2F56A

Barnase cross-linked with glutaraldehyde soaked in 6m urea
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease
publication title On the edge of the denaturation process: Application of X-ray diffraction to barnase and lysozyme cross-linked crystals with denaturants in molar concentrations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2f56A00
1HYFA 1R4YA 1FYSA 2C4BA 2SARA 1GMPA 1B3SA 4BIRA 1B2UA 3AHWA 1T2IA 4GHOA 3BIRA 3WHOA 2ZA4A 5GSPA 1RNTA 1YNVX 2RNTA 1I0XA 1BSBA 1RTUA 1BNFA 2HOHA 1SARA 1BRKA 2F56A 2KF5A 1RNBA 1TRPA 1BU4A 2KF4A 1BRIA 4J5GA 1BRGA 3A5EA 1BRHA 4J5KA 1FUSA 1GSPA 1BRJA 3Q3FA 4HAAA 1I3IA 1BANA 1BAOA 1BNIA 1GMQA 1MGRA 1PYLA 1BSEA 1T2HA 1RGKA 1YVSA 2F5WA 1IYYA 1YGWA 1GMRA 1RMSA 1GOUA 1GOVA 2AADA 6GSPA 1B2ZA 1FUTA 1RGAA 1X1XA 1ZGXA 1I2GA 3AGNA 3D5GA 1RGCA 1JBTA 1BIRA 1I8VA 1RGFA 1I70A 1UCIA 2KAAA 1LNIA 1BSCA 3HOHA 3URPA 2AAEA 1AY7A 8RNTA 1RGHA 1Q9EA 1B2SA 1JBRA 3DGYA 1B21A 3D5IA 1MGWA 1BRSA 1RN1A 1BNJA 3AHSA 5BU4A 1FZUA 1LRAA 1X1UA 1AQZA 2KF6A 1BNRA 1BRNL 1RGEA 1UCKA 1I2FA 1B2XA 1GOYA 1B20A 5HOHA 6RNTA 1C54A 1PY3A 3GSPA 5RNTA 1RGLA 1RN4A 1BVIA 2KF3A 5BIRA 1TRQA 3AGOA 7GSPA 1RCKA 1RDSA 3KCHA 1I3FA 1LOYA 1X1WA 2BU4A 3D4AA 1I0VA 1UCLA 9RNTA 1BGSA 1JBSA 2F5MA 1BNGA 1RGGA 1CH0A 1BOXA 1RCLA 1G02A 2F4YA 1RHLA 1RSNA 1X1YA 1B2MA 3RNTA 1DE3A 1TTOA 2GSPA 3BU4A 2RBIA 7RNTA 2BIRA 1DETA 4GSPA 1BNEA 1A2PA 3WR2A 1B27A 1I2EA 1RLSA 3SYUA 1LOVA 1BSDA 4HOHA 3DH2A 1HZ1A 1BNSA 1LOWA 1BSAA 4BU4A 1FW7A 1BUJA 1UCJA 4RNTA
chains in the Genus database with same CATH superfamily
2L4VA 1OHPA 1UI8A 1QAKA 2P0MA 4OUQA 4O8SA 4HM2B 4WYKA 3UB1A 5M1AA 3CCE3 1HU9A 1TJDA 1GD4A 3BIRA 2ZHXB 1W02A 2ZA4A 2QA43 2CFWA 1RNTA 4RNYA 3FG1A 5G1LA 2INXA 1I0XA 3MG1A 1FGQA 1RTUA 3CME3 1TIJA 2HOHA 1SARA 2XRXB 1V74A 2QEX3 1UGHI 1VZZA 1OGZA 4K61A 1CEWI 2KF4A 1YVBI 3CU3A 3FGYA 3NV0B 3S5CA 1NU3A 1PFPA 4RNZA 1BRHA 1VQ53 3CD63 3DGMA 4MMXB 4HM1B 1RKYA 3FLJA 3CC23 1VQM3 3FKAA 1GSPA 4J8TA 4NREA 1HKXA 5CLKA 2FNQA 2GU1A 2BHMA 2IA7A 2HMMB 1W6CA 3GRDA 3LTCA 1BNIA 1MGRA 4PEJA 4FMDA 2IUKA 5JPUA 1YGWA 2KXGA 3ALAA 4I4KA 4HM6B 5BXQA 1TFKA 3LT9A 4FCMA 1O7HB 5FW5A 1OF5B 1Q42A 3LTBA 1JB2A 6GSPA 1EQKA 1B2ZA 3K9MC 1X1XA 3H51A 1N5HA 2CWTA 3AGNA 2HMOB 1YI23 1BIRA 4ZM8A 1NNVA 2FGTA 2W03A 5M19A 1A67A 3SOYA 2CWVA 2CIUA 2MC8A 3F8HA 3HOHA 4R1KA 8RNTA 3V92A 1Q9EA 3DGNA 3MHEA 3X3YA 1JBRA 3EBYA 1E3RA 3DGYA 3DGLA 3D5IA 1BNJA 1UI7A 3FH1A 1C7HA 2OOVC 3GWRA 3PZWA 5LC6A 3U1WA 5BU4A 2E2VA 1AV4A 1AQZA 2KF6A 3CNXA 3GAXA 2OQEA 1BRNL 2OWPA 1GOYA 2PNCA 2R4IA 3JUPA 5HOHA 3G713 1DVDA 3HI7A 2HMJB 2BMRB 4KVHA 4TX4A 1C54A 1ULIB 3OW22 3S29A 1BVIA 4XBYA 1UUWB 4RBNA 1K8A4 1IVXA 4N6UA 3VGNA 2GXFA 1CQSA 1Q40B 3AMOB 3CCR3 3NQYA 1VQO3 2CH9A 2ML5A 5A0OB 2BU4A 3D4AA 3ZG5A 1CYVA 1BGSA 3X40A 1JZOA 3NV0A 1JNQA 2OCTA 1RJOA 1W6YA 2XH9A 1BOXA 3MG3A 5CF1A 3CCL3 2CHCA 2YX9A 6STDA 1N8QA 3DM8A 4I5QA 2PZVA 1JN5B 1Q864 2OTJ3 1TTOA 1SPUA 2QIYA 3BNCA 5EEOA 3HK4A 2CG0A 4KFDA 4N6LA 3G6E3 3EN8A 1WNHA 3IMAB 3KSED 4LEHA 3NM2A 7RNTA 2BIRA 3NBJA 3T0UA 1A2PA 1OF5A 3WR2A 2Z7AA 1VQN3 4CCVA 1PU4A 4K90B 3B4PA 4HBRA 1HZ1A 1BNSA 3WMDA 5IEPA 3KKGA 2O9UX 3S27A 3IJEB 1LQMB 4XM4A 1SIIA 1R4YA 1MWSA 2C4BA 1VQ43 1GMPA 1B3SA 2H0GA 1M1K4 1KD14 1STFI 3EHCA 3IPTA 1FUWA 5STDA 5IG4A 1IQYA 1SQWA 3QK9A 2H0HA 3B4OA 2RNTA 3EE1A 4GL6A 2WOFA 2H0IA 3HX8A 1BSBA 1OH0A 4N6NB 3H3HA 1W5ZA 3I0YA 4IPBA 3KE7A 1LNHA 4WP5A 1YHQ3 4KZ1A 1TRPA 1BRIA 1JB4A 2W56B 1MWRA 1O7PB 2CFDA 2J8XB 4J5KA 4K1UA 2W0QA 1FUSA 4FR9A 3LH4A 1WMOA 3Q3FA 4K1VA 4HAAA 3CCV3 1Z1SA 3GZBA 4BTWA 1WMPA 1Q40A 3AMOA 4CJNA 4O3VA 4AEQA 3D9RA 2KRTA 1A2VA 3F14A 2GBXB 1GOUA 4RZMA 5AEWB 2AADA 4L8PA 1RRHA 4WWUC 2IYJA 3MG2A 2F86B 4HM5B 2Z76A 1U8CB 3N8BA 2XEPA 2QGUA 4J9AA 1I2GA 3D5GA 3DXOA 5KP3A 5IG3A 1I8VA 1STDA 4HM7B 2IMJA 3SVAA 1I70A 2YFIB 1JN5A 1M1XB 3NBRA 1BSCA 3NUVA 3PYJA 5AIFA 2AAEA 1DYUA 1AVLA 1RGHA 1EA2A 4XDVA 5CF2A 1NWWA 1YJW3 1IDPA 1B21A 1W7CA 3K63A 5AIIA 3D3LA 1GYBA 3AHSA 5IENA 1FZUA 1LRAA 1X1UA 3LTDA 4JRFA 1ULJB 3A76A 3NXJA 5BVBA 2ZL8A 1B2XA 1OHSA 3VF1A 3ZG0A 5ELUA 3LZAA 1GY5A 5AYRB 1LOXA 1RGLA 1RN4A 2WOHA 3M8CA 2KF3A 1VQL3 3CPW2 1EG9B 4EBGA 1IV7A 4L7KA 3L0RA 1IK3A 3UL6A 1QALA 2W6JH 3HZPA 4X2HA 1UUGB 1E97A 3NQZA 1RDSA 4GB5A 1ASKA 1I3FA 3KIIA 1S5AA 2IUJA 4AKZA 2CX1A 5CK6A 5KP1A 2HMKB 3F9SA 2JQ5A 3G8ZA 1K41A 3QRDA 9RNTA 1O7NB 2XSHB 3PCRA 2F5MA 2Q07A 2W56A 1BNGA 2W04A 3K5TA 1QJGA 1JBSA 1RGGA 2P09A 4MEIA 4FCJA 1QVG2 4HZBB 3S67A 4ILFA 1EEJA 1N5PA 2F4YA 2L1SA 3WODG 1N9JA 1RSNA 5D83A 2CW9A 3O8YA 1B2MA 4G1MB 2P05A 3RNTA 3CPOA 4JF8A 2W9QA 4OK0A 1M9GA 2C10A 2K54A 1Q824 4LYLB 3LOYA 3BU4A 1YGEA 2D1WA 4EYCA 1DETA 2IY2A 3JUOA 4H61A 2OOVA 1B27A 4X2OA 3SYUA 3RGAA 1LOVA 1BSDA 1V58A 3JUNA 2XF3A 1BSAA 3K7CA 1FW7A 2CFGA 1JKGB 4HM4B 1VQ73 1KQS2 1UCJA 1U5OA 4RNTA 3ER7A 1N8R4 3UL5A 3MPHA 1KWIA 1OPYA 1QMAA 1G0TA 2SARA 4L8OA 4BIRA 1MNLA 4R80A 2V1LA 1B2UA 1WQLB 1UW1A 1T2IA 3KSPA 5G2GA 3WHOA 5GSPA 2E2TA 4XB5A 5JPPA 5AIHA 1G96A 2KCDA 3I553 2R41A 2Y74A 1IT7A 1US1A 1FGRA 1BNFA 5D82A 3TDGA 1GS3A 1UGIA 1FGOA 1S723 2KF5A 4Q53A 3RGRA 1RNBA 1OHOA 2W2CA 1E3VA 3JUQA 2I9WA 1T5YA 4J5GA 1BRGA 3GZYB 1A90A 3X41A 3BNBA 2STDA 2A15A 5IF6A 1OACA 3ZFZA 3SEDA 1BRJA 1OCVA 2ML6A 2OTL3 1I3IA 4N6MA 1BANA 1BAOA 4EC6A 1FGTA 3NBBA 4STDA 1BSEA 1T2HA 1RGKA 1EKMA 2XSOB 4QWTA 1JZDA 1IVWA 1GMRA 1RMSA 3JUMA 3U97A 1GOVA 1JB5A 1AVKA 2HMLB 2WO0A 5IG5A 3CCU3 1L5GB 1FUTA 1K28A 1RGAA 1ZGXA 3G4S3 4EW5A 3SLUA 2RGQA 1NB5I 3UJMA 1FA3A 1RGCA 5IG0A 1W00A 4HZ9B 1UCIA 3S28A 4BL3A 3MKIA 4OVMA 5G1KA 5HGRA 3CCQ3 1K734 3PXMA 1DMQA 1W6GA 1AY7A 1W2B2 4XDWA 1AR0A 3PS8A 1VQQA 3D79A 2CG1A 1D6YA 1JV2B 2F98A 2MF7A 2GEXA 2P0XA 1D6ZA 3DGOA 1ZS7A 1GY6A 3MYTA 1MGWA 5TGNA 2Z77A 1YJ93 2E2UA 3OX9A 4LZIA 1LVNA 1O7GB 4N6V0 1Q7Y4 1RGEA 1JKGA 1I2FA 3LYGA 3VSYA 3PCSA 4HKVB 3F7SA 3NHXA 1UUVB 1Q7HA 4N6TA 1TRQA 3WDGB 2Y73A 1OGXA 1IU7A 1W01A 2FXTA 2WGQA 3AGOA 4HM3B 1ZO2A 7GSPA 3EC9A 1JRQA 1ISKA 2HMNB 1ZX2A 3BNEA 4CDLA 3K0ZA 3SX1A 5DREA 1VQ83 2GEYA 2XR8B 2XFSA 1ROAA 1UCLA 3EF8A 2BNGA 2B24B 4KT3B 1VQP3 1R4CA 3T8NA 3OV4A 4XBXA 3LMLA 1IQ8A 4N3VA 1CH0A 2UGIA 2UX0A 1G02A 1RHLA 1TUHA 1X1YA 3EX9A 3F7XA 5EVHA 5FGOA 3J7Yd 2O3OA 3LTAA 1DE3A 1NJI4 3LXUX 1IVVA 3JVCA 4CPKA 3WA3A 1CYUA 2RBIA 4HM8B 1DMMA 2BMOB 2CKFB 1O7MB 5IERA 3MSOA 1A2KA 4H3UA 1I2EA 1RLSA 4BTXA 1VQ93 1IQXA 3DH2A 3X3XA 1LOWA 4EXRA 1DMNA 3HIIA 2CC3A 1GY7A 2F99A 3V99A 5D81A 3EQQB 2ZDJA 4MMZB 5ELJA 2K3DA 4MMYB 1V57A 1HYFA 2XGNA 1FYSA 3OWUA 3T8UA 3Q1CA 2CX0A 3AHWA 1LQGC 3EB8A 4GHOA 1QVF2 1YNVX 4IT7A 1JJ22 3KFQC 5IW9A 3CMA3 1KSIA 2LYXA 1BRKA 3EBTA 4XBTA 2F56A 4HVNA 4O02B 4BL2A 2P38A 3WOEB 1BU4A 1EUIC 2B1XB 3F8XA 1TU5A 3A5EA 1TP6A 2JDIH 2OQEC 3OXAA 4R9KA 3CCJ3 1M904 1VQ63 2WGOA 2GBWB 4HM0B 2XGLA 3V98A 3E99A 3ROBA 1GMQA 1PYLA 2YFLB 5AEUB 1YVSA 2F5WA 4LGQA 3CC43 1BUQA 1IYYA 3OWYA 1Y4KA 5KP4A 3SXXA 3BNDA 3FCSB 1YIJ3 4WHAA 5CXOA 5IEOA 3NX0A 4MJDA 1K9M4 1WMNA 5AYSC 1IV9A 3HIGA 1YJN3 3DMCA 5AI1A 1W2ZA 1IT8A 4NHFA 2RSXA 5LC7A 1JBTA 2BT3A 2BO9B 3PGBA 8CHOA 2Z6BA 3B7CA 3WA2X 2BMQB 1RGFA 2C11A 2KAAA 4LSOA 3BB9A 1RN7A 1LNIA 4KFFA 4IIAA 3URPA 1LXEA 2CFLA 4WYKB 1ROVA 4R4KA 1RRLA 1B2SA 2LQVA 3DZLA 3KN4A 4NPBA 2SBLA 3CCS3 1UDII 3NM7A 2XFTA 3KZTA 1WTHA 1O7WB 1RN1A 1BRSA 1SJWA 2CWUA 3G0KA 1NO3A 3Q2PA 7STDA 3OWSA 3GZXB 1BNRA 5M18A 1N9EA 1UCKA 4FMAA 1B20A 1F8NA 6RNTA 1D6UA 1VQK3 1MWTA 1PY3A 3GSPA 5RNTA 2K0MA 3WOFB 2CK3H 5AIGA 4AKYA 1QAFA 5I97A 5JBSA 1KC84 4R9LA 5BIRA 3FSDA 3EJVA 1SIHA 3FZWA 3DY5A 1YIT3 3G16A 2YFJB 3LT8A 1RCKA 1NB3I 3ECFA 3UNLA 3DUKA 3KCHA 2D42A 3I563 1LOYA 4EV2A 1X1WA 4N6OB 1W4NA 4BTYA 1I0VA 2GU3A 3SOAA 1Q814 1J2BA 1T3BA 1GD3A 3F40A 4KFEA 1FGMA 1NDOB 2M7OA 3Q90A 3FG3A 3CCM3 2RCDA 5DRVA 3CNMA 1RCLA 4HYZA 3X42A 1DVCA 3GZRA 4HJLB 3CC73 4ORLA 1MWUA 1OUNA 2GSPA 1IVUA 2RFRA 4EV5A 4U13A 3FG4A 3MWZA 3N54B 4DKIA 4GSPA 1BNEA 4LMIA 3EN1B 2UUGC 4WFOA 3B8LA 3CXC2 1TFOA 4FMCA 2CFKA 3BLZA 4HOHA 3N9HA 5EQLA 3RDEA 3FF2A 4FMBA 3STDA 4FCZA 2W9PA 4O2HA 4BU4A 1BUJA 3X3ZA 1MOLA 3FF0A
chains in the Genus database with same CATH topology
1HYFA 1R4YA 1FYSA 2C4BA 2SARA 1GMPA 1B3SA 4BIRA 1B2UA 3AHWA 1T2IA 4GHOA 3BIRA 3WHOA 2ZA4A 5GSPA 1RNTA 1YNVX 2RNTA 1I0XA 1BSBA 1RTUA 1BNFA 2HOHA 1SARA 1BRKA 2F56A 2KF5A 1RNBA 1TRPA 1BU4A 2KF4A 1BRIA 4J5GA 1BRGA 3A5EA 1BRHA 4J5KA 1FUSA 1GSPA 1BRJA 3Q3FA 4HAAA 1I3IA 1BANA 1BAOA 1BNIA 1GMQA 1MGRA 1PYLA 1BSEA 1T2HA 1RGKA 1YVSA 2F5WA 1IYYA 1YGWA 1GMRA 1RMSA 1GOUA 1GOVA 2AADA 6GSPA 1B2ZA 1FUTA 1RGAA 1X1XA 1ZGXA 1I2GA 3AGNA 3D5GA 1RGCA 1JBTA 1BIRA 1I8VA 1RGFA 1I70A 1UCIA 2KAAA 1LNIA 1BSCA 3HOHA 3URPA 2AAEA 1AY7A 8RNTA 1RGHA 1Q9EA 1B2SA 1JBRA 3DGYA 1B21A 3D5IA 1MGWA 1BRSA 1RN1A 1BNJA 3AHSA 5BU4A 1FZUA 1LRAA 1X1UA 1AQZA 2KF6A 1BNRA 1BRNL 1RGEA 1UCKA 1I2FA 1B2XA 1GOYA 1B20A 5HOHA 6RNTA 1C54A 1PY3A 3GSPA 5RNTA 1RGLA 1RN4A 1BVIA 2KF3A 5BIRA 1TRQA 3AGOA 7GSPA 1RCKA 1RDSA 3KCHA 1I3FA 1LOYA 1X1WA 2BU4A 3D4AA 1I0VA 1UCLA 9RNTA 1BGSA 1JBSA 2F5MA 1BNGA 1RGGA 1CH0A 1BOXA 1RCLA 1G02A 2F4YA 1RHLA 1RSNA 1X1YA 1B2MA 3RNTA 1DE3A 1TTOA 2GSPA 3BU4A 2RBIA 7RNTA 2BIRA 1DETA 4GSPA 1BNEA 1A2PA 3WR2A 1B27A 1I2EA 1RLSA 3SYUA 1LOVA 1BSDA 4HOHA 3DH2A 1HZ1A 1BNSA 1LOWA 1BSAA 4BU4A 1FW7A 1BUJA 1UCJA 4RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYF A;  1R4Y A;  1FYS A;  2C4B A;  2SAR A;  1GMP A;  1B3S A;  4BIR A;  1B2U A;  3AHW A;  1T2I A;  4GHO A;  3BIR A;  3WHO A;  2ZA4 A;  5GSP A;  1RNT A;  1YNV X;  2RNT A;  1I0X A;  1BSB A;  1RTU A;  1BNF A;  2HOH A;  1SAR A;  1BRK A;  2F56 A;  2KF5 A;  1RNB A;  1TRP A;  1BU4 A;  2KF4 A;  1BRI A;  4J5G A;  1BRG A;  3A5E A;  1BRH A;  4J5K A;  1FUS A;  1GSP A;  1BRJ A;  3Q3F A;  4HAA A;  1I3I A;  1BAN A;  1BAO A;  1BNI A;  1GMQ A;  1MGR A;  1PYL A;  1BSE A;  1T2H A;  1RGK A;  1YVS A;  2F5W A;  1IYY A;  1YGW A;  1GMR A;  1RMS A;  1GOU A;  1GOV A;  2AAD A;  6GSP A;  1B2Z A;  1FUT A;  1RGA A;  1X1X A;  1ZGX A;  1I2G A;  3AGN A;  3D5G A;  1RGC A;  1JBT A;  1BIR A;  1I8V A;  1RGF A;  1I70 A;  1UCI A;  2KAA A;  1LNI A;  1BSC A;  3HOH A;  3URP A;  2AAE A;  1AY7 A;  8RNT A;  1RGH A;  1Q9E A;  1B2S A;  1JBR A;  3DGY A;  1B21 A;  3D5I A;  1MGW A;  1BRS A;  1RN1 A;  1BNJ A;  3AHS A;  5BU4 A;  1FZU A;  1LRA A;  1X1U A;  1AQZ A;  2KF6 A;  1BNR A;  1BRN L;  1RGE A;  1UCK A;  1I2F A;  1B2X A;  1GOY A;  1B20 A;  5HOH A;  6RNT A;  1C54 A;  1PY3 A;  3GSP A;  5RNT A;  1RGL A;  1RN4 A;  1BVI A;  2KF3 A;  5BIR A;  1TRQ A;  3AGO A;  7GSP A;  1RCK A;  1RDS A;  3KCH A;  1I3F A;  1LOY A;  1X1W A;  2BU4 A;  3D4A A;  1I0V A;  1UCL A;  9RNT A;  1BGS A;  1JBS A;  2F5M A;  1BNG A;  1RGG A;  1CH0 A;  1BOX A;  1RCL A;  1G02 A;  2F4Y A;  1RHL A;  1RSN A;  1X1Y A;  1B2M A;  3RNT A;  1DE3 A;  1TTO A;  2GSP A;  3BU4 A;  2RBI A;  7RNT A;  2BIR A;  1DET A;  4GSP A;  1BNE A;  1A2P A;  3WR2 A;  1B27 A;  1I2E A;  1RLS A;  3SYU A;  1LOV A;  1BSD A;  4HOH A;  3DH2 A;  1HZ1 A;  1BNS A;  1LOW A;  1BSA A;  4BU4 A;  1FW7 A;  1BUJ A;  1UCJ A;  4RNT A; 
#chains in the Genus database with same CATH topology
 2L4V A;  1OHP A;  1UI8 A;  1QAK A;  2P0M A;  4OUQ A;  4O8S A;  4HM2 B;  4WYK A;  3UB1 A;  5M1A A;  3CCE 3;  1HU9 A;  1TJD A;  1GD4 A;  3BIR A;  2ZHX B;  1W02 A;  2ZA4 A;  2QA4 3;  2CFW A;  1RNT A;  4RNY A;  3FG1 A;  5G1L A;  2INX A;  1I0X A;  3MG1 A;  1FGQ A;  1RTU A;  3CME 3;  1TIJ A;  2HOH A;  1SAR A;  2XRX B;  1V74 A;  2QEX 3;  1UGH I;  1VZZ A;  1OGZ A;  4K61 A;  1CEW I;  2KF4 A;  1YVB I;  3CU3 A;  3FGY A;  3NV0 B;  3S5C A;  1NU3 A;  1PFP A;  4RNZ A;  1BRH A;  1VQ5 3;  3CD6 3;  3DGM A;  4MMX B;  4HM1 B;  1RKY A;  3FLJ A;  3CC2 3;  1VQM 3;  3FKA A;  1GSP A;  4J8T A;  4NRE A;  1HKX A;  5CLK A;  2FNQ A;  2GU1 A;  2BHM A;  2IA7 A;  2HMM B;  1W6C A;  3GRD A;  3LTC A;  1BNI A;  1MGR A;  4PEJ A;  4FMD A;  2IUK A;  5JPU A;  1YGW A;  2KXG A;  3ALA A;  4I4K A;  4HM6 B;  5BXQ A;  1TFK A;  3LT9 A;  4FCM A;  1O7H B;  5FW5 A;  1OF5 B;  1Q42 A;  3LTB A;  1JB2 A;  6GSP A;  1EQK A;  1B2Z A;  3K9M C;  1X1X A;  3H51 A;  1N5H A;  2CWT A;  3AGN A;  2HMO B;  1YI2 3;  1BIR A;  4ZM8 A;  1NNV A;  2FGT A;  2W03 A;  5M19 A;  1A67 A;  3SOY A;  2CWV A;  2CIU A;  2MC8 A;  3F8H A;  3HOH A;  4R1K A;  8RNT A;  3V92 A;  1Q9E A;  3DGN A;  3MHE A;  3X3Y A;  1JBR A;  3EBY A;  1E3R A;  3DGY A;  3DGL A;  3D5I A;  1BNJ A;  1UI7 A;  3FH1 A;  1C7H A;  2OOV C;  3GWR A;  3PZW A;  5LC6 A;  3U1W A;  5BU4 A;  2E2V A;  1AV4 A;  1AQZ A;  2KF6 A;  3CNX A;  3GAX A;  2OQE A;  1BRN L;  2OWP A;  1GOY A;  2PNC A;  2R4I A;  3JUP A;  5HOH A;  3G71 3;  1DVD A;  3HI7 A;  2HMJ B;  2BMR B;  4KVH A;  4TX4 A;  1C54 A;  1ULI B;  3OW2 2;  3S29 A;  1BVI A;  4XBY A;  1UUW B;  4RBN A;  1K8A 4;  1IVX A;  4N6U A;  3VGN A;  2GXF A;  1CQS A;  1Q40 B;  3AMO B;  3CCR 3;  3NQY A;  1VQO 3;  2CH9 A;  2ML5 A;  5A0O B;  2BU4 A;  3D4A A;  3ZG5 A;  1CYV A;  1BGS A;  3X40 A;  1JZO A;  3NV0 A;  1JNQ A;  2OCT A;  1RJO A;  1W6Y A;  2XH9 A;  1BOX A;  3MG3 A;  5CF1 A;  3CCL 3;  2CHC A;  2YX9 A;  6STD A;  1N8Q A;  3DM8 A;  4I5Q A;  2PZV A;  1JN5 B;  1Q86 4;  2OTJ 3;  1TTO A;  1SPU A;  2QIY A;  3BNC A;  5EEO A;  3HK4 A;  2CG0 A;  4KFD A;  4N6L A;  3G6E 3;  3EN8 A;  1WNH A;  3IMA B;  3KSE D;  4LEH A;  3NM2 A;  7RNT A;  2BIR A;  3NBJ A;  3T0U A;  1A2P A;  1OF5 A;  3WR2 A;  2Z7A A;  1VQN 3;  4CCV A;  1PU4 A;  4K90 B;  3B4P A;  4HBR A;  1HZ1 A;  1BNS A;  3WMD A;  5IEP A;  3KKG A;  2O9U X;  3S27 A;  3IJE B;  1LQM B;  4XM4 A;  1SII A;  1R4Y A;  1MWS A;  2C4B A;  1VQ4 3;  1GMP A;  1B3S A;  2H0G A;  1M1K 4;  1KD1 4;  1STF I;  3EHC A;  3IPT A;  1FUW A;  5STD A;  5IG4 A;  1IQY A;  1SQW A;  3QK9 A;  2H0H A;  3B4O A;  2RNT A;  3EE1 A;  4GL6 A;  2WOF A;  2H0I A;  3HX8 A;  1BSB A;  1OH0 A;  4N6N B;  3H3H A;  1W5Z A;  3I0Y A;  4IPB A;  3KE7 A;  1LNH A;  4WP5 A;  1YHQ 3;  4KZ1 A;  1TRP A;  1BRI A;  1JB4 A;  2W56 B;  1MWR A;  1O7P B;  2CFD A;  2J8X B;  4J5K A;  4K1U A;  2W0Q A;  1FUS A;  4FR9 A;  3LH4 A;  1WMO A;  3Q3F A;  4K1V A;  4HAA A;  3CCV 3;  1Z1S A;  3GZB A;  4BTW A;  1WMP A;  1Q40 A;  3AMO A;  4CJN A;  4O3V A;  4AEQ A;  3D9R A;  2KRT A;  1A2V A;  3F14 A;  2GBX B;  1GOU A;  4RZM A;  5AEW B;  2AAD A;  4L8P A;  1RRH A;  4WWU C;  2IYJ A;  3MG2 A;  2F86 B;  4HM5 B;  2Z76 A;  1U8C B;  3N8B A;  2XEP A;  2QGU A;  4J9A A;  1I2G A;  3D5G A;  3DXO A;  5KP3 A;  5IG3 A;  1I8V A;  1STD A;  4HM7 B;  2IMJ A;  3SVA A;  1I70 A;  2YFI B;  1JN5 A;  1M1X B;  3NBR A;  1BSC A;  3NUV A;  3PYJ A;  5AIF A;  2AAE A;  1DYU A;  1AVL A;  1RGH A;  1EA2 A;  4XDV A;  5CF2 A;  1NWW A;  1YJW 3;  1IDP A;  1B21 A;  1W7C A;  3K63 A;  5AII A;  3D3L A;  1GYB A;  3AHS A;  5IEN A;  1FZU A;  1LRA A;  1X1U A;  3LTD A;  4JRF A;  1ULJ B;  3A76 A;  3NXJ A;  5BVB A;  2ZL8 A;  1B2X A;  1OHS A;  3VF1 A;  3ZG0 A;  5ELU A;  3LZA A;  1GY5 A;  5AYR B;  1LOX A;  1RGL A;  1RN4 A;  2WOH A;  3M8C A;  2KF3 A;  1VQL 3;  3CPW 2;  1EG9 B;  4EBG A;  1IV7 A;  4L7K A;  3L0R A;  1IK3 A;  3UL6 A;  1QAL A;  2W6J H;  3HZP A;  4X2H A;  1UUG B;  1E97 A;  3NQZ A;  1RDS A;  4GB5 A;  1ASK A;  1I3F A;  3KII A;  1S5A A;  2IUJ A;  4AKZ A;  2CX1 A;  5CK6 A;  5KP1 A;  2HMK B;  3F9S A;  2JQ5 A;  3G8Z A;  1K41 A;  3QRD A;  9RNT A;  1O7N B;  2XSH B;  3PCR A;  2F5M A;  2Q07 A;  2W56 A;  1BNG A;  2W04 A;  3K5T A;  1QJG A;  1JBS A;  1RGG A;  2P09 A;  4MEI A;  4FCJ A;  1QVG 2;  4HZB B;  3S67 A;  4ILF A;  1EEJ A;  1N5P A;  2F4Y A;  2L1S A;  3WOD G;  1N9J A;  1RSN A;  5D83 A;  2CW9 A;  3O8Y A;  1B2M A;  4G1M B;  2P05 A;  3RNT A;  3CPO A;  4JF8 A;  2W9Q A;  4OK0 A;  1M9G A;  2C10 A;  2K54 A;  1Q82 4;  4LYL B;  3LOY A;  3BU4 A;  1YGE A;  2D1W A;  4EYC A;  1DET A;  2IY2 A;  3JUO A;  4H61 A;  2OOV A;  1B27 A;  4X2O A;  3SYU A;  3RGA A;  1LOV A;  1BSD A;  1V58 A;  3JUN A;  2XF3 A;  1BSA A;  3K7C A;  1FW7 A;  2CFG A;  1JKG B;  4HM4 B;  1VQ7 3;  1KQS 2;  1UCJ A;  1U5O A;  4RNT A;  3ER7 A;  1N8R 4;  3UL5 A;  3MPH A;  1KWI A;  1OPY A;  1QMA A;  1G0T A;  2SAR A;  4L8O A;  4BIR A;  1MNL A;  4R80 A;  2V1L A;  1B2U A;  1WQL B;  1UW1 A;  1T2I A;  3KSP A;  5G2G A;  3WHO A;  5GSP A;  2E2T A;  4XB5 A;  5JPP A;  5AIH A;  1G96 A;  2KCD A;  3I55 3;  2R41 A;  2Y74 A;  1IT7 A;  1US1 A;  1FGR A;  1BNF A;  5D82 A;  3TDG A;  1GS3 A;  1UGI A;  1FGO A;  1S72 3;  2KF5 A;  4Q53 A;  3RGR A;  1RNB A;  1OHO A;  2W2C A;  1E3V A;  3JUQ A;  2I9W A;  1T5Y A;  4J5G A;  1BRG A;  3GZY B;  1A90 A;  3X41 A;  3BNB A;  2STD A;  2A15 A;  5IF6 A;  1OAC A;  3ZFZ A;  3SED A;  1BRJ A;  1OCV A;  2ML6 A;  2OTL 3;  1I3I A;  4N6M A;  1BAN A;  1BAO A;  4EC6 A;  1FGT A;  3NBB A;  4STD A;  1BSE A;  1T2H A;  1RGK A;  1EKM A;  2XSO B;  4QWT A;  1JZD A;  1IVW A;  1GMR A;  1RMS A;  3JUM A;  3U97 A;  1GOV A;  1JB5 A;  1AVK A;  2HML B;  2WO0 A;  5IG5 A;  3CCU 3;  1L5G B;  1FUT A;  1K28 A;  1RGA A;  1ZGX A;  3G4S 3;  4EW5 A;  3SLU A;  2RGQ A;  1NB5 I;  3UJM A;  1FA3 A;  1RGC A;  5IG0 A;  1W00 A;  4HZ9 B;  1UCI A;  3S28 A;  4BL3 A;  3MKI A;  4OVM A;  5G1K A;  5HGR A;  3CCQ 3;  1K73 4;  3PXM A;  1DMQ A;  1W6G A;  1AY7 A;  1W2B 2;  4XDW A;  1AR0 A;  3PS8 A;  1VQQ A;  3D79 A;  2CG1 A;  1D6Y A;  1JV2 B;  2F98 A;  2MF7 A;  2GEX A;  2P0X A;  1D6Z A;  3DGO A;  1ZS7 A;  1GY6 A;  3MYT A;  1MGW A;  5TGN A;  2Z77 A;  1YJ9 3;  2E2U A;  3OX9 A;  4LZI A;  1LVN A;  1O7G B;  4N6V 0;  1Q7Y 4;  1RGE A;  1JKG A;  1I2F A;  3LYG A;  3VSY A;  3PCS A;  4HKV B;  3F7S A;  3NHX A;  1UUV B;  1Q7H A;  4N6T A;  1TRQ A;  3WDG B;  2Y73 A;  1OGX A;  1IU7 A;  1W01 A;  2FXT A;  2WGQ A;  3AGO A;  4HM3 B;  1ZO2 A;  7GSP A;  3EC9 A;  1JRQ A;  1ISK A;  2HMN B;  1ZX2 A;  3BNE A;  4CDL A;  3K0Z A;  3SX1 A;  5DRE A;  1VQ8 3;  2GEY A;  2XR8 B;  2XFS A;  1ROA A;  1UCL A;  3EF8 A;  2BNG A;  2B24 B;  4KT3 B;  1VQP 3;  1R4C A;  3T8N A;  3OV4 A;  4XBX A;  3LML A;  1IQ8 A;  4N3V A;  1CH0 A;  2UGI A;  2UX0 A;  1G02 A;  1RHL A;  1TUH A;  1X1Y A;  3EX9 A;  3F7X A;  5EVH A;  5FGO A;  3J7Y d;  2O3O A;  3LTA A;  1DE3 A;  1NJI 4;  3LXU X;  1IVV A;  3JVC A;  4CPK A;  3WA3 A;  1CYU A;  2RBI A;  4HM8 B;  1DMM A;  2BMO B;  2CKF B;  1O7M B;  5IER A;  3MSO A;  1A2K A;  4H3U A;  1I2E A;  1RLS A;  4BTX A;  1VQ9 3;  1IQX A;  3DH2 A;  3X3X A;  1LOW A;  4EXR A;  1DMN A;  3HII A;  2CC3 A;  1GY7 A;  2F99 A;  3V99 A;  5D81 A;  3EQQ B;  2ZDJ A;  4MMZ B;  5ELJ A;  2K3D A;  4MMY B;  1V57 A;  1HYF A;  2XGN A;  1FYS A;  3OWU A;  3T8U A;  3Q1C A;  2CX0 A;  3AHW A;  1LQG C;  3EB8 A;  4GHO A;  1QVF 2;  1YNV X;  4IT7 A;  1JJ2 2;  3KFQ C;  5IW9 A;  3CMA 3;  1KSI A;  2LYX A;  1BRK A;  3EBT A;  4XBT A;  2F56 A;  4HVN A;  4O02 B;  4BL2 A;  2P38 A;  3WOE B;  1BU4 A;  1EUI C;  2B1X B;  3F8X A;  1TU5 A;  3A5E A;  1TP6 A;  2JDI H;  2OQE C;  3OXA A;  4R9K A;  3CCJ 3;  1M90 4;  1VQ6 3;  2WGO A;  2GBW B;  4HM0 B;  2XGL A;  3V98 A;  3E99 A;  3ROB A;  1GMQ A;  1PYL A;  2YFL B;  5AEU B;  1YVS A;  2F5W A;  4LGQ A;  3CC4 3;  1BUQ A;  1IYY A;  3OWY A;  1Y4K A;  5KP4 A;  3SXX A;  3BND A;  3FCS B;  1YIJ 3;  4WHA A;  5CXO A;  5IEO A;  3NX0 A;  4MJD A;  1K9M 4;  1WMN A;  5AYS C;  1IV9 A;  3HIG A;  1YJN 3;  3DMC A;  5AI1 A;  1W2Z A;  1IT8 A;  4NHF A;  2RSX A;  5LC7 A;  1JBT A;  2BT3 A;  2BO9 B;  3PGB A;  8CHO A;  2Z6B A;  3B7C A;  3WA2 X;  2BMQ B;  1RGF A;  2C11 A;  2KAA A;  4LSO A;  3BB9 A;  1RN7 A;  1LNI A;  4KFF A;  4IIA A;  3URP A;  1LXE A;  2CFL A;  4WYK B;  1ROV A;  4R4K A;  1RRL A;  1B2S A;  2LQV A;  3DZL A;  3KN4 A;  4NPB A;  2SBL A;  3CCS 3;  1UDI I;  3NM7 A;  2XFT A;  3KZT A;  1WTH A;  1O7W B;  1RN1 A;  1BRS A;  1SJW A;  2CWU A;  3G0K A;  1NO3 A;  3Q2P A;  7STD A;  3OWS A;  3GZX B;  1BNR A;  5M18 A;  1N9E A;  1UCK A;  4FMA A;  1B20 A;  1F8N A;  6RNT A;  1D6U A;  1VQK 3;  1MWT A;  1PY3 A;  3GSP A;  5RNT A;  2K0M A;  3WOF B;  2CK3 H;  5AIG A;  4AKY A;  1QAF A;  5I97 A;  5JBS A;  1KC8 4;  4R9L A;  5BIR A;  3FSD A;  3EJV A;  1SIH A;  3FZW A;  3DY5 A;  1YIT 3;  3G16 A;  2YFJ B;  3LT8 A;  1RCK A;  1NB3 I;  3ECF A;  3UNL A;  3DUK A;  3KCH A;  2D42 A;  3I56 3;  1LOY A;  4EV2 A;  1X1W A;  4N6O B;  1W4N A;  4BTY A;  1I0V A;  2GU3 A;  3SOA A;  1Q81 4;  1J2B A;  1T3B A;  1GD3 A;  3F40 A;  4KFE A;  1FGM A;  1NDO B;  2M7O A;  3Q90 A;  3FG3 A;  3CCM 3;  2RCD A;  5DRV A;  3CNM A;  1RCL A;  4HYZ A;  3X42 A;  1DVC A;  3GZR A;  4HJL B;  3CC7 3;  4ORL A;  1MWU A;  1OUN A;  2GSP A;  1IVU A;  2RFR A;  4EV5 A;  4U13 A;  3FG4 A;  3MWZ A;  3N54 B;  4DKI A;  4GSP A;  1BNE A;  4LMI A;  3EN1 B;  2UUG C;  4WFO A;  3B8L A;  3CXC 2;  1TFO A;  4FMC A;  2CFK A;  3BLZ A;  4HOH A;  3N9H A;  5EQL A;  3RDE A;  3FF2 A;  4FMB A;  3STD A;  4FCZ A;  2W9P A;  4O2H A;  4BU4 A;  1BUJ A;  3X3Z A;  1MOL A;  3FF0 A; 
#chains in the Genus database with same CATH homology
 1HYF A;  1R4Y A;  1FYS A;  2C4B A;  2SAR A;  1GMP A;  1B3S A;  4BIR A;  1B2U A;  3AHW A;  1T2I A;  4GHO A;  3BIR A;  3WHO A;  2ZA4 A;  5GSP A;  1RNT A;  1YNV X;  2RNT A;  1I0X A;  1BSB A;  1RTU A;  1BNF A;  2HOH A;  1SAR A;  1BRK A;  2F56 A;  2KF5 A;  1RNB A;  1TRP A;  1BU4 A;  2KF4 A;  1BRI A;  4J5G A;  1BRG A;  3A5E A;  1BRH A;  4J5K A;  1FUS A;  1GSP A;  1BRJ A;  3Q3F A;  4HAA A;  1I3I A;  1BAN A;  1BAO A;  1BNI A;  1GMQ A;  1MGR A;  1PYL A;  1BSE A;  1T2H A;  1RGK A;  1YVS A;  2F5W A;  1IYY A;  1YGW A;  1GMR A;  1RMS A;  1GOU A;  1GOV A;  2AAD A;  6GSP A;  1B2Z A;  1FUT A;  1RGA A;  1X1X A;  1ZGX A;  1I2G A;  3AGN A;  3D5G A;  1RGC A;  1JBT A;  1BIR A;  1I8V A;  1RGF A;  1I70 A;  1UCI A;  2KAA A;  1LNI A;  1BSC A;  3HOH A;  3URP A;  2AAE A;  1AY7 A;  8RNT A;  1RGH A;  1Q9E A;  1B2S A;  1JBR A;  3DGY A;  1B21 A;  3D5I A;  1MGW A;  1BRS A;  1RN1 A;  1BNJ A;  3AHS A;  5BU4 A;  1FZU A;  1LRA A;  1X1U A;  1AQZ A;  2KF6 A;  1BNR A;  1BRN L;  1RGE A;  1UCK A;  1I2F A;  1B2X A;  1GOY A;  1B20 A;  5HOH A;  6RNT A;  1C54 A;  1PY3 A;  3GSP A;  5RNT A;  1RGL A;  1RN4 A;  1BVI A;  2KF3 A;  5BIR A;  1TRQ A;  3AGO A;  7GSP A;  1RCK A;  1RDS A;  3KCH A;  1I3F A;  1LOY A;  1X1W A;  2BU4 A;  3D4A A;  1I0V A;  1UCL A;  9RNT A;  1BGS A;  1JBS A;  2F5M A;  1BNG A;  1RGG A;  1CH0 A;  1BOX A;  1RCL A;  1G02 A;  2F4Y A;  1RHL A;  1RSN A;  1X1Y A;  1B2M A;  3RNT A;  1DE3 A;  1TTO A;  2GSP A;  3BU4 A;  2RBI A;  7RNT A;  2BIR A;  1DET A;  4GSP A;  1BNE A;  1A2P A;  3WR2 A;  1B27 A;  1I2E A;  1RLS A;  3SYU A;  1LOV A;  1BSD A;  4HOH A;  3DH2 A;  1HZ1 A;  1BNS A;  1LOW A;  1BSA A;  4BU4 A;  1FW7 A;  1BUJ A;  1UCJ A;  4RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...