL A;  3K5T A;  4G1M B;  2GBW B;  3X40 A;  1IVX A;  5IG4 A;  3FSD A;  3BND A;  3KFQ C;  3WA3 A;  2HMK B;  3LTB A;  3LYG A;  5IER A;  3K9M C;  2IUJ A;  3CCJ 3;  4IPB A;  3DZL A;  1JNQ A;  1U8C B;  2CKF B;  4HM8 B;  2W6J H;  4J8T A;  3G4S 3;  1HU9 A;  3EJV A;  3HI7 A;  1QAL A;  1ROA A;  2CG0 A;  1O7W B;  4MMZ B;  1Z1S A;  3CNX A;  3V99 A;  3CPW 2;  2XGL A;  1NB3 I;  3OWS A;  2F99 A;  5DRV A;  3B8L A;  4NRE A;  1ULI B;  3SVA A;  3BNC A;  1GD3 A;  1WQL B;  1R4C A;  2YFL B;  1N9E A;  2JQ5 A;  1QJG A;  3MG1 A;  2CFD A;  1E3R A;  1O7H B;  1CEW I;  2GU1 A;  4LSO A;  1EKM A;  2O3O A;  2ML5 A;  4LMI A;  1W7C A;  2Z6B A;  1DVC A;  2R4I A;  1DMQ A;  1STD A;  5D81 A;  3V98 A;  3MPH A;  2QIY A;  1LVN A;  1QAF A;  4KFE A;  1IQY A;  1QAK A;  1GY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...