1VQO3

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vqo300
1YI23 2OTL3 2QEX3 1W2B2 1JJ22 3CCE3 3CCS3 3G4S3 1VQ93 1K8A4 1QVF2 3CCR3 1Q7Y4 3CC23 1YJW3 1K734 1Q864 3I563 1YHQ3 1VQL3 3CPW2 3CCU3 1VQ43 1Q824 1YJ93 3G6E3 3CD63 3G713 1YIJ3 1QVG2 1KC84 1M904 2OTJ3 3CCQ3 1VQ73 3CC43 3I553 3OW22 3CCM3 3CCL3 1VQK3 1Q814 2QA43 3CCJ3 3CXC2 3CME3 1M1K4 1VQ53 1NJI4 1YJN3 1VQO3 1VQM3 1N8R4 1VQ63 3CMA3 3CC73 1VQN3 3CCV3 1VQP3 1S723 1YIT3 1KD14 1K9M4 1KQS2 1VQ83
chains in the Genus database with same CATH superfamily
1FGTA 2CX0A 1A2PA 2XH9A 4L7KA 3NBRA 3D79A 3G8ZA 3CCS3 3MG1A 4RBNA 1K8A4 1PYLA 1RNBA 2C11A 4HM3B 1SPUA 3DXOA 3H51A 3RGRA 1UI8A 3CCU3 2MC8A 3G6E3 3MYTA 1TFKA 2CIUA 1B2SA 3CPOA 1RDSA 5KP1A 1PU4A 1OH0A 3D4AA 2E2VA 2XSHB 3E99A 1RMSA 2XGLA 1TRQA 1M9GA 3X3YA 3X41A 5RNTA 1W5ZA 2GEXA 1WMOA 3NV0B 3VSYA 4EXRA 4G1MB 4PEJA 1I8VA 3F7SA 3ZG5A 1VQ83 1GOVA 1W2ZA 1CYVA 1LVNA 1IT7A 3LOYA 2CH9A 1GY6A 4AKZA 1FGMA 1SARA 2CX1A 4KFFA 1QVF2 2UX0A 1UCKA 3CC23 3BNBA 4EBGA 1ZGXA 1VQL3 3SOAA 3VGNA 1JB2A 4LZIA 2Z6BA 1Q42A 1OUNA 1UI7A 2XFTA 1IYYA 3PZWA 3EE1A 1GMQA 3HIGA 2A15A 1E3RA 1LOYA 3EC9A 4O2HA 2E2UA 3CXC2 2B24B 1UGHI 3RGAA 1N8R4 1B2MA 1S5AA 1O7NB 3KN4A 1QJGA 1U8CB 1OF5B 1RN4A 1I2EA 3SOYA 6STDA 5CXOA 1TU5A 4KZ1A 1B2ZA 5AI1A 1GY5A 1CEWI 1SIHA 4U13A 4RNTA 5AYSC 2YFIB 2HMJB 4GL6A 4BTYA 3KIIA 3LYGA 1RGAA 5EQLA 1T2HA 1IVXA 5G1KA 1KC84 3WODG 4BL3A 3GZBA 4N6MA 5AEWB 1N9EA 3FKAA 1IK3A 2C10A 1I3FA 4HBRA 3UL5A 2KAAA 5DRVA 4LGQA 4MMXB 3AGNA 1LOXA 1E3VA 1W01A 4OVMA 5CF1A 1C7HA 3T0UA 1GS3A 2F86B 4L8PA 3WA2X 1BSAA 3F9SA 4ZM8A 4FMCA 3DM8A 3EN1B 2XFSA 1IV9A 1AV4A 1V74A 4K90B 1SIIA 1BSBA 2Z7AA 3FZWA 1B2UA 4HJLB 4CDLA 3QK9A 3BU4A 3DGYA 4KT3B 3Q3FA 3X3XA 1A2KA 2YX9A 1YJ93 3DZLA 3S67A 2KF4A 1IVUA 1QAKA 2FXTA 3AMOA 3BLZA 3OXAA 3OWUA 1G0TA 3LT9A 1A90A 2K54A 2OWPA 3D3LA 2GSPA 1I0XA 1LOVA 1GD3A 1BRIA 4K1UA 1L5GB 4JF8A 4XDVA 3CC73 5GSPA 1JZDA 2W6JH 1VQK3 5AIHA 1US1A 1WNHA 3S27A 2OOVC 3NQZA 4MEIA 3UL6A 3HI7A 5IEPA 2XRXB 3B4OA 5IF6A 3NUVA 4N6UA 3D5GA 1TJDA 2LQVA 3V98A 2ZHXB 1YGWA 4MJDA 4RZMA 3CPW2 1JZOA 2V1LA 3MPHA 2ML5A 3GZRA 1T3BA 5EEOA 3BNCA 3UJMA 3FF2A 4GSPA 3X3ZA 2FGTA 1DMQA 1N8QA 2CK3H 1STFI 2P0MA 2QGUA 1GOUA 4N6OB 3K9MC 3LTAA 1DYUA 3RNTA 1SQWA 3EBTA 1GOYA 1STDA 1VQQA 2GBWB 1LOWA 3CCV3 2CG0A 1W6YA 1CH0A 1BNJA 1Z1SA 2JDIH 3FGYA 3LMLA 2IUJA 4R1KA 3PCRA 5HGRA 8CHOA 1LRAA 2AAEA 2GEYA 2RSXA 1TRPA 5D81A 3IJEB 1IQXA 3WOFB 3F14A 3FCSB 1UW1A 1I2FA 4HM2B 2UGIA 2IMJA 1FUTA 2HMKB 1RGKA 4LYLB 5D82A 3LTBA 4EV5A 3WR2A 4OK0A 2GU3A 5M1AA 3F8XA 2D1WA 1IQ8A 3T8UA 3CC43 1W02A 3FG3A 5JBSA 1AQZA 3B4PA 2R4IA 4EV2A 1JN5B 1RTUA 4XB5A 2SBLA 1YJN3 1ISKA 3K63A 4N3VA 3DGNA 1KWIA 3EBYA 3BNDA 4N6TA 4FMAA 1JB4A 2W9PA 1T5YA 3NXJA 1RGCA 4O3VA 1W2B2 1BRJA 1Q9EA 3BIRA 3Q90A 2OQEA 8RNTA 3IPTA 3NM7A 4KFDA 1Q7Y4 1K734 2W56B 3BB9A 1GY7A 1ZX2A 1JN5A 1AVKA 1O7HB 1VQ43 1BUJA 1FYSA 1TUHA 3O8YA 2KRTA 4J9AA 3SXXA 4HM4B 2CW9A 1MWTA 2Q07A 3NV0A 3JUPA 4FR9A 1DVDA 1I2GA 1TIJA 4MMZB 2ZL8A 2CWUA 1NB5I 2P0XA 3DY5A 3SX1A 3B8LA 1OHPA 2Y74A 1E97A 4O8SA 3URPA 1IT8A 1BNEA 2F99A 1VQM3 2W56A 3WA3A 3GZYB 3S5CA 1A2VA 2RGQA 2OQEC 1O7GB 3AHSA 1EKMA 4N6V0 1BRSA 1U5OA 3T8NA 2INXA 4XDWA 5BXQA 3PYJA 3EJVA 1GSPA 3MWZA 3X40A 2JQ5A 5AEUB 5CK6A 4GB5A 2L1SA 3PCSA 5FW5A 4RNYA 1B2XA 2K3DA 1VQ73 2F4YA 1DMMA 3PGBA 5IG4A 1OF5A 1W6GA 2AADA 1RSNA 1AY7A 4WYKB 1OGZA 4I4KA 3CCJ3 1OACA 3B7CA 3EX9A 4BTWA 4LSOA 1FGOA 2STDA 5CLKA 2WGOA 3A5EA 2GXFA 3CNMA 5IG0A 1JBSA 1X1YA 3EQQB 1BANA 4AEQA 2XF3A 5IG3A 4XBTA 5IW9A 1JJ22 3KKGA 3CCE3 4HM8B 1EA2A 2W04A 1JNQA 1BRKA 5AIFA 5ELUA 3GRDA 4HZ9B 3CU3A 2OOVA 5CF2A 3WMDA 1JRQA 1FGQA 4XBXA 3OWSA 1MWRA 1WQLB 1EUIC 1NB3I 2IA7A 1O7PB 3OV4A 1NNVA 4IIAA 4HKVB 3ER7A 2F98A 1I70A 1PFPA 1UGIA 1ZO2A 1LQMB 1NDOB 3DH2A 4R9LA 1K41A 4MMYB 4WWUC 4J8TA 4BIRA 1B20A 3S29A 1D6UA 5I97A 1VQ53 1BGSA 1UUGB 2CHCA 4GHOA 4BU4A 1VQO3 3VF1A 3A76A 1EQKA 2W0QA 3HZPA 4EC6A 1OPYA 1RHLA 2UUGC 3H3HA 2H0GA 3K7CA 3UNLA 3JUMA 3NBJA 2IYJA 1R4CA 1BU4A 4WHAA 4NHFA 3KFQC 5AIGA 5BVBA 1CYUA 4WP5A 3CD63 3D5IA 1WMNA 2GBXB 3DGMA 3GSPA 2WOHA 2KF6A 1QVG2 2CFDA 5ELJA 5IENA 2CKFB 1TP6A 1IDPA 1BRGA 3ALAA 3F7XA 1C54A 2OCTA 3OW22 4JRFA 2CWVA 1UCJA 4CPKA 2MF7A 5G2GA 1G96A 4AKYA 3GZXB 3G0KA 3LXUX 3J7Yd 1VQ63 3JUOA 4Q53A 1B21A 5A0OB 3DMCA 3KCHA 5AIIA 1VQN3 3S28A 1S723 4DKIA 1YIT3 3FG4A 3G16A 4KFEA 4X2HA 1BSCA 2R41A 4HM7B 1JBRA 3FH1A 1AR0A 1V58A 4ORLA 3X42A 4O02B 2GU1A 1DETA 2CFKA 2CG1A 3G4S3 2P09A 4NPBA 1X1UA 1VQ93 1YJW3 3ZG0A 1MGRA 1V57A 4FMDA 3WDGB 4N6LA 4HZBB 1ZS7A 1RRLA 4HOHA 4R80A 1EEJA 3N54B 3CCQ3 2WOFA 1OCVA 1MWSA 1RJOA 2KF5A 1GYBA 1UUVB 3EB8A 3OX9A 1RGGA 4H3UA 4N6NB 3LZAA 3DGLA 3KSED 3ROBA 2ML6A 1JBTA 1CQSA 1IV7A 1D6ZA 2CC3A 1NJI4 4HM1B 2HMOB 5LC7A 1UUWB 1Q7HA 1RGHA 2C4BA 4BL2A 1VQP3 3GAXA 2HMMB 4TX4A 4HVNA 2OTL3 4FCZA 1AVLA 4XBYA 1M1XB 2Z76A 1RN7A 4X2OA 3N8BA 5M18A 3AHWA 3LTCA 1IU7A 1IVVA 1FGRA 1WTHA 3BNEA 2D42A 4R4KA 3JUNA 1GMRA 2LYXA 3MHEA 5IG5A 4QWTA 1ULJB 1Q864 2L4VA 1OGXA 3LTDA 3FSDA 1PY3A 2CFLA 3G713 1YIJ3 1W00A 2B1XB 1O7MB 1QAFA 1RRHA 4XM4A 1RKYA 2BMOB 1G02A 3MG2A 5BIRA 2ZDJA 3PS8A 3I553 2O9UX 3NM2A 4I5QA 1EG9B 3UB1A 4EW5A 1RLSA 1SJWA 1M1K4 2YFJB 1NU3A 2J8XB 3NHXA 1X1WA 5KP3A 3OWYA 4STDA 2BU4A 3WHOA 1TTOA 3CMA3 2IUKA 5TGNA 3I0YA 1I3IA 3V99A 1JB5A 2O3OA 3K5TA 5JPPA 1MWUA 1KD14 1K9M4 5IEOA 2QEX3 3EF8A 2HMNB 1BNSA 2RNTA 2W03A 3NX0A 4IPBA 1IQYA 2KF3A 2WO0A 1MOLA 5KP4A 4CCVA 6RNTA 1JKGB 4HYZA 2BO9B 3V92A 3ZFZA 1BRNL 3K0ZA 2M7OA 2P38A 1R4YA 1YVBI 2BHMA 1FUSA 3TDGA 1BOXA 1DE3A 1FZUA 4FCMA 4J5GA 1GD4A 4LEHA 1W7CA 7STDA 1FW7A 2RFRA 3CCL3 2BIRA 1VZZA 1UDII 1RGLA 1UCLA 2Z77A 3CME3 3HX8A 3JUQA 3FG1A 5EVHA 1MNLA 3PXMA 3LH4A 2K0MA 4H61A 1JKGA 3MSOA 4LMIA 1WMPA 2BMRB 2HOHA 2KCDA 1BNGA 3SYUA 1DVCA 2PZVA 1BNRA 3SVAA 1YI23 2WGQA 1YGEA 1N5HA 4IT7A 1FA3A 1LNHA 1HKXA 3HIIA 3U97A 4WYKA 1D6YA 2CWTA 1OHSA 5AYRB 1NWWA 4FCJA 5BU4A 2W2CA 4K1VA 4L8OA 1M904 2Y73A 1Q814 1B3SA 1ASKA 2RBIA 1ROAA 3AGOA 3IMAB 4BTXA 5D83A 6GSPA 1KSIA 1NO3A 3CCM3 3HOHA 4J5KA 3STDA 4WFOA 1RCKA 1LXEA 2F5MA 2IY2A 3U1WA 4FMBA 1YVSA 2FNQA 1RN1A 2YFLB 3EN8A 2CFGA 3SEDA 2ZA4A 1UCIA 3AMOB 3NQYA 1BIRA 1W6CA 2BNGA 1FUWA 3FF0A 1N9JA 1RGFA 1T2IA 1X1XA 2QIYA 1ROVA 5STDA 2F5WA 1BAOA 2SARA 3QRDA 7GSPA 2H0HA 3CCR3 1ULIB 1DMNA 2RCDA 3I563 1LNIA 5DREA 5M19A 1Q824 3WOEB 3LT8A 1Y4KA 2PNCA 1GMPA 7RNTA 3MKIA 4CJNA 2OTJ3 3L0RA 1BUQA 1QMAA 1RGEA 3D9RA 5IERA 3KE7A 1BVIA 1F8NA 1JV2B 2H0IA 4R9KA 1BNIA 2QA43 4HM5B 3KSPA 4OUQA 3ECFA 5G1LA 1W4NA 3F40A 3MG3A 4HM0B 3Q2PA 3NBBA 5HOHA 1RNTA 2XEPA 3HK4A 1HU9A 1Q40B 2F56A 4K61A 1IVWA 3Q1CA 2P05A 4KVHA 2I9WA 1QALA 3N9HA 1N5PA 1OHOA 3DUKA 4EYCA 2E2TA 5JPUA 3F8HA 1BRHA 1MGWA 1K28A 3CNXA 4NREA 3RDEA 1YHQ3 1J2BA 2HMLB 3JVCA 2XGNA 3DGOA 1I0VA 1YNVX 4HM6B 1BSDA 3EHCA 4ILFA 3KZTA 1HZ1A 1Q40A 4RNZA 1BSEA 2W9QA 2XR8B 1A67A 5LC6A 1B27A 1TFOA 2CFWA 1RCLA 2BT3A 1LQGC 5FGOA 3GWRA 2BMQB 4HAAA 2XSOB 3M8CA 9RNTA 1BNFA 2KXGA 1O7WB 3FLJA 1KQS2 1HYFA 3SLUA
chains in the Genus database with same CATH topology
1FGTA 2XH9A 4L7KA 3NBRA 3G8ZA 3CCS3 3MG1A 4RBNA 1K8A4 2C11A 4HM3B 1SPUA 3DXOA 3H51A 3RGRA 1UI8A 3CCU3 2MC8A 3G6E3 3MYTA 1TFKA 2CIUA 3CPOA 5KP1A 1PU4A 1OH0A 2E2VA 2XSHB 3E99A 2XGLA 3X41A 1M9GA 3X3YA 1W5ZA 2GEXA 1WMOA 3NV0B 3VSYA 4EXRA 4G1MB 4PEJA 3F7SA 1VQ83 1W2ZA 1CYVA 1LVNA 1IT7A 3LOYA 2CH9A 1GY6A 4AKZA 1FGMA 4KFFA 1QVF2 2UX0A 3CC23 3BNBA 4EBGA 1VQL3 3SOAA 3VGNA 1JB2A 4LZIA 2Z6BA 1Q42A 1OUNA 1UI7A 2XFTA 3PZWA 3EE1A 3HIGA 2A15A 1E3RA 3EC9A 4O2HA 2E2UA 3CXC2 2B24B 3RGAA 1N8R4 1S5AA 1O7NB 3KN4A 1QJGA 1U8CB 1OF5B 3SOYA 6STDA 5CXOA 1TU5A 4KZ1A 5AI1A 1GY5A 1CEWI 1SIHA 4U13A 5AYSC 2YFIB 2HMJB 4GL6A 4BTYA 3KIIA 3LYGA 5EQLA 1IVXA 1KC84 3WODG 3GZBA 4N6MA 5AEWB 1N9EA 3FKAA 1IK3A 2C10A 4HBRA 3UL5A 5DRVA 4LGQA 4MMXB 1LOXA 1E3VA 1W01A 4OVMA 5CF1A 1C7HA 3T0UA 1GS3A 2F86B 4L8PA 3WA2X 3F9SA 4ZM8A 4FMCA 3DM8A 3EN1B 2XFSA 1IV9A 1AV4A 1V74A 4K90B 1SIIA 2Z7AA 3FZWA 4HJLB 4CDLA 3QK9A 3X3XA 1A2KA 2YX9A 1YJ93 3DZLA 3S67A 1IVUA 1QAKA 2FXTA 3AMOA 3BLZA 3OXAA 3OWUA 3LT9A 1A90A 2K54A 2OWPA 3D3LA 1GD3A 4K1UA 1L5GB 4JF8A 4XDVA 3CC73 2W6JH 5AIHA 1US1A 1WNHA 3S27A 2OOVC 3NQZA 4MEIA 3UL6A 3HI7A 5IEPA 2XRXB 3B4OA 5IF6A 3NUVA 4N6UA 2LQVA 3V98A 4MJDA 4RZMA 3CPW2 2V1LA 3MPHA 3GZRA 5EEOA 3BNCA 3UJMA 3FF2A 3X3ZA 2FGTA 1DMQA 1N8QA 2CK3H 1STFI 2P0MA 2QGUA 4N6OB 3K9MC 3LTAA 1DYUA 1SQWA 3EBTA 1STDA 2GBWB 3CCV3 2CG0A 1W6YA 1Z1SA 3FGYA 2JDIH 3LMLA 2IUJA 4R1KA 3PCRA 5HGRA 8CHOA 2RSXA 2GEYA 5D81A 3IJEB 1IQXA 3WOFB 3F14A 3FCSB 1UW1A 4HM2B 4EV5A 2IMJA 2HMKB 5D82A 3LTBA 4OK0A 2GU3A 3F8XA 2D1WA 1IQ8A 3CC43 1W02A 3FG3A 5JBSA 3B4PA 2R4IA 4EV2A 1JN5B 1YJN3 4XB5A 2SBLA 1ISKA 3K63A 4N3VA 3DGNA 1KWIA 3EBYA 3BNDA 4N6TA 4FMAA 1JB4A 2W9PA 1T5YA 3NXJA 4O3VA 1W2B2 3Q90A 2OQEA 3IPTA 3NM7A 4KFDA 1Q7Y4 1K734 2W56B 3BB9A 1GY7A 1ZX2A 1JN5A 1AVKA 1O7HB 1VQ43 3SXXA 1TUHA 3O8YA 2KRTA 4J9AA 4HM4B 2CW9A 2Q07A 3NV0A 4FR9A 3JUPA 1DVDA 1TIJA 4MMZB 2ZL8A 2CWUA 1NB5I 2P0XA 3DY5A 3SX1A 3B8LA 1OHPA 2Y74A 1E97A 4O8SA 1IT8A 2F99A 1VQM3 2W56A 3WA3A 3GZYB 3S5CA 1A2VA 2RGQA 2OQEC 1O7GB 1EKMA 4N6V0 3T8NA 1U5OA 2INXA 4XDWA 5BXQA 3PYJA 3EJVA 3MWZA 3X40A 2JQ5A 5AEUB 5CK6A 4GB5A 3PCSA 5FW5A 4RNYA 1VQ73 5IG4A 1DMMA 3PGBA 1OF5A 1W6GA 4WYKB 1OGZA 4I4KA 3CCJ3 1OACA 3B7CA 3EX9A 4BTWA 4LSOA 1FGOA 2STDA 5CLKA 2WGOA 5IG0A 2GXFA 3CNMA 3EQQB 4AEQA 2XF3A 5IG3A 4XBTA 5IW9A 1JJ22 3KKGA 3CCE3 4HM8B 1EA2A 2W04A 1JNQA 5ELUA 5AIFA 3GRDA 4HZ9B 3CU3A 2OOVA 5CF2A 3WMDA 1JRQA 1FGQA 4XBXA 3OWSA 1WQLB 2IA7A 1NB3I 1O7PB 3OV4A 4IIAA 4HKVB 3ER7A 2F98A 1PFPA 1ZO2A 1NDOB 1VQK3 4R9LA 1K41A 4MMYB 4WWUC 4J8TA 3S29A 1D6UA 5I97A 1VQ53 2CHCA 1VQO3 3VF1A 3A76A 1EQKA 2W0QA 3HZPA 4EC6A 1OPYA 3H3HA 3UNLA 3K7CA 3JUMA 3NBJA 1R4CA 4WHAA 4NHFA 3KFQC 5AIGA 5BVBA 1CYUA 4WP5A 3CD63 1WMNA 2GBXB 3DGMA 2WOHA 1QVG2 2CFDA 5ELJA 5IENA 2CKFB 1TP6A 1IDPA 3ALAA 3F7XA 2OCTA 3OW22 4JRFA 2CWVA 2MF7A 5G2GA 1G96A 4AKYA 3GZXB 3G0KA 3LXUX 3J7Yd 1VQ63 3JUOA 4Q53A 5A0OB 3DMCA 5AIIA 1VQN3 3S28A 1S723 1YIT3 3FG4A 3G16A 4KFEA 4X2HA 4HM7B 3FH1A 1AR0A 4ORLA 3X42A 4O02B 2GU1A 2CG1A 2CFKA 3G4S3 1VQ93 2P09A 1YJW3 4FMDA 3WDGB 4N6LA 4HZBB 1RRLA 4R80A 3N54B 3CCQ3 2WOFA 1OCVA 1RJOA 1Q814 1GYBA 1UUVB 3EB8A 3OX9A 4N6NB 4H3UA 3ROBA 3LZAA 3DGLA 3KSED 3T8UA 2ML6A 1CQSA 1IV7A 1D6ZA 2CC3A 1NJI4 4HM1B 2HMOB 5LC7A 1UUWB 1VQP3 3GAXA 2HMMB 4TX4A 4HVNA 2OTL3 4FCZA 1AVLA 4XBYA 1M1XB 2Z76A 1RN7A 4X2OA 3N8BA 3LTCA 1IU7A 1IVVA 1FGRA 1WTHA 3BNEA 2D42A 4R4KA 3JUNA 3MHEA 2LYXA 5IG5A 4QWTA 1ULJB 1Q864 2L4VA 1OGXA 3LTDA 3FSDA 2CFLA 3G713 1YIJ3 1W00A 2B1XB 1O7MB 1QAFA 1RRHA 4XM4A 1RKYA 2BMOB 3MG2A 2ZDJA 3PS8A 3I553 2O9UX 3NM2A 3UB1A 1EG9B 1SJWA 1M1K4 2YFJB 1NU3A 3NHXA 5KP3A 3OWYA 4STDA 3CMA3 2IUKA 5TGNA 3I0YA 3V99A 1JB5A 2O3OA 3K5TA 5JPPA 1KD14 1K9M4 5IEOA 2QEX3 3EF8A 2HMNB 2W03A 3NX0A 5KP4A 4IPBA 1IQYA 2WO0A 1MOLA 4CCVA 1JKGB 4HYZA 2BO9B 3V92A 3K0ZA 2M7OA 2P38A 1YVBI 2BHMA 3TDGA 4FCMA 1GD4A 4LEHA 1W7CA 7STDA 2RFRA 3CCL3 1VZZA 2Z77A 3CME3 3HX8A 3JUQA 3FG1A 5EVHA 1MNLA 3PXMA 3LH4A 2K0MA 4H61A 1JKGA 3MSOA 4LMIA 1WMPA 2BMRB 2KCDA 1DVCA 2PZVA 3SVAA 1YI23 2WGQA 1YGEA 1N5HA 4IT7A 1FA3A 1LNHA 1HKXA 3HIIA 3U97A 4WYKA 1D6YA 2CWTA 1OHSA 5AYRB 1NWWA 4FCJA 2W2CA 4K1VA 4L8OA 1M904 2Y73A 1ASKA 3IMAB 1ROAA 4BTXA 5D83A 1KSIA 1NO3A 3CCM3 3STDA 4WFOA 3U1WA 1LXEA 4FMBA 2FNQA 2YFLB 3EN8A 2CFGA 3SEDA 3AMOB 3NQYA 2BNGA 1W6CA 1FUWA 3FF0A 1N9JA 2QIYA 1ROVA 5STDA 3QRDA 3CCR3 1ULIB 1DMNA 2RCDA 3I563 5DREA 1Q824 3WOEB 3LT8A 1Y4KA 2PNCA 2OTJ3 3MKIA 3L0RA 1BUQA 1QMAA 3D9RA 5IERA 3KE7A 1F8NA 1JV2B 4R9KA 2QA43 4HM5B 3KSPA 4OUQA 3ECFA 1W4NA 3F40A 3MG3A 4HM0B 3Q2PA 3NBBA 2XEPA 3HK4A 1HU9A 1Q40B 4K61A 1IVWA 3Q1CA 2P05A 4KVHA 2I9WA 1QALA 3N9HA 1N5PA 1OHOA 3DUKA 4EYCA 2E2TA 5JPUA 3F8HA 3CNXA 1K28A 4NREA 3RDEA 1YHQ3 1J2BA 2HMLB 3JVCA 2XGNA 3DGOA 4HM6B 3EHCA 3KZTA 1Q40A 4RNZA 2W9QA 2XR8B 1A67A 5LC6A 1TFOA 2CFWA 2BT3A 5FGOA 3GWRA 2BMQB 2XSOB 3M8CA 2KXGA 1O7WB 3FLJA 1KQS2 2ML5A 3SLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 3;  2OTL 3;  2QEX 3;  1W2B 2;  1JJ2 2;  3CCE 3;  3CCS 3;  3G4S 3;  1VQ9 3;  1K8A 4;  1QVF 2;  3CCR 3;  1Q7Y 4;  3CC2 3;  1YJW 3;  1K73 4;  1Q86 4;  3I56 3;  1YHQ 3;  1VQL 3;  3CPW 2;  3CCU 3;  1VQ4 3;  1Q82 4;  1YJ9 3;  3G6E 3;  3CD6 3;  3G71 3;  1YIJ 3;  1QVG 2;  1KC8 4;  1M90 4;  2OTJ 3;  3CCQ 3;  1VQ7 3;  3CC4 3;  3I55 3;  3OW2 2;  3CCM 3;  3CCL 3;  1VQK 3;  1Q81 4;  2QA4 3;  3CCJ 3;  3CXC 2;  3CME 3;  1M1K 4;  1VQ5 3;  1NJI 4;  1YJN 3;  1VQO 3;  1VQM 3;  1N8R 4;  1VQ6 3;  3CMA 3;  3CC7 3;  1VQN 3;  3CCV 3;  1VQP 3;  1S72 3;  1YIT 3;  1KD1 4;  1K9M 4;  1KQS 2;  1VQ8 3; 
#chains in the Genus database with same CATH topology
 1FGT A;  2CX0 A;  1A2P A;  2XH9 A;  4L7K A;  3NBR A;  3D79 A;  3G8Z A;  3CCS 3;  3MG1 A;  4RBN A;  1K8A 4;  1PYL A;  1RNB A;  2C11 A;  4HM3 B;  1SPU A;  3DXO A;  3H51 A;  3RGR A;  1UI8 A;  3CCU 3;  2MC8 A;  3G6E 3;  3MYT A;  1TFK A;  2CIU A;  1B2S A;  3CPO A;  1RDS A;  5KP1 A;  1PU4 A;  1OH0 A;  3D4A A;  2E2V A;  2XSH B;  3E99 A;  1RMS A;  2XGL A;  1TRQ A;  1M9G A;  3X3Y A;  3X41 A;  5RNT A;  1W5Z A;  2GEX A;  1WMO A;  3NV0 B;  3VSY A;  4EXR A;  4G1M B;  4PEJ A;  1I8V A;  3F7S A;  3ZG5 A;  1VQ8 3;  1GOV A;  1W2Z A;  1CYV A;  1LVN A;  1IT7 A;  3LOY A;  2CH9 A;  1GY6 A;  4AKZ A;  1FGM A;  1SAR A;  2CX1 A;  4KFF A;  1QVF 2;  2UX0 A;  1UCK A;  3CC2 3;  3BNB A;  4EBG A;  1ZGX A;  1VQL 3;  3SOA A;  3VGN A;  1JB2 A;  4LZI A;  2Z6B A;  1Q42 A;  1OUN A;  1UI7 A;  2XFT A;  1IYY A;  3PZW A;  3EE1 A;  1GMQ A;  3HIG A;  2A15 A;  1E3R A;  1LOY A;  3EC9 A;  4O2H A;  2E2U A;  3CXC 2;  2B24 B;  1UGH I;  3RGA A;  1N8R 4;  1B2M A;  1S5A A;  1O7N B;  3KN4 A;  1QJG A;  1U8C B;  1OF5 B;  1RN4 A;  1I2E A;  3SOY A;  6STD A;  5CXO A;  1TU5 A;  4KZ1 A;  1B2Z A;  5AI1 A;  1GY5 A;  1CEW I;  1SIH A;  4U13 A;  4RNT A;  5AYS C;  2YFI B;  2HMJ B;  4GL6 A;  4BTY A;  3KII A;  3LYG A;  1RGA A;  5EQL A;  1T2H A;  1IVX A;  5G1K A;  1KC8 4;  3WOD G;  4BL3 A;  3GZB A;  4N6M A;  5AEW B;  1N9E A;  3FKA A;  1IK3 A;  2C10 A;  1I3F A;  4HBR A;  3UL5 A;  2KAA A;  5DRV A;  4LGQ A;  4MMX B;  3AGN A;  1LOX A;  1E3V A;  1W01 A;  4OVM A;  5CF1 A;  1C7H A;  3T0U A;  1GS3 A;  2F86 B;  4L8P A;  3WA2 X;  1BSA A;  3F9S A;  4ZM8 A;  4FMC A;  3DM8 A;  3EN1 B;  2XFS A;  1IV9 A;  1AV4 A;  1V74 A;  4K90 B;  1SII A;  1BSB A;  2Z7A A;  3FZW A;  1B2U A;  4HJL B;  4CDL A;  3QK9 A;  3BU4 A;  3DGY A;  4KT3 B;  3Q3F A;  3X3X A;  1A2K A;  2YX9 A;  1YJ9 3;  3DZL A;  3S67 A;  2KF4 A;  1IVU A;  1QAK A;  2FXT A;  3AMO A;  3BLZ A;  3OXA A;  3OWU A;  1G0T A;  3LT9 A;  1A90 A;  2K54 A;  2OWP A;  3D3L A;  2GSP A;  1I0X A;  1LOV A;  1GD3 A;  1BRI A;  4K1U A;  1L5G B;  4JF8 A;  4XDV A;  3CC7 3;  5GSP A;  1JZD A;  2W6J H;  1VQK 3;  5AIH A;  1US1 A;  1WNH A;  3S27 A;  2OOV C;  3NQZ A;  4MEI A;  3UL6 A;  3HI7 A;  5IEP A;  2XRX B;  3B4O A;  5IF6 A;  3NUV A;  4N6U A;  3D5G A;  1TJD A;  2LQV A;  3V98 A;  2ZHX B;  1YGW A;  4MJD A;  4RZM A;  3CPW 2;  1JZO A;  2V1L A;  3MPH A;  2ML5 A;  3GZR A;  1T3B A;  5EEO A;  3BNC A;  3UJM A;  3FF2 A;  4GSP A;  3X3Z A;  2FGT A;  1DMQ A;  1N8Q A;  2CK3 H;  1STF I;  2P0M A;  2QGU A;  1GOU A;  4N6O B;  3K9M C;  3LTA A;  1DYU A;  3RNT A;  1SQW A;  3EBT A;  1GOY A;  1STD A;  1VQQ A;  2GBW B;  1LOW A;  3CCV 3;  2CG0 A;  1W6Y A;  1CH0 A;  1BNJ A;  1Z1S A;  2JDI H;  3FGY A;  3LML A;  2IUJ A;  4R1K A;  3PCR A;  5HGR A;  8CHO A;  1LRA A;  2AAE A;  2GEY A;  2RSX A;  1TRP A;  5D81 A;  3IJE B;  1IQX A;  3WOF B;  3F14 A;  3FCS B;  1UW1 A;  1I2F A;  4HM2 B;  2UGI A;  2IMJ A;  1FUT A;  2HMK B;  1RGK A;  4LYL B;  5D82 A;  3LTB A;  4EV5 A;  3WR2 A;  4OK0 A;  2GU3 A;  5M1A A;  3F8X A;  2D1W A;  1IQ8 A;  3T8U A;  3CC4 3;  1W02 A;  3FG3 A;  5JBS A;  1AQZ A;  3B4P A;  2R4I A;  4EV2 A;  1JN5 B;  1RTU A;  4XB5 A;  2SBL A;  1YJN 3;  1ISK A;  3K63 A;  4N3V A;  3DGN A;  1KWI A;  3EBY A;  3BND A;  4N6T A;  4FMA A;  1JB4 A;  2W9P A;  1T5Y A;  3NXJ A;  1RGC A;  4O3V A;  1W2B 2;  1BRJ A;  1Q9E A;  3BIR A;  3Q90 A;  2OQE A;  8RNT A;  3IPT A;  3NM7 A;  4KFD A;  1Q7Y 4;  1K73 4;  2W56 B;  3BB9 A;  1GY7 A;  1ZX2 A;  1JN5 A;  1AVK A;  1O7H B;  1VQ4 3;  1BUJ A;  1FYS A;  1TUH A;  3O8Y A;  2KRT A;  4J9A A;  3SXX A;  4HM4 B;  2CW9 A;  1MWT A;  2Q07 A;  3NV0 A;  3JUP A;  4FR9 A;  1DVD A;  1I2G A;  1TIJ A;  4MMZ B;  2ZL8 A;  2CWU A;  1NB5 I;  2P0X A;  3DY5 A;  3SX1 A;  3B8L A;  1OHP A;  2Y74 A;  1E97 A;  4O8S A;  3URP A;  1IT8 A;  1BNE A;  2F99 A;  1VQM 3;  2W56 A;  3WA3 A;  3GZY B;  3S5C A;  1A2V A;  2RGQ A;  2OQE C;  1O7G B;  3AHS A;  1EKM A;  4N6V 0;  1BRS A;  1U5O A;  3T8N A;  2INX A;  4XDW A;  5BXQ A;  3PYJ A;  3EJV A;  1GSP A;  3MWZ A;  3X40 A;  2JQ5 A;  5AEU B;  5CK6 A;  4GB5 A;  2L1S A;  3PCS A;  5FW5 A;  4RNY A;  1B2X A;  2K3D A;  1VQ7 3;  2F4Y A;  1DMM A;  3PGB A;  5IG4 A;  1OF5 A;  1W6G A;  2AAD A;  1RSN A;  1AY7 A;  4WYK B;  1OGZ A;  4I4K A;  3CCJ 3;  1OAC A;  3B7C A;  3EX9 A;  4BTW A;  4LSO A;  1FGO A;  2STD A;  5CLK A;  2WGO A;  3A5E A;  2GXF A;  3CNM A;  5IG0 A;  1JBS A;  1X1Y A;  3EQQ B;  1BAN A;  4AEQ A;  2XF3 A;  5IG3 A;  4XBT A;  5IW9 A;  1JJ2 2;  3KKG A;  3CCE 3;  4HM8 B;  1EA2 A;  2W04 A;  1JNQ A;  1BRK A;  5AIF A;  5ELU A;  3GRD A;  4HZ9 B;  3CU3 A;  2OOV A;  5CF2 A;  3WMD A;  1JRQ A;  1FGQ A;  4XBX A;  3OWS A;  1MWR A;  1WQL B;  1EUI C;  1NB3 I;  2IA7 A;  1O7P B;  3OV4 A;  1NNV A;  4IIA A;  4HKV B;  3ER7 A;  2F98 A;  1I70 A;  1PFP A;  1UGI A;  1ZO2 A;  1LQM B;  1NDO B;  3DH2 A;  4R9L A;  1K41 A;  4MMY B;  4WWU C;  4J8T A;  4BIR A;  1B20 A;  3S29 A;  1D6U A;  5I97 A;  1VQ5 3;  1BGS A;  1UUG B;  2CHC A;  4GHO A;  4BU4 A;  1VQO 3;  3VF1 A;  3A76 A;  1EQK A;  2W0Q A;  3HZP A;  4EC6 A;  1OPY A;  1RHL A;  2UUG C;  3H3H A;  2H0G A;  3K7C A;  3UNL A;  3JUM A;  3NBJ A;  2IYJ A;  1R4C A;  1BU4 A;  4WHA A;  4NHF A;  3KFQ C;  5AIG A;  5BVB A;  1CYU A;  4WP5 A;  3CD6 3;  3D5I A;  1WMN A;  2GBX B;  3DGM A;  3GSP A;  2WOH A;  2KF6 A;  1QVG 2;  2CFD A;  5ELJ A;  5IEN A;  2CKF B;  1TP6 A;  1IDP A;  1BRG A;  3ALA A;  3F7X A;  1C54 A;  2OCT A;  3OW2 2;  4JRF A;  2CWV A;  1UCJ A;  4CPK A;  2MF7 A;  5G2G A;  1G96 A;  4AKY A;  3GZX B;  3G0K A;  3LXU X;  3J7Y d;  1VQ6 3;  3JUO A;  4Q53 A;  1B21 A;  5A0O B;  3DMC A;  3KCH A;  5AII A;  1VQN 3;  3S28 A;  1S72 3;  4DKI A;  1YIT 3;  3FG4 A;  3G16 A;  4KFE A;  4X2H A;  1BSC A;  2R41 A;  4HM7 B;  1JBR A;  3FH1 A;  1AR0 A;  1V58 A;  4ORL A;  3X42 A;  4O02 B;  2GU1 A;  1DET A;  2CFK A;  2CG1 A;  3G4S 3;  2P09 A;  4NPB A;  1X1U A;  1VQ9 3;  1YJW 3;  3ZG0 A;  1MGR A;  1V57 A;  4FMD A;  3WDG B;  4N6L A;  4HZB B;  1ZS7 A;  1RRL A;  4HOH A;  4R80 A;  1EEJ A;  3N54 B;  3CCQ 3;  2WOF A;  1OCV A;  1MWS A;  1RJO A;  2KF5 A;  1GYB A;  1UUV B;  3EB8 A;  3OX9 A;  1RGG A;  4H3U A;  4N6N B;  3LZA A;  3DGL A;  3KSE D;  3ROB A;  2ML6 A;  1JBT A;  1CQS A;  1IV7 A;  1D6Z A;  2CC3 A;  1NJI 4;  4HM1 B;  2HMO B;  5LC7 A;  1UUW B;  1Q7H A;  1RGH A;  2C4B A;  4BL2 A;  1VQP 3;  3GAX A;  2HMM B;  4TX4 A;  4HVN A;  2OTL 3;  4FCZ A;  1AVL A;  4XBY A;  1M1X B;  2Z76 A;  1RN7 A;  4X2O A;  3N8B A;  5M18 A;  3AHW A;  3LTC A;  1IU7 A;  1IVV A;  1FGR A;  1WTH A;  3BNE A;  2D42 A;  4R4K A;  3JUN A;  1GMR A;  2LYX A;  3MHE A;  5IG5 A;  4QWT A;  1ULJ B;  1Q86 4;  2L4V A;  1OGX A;  3LTD A;  3FSD A;  1PY3 A;  2CFL A;  3G71 3;  1YIJ 3;  1W00 A;  2B1X B;  1O7M B;  1QAF A;  1RRH A;  4XM4 A;  1RKY A;  2BMO B;  1G02 A;  3MG2 A;  5BIR A;  2ZDJ A;  3PS8 A;  3I55 3;  2O9U X;  3NM2 A;  4I5Q A;  1EG9 B;  3UB1 A;  4EW5 A;  1RLS A;  1SJW A;  1M1K 4;  2YFJ B;  1NU3 A;  2J8X B;  3NHX A;  1X1W A;  5KP3 A;  3OWY A;  4STD A;  2BU4 A;  3WHO A;  1TTO A;  3CMA 3;  2IUK A;  5TGN A;  3I0Y A;  1I3I A;  3V99 A;  1JB5 A;  2O3O A;  3K5T A;  5JPP A;  1MWU A;  1KD1 4;  1K9M 4;  5IEO A;  2QEX 3;  3EF8 A;  2HMN B;  1BNS A;  2RNT A;  2W03 A;  3NX0 A;  4IPB A;  1IQY A;  2KF3 A;  2WO0 A;  1MOL A;  5KP4 A;  4CCV A;  6RNT A;  1JKG B;  4HYZ A;  2BO9 B;  3V92 A;  3ZFZ A;  1BRN L;  3K0Z A;  2M7O A;  2P38 A;  1R4Y A;  1YVB I;  2BHM A;  1FUS A;  3TDG A;  1BOX A;  1DE3 A;  1FZU A;  4FCM A;  4J5G A;  1GD4 A;  4LEH A;  1W7C A;  7STD A;  1FW7 A;  2RFR A;  3CCL 3;  2BIR A;  1VZZ A;  1UDI I;  1RGL A;  1UCL A;  2Z77 A;  3CME 3;  3HX8 A;  3JUQ A;  3FG1 A;  5EVH A;  1MNL A;  3PXM A;  3LH4 A;  2K0M A;  4H61 A;  1JKG A;  3MSO A;  4LMI A;  1WMP A;  2BMR B;  2HOH A;  2KCD A;  1BNG A;  3SYU A;  1DVC A;  2PZV A;  1BNR A;  3SVA A;  1YI2 3;  2WGQ A;  1YGE A;  1N5H A;  4IT7 A;  1FA3 A;  1LNH A;  1HKX A;  3HII A;  3U97 A;  4WYK A;  1D6Y A;  2CWT A;  1OHS A;  5AYR B;  1NWW A;  4FCJ A;  5BU4 A;  2W2C A;  4K1V A;  4L8O A;  1M90 4;  2Y73 A;  1Q81 4;  1B3S A;  1ASK A;  2RBI A;  1ROA A;  3AGO A;  3IMA B;  4BTX A;  5D83 A;  6GSP A;  1KSI A;  1NO3 A;  3CCM 3;  3HOH A;  4J5K A;  3STD A;  4WFO A;  1RCK A;  1LXE A;  2F5M A;  2IY2 A;  3U1W A;  4FMB A;  1YVS A;  2FNQ A;  1RN1 A;  2YFL B;  3EN8 A;  2CFG A;  3SED A;  2ZA4 A;  1UCI A;  3AMO B;  3NQY A;  1BIR A;  1W6C A;  2BNG A;  1FUW A;  3FF0 A;  1N9J A;  1RGF A;  1T2I A;  1X1X A;  2QIY A;  1ROV A;  5STD A;  2F5W A;  1BAO A;  2SAR A;  3QRD A;  7GSP A;  2H0H A;  3CCR 3;  1ULI B;  1DMN A;  2RCD A;  3I56 3;  1LNI A;  5DRE A;  5M19 A;  1Q82 4;  3WOE B;  3LT8 A;  1Y4K A;  2PNC A;  1GMP A;  7RNT A;  3MKI A;  4CJN A;  2OTJ 3;  3L0R A;  1BUQ A;  1QMA A;  1RGE A;  3D9R A;  5IER A;  3KE7 A;  1BVI A;  1F8N A;  1JV2 B;  2H0I A;  4R9K A;  1BNI A;  2QA4 3;  4HM5 B;  3KSP A;  4OUQ A;  3ECF A;  5G1L A;  1W4N A;  3F40 A;  3MG3 A;  4HM0 B;  3Q2P A;  3NBB A;  5HOH A;  1RNT A;  2XEP A;  3HK4 A;  1HU9 A;  1Q40 B;  2F56 A;  4K61 A;  1IVW A;  3Q1C A;  2P05 A;  4KVH A;  2I9W A;  1QAL A;  3N9H A;  1N5P A;  1OHO A;  3DUK A;  4EYC A;  2E2T A;  5JPU A;  3F8H A;  1BRH A;  1MGW A;  1K28 A;  3CNX A;  4NRE A;  3RDE A;  1YHQ 3;  1J2B A;  2HML B;  3JVC A;  2XGN A;  3DGO A;  1I0V A;  1YNV X;  4HM6 B;  1BSD A;  3EHC A;  4ILF A;  3KZT A;  1HZ1 A;  1Q40 A;  4RNZ A;  1BSE A;  2W9Q A;  2XR8 B;  1A67 A;  5LC6 A;  1B27 A;  1TFO A;  2CFW A;  1RCL A;  2BT3 A;  1LQG C;  5FGO A;  3GWR A;  2BMQ B;  4HAA A;  2XSO B;  3M8C A;  9RNT A;  1BNF A;  2KXG A;  1O7W B;  3FLJ A;  1KQS 2;  1HYF A;  3SLU A; 
#chains in the Genus database with same CATH homology
 1FGT A;  2XH9 A;  4L7K A;  3NBR A;  3G8Z A;  3CCS 3;  3MG1 A;  4RBN A;  1K8A 4;  2C11 A;  4HM3 B;  1SPU A;  3DXO A;  3H51 A;  3RGR A;  1UI8 A;  3CCU 3;  2MC8 A;  3G6E 3;  3MYT A;  1TFK A;  2CIU A;  3CPO A;  5KP1 A;  1PU4 A;  1OH0 A;  2E2V A;  2XSH B;  3E99 A;  2XGL A;  3X41 A;  1M9G A;  3X3Y A;  1W5Z A;  2GEX A;  1WMO A;  3NV0 B;  3VSY A;  4EXR A;  4G1M B;  4PEJ A;  3F7S A;  1VQ8 3;  1W2Z A;  1CYV A;  1LVN A;  1IT7 A;  3LOY A;  2CH9 A;  1GY6 A;  4AKZ A;  1FGM A;  4KFF A;  1QVF 2;  2UX0 A;  3CC2 3;  3BNB A;  4EBG A;  1VQL 3;  3SOA A;  3VGN A;  1JB2 A;  4LZI A;  2Z6B A;  1Q42 A;  1OUN A;  1UI7 A;  2XFT A;  3PZW A;  3EE1 A;  3HIG A;  2A15 A;  1E3R A;  3EC9 A;  4O2H A;  2E2U A;  3CXC 2;  2B24 B;  3RGA A;  1N8R 4;  1S5A A;  1O7N B;  3KN4 A;  1QJG A;  1U8C B;  1OF5 B;  3SOY A;  6STD A;  5CXO A;  1TU5 A;  4KZ1 A;  5AI1 A;  1GY5 A;  1CEW I;  1SIH A;  4U13 A;  5AYS C;  2YFI B;  2HMJ B;  4GL6 A;  4BTY A;  3KII A;  3LYG A;  5EQL A;  1IVX A;  1KC8 4;  3WOD G;  3GZB A;  4N6M A;  5AEW B;  1N9E A;  3FKA A;  1IK3 A;  2C10 A;  4HBR A;  3UL5 A;  5DRV A;  4LGQ A;  4MMX B;  1LOX A;  1E3V A;  1W01 A;  4OVM A;  5CF1 A;  1C7H A;  3T0U A;  1GS3 A;  2F86 B;  4L8P A;  3WA2 X;  3F9S A;  4ZM8 A;  4FMC A;  3DM8 A;  3EN1 B;  2XFS A;  1IV9 A;  1AV4 A;  1V74 A;  4K90 B;  1SII A;  2Z7A A;  3FZW A;  4HJL B;  4CDL A;  3QK9 A;  3X3X A;  1A2K A;  2YX9 A;  1YJ9 3;  3DZL A;  3S67 A;  1IVU A;  1QAK A;  2FXT A;  3AMO A;  3BLZ A;  3OXA A;  3OWU A;  3LT9 A;  1A90 A;  2K54 A;  2OWP A;  3D3L A;  1GD3 A;  4K1U A;  1L5G B;  4JF8 A;  4XDV A;  3CC7 3;  2W6J H;  5AIH A;  1US1 A;  1WNH A;  3S27 A;  2OOV C;  3NQZ A;  4MEI A;  3UL6 A;  3HI7 A;  5IEP A;  2XRX B;  3B4O A;  5IF6 A;  3NUV A;  4N6U A;  2LQV A;  3V98 A;  4MJD A;  4RZM A;  3CPW 2;  2V1L A;  3MPH A;  3GZR A;  5EEO A;  3BNC A;  3UJM A;  3FF2 A;  3X3Z A;  2FGT A;  1DMQ A;  1N8Q A;  2CK3 H;  1STF I;  2P0M A;  2QGU A;  4N6O B;  3K9M C;  3LTA A;  1DYU A;  1SQW A;  3EBT A;  1STD A;  2GBW B;  3CCV 3;  2CG0 A;  1W6Y A;  1Z1S A;  3FGY A;  2JDI H;  3LML A;  2IUJ A;  4R1K A;  3PCR A;  5HGR A;  8CHO A;  2RSX A;  2GEY A;  5D81 A;  3IJE B;  1IQX A;  3WOF B;  3F14 A;  3FCS B;  1UW1 A;  4HM2 B;  4EV5 A;  2IMJ A;  2HMK B;  5D82 A;  3LTB A;  4OK0 A;  2GU3 A;  3F8X A;  2D1W A;  1IQ8 A;  3CC4 3;  1W02 A;  3FG3 A;  5JBS A;  3B4P A;  2R4I A;  4EV2 A;  1JN5 B;  1YJN 3;  4XB5 A;  2SBL A;  1ISK A;  3K63 A;  4N3V A;  3DGN A;  1KWI A;  3EBY A;  3BND A;  4N6T A;  4FMA A;  1JB4 A;  2W9P A;  1T5Y A;  3NXJ A;  4O3V A;  1W2B 2;  3Q90 A;  2OQE A;  3IPT A;  3NM7 A;  4KFD A;  1Q7Y 4;  1K73 4;  2W56 B;  3BB9 A;  1GY7 A;  1ZX2 A;  1JN5 A;  1AVK A;  1O7H B;  1VQ4 3;  3SXX A;  1TUH A;  3O8Y A;  2KRT A;  4J9A A;  4HM4 B;  2CW9 A;  2Q07 A;  3NV0 A;  4FR9 A;  3JUP A;  1DVD A;  1TIJ A;  4MMZ B;  2ZL8 A;  2CWU A;  1NB5 I;  2P0X A;  3DY5 A;  3SX1 A;  3B8L A;  1OHP A;  2Y74 A;  1E97 A;  4O8S A;  1IT8 A;  2F99 A;  1VQM 3;  2W56 A;  3WA3 A;  3GZY B;  3S5C A;  1A2V A;  2RGQ A;  2OQE C;  1O7G B;  1EKM A;  4N6V 0;  3T8N A;  1U5O A;  2INX A;  4XDW A;  5BXQ A;  3PYJ A;  3EJV A;  3MWZ A;  3X40 A;  2JQ5 A;  5AEU B;  5CK6 A;  4GB5 A;  3PCS A;  5FW5 A;  4RNY A;  1VQ7 3;  5IG4 A;  1DMM A;  3PGB A;  1OF5 A;  1W6G A;  4WYK B;  1OGZ A;  4I4K A;  3CCJ 3;  1OAC A;  3B7C A;  3EX9 A;  4BTW A;  4LSO A;  1FGO A;  2STD A;  5CLK A;  2WGO A;  5IG0 A;  2GXF A;  3CNM A;  3EQQ B;  4AEQ A;  2XF3 A;  5IG3 A;  4XBT A;  5IW9 A;  1JJ2 2;  3KKG A;  3CCE 3;  4HM8 B;  1EA2 A;  2W04 A;  1JNQ A;  5ELU A;  5AIF A;  3GRD A;  4HZ9 B;  3CU3 A;  2OOV A;  5CF2 A;  3WMD A;  1JRQ A;  1FGQ A;  4XBX A;  3OWS A;  1WQL B;  2IA7 A;  1NB3 I;  1O7P B;  3OV4 A;  4IIA A;  4HKV B;  3ER7 A;  2F98 A;  1PFP A;  1ZO2 A;  1NDO B;  1VQK 3;  4R9L A;  1K41 A;  4MMY B;  4WWU C;  4J8T A;  3S29 A;  1D6U A;  5I97 A;  1VQ5 3;  2CHC A;  1VQO 3;  3VF1 A;  3A76 A;  1EQK A;  2W0Q A;  3HZP A;  4EC6 A;  1OPY A;  3H3H A;  3UNL A;  3K7C A;  3JUM A;  3NBJ A;  1R4C A;  4WHA A;  4NHF A;  3KFQ C;  5AIG A;  5BVB A;  1CYU A;  4WP5 A;  3CD6 3;  1WMN A;  2GBX B;  3DGM A;  2WOH A;  1QVG 2;  2CFD A;  5ELJ A;  5IEN A;  2CKF B;  1TP6 A;  1IDP A;  3ALA A;  3F7X A;  2OCT A;  3OW2 2;  4JRF A;  2CWV A;  2MF7 A;  5G2G A;  1G96 A;  4AKY A;  3GZX B;  3G0K A;  3LXU X;  3J7Y d;  1VQ6 3;  3JUO A;  4Q53 A;  5A0O B;  3DMC A;  5AII A;  1VQN 3;  3S28 A;  1S72 3;  1YIT 3;  3FG4 A;  3G16 A;  4KFE A;  4X2H A;  4HM7 B;  3FH1 A;  1AR0 A;  4ORL A;  3X42 A;  4O02 B;  2GU1 A;  2CG1 A;  2CFK A;  3G4S 3;  1VQ9 3;  2P09 A;  1YJW 3;  4FMD A;  3WDG B;  4N6L A;  4HZB B;  1RRL A;  4R80 A;  3N54 B;  3CCQ 3;  2WOF A;  1OCV A;  1RJO A;  1Q81 4;  1GYB A;  1UUV B;  3EB8 A;  3OX9 A;  4N6N B;  4H3U A;  3ROB A;  3LZA A;  3DGL A;  3KSE D;  3T8U A;  2ML6 A;  1CQS A;  1IV7 A;  1D6Z A;  2CC3 A;  1NJI 4;  4HM1 B;  2HMO B;  5LC7 A;  1UUW B;  1VQP 3;  3GAX A;  2HMM B;  4TX4 A;  4HVN A;  2OTL 3;  4FCZ A;  1AVL A;  4XBY A;  1M1X B;  2Z76 A;  1RN7 A;  4X2O A;  3N8B A;  3LTC A;  1IU7 A;  1IVV A;  1FGR A;  1WTH A;  3BNE A;  2D42 A;  4R4K A;  3JUN A;  3MHE A;  2LYX A;  5IG5 A;  4QWT A;  1ULJ B;  1Q86 4;  2L4V A;  1OGX A;  3LTD A;  3FSD A;  2CFL A;  3G71 3;  1YIJ 3;  1W00 A;  2B1X B;  1O7M B;  1QAF A;  1RRH A;  4XM4 A;  1RKY A;  2BMO B;  3MG2 A;  2ZDJ A;  3PS8 A;  3I55 3;  2O9U X;  3NM2 A;  3UB1 A;  1EG9 B;  1SJW A;  1M1K 4;  2YFJ B;  1NU3 A;  3NHX A;  5KP3 A;  3OWY A;  4STD A;  3CMA 3;  2IUK A;  5TGN A;  3I0Y A;  3V99 A;  1JB5 A;  2O3O A;  3K5T A;  5JPP A;  1KD1 4;  1K9M 4;  5IEO A;  2QEX 3;  3EF8 A;  2HMN B;  2W03 A;  3NX0 A;  5KP4 A;  4IPB A;  1IQY A;  2WO0 A;  1MOL A;  4CCV A;  1JKG B;  4HYZ A;  2BO9 B;  3V92 A;  3K0Z A;  2M7O A;  2P38 A;  1YVB I;  2BHM A;  3TDG A;  4FCM A;  1GD4 A;  4LEH A;  1W7C A;  7STD A;  2RFR A;  3CCL 3;  1VZZ A;  2Z77 A;  3CME 3;  3HX8 A;  3JUQ A;  3FG1 A;  5EVH A;  1MNL A;  3PXM A;  3LH4 A;  2K0M A;  4H61 A;  1JKG A;  3MSO A;  4LMI A;  1WMP A;  2BMR B;  2KCD A;  1DVC A;  2PZV A;  3SVA A;  1YI2 3;  2WGQ A;  1YGE A;  1N5H A;  4IT7 A;  1FA3 A;  1LNH A;  1HKX A;  3HII A;  3U97 A;  4WYK A;  1D6Y A;  2CWT A;  1OHS A;  5AYR B;  1NWW A;  4FCJ A;  2W2C A;  4K1V A;  4L8O A;  1M90 4;  2Y73 A;  1ASK A;  3IMA B;  1ROA A;  4BTX A;  5D83 A;  1KSI A;  1NO3 A;  3CCM 3;  3STD A;  4WFO A;  3U1W A;  1LXE A;  4FMB A;  2FNQ A;  2YFL B;  3EN8 A;  2CFG A;  3SED A;  3AMO B;  3NQY A;  2BNG A;  1W6C A;  1FUW A;  3FF0 A;  1N9J A;  2QIY A;  1ROV A;  5STD A;  3QRD A;  3CCR 3;  1ULI B;  1DMN A;  2RCD A;  3I56 3;  5DRE A;  1Q82 4;  3WOE B;  3LT8 A;  1Y4K A;  2PNC A;  2OTJ 3;  3MKI A;  3L0R A;  1BUQ A;  1QMA A;  3D9R A;  5IER A;  3KE7 A;  1F8N A;  1JV2 B;  4R9K A;  2QA4 3;  4HM5 B;  3KSP A;  4OUQ A;  3ECF A;  1W4N A;  3F40 A;  3MG3 A;  4HM0 B;  3Q2P A;  3NBB A;  2XEP A;  3HK4 A;  1HU9 A;  1Q40 B;  4K61 A;  1IVW A;  3Q1C A;  2P05 A;  4KVH A;  2I9W A;  1QAL A;  3N9H A;  1N5P A;  1OHO A;  3DUK A;  4EYC A;  2E2T A;  5JPU A;  3F8H A;  3CNX A;  1K28 A;  4NRE A;  3RDE A;  1YHQ 3;  1J2B A;  2HML B;  3JVC A;  2XGN A;  3DGO A;  4HM6 B;  3EHC A;  3KZT A;  1Q40 A;  4RNZ A;  2W9Q A;  2XR8 B;  1A67 A;  5LC6 A;  1TFO A;  2CFW A;  2BT3 A;  5FGO A;  3GWR A;  2BMQ B;  2XSO B;  3M8C A;  2KXG A;  1O7W B;  3FLJ A;  1KQS 2;  2ML5 A;  3SLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...