1VQO3

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 19
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vqo300
1YJN3 3CPW2 3G713 3OW22 1KC84 1VQ53 3CD63 2OTJ3 1YJW3 3CCU3 1VQK3 1VQM3 3CCL3 1Q824 1YIJ3 1YJ93 2QEX3 1S723 1K9M4 1VQP3 3CCV3 1VQO3 1QVG2 1KD14 3CMA3 1YHQ3 1JJ22 3CCR3 1Q814 1NJI4 1Q7Y4 1VQ63 1K734 1Q864 1VQL3 1VQN3 2QA43 1K8A4 1M1K4 3G4S3 3CC73 1M904 3G6E3 3CME3 1VQ73 3CCJ3 1YI23 3CCE3 1W2B2 3CC23 1VQ43 3I563 1QVF2 1KQS2 3CCQ3 3CCM3 1N8R4 3CXC2 1YIT3 3CCS3 1VQ83 1VQ93 3I553 2OTL3 3CC43
chains in the Genus database with same CATH superfamily
3JUMA 3S5CA 4FMBA 2C10A 2CWTA 5AIFA 3CD63 2UX0A 2P05A 5A0OB 3F8HA 4L8OA 1OPYA 2OOVC 3NXJA 4HYZA 1Q824 1M1XB 1S723 1RMSA 4NREA 3CCV3 2OWPA 1UCIA 3GZRA 4G1MB 1VQ63 3FF2A 1BRSA 4HM5B 5IW9A 1YVBI 5HOHA 1K8A4 1GOUA 3DH2A 1LQGC 4WFOA 4HZ9B 1BNEA 4N6UA 1I8VA 1BRIA 1BSEA 3BNDA 1BOXA 1MNLA 1E97A 3SEDA 1U5OA 1X1XA 1JBTA 3DMCA 4FCJA 1T5YA 2P0MA 1IQYA 3JUPA 3JVCA 3NHXA 3UB1A 1DVDA 1FZUA 4MEIA 4RZMA 2B1XB 1UI8A 2GBXB 2UUGC 2W0QA 2Z77A 4O3VA 3H3HA 3NV0A 4FMAA 1JZOA 3GRDA 3FG4A 1RGCA 4LEHA 2K0MA 3BNEA 4K90B 1JJ22 1SARA 2IA7A 1HKXA 1Z1SA 5HGRA 1M1K4 3KSED 3G4S3 1O7NB 3KFQC 3LH4A 5IEPA 2WOHA 1JZDA 1UW1A 3BB9A 1VQ73 3SOAA 1SIIA 3B8LA 3CC23 4LZIA 3CNMA 4XBTA 1B2UA 1VZZA 1N8R4 3LT8A 2CWUA 5BVBA 1AQZA 3CPOA 1F8NA 1LOYA 3A5EA 3EE1A 1RGKA 2F98A 3LT9A 4HM3B 1BRNL 1WMNA 3WA3A 3MWZA 1GOVA 3T8NA 2M7OA 1YIJ3 2OQEC 1NO3A 1Q42A 3PGBA 2RGQA 4J5KA 1M9GA 1BVIA 3NV0B 1GSPA 3G8ZA 1FGMA 4HM2B 2XSOB 2CFLA 1T2HA 4O2HA 1OGXA 3LTCA 4WWUC 1TFOA 2PZVA 4O8SA 1O7PB 2GU3A 2W9PA 5AYRB 5IENA 1X1UA 4HKVB 3J7Yd 3K9MC 1N9EA 1B2MA 2P09A 2FGTA 1CQSA 4BL2A 3NQYA 4KFDA 4XB5A 3TDGA 1IK3A 1VQ93 2WOFA 3PZWA 1W6YA 4RNZA 3EBTA 2IUJA 1TU5A 1AV4A 3DGOA 2F99A 1DMNA 5M19A 1R4YA 2OOVA 5BXQA 2W6JH 2GXFA 3EF8A 3JUQA 5M1AA 1VQK3 1TJDA 1BUQA 1UGHI 2L4VA 1VQP3 5AEUB 3WR2A 5IG0A 4J8TA 3VF1A 2CFWA 2CFDA 1MGRA 2FXTA 1Y4KA 3CME3 2SBLA 3CCJ3 3CU3A 3DGYA 1PFPA 4RNYA 2XF3A 3CCQ3 1Q7HA 1I3FA 4N6NB 3CCM3 2YX9A 1B21A 1LRAA 3MYTA 6STDA 3MHEA 2W2CA 3PS8A 1EUIC 2BU4A 1GOYA 4H3UA 4NHFA 1C7HA 2H0GA 3X41A 3UJMA 1JV2B 1KC84 3IMAB 3MSOA 3BNBA 1R4CA 4NPBA 2CG1A 1CH0A 2BMOB 1AVKA 2KRTA 1IVUA 4KZ1A 4HZBB 4N3VA 1IVWA 4H61A 4GSPA 2IUKA 2KCDA 7RNTA 3CMA3 1RN7A 2RFRA 2CHCA 1STDA 1O7GB 5IG5A 1US1A 2BMQB 1NJI4 1VQN3 2F5MA 4FMCA 4L7KA 3DY5A 3SYUA 4WYKB 1Q864 1ZS7A 4J9AA 4LMIA 2PNCA 2E2TA 5KP1A 4N6LA 2HMKB 3UL6A 1V57A 2CH9A 2LYXA 3G6E3 5LC7A 3WOFB 3FSDA 4HM4B 3WMDA 1WTHA 1I2FA 5CK6A 1B2ZA 3BU4A 3F7XA 3D9RA 1EA2A 2P0XA 1YJN3 4XBXA 2LQVA 2CFKA 2HMOB 5EVHA 1OHOA 5IF6A 2UGIA 1YVSA 4WYKA 1IU7A 1I70A 2O9UX 3KN4A 3OWYA 3V98A 1BSDA 1QALA 3EHCA 3N9HA 5BU4A 1KD14 1SIHA 1YHQ3 2F5WA 1RGFA 5G1LA 2GU1A 2D42A 2GEYA 4EBGA 1J2BA 5EEOA 1D6YA 1BNGA 1BNRA 2ZL8A 3EQQB 1Q40B 3U1WA 4N6TA 1B3SA 1JKGA 1QAFA 4OVMA 5FGOA 4IPBA 2CWVA 3NUVA 1FGTA 3OV4A 1RNBA 4XM4A 4HBRA 2ML6A 1BGSA 1CYUA 1JB2A 1EEJA 3FLJA 3O8YA 3NM2A 1WQLB 1FUWA 1LVNA 1VQ83 1BNIA 2CX0A 5I97A 1ZO2A 3F9SA 3AMOA 3FG1A 2XGNA 4Q53A 3D5IA 4LYLB 1I2EA 3EBYA 1BIRA 2JQ5A 1RGLA 4BU4A 1MWRA 4R4KA 1YJ93 1SQWA 5TGNA 2RCDA 5D81A 1ULIB 1W00A 1FGRA 2IYJA 4QWTA 4I4KA 2BIRA 3QRDA 3X3ZA 1MOLA 4HJLB 3EN1B 2Z76A 4R9LA 3X40A 2K54A 2ML5A 1OCVA 1RGAA 2K3DA 3M8CA 3AHWA 5STDA 3I563 3HX8A 1UUGB 4HM1B 1O7HB 4HM8B 1JRQA 2XFTA 1GD3A 1WNHA 3K5TA 1YGWA 3V92A 4DKIA 2WGOA 3D5GA 3G0KA 3B7CA 4J5GA 4X2OA 5G2GA 3GZXB 1JBSA 3EN8A 1BSCA 1EQKA 3CC43 4CCVA 1X1YA 3SOYA 1KSIA 5BIRA 3I0YA 1RKYA 1TIJA 5ELJA 4CDLA 1GMQA 4GB5A 4BTWA 3KKGA 2XH9A 4EW5A 7STDA 3FG3A 3WA2X 1SJWA 1Q7Y4 1T2IA 5AEWB 3LTAA 1MWSA 3PXMA 1JB4A 4MJDA 1GD4A 3MPHA 1V74A 1IV9A 1LOVA 4XDVA 4EV2A 3ROBA 1IT7A 3CNXA 1B2SA 3UNLA 5AYSC 3GAXA 4FCMA 4L8PA 2L1SA 3D3LA 3FF0A 3NBRA 1TFKA 5JPPA 1NWWA 2QIYA 4OK0A 5CLKA 4BL3A 3FH1A 7GSPA 1W02A 1RLSA 2OTL3 5IG3A 3G713 1BRJA 1OF5B 2STDA 1GY5A 3UL5A 3LXUX 1ZX2A 3LYGA 4HAAA 2KF6A 3RGAA 5GSPA 2WO0A 4U13A 1RNTA 4AEQA 1Q814 1PYLA 3F8XA 3RNTA 3D79A 1VQL3 1W2ZA 2SARA 5AIGA 4BTYA 3OXAA 3PCSA 3CC73 1BANA 2IMJA 4IIAA 1GY7A 1RHLA 4R1KA 1IVXA 1GY6A 1QJGA 1JB5A 1LQMB 1ASKA 2OCTA 3OX9A 5G1KA 1X1WA 1LOXA 1W5ZA 2C11A 2CFGA 2YFLB 2GSPA 1STFI 5IG4A 1O7MB 2Y74A 3KIIA 1K41A 1YGEA 2RNTA 4GL6A 4HM7B 4KT3B 5AIHA 2CK3H 3AHSA 3CPW2 1RSNA 1TP6A 3FKAA 1VQ53 1BNJA 1YJW3 5KP4A 3NQZA 3MG1A 4BTXA 3G16A 3AGNA 3S29A 2H0IA 1OACA 1RN4A 1RN1A 1SPUA 2I9WA 2MF7A 3LTDA 4CPKA 3K0ZA 4FCZA 1ROAA 2QA43 1WMOA 1OHPA 1GS3A 1TTOA 1BNFA 1BRGA 1FUTA 4FMDA 4K61A 5D82A 2W56A 2BO9B 1M904 1MWUA 1VQ43 3X3XA 1AVLA 1QVF2 1B27A 1Q9EA 4HOHA 2WGQA 2YFIB 3LMLA 3CXC2 1GMRA 1GYBA 3HIIA 1A2PA 1Q40A 1BSAA 2F56A 3LTBA 4K1UA 1RGGA 1EG9B 3NX0A 1N8QA 1ISKA 3GZBA 3Q3FA 2J8XB 4PEJA 4N6MA 1I0VA 3HI7A 3KE7A 1RGHA 4HM6B 4HVNA 1DMMA 1RGEA 4R80A 3X42A 2QEX3 1O7WB 2Z7AA 4EC6A 1VQO3 3FCSB 2INXA 4R9KA 2XRXB 1TRQA 1IV7A 1UCKA 3DUKA 3T8UA 3KCHA 3RDEA 3HZPA 1A90A 4TX4A 2W04A 1OHSA 3D4AA 2BNGA 4JRFA 1U8CB 3MG3A 4FR9A 4O02B 3EC9A 3ZG0A 4AKZA 1B2XA 3DZLA 1I3IA 1W6CA 1UDII 2GBWB 2CC3A 3ALAA 3IPTA 1RDSA 3K7CA 4GHOA 1BUJA 3KSPA 3OWUA 1G96A 4MMZB 4ILFA 3CCU3 4ZM8A 5RNTA 5LC6A 1E3VA 4BIRA 2HMJB 3DXOA 5CXOA 6GSPA 4STDA 1PY3A 3JUNA 1OF5A 2F4YA 1UI7A 3S27A 2FNQA 3JUOA 3ZG5A 2W03A 1I2GA 1NDOB 1E3RA 4JF8A 3PYJA 3VGNA 1W6GA 3N54B 3Q1CA 4HM0B 1NB3I 1W01A 3NBBA 1YI23 1IVVA 2XSHB 1N5PA 3HOHA 1JNQA 3CCS3 2ZDJA 1A2KA 2AADA 3DGLA 3V99A 3WODG 2W56B 3K63A 1BSBA 1AY7A 5IEOA 1OH0A 3EJVA 1FUSA 3N8BA 3MKIA 1IQXA 3HIGA 3SX1A 3Q2PA 3H51A 3S67A 3WHOA 5CF2A 1T3BA 1NB5I 3ER7A 1JN5A 2JDIH 2KF3A 5DRVA 1IYYA 1FW7A 2CW9A 4WP5A 2RBIA 1FYSA 3SVAA 1DYUA 1BAOA 3FGYA 3GZYB 2B24B 2Y73A 1KQS2 3B4PA 2W9QA 1D6UA 4KFEA 8CHOA 2F86B 2O3OA 2A15A 3BNCA 2D1WA 1BNSA 3MG2A 1VQQA 2Z6BA 1G02A 5DREA 3SLUA 3OW22 2XR8B 2IY2A 2OTJ3 1GMPA 1JN5B 1RRLA 1CYVA 1ROVA 3GWRA 3HK4A 1QMAA 1VQM3 1LNIA 1BRKA 4IT7A 4MMYB 5FW5A 3SXXA 1TRPA 1HU9A 1DMQA 2HMNB 3CCR3 1WMPA 5ELUA 4N6V0 1OGZA 1LXEA 8RNTA 4LSOA 2ZHXB 3S28A 2R41A 1LNHA 3PCRA 1UUVB 3B4OA 2HOHA 2BHMA 2YFJB 1RTUA 3LOYA 3STDA 1MWTA 5KP3A 3IJEB 1YIT3 2KF4A 4LGQA 4EXRA 1DE3A 1JKGB 1N5HA 1RCLA 3T0UA 1HYFA 3VSYA 2MC8A 4ORLA 4N6OB 1A2VA 1DETA 1OUNA 1JBRA 1NNVA 2Q07A 1CEWI 2H0HA 2CG0A 2XEPA 1PU4A 1G0TA 4OUQA 4XBYA 1K9M4 1RRHA 1UUWB 1ULJB 1EKMA 1V58A 2XFSA 3LZAA 9RNTA 2RSXA 1YNVX 1KWIA 1DVCA 1HZ1A 2BT3A 2CX1A 3GSPA 3RGRA 1MGWA 2CIUA 5CF1A 4I5QA 6RNTA 3BLZA 3ZFZA 1IDPA 2BMRB 3Q90A 5EQLA 3BIRA 2P38A 1UCJA 2R4IA 1BRHA 2V1LA 3QK9A 4X2HA 3AGOA 1NU3A 3DGMA 3NBJA 4KVHA 1L5GB 1FA3A 4CJNA 1QAKA 5AI1A 2C4BA 1AR0A 2QGUA 1ZGXA 2HMLB 3E99A 1D6ZA 3DGNA 3I553 3WDGB 3EB8A 1C54A 3OWSA 1W4NA 4K1VA 1IQ8A 3NM7A 4EYCA 1A67A 1RCKA 3F14A 4XDWA 3A76A 4EV5A 1IT8A 5JPUA 1RJOA 2CKFB 3U97A 3CCL3 4WHAA 4RNTA 2GEXA 1QVG2 3ECFA 1B20A 3WOEB 2ZA4A 1K734 3F40A 4RBNA 1BU4A 1K28A 5AIIA 5D83A 3L0RA 3DM8A 3X3YA 1LOWA 4KFFA 1TUHA 1W7CA 2E2VA 5IERA 1S5AA 2E2UA 5JBSA 3AMOB 3URPA 1UGIA 1N9JA 3KZTA 3CCE3 5M18A 1W2B2 3F7SA 2XGLA 3FZWA 1FGQA 2KXGA 4MMXB 2HMMB 2OQEA 2KAAA 1I0XA 2AAEA 2KF5A 1UCLA 1FGOA 4AKYA 3EX9A
chains in the Genus database with same CATH topology
3JUMA 3S5CA 4FMBA 2C10A 2CWTA 5AIFA 3CD63 2UX0A 2P05A 5A0OB 3F8HA 4L8OA 1OPYA 2OOVC 3NXJA 4HYZA 1Q824 1M1XB 1S723 4NREA 3CCV3 2OWPA 3GZRA 4G1MB 1VQ63 3FF2A 4HM5B 5IW9A 1YVBI 1K8A4 4WFOA 4HZ9B 4N6UA 3BNDA 3SEDA 1MNLA 1E97A 1U5OA 3DMCA 4FCJA 1T5YA 2P0MA 1IQYA 3JUPA 3JVCA 3NHXA 3UB1A 1DVDA 4MEIA 4RZMA 2B1XB 1UI8A 2GBXB 2W0QA 2Z77A 4O3VA 3H3HA 3NV0A 4FMAA 3GRDA 3FG4A 4LEHA 2K0MA 3BNEA 4K90B 1JJ22 2IA7A 1HKXA 1Z1SA 5HGRA 1M1K4 3KSED 3G4S3 1O7NB 3KFQC 3LH4A 2WOHA 1VQ73 1UW1A 3BB9A 3SOAA 1SIIA 3B8LA 3CC23 4LZIA 3CNMA 4XBTA 1VZZA 1N8R4 3LT8A 2CWUA 5BVBA 3CPOA 1F8NA 3EE1A 2F98A 3LT9A 4HM3B 1WMNA 3WA3A 3MWZA 3T8NA 1YIJ3 2M7OA 2OQEC 1NO3A 1Q42A 3PGBA 2RGQA 1M9GA 3NV0B 3G8ZA 1FGMA 4HM2B 2XSOB 2CFLA 4O2HA 1OGXA 3LTCA 4WWUC 1TFOA 2PZVA 4O8SA 1O7PB 2GU3A 2W9PA 5AYRB 5IENA 3J7Yd 4HKVB 3K9MC 1N9EA 2P09A 2FGTA 1CQSA 3NQYA 4KFDA 4XB5A 3TDGA 1IK3A 1VQ93 2WOFA 3PZWA 1W6YA 4RNZA 3EBTA 2IUJA 1TU5A 1AV4A 3DGOA 2F99A 1DMNA 2OOVA 5BXQA 2W6JH 2GXFA 3EF8A 3JUQA 1VQK3 1BUQA 2L4VA 1VQP3 5AEUB 5IG0A 4J8TA 3VF1A 2CFWA 2CFDA 2FXTA 1Y4KA 3CME3 2SBLA 3CCJ3 3CU3A 1PFPA 4RNYA 2XF3A 3CCQ3 4N6NB 3CCM3 2YX9A 6STDA 3MYTA 3MHEA 2W2CA 3PS8A 4H3UA 4NHFA 1C7HA 3X41A 3UJMA 1JV2B 1KC84 3IMAB 3MSOA 3BNBA 1R4CA 2CG1A 5KP4A 2BMOB 1AVKA 2KRTA 1IVUA 4KZ1A 4HZBB 4N3VA 1IVWA 4H61A 2IUKA 2KCDA 3CMA3 1RN7A 2RFRA 2CHCA 1STDA 1O7GB 5IG5A 1US1A 2BMQB 1NJI4 1VQN3 4FMCA 4L7KA 1Q864 3DY5A 4WYKB 4J9AA 4LMIA 2PNCA 2E2TA 5KP1A 4N6LA 2HMKB 3UL6A 2CH9A 2LYXA 3G6E3 5LC7A 3WOFB 3FSDA 4HM4B 3WMDA 1WTHA 5CK6A 3F7XA 3D9RA 1EA2A 2P0XA 1YJN3 4XBXA 2LQVA 2CFKA 2HMOB 5EVHA 1OHOA 5IF6A 4WYKA 1IU7A 2O9UX 3KN4A 3OWYA 3V98A 1QALA 3EHCA 3N9HA 1KD14 1SIHA 1YHQ3 2GU1A 2D42A 2GEYA 4EBGA 1J2BA 5EEOA 1D6YA 2ZL8A 3EQQB 1Q40B 3U1WA 4N6TA 1JKGA 1QAFA 4OVMA 5FGOA 4IPBA 2CWVA 3NUVA 1FGTA 3OV4A 4XM4A 4HBRA 2ML6A 1CYUA 1JB2A 3FLJA 3O8YA 3NM2A 1WQLB 1FUWA 1LVNA 1VQ83 5I97A 1ZO2A 3F9SA 3AMOA 3FG1A 2XGNA 4Q53A 3EBYA 2JQ5A 4R4KA 1YJ93 1SQWA 5TGNA 2RCDA 5D81A 1ULIB 1W00A 1FGRA 4QWTA 4I4KA 3QRDA 3X3ZA 1MOLA 4HJLB 3EN1B 2Z76A 4R9LA 3X40A 2K54A 2ML5A 1OCVA 3M8CA 5STDA 3I563 3HX8A 4HM1B 1O7HB 4HM8B 1JRQA 2XFTA 1GD3A 1WNHA 3K5TA 3V92A 5IEPA 2WGOA 5G2GA 3G0KA 3B7CA 4X2OA 1EQKA 3GZXB 3EN8A 3CC43 4CCVA 3SOYA 1KSIA 3I0YA 1RKYA 1TIJA 5ELJA 4CDLA 4GB5A 4BTWA 3KKGA 2XH9A 7STDA 3FG3A 3WA2X 1SJWA 1Q7Y4 5AEWB 3LTAA 3PXMA 1JB4A 4MJDA 1GD4A 3MPHA 1V74A 1IV9A 4XDVA 4EV2A 3ROBA 1IT7A 3CNXA 3UNLA 5AYSC 3GAXA 4FCMA 4L8PA 3D3LA 3FF0A 3NBRA 1TFKA 5JPPA 1NWWA 2QIYA 4OK0A 5CLKA 3FH1A 1W02A 2OTL3 5IG3A 3G713 1OF5B 2STDA 1GY5A 3UL5A 3LXUX 1ZX2A 3LYGA 3RGAA 2WO0A 4U13A 4AEQA 1Q814 3F8XA 1VQL3 1W2ZA 5AIGA 4BTYA 3OXAA 3PCSA 3CC73 2IMJA 4IIAA 1GY7A 4R1KA 1IVXA 1GY6A 1QJGA 1JB5A 2OCTA 1ASKA 3OX9A 1LOXA 1W5ZA 2C11A 2CFGA 2YFLB 1STFI 5IG4A 1O7MB 2Y74A 3KIIA 1K41A 1YGEA 4GL6A 4HM7B 5AIHA 2CK3H 3CPW2 1TP6A 3FKAA 1VQ53 1YJW3 3NQZA 3MG1A 4BTXA 3G16A 3S29A 1OACA 1SPUA 2I9WA 2MF7A 3LTDA 3K0ZA 4FCZA 1ROAA 2QA43 1WMOA 1OHPA 1GS3A 5D82A 4FMDA 1M904 4K61A 2W56A 2BO9B 1VQ43 3X3XA 1AVLA 1QVF2 2WGQA 2YFIB 3LMLA 3CXC2 1GYBA 3HIIA 1Q40A 3LTBA 4K1UA 1EG9B 3NX0A 1N8QA 1ISKA 3GZBA 4PEJA 4N6MA 3HI7A 3KE7A 4HM6B 4HVNA 1DMMA 4R80A 3X42A 2QEX3 1O7WB 2Z7AA 4EC6A 1VQO3 3FCSB 2INXA 4R9KA 2XRXB 1IV7A 3DUKA 3T8UA 3RDEA 3HZPA 1A90A 4TX4A 2W04A 4JRFA 2BNGA 1U8CB 3MG3A 4FR9A 4O02B 3EC9A 4AKZA 3DZLA 1W6CA 2GBWB 2CC3A 3ALAA 3IPTA 3K7CA 3KSPA 3OWUA 1G96A 4MMZB 3CCU3 4ZM8A 5LC6A 1E3VA 2HMJB 3DXOA 5CXOA 4STDA 3JUNA 1OF5A 1UI7A 3S27A 2FNQA 3JUOA 2W03A 1NDOB 1E3RA 4JF8A 3PYJA 3VGNA 1W6GA 3N54B 3Q1CA 4HM0B 1NB3I 1W01A 3NBBA 1YI23 1IVVA 2XSHB 1N5PA 1JNQA 3CCS3 2ZDJA 1A2KA 3DGLA 3V99A 3WODG 2W56B 3K63A 5IEOA 1OH0A 3EJVA 3N8BA 3MKIA 1IQXA 3HIGA 3SX1A 3Q2PA 3H51A 3S67A 5CF2A 1NB5I 3ER7A 1JN5A 2JDIH 5DRVA 2CW9A 4WP5A 3SVAA 1DYUA 3FGYA 3GZYB 2B24B 2Y73A 1KQS2 3B4PA 2W9QA 1D6UA 4KFEA 8CHOA 2F86B 2O3OA 2A15A 3BNCA 2D1WA 3MG2A 2Z6BA 5DREA 3SLUA 3OW22 2XR8B 2OTJ3 1JN5B 1RRLA 1CYVA 1ROVA 3GWRA 3HK4A 1QMAA 1VQM3 4IT7A 4MMYB 5FW5A 3SXXA 1HU9A 1DMQA 2HMNB 3CCR3 1WMPA 5ELUA 4N6V0 1OGZA 1LXEA 4LSOA 3S28A 1LNHA 3PCRA 1UUVB 3B4OA 2BHMA 2YFJB 3LOYA 3STDA 5KP3A 3IJEB 1YIT3 4LGQA 4EXRA 1JKGB 1N5HA 3T0UA 3VSYA 2MC8A 4ORLA 4N6OB 1A2VA 1OUNA 2Q07A 1CEWI 2XEPA 2CG0A 1PU4A 4OUQA 4XBYA 1K9M4 1RRHA 1UUWB 1ULJB 1EKMA 2XFSA 3LZAA 2RSXA 1KWIA 1DVCA 2BT3A 3RGRA 2CIUA 5CF1A 3BLZA 1IDPA 2BMRB 3Q90A 5EQLA 2P38A 2R4IA 4X2HA 2V1LA 3QK9A 1FA3A 1NU3A 3DGMA 3NBJA 4KVHA 1L5GB 1QAKA 5AI1A 1AR0A 2QGUA 2HMLB 3E99A 3I553 1D6ZA 3DGNA 3WDGB 3EB8A 3OWSA 1W4NA 4K1VA 1IQ8A 3NM7A 4EYCA 1A67A 3F14A 4XDWA 3A76A 4EV5A 1IT8A 5JPUA 1RJOA 2CKFB 3U97A 3CCL3 4WHAA 2GEXA 1QVG2 3ECFA 3WOEB 1K734 3F40A 4RBNA 5AIIA 1K28A 5D83A 3X3YA 3L0RA 3DM8A 4KFFA 1TUHA 1W7CA 2E2VA 5IERA 1S5AA 2E2UA 5JBSA 3AMOB 1N9JA 3KZTA 3CCE3 1W2B2 3F7SA 2XGLA 3FZWA 1FGQA 2KXGA 4MMXB 2HMMB 2OQEA 1OHSA 1FGOA 4AKYA 3EX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN 3;  3CPW 2;  3G71 3;  3OW2 2;  1KC8 4;  1VQ5 3;  3CD6 3;  2OTJ 3;  1YJW 3;  3CCU 3;  1VQK 3;  1VQM 3;  3CCL 3;  1Q82 4;  1YIJ 3;  1YJ9 3;  2QEX 3;  1S72 3;  1K9M 4;  1VQP 3;  3CCV 3;  1VQO 3;  1QVG 2;  1KD1 4;  3CMA 3;  1YHQ 3;  1JJ2 2;  3CCR 3;  1Q81 4;  1NJI 4;  1Q7Y 4;  1VQ6 3;  1K73 4;  1Q86 4;  1VQL 3;  1VQN 3;  2QA4 3;  1K8A 4;  1M1K 4;  3G4S 3;  3CC7 3;  1M90 4;  3G6E 3;  3CME 3;  1VQ7 3;  3CCJ 3;  1YI2 3;  3CCE 3;  1W2B 2;  3CC2 3;  1VQ4 3;  3I56 3;  1QVF 2;  1KQS 2;  3CCQ 3;  3CCM 3;  1N8R 4;  3CXC 2;  1YIT 3;  3CCS 3;  1VQ8 3;  1VQ9 3;  3I55 3;  2OTL 3;  3CC4 3; 
#chains in the Genus database with same CATH topology
 3JUM A;  3S5C A;  4FMB A;  2C10 A;  2CWT A;  5AIF A;  3CD6 3;  2UX0 A;  2P05 A;  5A0O B;  3F8H A;  4L8O A;  1OPY A;  2OOV C;  3NXJ A;  4HYZ A;  1Q82 4;  1M1X B;  1S72 3;  1RMS A;  4NRE A;  3CCV 3;  2OWP A;  1UCI A;  3GZR A;  4G1M B;  1VQ6 3;  3FF2 A;  1BRS A;  4HM5 B;  5IW9 A;  1YVB I;  5HOH A;  1K8A 4;  1GOU A;  3DH2 A;  1LQG C;  4WFO A;  4HZ9 B;  1BNE A;  4N6U A;  1I8V A;  1BRI A;  1BSE A;  3BND A;  1BOX A;  1MNL A;  1E97 A;  3SED A;  1U5O A;  1X1X A;  1JBT A;  3DMC A;  4FCJ A;  1T5Y A;  2P0M A;  1IQY A;  3JUP A;  3JVC A;  3NHX A;  3UB1 A;  1DVD A;  1FZU A;  4MEI A;  4RZM A;  2B1X B;  1UI8 A;  2GBX B;  2UUG C;  2W0Q A;  2Z77 A;  4O3V A;  3H3H A;  3NV0 A;  4FMA A;  1JZO A;  3GRD A;  3FG4 A;  1RGC A;  4LEH A;  2K0M A;  3BNE A;  4K90 B;  1JJ2 2;  1SAR A;  2IA7 A;  1HKX A;  1Z1S A;  5HGR A;  1M1K 4;  3KSE D;  3G4S 3;  1O7N B;  3KFQ C;  3LH4 A;  5IEP A;  2WOH A;  1JZD A;  1UW1 A;  3BB9 A;  1VQ7 3;  3SOA A;  1SII A;  3B8L A;  3CC2 3;  4LZI A;  3CNM A;  4XBT A;  1B2U A;  1VZZ A;  1N8R 4;  3LT8 A;  2CWU A;  5BVB A;  1AQZ A;  3CPO A;  1F8N A;  1LOY A;  3A5E A;  3EE1 A;  1RGK A;  2F98 A;  3LT9 A;  4HM3 B;  1BRN L;  1WMN A;  3WA3 A;  3MWZ A;  1GOV A;  3T8N A;  2M7O A;  1YIJ 3;  2OQE C;  1NO3 A;  1Q42 A;  3PGB A;  2RGQ A;  4J5K A;  1M9G A;  1BVI A;  3NV0 B;  1GSP A;  3G8Z A;  1FGM A;  4HM2 B;  2XSO B;  2CFL A;  1T2H A;  4O2H A;  1OGX A;  3LTC A;  4WWU C;  1TFO A;  2PZV A;  4O8S A;  1O7P B;  2GU3 A;  2W9P A;  5AYR B;  5IEN A;  1X1U A;  4HKV B;  3J7Y d;  3K9M C;  1N9E A;  1B2M A;  2P09 A;  2FGT A;  1CQS A;  4BL2 A;  3NQY A;  4KFD A;  4XB5 A;  3TDG A;  1IK3 A;  1VQ9 3;  2WOF A;  3PZW A;  1W6Y A;  4RNZ A;  3EBT A;  2IUJ A;  1TU5 A;  1AV4 A;  3DGO A;  2F99 A;  1DMN A;  5M19 A;  1R4Y A;  2OOV A;  5BXQ A;  2W6J H;  2GXF A;  3EF8 A;  3JUQ A;  5M1A A;  1VQK 3;  1TJD A;  1BUQ A;  1UGH I;  2L4V A;  1VQP 3;  5AEU B;  3WR2 A;  5IG0 A;  4J8T A;  3VF1 A;  2CFW A;  2CFD A;  1MGR A;  2FXT A;  1Y4K A;  3CME 3;  2SBL A;  3CCJ 3;  3CU3 A;  3DGY A;  1PFP A;  4RNY A;  2XF3 A;  3CCQ 3;  1Q7H A;  1I3F A;  4N6N B;  3CCM 3;  2YX9 A;  1B21 A;  1LRA A;  3MYT A;  6STD A;  3MHE A;  2W2C A;  3PS8 A;  1EUI C;  2BU4 A;  1GOY A;  4H3U A;  4NHF A;  1C7H A;  2H0G A;  3X41 A;  3UJM A;  1JV2 B;  1KC8 4;  3IMA B;  3MSO A;  3BNB A;  1R4C A;  4NPB A;  2CG1 A;  1CH0 A;  2BMO B;  1AVK A;  2KRT A;  1IVU A;  4KZ1 A;  4HZB B;  4N3V A;  1IVW A;  4H61 A;  4GSP A;  2IUK A;  2KCD A;  7RNT A;  3CMA 3;  1RN7 A;  2RFR A;  2CHC A;  1STD A;  1O7G B;  5IG5 A;  1US1 A;  2BMQ B;  1NJI 4;  1VQN 3;  2F5M A;  4FMC A;  4L7K A;  3DY5 A;  3SYU A;  4WYK B;  1Q86 4;  1ZS7 A;  4J9A A;  4LMI A;  2PNC A;  2E2T A;  5KP1 A;  4N6L A;  2HMK B;  3UL6 A;  1V57 A;  2CH9 A;  2LYX A;  3G6E 3;  5LC7 A;  3WOF B;  3FSD A;  4HM4 B;  3WMD A;  1WTH A;  1I2F A;  5CK6 A;  1B2Z A;  3BU4 A;  3F7X A;  3D9R A;  1EA2 A;  2P0X A;  1YJN 3;  4XBX A;  2LQV A;  2CFK A;  2HMO B;  5EVH A;  1OHO A;  5IF6 A;  2UGI A;  1YVS A;  4WYK A;  1IU7 A;  1I70 A;  2O9U X;  3KN4 A;  3OWY A;  3V98 A;  1BSD A;  1QAL A;  3EHC A;  3N9H A;  5BU4 A;  1KD1 4;  1SIH A;  1YHQ 3;  2F5W A;  1RGF A;  5G1L A;  2GU1 A;  2D42 A;  2GEY A;  4EBG A;  1J2B A;  5EEO A;  1D6Y A;  1BNG A;  1BNR A;  2ZL8 A;  3EQQ B;  1Q40 B;  3U1W A;  4N6T A;  1B3S A;  1JKG A;  1QAF A;  4OVM A;  5FGO A;  4IPB A;  2CWV A;  3NUV A;  1FGT A;  3OV4 A;  1RNB A;  4XM4 A;  4HBR A;  2ML6 A;  1BGS A;  1CYU A;  1JB2 A;  1EEJ A;  3FLJ A;  3O8Y A;  3NM2 A;  1WQL B;  1FUW A;  1LVN A;  1VQ8 3;  1BNI A;  2CX0 A;  5I97 A;  1ZO2 A;  3F9S A;  3AMO A;  3FG1 A;  2XGN A;  4Q53 A;  3D5I A;  4LYL B;  1I2E A;  3EBY A;  1BIR A;  2JQ5 A;  1RGL A;  4BU4 A;  1MWR A;  4R4K A;  1YJ9 3;  1SQW A;  5TGN A;  2RCD A;  5D81 A;  1ULI B;  1W00 A;  1FGR A;  2IYJ A;  4QWT A;  4I4K A;  2BIR A;  3QRD A;  3X3Z A;  1MOL A;  4HJL B;  3EN1 B;  2Z76 A;  4R9L A;  3X40 A;  2K54 A;  2ML5 A;  1OCV A;  1RGA A;  2K3D A;  3M8C A;  3AHW A;  5STD A;  3I56 3;  3HX8 A;  1UUG B;  4HM1 B;  1O7H B;  4HM8 B;  1JRQ A;  2XFT A;  1GD3 A;  1WNH A;  3K5T A;  1YGW A;  3V92 A;  4DKI A;  2WGO A;  3D5G A;  3G0K A;  3B7C A;  4J5G A;  4X2O A;  5G2G A;  3GZX B;  1JBS A;  3EN8 A;  1BSC A;  1EQK A;  3CC4 3;  4CCV A;  1X1Y A;  3SOY A;  1KSI A;  5BIR A;  3I0Y A;  1RKY A;  1TIJ A;  5ELJ A;  4CDL A;  1GMQ A;  4GB5 A;  4BTW A;  3KKG A;  2XH9 A;  4EW5 A;  7STD A;  3FG3 A;  3WA2 X;  1SJW A;  1Q7Y 4;  1T2I A;  5AEW B;  3LTA A;  1MWS A;  3PXM A;  1JB4 A;  4MJD A;  1GD4 A;  3MPH A;  1V74 A;  1IV9 A;  1LOV A;  4XDV A;  4EV2 A;  3ROB A;  1IT7 A;  3CNX A;  1B2S A;  3UNL A;  5AYS C;  3GAX A;  4FCM A;  4L8P A;  2L1S A;  3D3L A;  3FF0 A;  3NBR A;  1TFK A;  5JPP A;  1NWW A;  2QIY A;  4OK0 A;  5CLK A;  4BL3 A;  3FH1 A;  7GSP A;  1W02 A;  1RLS A;  2OTL 3;  5IG3 A;  3G71 3;  1BRJ A;  1OF5 B;  2STD A;  1GY5 A;  3UL5 A;  3LXU X;  1ZX2 A;  3LYG A;  4HAA A;  2KF6 A;  3RGA A;  5GSP A;  2WO0 A;  4U13 A;  1RNT A;  4AEQ A;  1Q81 4;  1PYL A;  3F8X A;  3RNT A;  3D79 A;  1VQL 3;  1W2Z A;  2SAR A;  5AIG A;  4BTY A;  3OXA A;  3PCS A;  3CC7 3;  1BAN A;  2IMJ A;  4IIA A;  1GY7 A;  1RHL A;  4R1K A;  1IVX A;  1GY6 A;  1QJG A;  1JB5 A;  1LQM B;  1ASK A;  2OCT A;  3OX9 A;  5G1K A;  1X1W A;  1LOX A;  1W5Z A;  2C11 A;  2CFG A;  2YFL B;  2GSP A;  1STF I;  5IG4 A;  1O7M B;  2Y74 A;  3KII A;  1K41 A;  1YGE A;  2RNT A;  4GL6 A;  4HM7 B;  4KT3 B;  5AIH A;  2CK3 H;  3AHS A;  3CPW 2;  1RSN A;  1TP6 A;  3FKA A;  1VQ5 3;  1BNJ A;  1YJW 3;  5KP4 A;  3NQZ A;  3MG1 A;  4BTX A;  3G16 A;  3AGN A;  3S29 A;  2H0I A;  1OAC A;  1RN4 A;  1RN1 A;  1SPU A;  2I9W A;  2MF7 A;  3LTD A;  4CPK A;  3K0Z A;  4FCZ A;  1ROA A;  2QA4 3;  1WMO A;  1OHP A;  1GS3 A;  1TTO A;  1BNF A;  1BRG A;  1FUT A;  4FMD A;  4K61 A;  5D82 A;  2W56 A;  2BO9 B;  1M90 4;  1MWU A;  1VQ4 3;  3X3X A;  1AVL A;  1QVF 2;  1B27 A;  1Q9E A;  4HOH A;  2WGQ A;  2YFI B;  3LML A;  3CXC 2;  1GMR A;  1GYB A;  3HII A;  1A2P A;  1Q40 A;  1BSA A;  2F56 A;  3LTB A;  4K1U A;  1RGG A;  1EG9 B;  3NX0 A;  1N8Q A;  1ISK A;  3GZB A;  3Q3F A;  2J8X B;  4PEJ A;  4N6M A;  1I0V A;  3HI7 A;  3KE7 A;  1RGH A;  4HM6 B;  4HVN A;  1DMM A;  1RGE A;  4R80 A;  3X42 A;  2QEX 3;  1O7W B;  2Z7A A;  4EC6 A;  1VQO 3;  3FCS B;  2INX A;  4R9K A;  2XRX B;  1TRQ A;  1IV7 A;  1UCK A;  3DUK A;  3T8U A;  3KCH A;  3RDE A;  3HZP A;  1A90 A;  4TX4 A;  2W04 A;  1OHS A;  3D4A A;  2BNG A;  4JRF A;  1U8C B;  3MG3 A;  4FR9 A;  4O02 B;  3EC9 A;  3ZG0 A;  4AKZ A;  1B2X A;  3DZL A;  1I3I A;  1W6C A;  1UDI I;  2GBW B;  2CC3 A;  3ALA A;  3IPT A;  1RDS A;  3K7C A;  4GHO A;  1BUJ A;  3KSP A;  3OWU A;  1G96 A;  4MMZ B;  4ILF A;  3CCU 3;  4ZM8 A;  5RNT A;  5LC6 A;  1E3V A;  4BIR A;  2HMJ B;  3DXO A;  5CXO A;  6GSP A;  4STD A;  1PY3 A;  3JUN A;  1OF5 A;  2F4Y A;  1UI7 A;  3S27 A;  2FNQ A;  3JUO A;  3ZG5 A;  2W03 A;  1I2G A;  1NDO B;  1E3R A;  4JF8 A;  3PYJ A;  3VGN A;  1W6G A;  3N54 B;  3Q1C A;  4HM0 B;  1NB3 I;  1W01 A;  3NBB A;  1YI2 3;  1IVV A;  2XSH B;  1N5P A;  3HOH A;  1JNQ A;  3CCS 3;  2ZDJ A;  1A2K A;  2AAD A;  3DGL A;  3V99 A;  3WOD G;  2W56 B;  3K63 A;  1BSB A;  1AY7 A;  5IEO A;  1OH0 A;  3EJV A;  1FUS A;  3N8B A;  3MKI A;  1IQX A;  3HIG A;  3SX1 A;  3Q2P A;  3H51 A;  3S67 A;  3WHO A;  5CF2 A;  1T3B A;  1NB5 I;  3ER7 A;  1JN5 A;  2JDI H;  2KF3 A;  5DRV A;  1IYY A;  1FW7 A;  2CW9 A;  4WP5 A;  2RBI A;  1FYS A;  3SVA A;  1DYU A;  1BAO A;  3FGY A;  3GZY B;  2B24 B;  2Y73 A;  1KQS 2;  3B4P A;  2W9Q A;  1D6U A;  4KFE A;  8CHO A;  2F86 B;  2O3O A;  2A15 A;  3BNC A;  2D1W A;  1BNS A;  3MG2 A;  1VQQ A;  2Z6B A;  1G02 A;  5DRE A;  3SLU A;  3OW2 2;  2XR8 B;  2IY2 A;  2OTJ 3;  1GMP A;  1JN5 B;  1RRL A;  1CYV A;  1ROV A;  3GWR A;  3HK4 A;  1QMA A;  1VQM 3;  1LNI A;  1BRK A;  4IT7 A;  4MMY B;  5FW5 A;  3SXX A;  1TRP A;  1HU9 A;  1DMQ A;  2HMN B;  3CCR 3;  1WMP A;  5ELU A;  4N6V 0;  1OGZ A;  1LXE A;  8RNT A;  4LSO A;  2ZHX B;  3S28 A;  2R41 A;  1LNH A;  3PCR A;  1UUV B;  3B4O A;  2HOH A;  2BHM A;  2YFJ B;  1RTU A;  3LOY A;  3STD A;  1MWT A;  5KP3 A;  3IJE B;  1YIT 3;  2KF4 A;  4LGQ A;  4EXR A;  1DE3 A;  1JKG B;  1N5H A;  1RCL A;  3T0U A;  1HYF A;  3VSY A;  2MC8 A;  4ORL A;  4N6O B;  1A2V A;  1DET A;  1OUN A;  1JBR A;  1NNV A;  2Q07 A;  1CEW I;  2H0H A;  2CG0 A;  2XEP A;  1PU4 A;  1G0T A;  4OUQ A;  4XBY A;  1K9M 4;  1RRH A;  1UUW B;  1ULJ B;  1EKM A;  1V58 A;  2XFS A;  3LZA A;  9RNT A;  2RSX A;  1YNV X;  1KWI A;  1DVC A;  1HZ1 A;  2BT3 A;  2CX1 A;  3GSP A;  3RGR A;  1MGW A;  2CIU A;  5CF1 A;  4I5Q A;  6RNT A;  3BLZ A;  3ZFZ A;  1IDP A;  2BMR B;  3Q90 A;  5EQL A;  3BIR A;  2P38 A;  1UCJ A;  2R4I A;  1BRH A;  2V1L A;  3QK9 A;  4X2H A;  3AGO A;  1NU3 A;  3DGM A;  3NBJ A;  4KVH A;  1L5G B;  1FA3 A;  4CJN A;  1QAK A;  5AI1 A;  2C4B A;  1AR0 A;  2QGU A;  1ZGX A;  2HML B;  3E99 A;  1D6Z A;  3DGN A;  3I55 3;  3WDG B;  3EB8 A;  1C54 A;  3OWS A;  1W4N A;  4K1V A;  1IQ8 A;  3NM7 A;  4EYC A;  1A67 A;  1RCK A;  3F14 A;  4XDW A;  3A76 A;  4EV5 A;  1IT8 A;  5JPU A;  1RJO A;  2CKF B;  3U97 A;  3CCL 3;  4WHA A;  4RNT A;  2GEX A;  1QVG 2;  3ECF A;  1B20 A;  3WOE B;  2ZA4 A;  1K73 4;  3F40 A;  4RBN A;  1BU4 A;  1K28 A;  5AII A;  5D83 A;  3L0R A;  3DM8 A;  3X3Y A;  1LOW A;  4KFF A;  1TUH A;  1W7C A;  2E2V A;  5IER A;  1S5A A;  2E2U A;  5JBS A;  3AMO B;  3URP A;  1UGI A;  1N9J A;  3KZT A;  3CCE 3;  5M18 A;  1W2B 2;  3F7S A;  2XGL A;  3FZW A;  1FGQ A;  2KXG A;  4MMX B;  2HMM B;  2OQE A;  2KAA A;  1I0X A;  2AAE A;  2KF5 A;  1UCL A;  1FGO A;  4AKY A;  3EX9 A; 
#chains in the Genus database with same CATH homology
 3JUM A;  3S5C A;  4FMB A;  2C10 A;  2CWT A;  5AIF A;  3CD6 3;  2UX0 A;  2P05 A;  5A0O B;  3F8H A;  4L8O A;  1OPY A;  2OOV C;  3NXJ A;  4HYZ A;  1Q82 4;  1M1X B;  1S72 3;  4NRE A;  3CCV 3;  2OWP A;  3GZR A;  4G1M B;  1VQ6 3;  3FF2 A;  4HM5 B;  5IW9 A;  1YVB I;  1K8A 4;  4WFO A;  4HZ9 B;  4N6U A;  3BND A;  3SED A;  1MNL A;  1E97 A;  1U5O A;  3DMC A;  4FCJ A;  1T5Y A;  2P0M A;  1IQY A;  3JUP A;  3JVC A;  3NHX A;  3UB1 A;  1DVD A;  4MEI A;  4RZM A;  2B1X B;  1UI8 A;  2GBX B;  2W0Q A;  2Z77 A;  4O3V A;  3H3H A;  3NV0 A;  4FMA A;  3GRD A;  3FG4 A;  4LEH A;  2K0M A;  3BNE A;  4K90 B;  1JJ2 2;  2IA7 A;  1HKX A;  1Z1S A;  5HGR A;  1M1K 4;  3KSE D;  3G4S 3;  1O7N B;  3KFQ C;  3LH4 A;  2WOH A;  1VQ7 3;  1UW1 A;  3BB9 A;  3SOA A;  1SII A;  3B8L A;  3CC2 3;  4LZI A;  3CNM A;  4XBT A;  1VZZ A;  1N8R 4;  3LT8 A;  2CWU A;  5BVB A;  3CPO A;  1F8N A;  3EE1 A;  2F98 A;  3LT9 A;  4HM3 B;  1WMN A;  3WA3 A;  3MWZ A;  3T8N A;  1YIJ 3;  2M7O A;  2OQE C;  1NO3 A;  1Q42 A;  3PGB A;  2RGQ A;  1M9G A;  3NV0 B;  3G8Z A;  1FGM A;  4HM2 B;  2XSO B;  2CFL A;  4O2H A;  1OGX A;  3LTC A;  4WWU C;  1TFO A;  2PZV A;  4O8S A;  1O7P B;  2GU3 A;  2W9P A;  5AYR B;  5IEN A;  3J7Y d;  4HKV B;  3K9M C;  1N9E A;  2P09 A;  2FGT A;  1CQS A;  3NQY A;  4KFD A;  4XB5 A;  3TDG A;  1IK3 A;  1VQ9 3;  2WOF A;  3PZW A;  1W6Y A;  4RNZ A;  3EBT A;  2IUJ A;  1TU5 A;  1AV4 A;  3DGO A;  2F99 A;  1DMN A;  2OOV A;  5BXQ A;  2W6J H;  2GXF A;  3EF8 A;  3JUQ A;  1VQK 3;  1BUQ A;  2L4V A;  1VQP 3;  5AEU B;  5IG0 A;  4J8T A;  3VF1 A;  2CFW A;  2CFD A;  2FXT A;  1Y4K A;  3CME 3;  2SBL A;  3CCJ 3;  3CU3 A;  1PFP A;  4RNY A;  2XF3 A;  3CCQ 3;  4N6N B;  3CCM 3;  2YX9 A;  6STD A;  3MYT A;  3MHE A;  2W2C A;  3PS8 A;  4H3U A;  4NHF A;  1C7H A;  3X41 A;  3UJM A;  1JV2 B;  1KC8 4;  3IMA B;  3MSO A;  3BNB A;  1R4C A;  2CG1 A;  5KP4 A;  2BMO B;  1AVK A;  2KRT A;  1IVU A;  4KZ1 A;  4HZB B;  4N3V A;  1IVW A;  4H61 A;  2IUK A;  2KCD A;  3CMA 3;  1RN7 A;  2RFR A;  2CHC A;  1STD A;  1O7G B;  5IG5 A;  1US1 A;  2BMQ B;  1NJI 4;  1VQN 3;  4FMC A;  4L7K A;  1Q86 4;  3DY5 A;  4WYK B;  4J9A A;  4LMI A;  2PNC A;  2E2T A;  5KP1 A;  4N6L A;  2HMK B;  3UL6 A;  2CH9 A;  2LYX A;  3G6E 3;  5LC7 A;  3WOF B;  3FSD A;  4HM4 B;  3WMD A;  1WTH A;  5CK6 A;  3F7X A;  3D9R A;  1EA2 A;  2P0X A;  1YJN 3;  4XBX A;  2LQV A;  2CFK A;  2HMO B;  5EVH A;  1OHO A;  5IF6 A;  4WYK A;  1IU7 A;  2O9U X;  3KN4 A;  3OWY A;  3V98 A;  1QAL A;  3EHC A;  3N9H A;  1KD1 4;  1SIH A;  1YHQ 3;  2GU1 A;  2D42 A;  2GEY A;  4EBG A;  1J2B A;  5EEO A;  1D6Y A;  2ZL8 A;  3EQQ B;  1Q40 B;  3U1W A;  4N6T A;  1JKG A;  1QAF A;  4OVM A;  5FGO A;  4IPB A;  2CWV A;  3NUV A;  1FGT A;  3OV4 A;  4XM4 A;  4HBR A;  2ML6 A;  1CYU A;  1JB2 A;  3FLJ A;  3O8Y A;  3NM2 A;  1WQL B;  1FUW A;  1LVN A;  1VQ8 3;  5I97 A;  1ZO2 A;  3F9S A;  3AMO A;  3FG1 A;  2XGN A;  4Q53 A;  3EBY A;  2JQ5 A;  4R4K A;  1YJ9 3;  1SQW A;  5TGN A;  2RCD A;  5D81 A;  1ULI B;  1W00 A;  1FGR A;  4QWT A;  4I4K A;  3QRD A;  3X3Z A;  1MOL A;  4HJL B;  3EN1 B;  2Z76 A;  4R9L A;  3X40 A;  2K54 A;  2ML5 A;  1OCV A;  3M8C A;  5STD A;  3I56 3;  3HX8 A;  4HM1 B;  1O7H B;  4HM8 B;  1JRQ A;  2XFT A;  1GD3 A;  1WNH A;  3K5T A;  3V92 A;  5IEP A;  2WGO A;  5G2G A;  3G0K A;  3B7C A;  4X2O A;  1EQK A;  3GZX B;  3EN8 A;  3CC4 3;  4CCV A;  3SOY A;  1KSI A;  3I0Y A;  1RKY A;  1TIJ A;  5ELJ A;  4CDL A;  4GB5 A;  4BTW A;  3KKG A;  2XH9 A;  7STD A;  3FG3 A;  3WA2 X;  1SJW A;  1Q7Y 4;  5AEW B;  3LTA A;  3PXM A;  1JB4 A;  4MJD A;  1GD4 A;  3MPH A;  1V74 A;  1IV9 A;  4XDV A;  4EV2 A;  3ROB A;  1IT7 A;  3CNX A;  3UNL A;  5AYS C;  3GAX A;  4FCM A;  4L8P A;  3D3L A;  3FF0 A;  3NBR A;  1TFK A;  5JPP A;  1NWW A;  2QIY A;  4OK0 A;  5CLK A;  3FH1 A;  1W02 A;  2OTL 3;  5IG3 A;  3G71 3;  1OF5 B;  2STD A;  1GY5 A;  3UL5 A;  3LXU X;  1ZX2 A;  3LYG A;  3RGA A;  2WO0 A;  4U13 A;  4AEQ A;  1Q81 4;  3F8X A;  1VQL 3;  1W2Z A;  5AIG A;  4BTY A;  3OXA A;  3PCS A;  3CC7 3;  2IMJ A;  4IIA A;  1GY7 A;  4R1K A;  1IVX A;  1GY6 A;  1QJG A;  1JB5 A;  2OCT A;  1ASK A;  3OX9 A;  1LOX A;  1W5Z A;  2C11 A;  2CFG A;  2YFL B;  1STF I;  5IG4 A;  1O7M B;  2Y74 A;  3KII A;  1K41 A;  1YGE A;  4GL6 A;  4HM7 B;  5AIH A;  2CK3 H;  3CPW 2;  1TP6 A;  3FKA A;  1VQ5 3;  1YJW 3;  3NQZ A;  3MG1 A;  4BTX A;  3G16 A;  3S29 A;  1OAC A;  1SPU A;  2I9W A;  2MF7 A;  3LTD A;  3K0Z A;  4FCZ A;  1ROA A;  2QA4 3;  1WMO A;  1OHP A;  1GS3 A;  5D82 A;  4FMD A;  1M90 4;  4K61 A;  2W56 A;  2BO9 B;  1VQ4 3;  3X3X A;  1AVL A;  1QVF 2;  2WGQ A;  2YFI B;  3LML A;  3CXC 2;  1GYB A;  3HII A;  1Q40 A;  3LTB A;  4K1U A;  1EG9 B;  3NX0 A;  1N8Q A;  1ISK A;  3GZB A;  4PEJ A;  4N6M A;  3HI7 A;  3KE7 A;  4HM6 B;  4HVN A;  1DMM A;  4R80 A;  3X42 A;  2QEX 3;  1O7W B;  2Z7A A;  4EC6 A;  1VQO 3;  3FCS B;  2INX A;  4R9K A;  2XRX B;  1IV7 A;  3DUK A;  3T8U A;  3RDE A;  3HZP A;  1A90 A;  4TX4 A;  2W04 A;  4JRF A;  2BNG A;  1U8C B;  3MG3 A;  4FR9 A;  4O02 B;  3EC9 A;  4AKZ A;  3DZL A;  1W6C A;  2GBW B;  2CC3 A;  3ALA A;  3IPT A;  3K7C A;  3KSP A;  3OWU A;  1G96 A;  4MMZ B;  3CCU 3;  4ZM8 A;  5LC6 A;  1E3V A;  2HMJ B;  3DXO A;  5CXO A;  4STD A;  3JUN A;  1OF5 A;  1UI7 A;  3S27 A;  2FNQ A;  3JUO A;  2W03 A;  1NDO B;  1E3R A;  4JF8 A;  3PYJ A;  3VGN A;  1W6G A;  3N54 B;  3Q1C A;  4HM0 B;  1NB3 I;  1W01 A;  3NBB A;  1YI2 3;  1IVV A;  2XSH B;  1N5P A;  1JNQ A;  3CCS 3;  2ZDJ A;  1A2K A;  3DGL A;  3V99 A;  3WOD G;  2W56 B;  3K63 A;  5IEO A;  1OH0 A;  3EJV A;  3N8B A;  3MKI A;  1IQX A;  3HIG A;  3SX1 A;  3Q2P A;  3H51 A;  3S67 A;  5CF2 A;  1NB5 I;  3ER7 A;  1JN5 A;  2JDI H;  5DRV A;  2CW9 A;  4WP5 A;  3SVA A;  1DYU A;  3FGY A;  3GZY B;  2B24 B;  2Y73 A;  1KQS 2;  3B4P A;  2W9Q A;  1D6U A;  4KFE A;  8CHO A;  2F86 B;  2O3O A;  2A15 A;  3BNC A;  2D1W A;  3MG2 A;  2Z6B A;  5DRE A;  3SLU A;  3OW2 2;  2XR8 B;  2OTJ 3;  1JN5 B;  1RRL A;  1CYV A;  1ROV A;  3GWR A;  3HK4 A;  1QMA A;  1VQM 3;  4IT7 A;  4MMY B;  5FW5 A;  3SXX A;  1HU9 A;  1DMQ A;  2HMN B;  3CCR 3;  1WMP A;  5ELU A;  4N6V 0;  1OGZ A;  1LXE A;  4LSO A;  3S28 A;  1LNH A;  3PCR A;  1UUV B;  3B4O A;  2BHM A;  2YFJ B;  3LOY A;  3STD A;  5KP3 A;  3IJE B;  1YIT 3;  4LGQ A;  4EXR A;  1JKG B;  1N5H A;  3T0U A;  3VSY A;  2MC8 A;  4ORL A;  4N6O B;  1A2V A;  1OUN A;  2Q07 A;  1CEW I;  2XEP A;  2CG0 A;  1PU4 A;  4OUQ A;  4XBY A;  1K9M 4;  1RRH A;  1UUW B;  1ULJ B;  1EKM A;  2XFS A;  3LZA A;  2RSX A;  1KWI A;  1DVC A;  2BT3 A;  3RGR A;  2CIU A;  5CF1 A;  3BLZ A;  1IDP A;  2BMR B;  3Q90 A;  5EQL A;  2P38 A;  2R4I A;  4X2H A;  2V1L A;  3QK9 A;  1FA3 A;  1NU3 A;  3DGM A;  3NBJ A;  4KVH A;  1L5G B;  1QAK A;  5AI1 A;  1AR0 A;  2QGU A;  2HML B;  3E99 A;  3I55 3;  1D6Z A;  3DGN A;  3WDG B;  3EB8 A;  3OWS A;  1W4N A;  4K1V A;  1IQ8 A;  3NM7 A;  4EYC A;  1A67 A;  3F14 A;  4XDW A;  3A76 A;  4EV5 A;  1IT8 A;  5JPU A;  1RJO A;  2CKF B;  3U97 A;  3CCL 3;  4WHA A;  2GEX A;  1QVG 2;  3ECF A;  3WOE B;  1K73 4;  3F40 A;  4RBN A;  5AII A;  1K28 A;  5D83 A;  3X3Y A;  3L0R A;  3DM8 A;  4KFF A;  1TUH A;  1W7C A;  2E2V A;  5IER A;  1S5A A;  2E2U A;  5JBS A;  3AMO B;  1N9J A;  3KZT A;  3CCE 3;  1W2B 2;  3F7S A;  2XGL A;  3FZW A;  1FGQ A;  2KXG A;  4MMX B;  2HMM B;  2OQE A;  1OHS A;  1FGO A;  4AKY A;  3EX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...