2F56A

Barnase cross-linked with glutaraldehyde soaked in 6m urea
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the edge of the denaturation process: Application of X-ray diffraction to barnase and lysozyme cross-linked crystals with denaturants in molar concentrations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
molecule keywords Ribonuclease
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2f56A00
3BU4A 4RNTA 1LOWA 3AGNA 4J5KA 1PY3A 2KF4A 1B20A 1RCLA 1RGCA 1BRHA 3WHOA 5RNTA 1RGEA 2F5WA 1HYFA 5BIRA 5BU4A 3D5GA 2KF5A 1GMRA 1RSNA 1BRGA 4J5GA 1BNRA 1RMSA 3DH2A 3AHSA 1GOUA 1RGAA 3AGOA 1X1WA 1BRIA 1BSAA 1FUSA 9RNTA 1CH0A 1B3SA 1FZUA 1ZGXA 2F5MA 1TRQA 1BRJA 1UCLA 4GSPA 1BU4A 1DETA 1I0XA 2KF3A 1R4YA 1FYSA 1GSPA 1RHLA 2GSPA 1I2GA 3D4AA 4BU4A 1RN1A 5GSPA 1UCJA 1BSBA 1BSDA 1BNEA 1JBRA 4GHOA 1LOVA 1B21A 1X1YA 3AHWA 3A5EA 1B2MA 1RGKA 1YVSA 3KCHA 5HOHA 3Q3FA 1T2IA 6RNTA 1TTOA 1GMQA 3DGYA 3HOHA 1BNGA 1I3IA 3BIRA 2AAEA 2BIRA 3GSPA 4HOHA 1DE3A 1Q9EA 1IYYA 1B2XA 1FW7A 1RNTA 7GSPA 1GOYA 1C54A 1RTUA 1G02A 1I2FA 1BRSA 1MGWA 1A2PA 1MGRA 1RN4A 1TRPA 1UCIA 1BAOA 1X1XA 1FUTA 1YGWA 1BSEA 1LRAA 3WR2A 1BSCA 1RGLA 2F4YA 6GSPA 1BGSA 7RNTA 1BNFA 1GOVA 1B27A 1I3FA 1GMPA 2KF6A 2RBIA 4HAAA 3SYUA 1BIRA 1RGHA 1BANA 1RGFA 1BNJA 2AADA 1AQZA 1BUJA 1B2UA 4BIRA 1RCKA 1BNSA 1BRNL 2F56A 1BNIA 1RGGA 1UCKA 2RNTA 1LNIA 1I8VA 1JBSA 1RNBA 2KAAA 1AY7A 1X1UA 2BU4A 1HZ1A 1B2SA 8RNTA 1RLSA 1LOYA 3RNTA 1B2ZA 2HOHA 2C4BA 1I0VA 1JBTA 1RDSA 1BRKA 1SARA 3URPA 1I70A 1BVIA 1I2EA 3D5IA 2ZA4A 1PYLA 1BOXA 2SARA 1T2HA 1YNVX
chains in the Genus database with same CATH superfamily
4EXRA 3N9HA 4FR9A 1PY3A 1B20A 1E3RA 1RCLA 1RGCA 3EHCA 1RJOA 1BRHA 1TP6A 1AV4A 3FZWA 2BHMA 2PZVA 1HYFA 1UUVB 2XEPA 3EN1B 3GZYB 2Z77A 5BU4A 1VQ73 1QVF2 1GMRA 3F7XA 4HM7B 5IW9A 2HMMB 3JUMA 3JUNA 4FCJA 4HM2B 5EQLA 5M18A 2XGLA 3JUOA 4KZ1A 3FG3A 3AGOA 1VQL3 4L8PA 1N8QA 2F86B 4FCZA 1W4NA 1UW1A 3LYGA 1KD14 1FUSA 3BNDA 1FZUA 1ASKA 1EUIC 1FGTA 2F5MA 2JQ5A 3RDEA 3HK4A 1TRQA 3PCSA 4GSPA 1FA3A 5CLKA 1JKGB 3JVCA 4KVHA 1KQS2 1EA2A 4ORLA 2QGUA 3STDA 1E97A 1R4YA 3D3LA 3EN8A 3Q1CA 3F9SA 4I4KA 3S5CA 4J9AA 1OHOA 2GU1A 5AIGA 3X42A 1I2GA 1TUHA 2MF7A 1QVG2 1RN1A 1TJDA 2W56B 2XR8B 4WHAA 1OHSA 1BSBA 1BSDA 2W56A 1BNEA 4PEJA 3BNCA 4Q53A 1YJN3 5AEWB 1X1YA 3CCL3 1SIIA 3GAXA 1V58A 2QIYA 2OQEC 2XSHB 1GD3A 4OK0A 1ZS7A 4K1VA 1LQMB 5AIHA 3S27A 3MSOA 1GMQA 1KSIA 3HOHA 2ML5A 1ULIB 4BTXA 4FMBA 1I3IA 2IA7A 2Z76A 3B7CA 2W2CA 2BIRA 1OGXA 2CK3H 1VQK3 1FW7A 3IMAB 3UJMA 5AIIA 3WDGB 1DMQA 1STFI 1MGRA 3RGRA 3LT8A 2ML6A 2O3OA 2CFWA 3FG1A 2YFIB 1OCVA 1YGWA 2XH9A 1LRAA 1N9EA 3CNXA 3LOYA 3AMOB 2F4YA 1YGEA 1MWUA 2CC3A 5EEOA 3I553 7RNTA 2LYXA 3MWZA 3I563 1GOVA 3E99A 1GMPA 1D6UA 4HAAA 3GZXB 4XB5A 4AEQA 2R4IA 3KZTA 4HYZA 3FH1A 3LTCA 2J8XB 3MG2A 2W04A 3OXAA 4X2OA 2AADA 2P0MA 1HU9A 2PNCA 3Q90A 4IPBA 1WTHA 4BIRA 1RCKA 4R4KA 1QJGA 1BRNL 4HM8B 2W9PA 3NHXA 3FF2A 3KSED 4FMDA 3KKGA 1DVCA 1LNHA 4KFEA 3UB1A 4N6LA 1VQQA 3VSYA 1W6GA 1X1UA 2BU4A 2F98A 1N5PA 3BNEA 1R4CA 4BL3A 8RNTA 1RLSA 3MYTA 4HVNA 3RNTA 3SOYA 1IU7A 1CQSA 3A76A 4WFOA 5JBSA 2CH9A 4HZBB 5DREA 1GS3A 3WA2X 1UUGB 4J8TA 3CNMA 1YIT3 1BVIA 1I2EA 1TFKA 2YX9A 2ZDJA 3PZWA 2SARA 1M9GA 4G1MB 2BMRB 3X3ZA 1W01A 5TGNA 1YNVX 4CJNA 4RNTA 4J5KA 3H3HA 2GEXA 4FMAA 1FGRA 2M7OA 2CFLA 3WHOA 3DGMA 1A90A 2B24B 2OCTA 5RNTA 2O9UX 1JJ22 1MOLA 3F40A 1SQWA 3NV0A 3NBJA 3NX0A 4QWTA 3AHSA 2CWUA 5D81A 1JB5A 1O7MB 2HMJB 1GY6A 3SOAA 1RKYA 4EYCA 1BSAA 1Q40B 2A15A 2WOHA 1JB2A 4N6OB 1UGIA 3F8HA 2KF3A 2W6JH 1UDII 1GD4A 1Q824 4LGQA 1GSPA 2CWVA 5BXQA 4AKZA 4BTWA 5GSPA 1E3VA 5CF1A 1UCJA 1V57A 4MMZB 3CME3 1VQP3 4HM6B 2BNGA 1JBRA 5JPPA 3OWUA 5BVBA 5G1KA 1RGKA 1YVSA 5HOHA 3NQZA 4HKVB 2L4VA 3DMCA 2R41A 3DGOA 1TTOA 4HM5B 2C11A 3DGYA 5IG3A 1MWTA 2XRXB 1OACA 1BUQA 4NREA 2XFSA 1ULJB 3G8ZA 3LTDA 3CPOA 3FG4A 2IUKA 1U5OA 5FW5A 3EJVA 3Q2PA 4NHFA 7GSPA 1JZDA 3UL6A 1C54A 1RTUA 1G02A 1I2FA 1MGWA 1RN4A 2E2TA 3ECFA 4ZM8A 4AKYA 2WOFA 3LMLA 1TRPA 4DKIA 1UCIA 3CCJ3 2P0XA 1X1XA 4EV5A 1Q814 4BTYA 5CF2A 2XGNA 1BSEA 1YVBI 1BSCA 1TU5A 4WP5A 3BLZA 1M1K4 2E2UA 3U97A 3CMA3 1VQ93 5IG5A 3NQYA 3N8BA 2RSXA 1NB5I 3CCQ3 4GL6A 1BNFA 2RBIA 1A2KA 4XBTA 5DRVA 3CCE3 4O3VA 1JB4A 1BIRA 2D1WA 3KE7A 3HX8A 1K8A4 1DMNA 4NPBA 4K90B 3JUPA 1RGFA 3EQQB 1JRQA 1Q40A 1Q42A 5AIFA 2XSOB 2CFDA 1B2UA 4XBXA 3G0KA 1BNSA 2CIUA 5EVHA 5CXOA 2W0QA 1JV2B 2HMKB 1JKGA 1UCKA 2RNTA 2K54A 1O7HB 5HGRA 1US1A 1U8CB 2H0HA 3ER7A 1PU4A 5LC7A 2IMJA 3K9MC 1VQO3 3LZAA 1HZ1A 1B2SA 2BO9B 2K0MA 4HM4B 4RNZA 1RN7A 5IEPA 3CPW2 3OW22 1LOYA 3PXMA 1TIJA 3H51A 1B2ZA 1G0TA 4N6TA 1VQ83 3NUVA 2JDIH 1A67A 1RDSA 2I9WA 3F8XA 5AYRB 1WMNA 4EW5A 1AVLA 2ZHXB 3URPA 1NDOB 1WNHA 3FSDA 3CD63 3D5IA 5JPUA 1JZOA 2ZA4A 1PYLA 2MC8A 3N54B 2BMOB 1IQYA 3BU4A 3K0ZA 1FUWA 4CPKA 2YFLB 2Y73A 2CFGA 1MNLA 2Z6BA 2KF4A 3CXC2 1DVDA 1EQKA 4FMCA 3QRDA 4FCMA 1RGEA 3NV0B 1VQN3 3NM7A 3D9RA 3ZG5A 2KF5A 1T5YA 1KC84 1BRGA 4XBYA 1IV7A 1W7CA 1ROAA 3DH2A 1YI23 2OWPA 1GOUA 1RGAA 2CX0A 1QALA 4JF8A 1NWWA 3OV4A 3ALAA 9RNTA 2SBLA 1B3SA 4RZMA 1PFPA 1UUWB 1IT7A 3HI7A 1V74A 3LT9A 1W2B2 3DGNA 5IEOA 1VQ63 1UCLA 4R9KA 1UGHI 4CCVA 1IVUA 3FCSB 3CC23 2RFRA 1VQ43 1DETA 1I0XA 3DGLA 1IVWA 1ROVA 1RRHA 2IY2A 3V98A 3WMDA 1FYSA 3B4OA 1RHLA 2GSPA 2LQVA 1S723 1CYUA 3D4AA 4WYKA 2Y74A 3DZLA 4L8OA 5AYSC 6STDA 1J2BA 1WMOA 1CYVA 2C10A 1JN5B 7STDA 1HKXA 4HM3B 3OX9A 1B21A 1ISKA 1QAKA 3AHWA 3T8NA 4LYLB 2ZL8A 4TX4A 2W03A 1Z1SA 3EE1A 1OF5B 1FGQA 3KCHA 4R9LA 3NBRA 3S67A 3Q3FA 4KT3B 3ZG0A 1FGMA 4EBGA 3TDGA 2Z7AA 1T2IA 1NO3A 3MG3A 6RNTA 2IYJA 1NNVA 3FLJA 1K41A 2BT3A 1BNGA 3U1WA 4KFDA 3GSPA 2RGQA 5STDA 4HOHA 3CCR3 1MWSA 3VF1A 1DE3A 1Q9EA 1B2XA 2P38A 1RNTA 4R1KA 4STDA 1KWIA 3LXUX 8CHOA 5IG4A 2QA43 3IJEB 4HBRA 1GY5A 3KIIA 1BAOA 4MEIA 3EX9A 3X3XA 1IVXA 3DXOA 1T3BA 3HIIA 3G713 4IIAA 1W02A 1NU3A 3LTBA 4O8SA 6GSPA 1W2ZA 5D82A 3KFQC 4L7KA 1D6YA 2CWTA 3SYUA 1QMAA 2KF6A 3T0UA 4EV2A 3D79A 1QAFA 2V1LA 1O7PB 1S5AA 2KRTA 2BMQB 3MG1A 1M1XB 1Q864 1K734 1OUNA 4MJDA 2FGTA 4BL2A 3VGNA 3KN4A 2KXGA 4WWUC 2UUGC 1BNIA 1RGGA 3QK9A 5AI1A 3GZRA 1I8VA 3CCV3 1JBSA 1RNBA 2CFKA 1AY7A 2WGQA 3HIGA 3NXJA 5G2GA 2CG1A 3J7Yd 3GZBA 5IF6A 1EKMA 4WYKB 1W6YA 4N6NB 3K7CA 3FKAA 5ELJA 5M1AA 5IG0A 1DMMA 3CU3A 1JBTA 1W6CA 2CG0A 1W00A 1LVNA 1STDA 1SPUA 4XDVA 1UI7A 3G16A 4HZ9B 1O7GB 1I70A 1OF5A 1RRLA 3WA3A 4HJLB 3SVAA 2XFTA 1VZZA 2HMOB 3PCRA 4ILFA 1LOWA 3AGNA 4JRFA 2QEX3 1YIJ3 3EF8A 1OGZA 2K3DA 3K63A 3NBBA 3AMOA 2CW9A 4RNYA 4LZIA 3MPHA 5IERA 3PYJA 2KCDA 2F5WA 3OWSA 4N3VA 5BIRA 2OOVA 3K5TA 3D5GA 2D42A 1RSNA 4J5GA 1VQ53 4HM0B 1BNRA 1RMSA 1GY7A 1SJWA 1WQLB 4LSOA 3SEDA 1Q7Y4 3SLUA 3CCM3 1SIHA 2CHCA 1X1WA 2CKFB 1OH0A 1OHPA 1BRIA 5CK6A 3CC43 3MKIA 1CH0A 1NB3I 1ZGXA 2F99A 3M8CA 1A2VA 5KP1A 4O2HA 3T8UA 4HM1B 3V92A 5G1LA 4H61A 1CEWI 2H0IA 3WOEB 3I0YA 4OVMA 3LH4A 1N5HA 1BRJA 2P05A 2YFJB 3GRDA 1BU4A 1LQGC 1NJI4 3F14A 1DYUA 1ZO2A 2OTL3 2HMNB 2GXFA 1YJW3 4GB5A 1G96A 1JN5A 3BNBA 4BU4A 5AEUB 2UGIA 3RGAA 3BB9A 3JUQA 1AR0A 1LOVA 4GHOA 3LTAA 3IPTA 1TFOA 5A0OB 3EBTA 3S29A 3A5EA 1B2MA 2OOVC 1O7WB 3CC73 4N6V0 2XF3A 3DUKA 2P09A 3EB8A 3FF0A 2E2VA 3X3YA 2GBXB 2WGOA 1LOXA 1M904 4XDWA 4R80A 3FGYA 3O8YA 4OUQA 3V99A 1EEJA 2HMLB 3BIRA 2AAEA 2UX0A 3PS8A 1FGOA 1D6ZA 3DY5A 1IYYA 4N6MA 2GU3A 3CCS3 4H3UA 4N6UA 1AVKA 5D83A 1GOYA 3B4PA 4K1UA 3CCU3 1BRSA 1ZX2A 1A2PA 1MWRA 4LEHA 3SXXA 1N9JA 1N8R4 5ELUA 4RBNA 2INXA 2RCDA 1O7NB 1JNQA 4U13A 1FUTA 3ZFZA 4EC6A 3WR2A 3WODG 1YJ93 2CX1A 2Q07A 1RGLA 2FXTA 4MMXB 1K28A 1IK3A 1BGSA 1LXEA 3EC9A 5FGOA 2IUJA 3KSPA 1YHQ3 4KFFA 1IV9A 1I3FA 1B27A 3G4S3 3PGBA 2L1SA 4O02B 5IENA 1Y4KA 1IDPA 2OTJ3 3ROBA 3L0RA 1W5ZA 3GWRA 1RGHA 1WMPA 2GEYA 3F7SA 3EBYA 1BANA 4IT7A 3S28A 2B1XB 4X2HA 4LMIA 1BNJA 3X41A 1AQZA 4CDLA 1IQ8A 3OWYA 3G6E3 1K9M4 1BUJA 5I97A 2H0GA 1EG9B 2GBWB 2W9QA 4MMYB 2F56A 4K61A 5LC6A 2STDA 1IQXA 3DM8A 3SX1A 1LNIA 1Q7HA 3HZPA 1IT8A 4XM4A 2KAAA 2OQEA 4I5QA 1L5GB 3X40A 3UNLA 2FNQA 3UL5A 1GYBA 1C7HA 1VQM3 2HOHA 2C4BA 1I0VA 1UI8A 1BRKA 3B8LA 1SARA 3NM2A 1F8NA 3WOFB 5KP3A 5M19A 2WO0A 1IVVA 5KP4A 1BOXA 1OPYA 3MHEA 1T2HA
chains in the Genus database with same CATH topology
3BU4A 4RNTA 1LOWA 3AGNA 4J5KA 1PY3A 2KF4A 1B20A 1RCLA 1RGCA 1BRHA 3WHOA 5RNTA 1RGEA 2F5WA 1HYFA 5BIRA 5BU4A 3D5GA 2KF5A 1GMRA 1RSNA 1BRGA 4J5GA 1BNRA 1RMSA 3DH2A 3AHSA 1GOUA 1RGAA 3AGOA 1X1WA 1BRIA 1BSAA 1FUSA 9RNTA 1CH0A 1B3SA 1FZUA 1ZGXA 2F5MA 1TRQA 1BRJA 1UCLA 4GSPA 1BU4A 1DETA 1I0XA 2KF3A 1R4YA 1FYSA 1GSPA 1RHLA 2GSPA 1I2GA 3D4AA 4BU4A 1RN1A 5GSPA 1UCJA 1BSBA 1BSDA 1BNEA 1JBRA 4GHOA 1LOVA 1B21A 1X1YA 3AHWA 3A5EA 1B2MA 1RGKA 1YVSA 3KCHA 5HOHA 3Q3FA 1T2IA 6RNTA 1TTOA 1GMQA 3DGYA 3HOHA 1BNGA 1I3IA 3BIRA 2AAEA 2BIRA 3GSPA 4HOHA 1DE3A 1Q9EA 1IYYA 1B2XA 1FW7A 1RNTA 7GSPA 1GOYA 1C54A 1RTUA 1G02A 1I2FA 1BRSA 1MGWA 1A2PA 1MGRA 1RN4A 1TRPA 1UCIA 1BAOA 1X1XA 1FUTA 1YGWA 1BSEA 1LRAA 3WR2A 1BSCA 1RGLA 2F4YA 6GSPA 1BGSA 7RNTA 1BNFA 1GOVA 1B27A 1I3FA 1GMPA 2KF6A 2RBIA 4HAAA 3SYUA 1BIRA 1RGHA 1BANA 1RGFA 1BNJA 2AADA 1AQZA 1BUJA 1B2UA 4BIRA 1RCKA 1BNSA 1BRNL 2F56A 1BNIA 1RGGA 1UCKA 2RNTA 1LNIA 1I8VA 1JBSA 1RNBA 2KAAA 1AY7A 1X1UA 2BU4A 1HZ1A 1B2SA 8RNTA 1RLSA 1LOYA 3RNTA 1B2ZA 2HOHA 2C4BA 1I0VA 1JBTA 1RDSA 1BRKA 1SARA 3URPA 1I70A 1BVIA 1I2EA 3D5IA 2ZA4A 1PYLA 1BOXA 2SARA 1T2HA 1YNVX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BU4 A;  4RNT A;  1LOW A;  3AGN A;  4J5K A;  1PY3 A;  2KF4 A;  1B20 A;  1RCL A;  1RGC A;  1BRH A;  3WHO A;  5RNT A;  1RGE A;  2F5W A;  1HYF A;  5BIR A;  5BU4 A;  3D5G A;  2KF5 A;  1GMR A;  1RSN A;  1BRG A;  4J5G A;  1BNR A;  1RMS A;  3DH2 A;  3AHS A;  1GOU A;  1RGA A;  3AGO A;  1X1W A;  1BRI A;  1BSA A;  1FUS A;  9RNT A;  1CH0 A;  1B3S A;  1FZU A;  1ZGX A;  2F5M A;  1TRQ A;  1BRJ A;  1UCL A;  4GSP A;  1BU4 A;  1DET A;  1I0X A;  2KF3 A;  1R4Y A;  1FYS A;  1GSP A;  1RHL A;  2GSP A;  1I2G A;  3D4A A;  4BU4 A;  1RN1 A;  5GSP A;  1UCJ A;  1BSB A;  1BSD A;  1BNE A;  1JBR A;  4GHO A;  1LOV A;  1B21 A;  1X1Y A;  3AHW A;  3A5E A;  1B2M A;  1RGK A;  1YVS A;  3KCH A;  5HOH A;  3Q3F A;  1T2I A;  6RNT A;  1TTO A;  1GMQ A;  3DGY A;  3HOH A;  1BNG A;  1I3I A;  3BIR A;  2AAE A;  2BIR A;  3GSP A;  4HOH A;  1DE3 A;  1Q9E A;  1IYY A;  1B2X A;  1FW7 A;  1RNT A;  7GSP A;  1GOY A;  1C54 A;  1RTU A;  1G02 A;  1I2F A;  1BRS A;  1MGW A;  1A2P A;  1MGR A;  1RN4 A;  1TRP A;  1UCI A;  1BAO A;  1X1X A;  1FUT A;  1YGW A;  1BSE A;  1LRA A;  3WR2 A;  1BSC A;  1RGL A;  2F4Y A;  6GSP A;  1BGS A;  7RNT A;  1BNF A;  1GOV A;  1B27 A;  1I3F A;  1GMP A;  2KF6 A;  2RBI A;  4HAA A;  3SYU A;  1BIR A;  1RGH A;  1BAN A;  1RGF A;  1BNJ A;  2AAD A;  1AQZ A;  1BUJ A;  1B2U A;  4BIR A;  1RCK A;  1BNS A;  1BRN L;  2F56 A;  1BNI A;  1RGG A;  1UCK A;  2RNT A;  1LNI A;  1I8V A;  1JBS A;  1RNB A;  2KAA A;  1AY7 A;  1X1U A;  2BU4 A;  1HZ1 A;  1B2S A;  8RNT A;  1RLS A;  1LOY A;  3RNT A;  1B2Z A;  2HOH A;  2C4B A;  1I0V A;  1JBT A;  1RDS A;  1BRK A;  1SAR A;  3URP A;  1I70 A;  1BVI A;  1I2E A;  3D5I A;  2ZA4 A;  1PYL A;  1BOX A;  2SAR A;  1T2H A;  1YNV X; 
#chains in the Genus database with same CATH topology
 4EXR A;  3N9H A;  4FR9 A;  1PY3 A;  1B20 A;  1E3R A;  1RCL A;  1RGC A;  3EHC A;  1RJO A;  1BRH A;  1TP6 A;  1AV4 A;  3FZW A;  2BHM A;  2PZV A;  1HYF A;  1UUV B;  2XEP A;  3EN1 B;  3GZY B;  2Z77 A;  5BU4 A;  1VQ7 3;  1QVF 2;  1GMR A;  3F7X A;  4HM7 B;  5IW9 A;  2HMM B;  3JUM A;  3JUN A;  4FCJ A;  4HM2 B;  5EQL A;  5M18 A;  2XGL A;  3JUO A;  4KZ1 A;  3FG3 A;  3AGO A;  1VQL 3;  4L8P A;  1N8Q A;  2F86 B;  4FCZ A;  1W4N A;  1UW1 A;  3LYG A;  1KD1 4;  1FUS A;  3BND A;  1FZU A;  1ASK A;  1EUI C;  1FGT A;  2F5M A;  2JQ5 A;  3RDE A;  3HK4 A;  1TRQ A;  3PCS A;  4GSP A;  1FA3 A;  5CLK A;  1JKG B;  3JVC A;  4KVH A;  1KQS 2;  1EA2 A;  4ORL A;  2QGU A;  3STD A;  1E97 A;  1R4Y A;  3D3L A;  3EN8 A;  3Q1C A;  3F9S A;  4I4K A;  3S5C A;  4J9A A;  1OHO A;  2GU1 A;  5AIG A;  3X42 A;  1I2G A;  1TUH A;  2MF7 A;  1QVG 2;  1RN1 A;  1TJD A;  2W56 B;  2XR8 B;  4WHA A;  1OHS A;  1BSB A;  1BSD A;  2W56 A;  1BNE A;  4PEJ A;  3BNC A;  4Q53 A;  1YJN 3;  5AEW B;  1X1Y A;  3CCL 3;  1SII A;  3GAX A;  1V58 A;  2QIY A;  2OQE C;  2XSH B;  1GD3 A;  4OK0 A;  1ZS7 A;  4K1V A;  1LQM B;  5AIH A;  3S27 A;  3MSO A;  1GMQ A;  1KSI A;  3HOH A;  2ML5 A;  1ULI B;  4BTX A;  4FMB A;  1I3I A;  2IA7 A;  2Z76 A;  3B7C A;  2W2C A;  2BIR A;  1OGX A;  2CK3 H;  1VQK 3;  1FW7 A;  3IMA B;  3UJM A;  5AII A;  3WDG B;  1DMQ A;  1STF I;  1MGR A;  3RGR A;  3LT8 A;  2ML6 A;  2O3O A;  2CFW A;  3FG1 A;  2YFI B;  1OCV A;  1YGW A;  2XH9 A;  1LRA A;  1N9E A;  3CNX A;  3LOY A;  3AMO B;  2F4Y A;  1YGE A;  1MWU A;  2CC3 A;  5EEO A;  3I55 3;  7RNT A;  2LYX A;  3MWZ A;  3I56 3;  1GOV A;  3E99 A;  1GMP A;  1D6U A;  4HAA A;  3GZX B;  4XB5 A;  4AEQ A;  2R4I A;  3KZT A;  4HYZ A;  3FH1 A;  3LTC A;  2J8X B;  3MG2 A;  2W04 A;  3OXA A;  4X2O A;  2AAD A;  2P0M A;  1HU9 A;  2PNC A;  3Q90 A;  4IPB A;  1WTH A;  4BIR A;  1RCK A;  4R4K A;  1QJG A;  1BRN L;  4HM8 B;  2W9P A;  3NHX A;  3FF2 A;  3KSE D;  4FMD A;  3KKG A;  1DVC A;  1LNH A;  4KFE A;  3UB1 A;  4N6L A;  1VQQ A;  3VSY A;  1W6G A;  1X1U A;  2BU4 A;  2F98 A;  1N5P A;  3BNE A;  1R4C A;  4BL3 A;  8RNT A;  1RLS A;  3MYT A;  4HVN A;  3RNT A;  3SOY A;  1IU7 A;  1CQS A;  3A76 A;  4WFO A;  5JBS A;  2CH9 A;  4HZB B;  5DRE A;  1GS3 A;  3WA2 X;  1UUG B;  4J8T A;  3CNM A;  1YIT 3;  1BVI A;  1I2E A;  1TFK A;  2YX9 A;  2ZDJ A;  3PZW A;  2SAR A;  1M9G A;  4G1M B;  2BMR B;  3X3Z A;  1W01 A;  5TGN A;  1YNV X;  4CJN A;  4RNT A;  4J5K A;  3H3H A;  2GEX A;  4FMA A;  1FGR A;  2M7O A;  2CFL A;  3WHO A;  3DGM A;  1A90 A;  2B24 B;  2OCT A;  5RNT A;  2O9U X;  1JJ2 2;  1MOL A;  3F40 A;  1SQW A;  3NV0 A;  3NBJ A;  3NX0 A;  4QWT A;  3AHS A;  2CWU A;  5D81 A;  1JB5 A;  1O7M B;  2HMJ B;  1GY6 A;  3SOA A;  1RKY A;  4EYC A;  1BSA A;  1Q40 B;  2A15 A;  2WOH A;  1JB2 A;  4N6O B;  1UGI A;  3F8H A;  2KF3 A;  2W6J H;  1UDI I;  1GD4 A;  1Q82 4;  4LGQ A;  1GSP A;  2CWV A;  5BXQ A;  4AKZ A;  4BTW A;  5GSP A;  1E3V A;  5CF1 A;  1UCJ A;  1V57 A;  4MMZ B;  3CME 3;  1VQP 3;  4HM6 B;  2BNG A;  1JBR A;  5JPP A;  3OWU A;  5BVB A;  5G1K A;  1RGK A;  1YVS A;  5HOH A;  3NQZ A;  4HKV B;  2L4V A;  3DMC A;  2R41 A;  3DGO A;  1TTO A;  4HM5 B;  2C11 A;  3DGY A;  5IG3 A;  1MWT A;  2XRX B;  1OAC A;  1BUQ A;  4NRE A;  2XFS A;  1ULJ B;  3G8Z A;  3LTD A;  3CPO A;  3FG4 A;  2IUK A;  1U5O A;  5FW5 A;  3EJV A;  3Q2P A;  4NHF A;  7GSP A;  1JZD A;  3UL6 A;  1C54 A;  1RTU A;  1G02 A;  1I2F A;  1MGW A;  1RN4 A;  2E2T A;  3ECF A;  4ZM8 A;  4AKY A;  2WOF A;  3LML A;  1TRP A;  4DKI A;  1UCI A;  3CCJ 3;  2P0X A;  1X1X A;  4EV5 A;  1Q81 4;  4BTY A;  5CF2 A;  2XGN A;  1BSE A;  1YVB I;  1BSC A;  1TU5 A;  4WP5 A;  3BLZ A;  1M1K 4;  2E2U A;  3U97 A;  3CMA 3;  1VQ9 3;  5IG5 A;  3NQY A;  3N8B A;  2RSX A;  1NB5 I;  3CCQ 3;  4GL6 A;  1BNF A;  2RBI A;  1A2K A;  4XBT A;  5DRV A;  3CCE 3;  4O3V A;  1JB4 A;  1BIR A;  2D1W A;  3KE7 A;  3HX8 A;  1K8A 4;  1DMN A;  4NPB A;  4K90 B;  3JUP A;  1RGF A;  3EQQ B;  1JRQ A;  1Q40 A;  1Q42 A;  5AIF A;  2XSO B;  2CFD A;  1B2U A;  4XBX A;  3G0K A;  1BNS A;  2CIU A;  5EVH A;  5CXO A;  2W0Q A;  1JV2 B;  2HMK B;  1JKG A;  1UCK A;  2RNT A;  2K54 A;  1O7H B;  5HGR A;  1US1 A;  1U8C B;  2H0H A;  3ER7 A;  1PU4 A;  5LC7 A;  2IMJ A;  3K9M C;  1VQO 3;  3LZA A;  1HZ1 A;  1B2S A;  2BO9 B;  2K0M A;  4HM4 B;  4RNZ A;  1RN7 A;  5IEP A;  3CPW 2;  3OW2 2;  1LOY A;  3PXM A;  1TIJ A;  3H51 A;  1B2Z A;  1G0T A;  4N6T A;  1VQ8 3;  3NUV A;  2JDI H;  1A67 A;  1RDS A;  2I9W A;  3F8X A;  5AYR B;  1WMN A;  4EW5 A;  1AVL A;  2ZHX B;  3URP A;  1NDO B;  1WNH A;  3FSD A;  3CD6 3;  3D5I A;  5JPU A;  1JZO A;  2ZA4 A;  1PYL A;  2MC8 A;  3N54 B;  2BMO B;  1IQY A;  3BU4 A;  3K0Z A;  1FUW A;  4CPK A;  2YFL B;  2Y73 A;  2CFG A;  1MNL A;  2Z6B A;  2KF4 A;  3CXC 2;  1DVD A;  1EQK A;  4FMC A;  3QRD A;  4FCM A;  1RGE A;  3NV0 B;  1VQN 3;  3NM7 A;  3D9R A;  3ZG5 A;  2KF5 A;  1T5Y A;  1KC8 4;  1BRG A;  4XBY A;  1IV7 A;  1W7C A;  1ROA A;  3DH2 A;  1YI2 3;  2OWP A;  1GOU A;  1RGA A;  2CX0 A;  1QAL A;  4JF8 A;  1NWW A;  3OV4 A;  3ALA A;  9RNT A;  2SBL A;  1B3S A;  4RZM A;  1PFP A;  1UUW B;  1IT7 A;  3HI7 A;  1V74 A;  3LT9 A;  1W2B 2;  3DGN A;  5IEO A;  1VQ6 3;  1UCL A;  4R9K A;  1UGH I;  4CCV A;  1IVU A;  3FCS B;  3CC2 3;  2RFR A;  1VQ4 3;  1DET A;  1I0X A;  3DGL A;  1IVW A;  1ROV A;  1RRH A;  2IY2 A;  3V98 A;  3WMD A;  1FYS A;  3B4O A;  1RHL A;  2GSP A;  2LQV A;  1S72 3;  1CYU A;  3D4A A;  4WYK A;  2Y74 A;  3DZL A;  4L8O A;  5AYS C;  6STD A;  1J2B A;  1WMO A;  1CYV A;  2C10 A;  1JN5 B;  7STD A;  1HKX A;  4HM3 B;  3OX9 A;  1B21 A;  1ISK A;  1QAK A;  3AHW A;  3T8N A;  4LYL B;  2ZL8 A;  4TX4 A;  2W03 A;  1Z1S A;  3EE1 A;  1OF5 B;  1FGQ A;  3KCH A;  4R9L A;  3NBR A;  3S67 A;  3Q3F A;  4KT3 B;  3ZG0 A;  1FGM A;  4EBG A;  3TDG A;  2Z7A A;  1T2I A;  1NO3 A;  3MG3 A;  6RNT A;  2IYJ A;  1NNV A;  3FLJ A;  1K41 A;  2BT3 A;  1BNG A;  3U1W A;  4KFD A;  3GSP A;  2RGQ A;  5STD A;  4HOH A;  3CCR 3;  1MWS A;  3VF1 A;  1DE3 A;  1Q9E A;  1B2X A;  2P38 A;  1RNT A;  4R1K A;  4STD A;  1KWI A;  3LXU X;  8CHO A;  5IG4 A;  2QA4 3;  3IJE B;  4HBR A;  1GY5 A;  3KII A;  1BAO A;  4MEI A;  3EX9 A;  3X3X A;  1IVX A;  3DXO A;  1T3B A;  3HII A;  3G71 3;  4IIA A;  1W02 A;  1NU3 A;  3LTB A;  4O8S A;  6GSP A;  1W2Z A;  5D82 A;  3KFQ C;  4L7K A;  1D6Y A;  2CWT A;  3SYU A;  1QMA A;  2KF6 A;  3T0U A;  4EV2 A;  3D79 A;  1QAF A;  2V1L A;  1O7P B;  1S5A A;  2KRT A;  2BMQ B;  3MG1 A;  1M1X B;  1Q86 4;  1K73 4;  1OUN A;  4MJD A;  2FGT A;  4BL2 A;  3VGN A;  3KN4 A;  2KXG A;  4WWU C;  2UUG C;  1BNI A;  1RGG A;  3QK9 A;  5AI1 A;  3GZR A;  1I8V A;  3CCV 3;  1JBS A;  1RNB A;  2CFK A;  1AY7 A;  2WGQ A;  3HIG A;  3NXJ A;  5G2G A;  2CG1 A;  3J7Y d;  3GZB A;  5IF6 A;  1EKM A;  4WYK B;  1W6Y A;  4N6N B;  3K7C A;  3FKA A;  5ELJ A;  5M1A A;  5IG0 A;  1DMM A;  3CU3 A;  1JBT A;  1W6C A;  2CG0 A;  1W00 A;  1LVN A;  1STD A;  1SPU A;  4XDV A;  1UI7 A;  3G16 A;  4HZ9 B;  1O7G B;  1I70 A;  1OF5 A;  1RRL A;  3WA3 A;  4HJL B;  3SVA A;  2XFT A;  1VZZ A;  2HMO B;  3PCR A;  4ILF A;  1LOW A;  3AGN A;  4JRF A;  2QEX 3;  1YIJ 3;  3EF8 A;  1OGZ A;  2K3D A;  3K63 A;  3NBB A;  3AMO A;  2CW9 A;  4RNY A;  4LZI A;  3MPH A;  5IER A;  3PYJ A;  2KCD A;  2F5W A;  3OWS A;  4N3V A;  5BIR A;  2OOV A;  3K5T A;  3D5G A;  2D42 A;  1RSN A;  4J5G A;  1VQ5 3;  4HM0 B;  1BNR A;  1RMS A;  1GY7 A;  1SJW A;  1WQL B;  4LSO A;  3SED A;  1Q7Y 4;  3SLU A;  3CCM 3;  1SIH A;  2CHC A;  1X1W A;  2CKF B;  1OH0 A;  1OHP A;  1BRI A;  5CK6 A;  3CC4 3;  3MKI A;  1CH0 A;  1NB3 I;  1ZGX A;  2F99 A;  3M8C A;  1A2V A;  5KP1 A;  4O2H A;  3T8U A;  4HM1 B;  3V92 A;  5G1L A;  4H61 A;  1CEW I;  2H0I A;  3WOE B;  3I0Y A;  4OVM A;  3LH4 A;  1N5H A;  1BRJ A;  2P05 A;  2YFJ B;  3GRD A;  1BU4 A;  1LQG C;  1NJI 4;  3F14 A;  1DYU A;  1ZO2 A;  2OTL 3;  2HMN B;  2GXF A;  1YJW 3;  4GB5 A;  1G96 A;  1JN5 A;  3BNB A;  4BU4 A;  5AEU B;  2UGI A;  3RGA A;  3BB9 A;  3JUQ A;  1AR0 A;  1LOV A;  4GHO A;  3LTA A;  3IPT A;  1TFO A;  5A0O B;  3EBT A;  3S29 A;  3A5E A;  1B2M A;  2OOV C;  1O7W B;  3CC7 3;  4N6V 0;  2XF3 A;  3DUK A;  2P09 A;  3EB8 A;  3FF0 A;  2E2V A;  3X3Y A;  2GBX B;  2WGO A;  1LOX A;  1M90 4;  4XDW A;  4R80 A;  3FGY A;  3O8Y A;  4OUQ A;  3V99 A;  1EEJ A;  2HML B;  3BIR A;  2AAE A;  2UX0 A;  3PS8 A;  1FGO A;  1D6Z A;  3DY5 A;  1IYY A;  4N6M A;  2GU3 A;  3CCS 3;  4H3U A;  4N6U A;  1AVK A;  5D83 A;  1GOY A;  3B4P A;  4K1U A;  3CCU 3;  1BRS A;  1ZX2 A;  1A2P A;  1MWR A;  4LEH A;  3SXX A;  1N9J A;  1N8R 4;  5ELU A;  4RBN A;  2INX A;  2RCD A;  1O7N B;  1JNQ A;  4U13 A;  1FUT A;  3ZFZ A;  4EC6 A;  3WR2 A;  3WOD G;  1YJ9 3;  2CX1 A;  2Q07 A;  1RGL A;  2FXT A;  4MMX B;  1K28 A;  1IK3 A;  1BGS A;  1LXE A;  3EC9 A;  5FGO A;  2IUJ A;  3KSP A;  1YHQ 3;  4KFF A;  1IV9 A;  1I3F A;  1B27 A;  3G4S 3;  3PGB A;  2L1S A;  4O02 B;  5IEN A;  1Y4K A;  1IDP A;  2OTJ 3;  3ROB A;  3L0R A;  1W5Z A;  3GWR A;  1RGH A;  1WMP A;  2GEY A;  3F7S A;  3EBY A;  1BAN A;  4IT7 A;  3S28 A;  2B1X B;  4X2H A;  4LMI A;  1BNJ A;  3X41 A;  1AQZ A;  4CDL A;  1IQ8 A;  3OWY A;  3G6E 3;  1K9M 4;  1BUJ A;  5I97 A;  2H0G A;  1EG9 B;  2GBW B;  2W9Q A;  4MMY B;  2F56 A;  4K61 A;  5LC6 A;  2STD A;  1IQX A;  3DM8 A;  3SX1 A;  1LNI A;  1Q7H A;  3HZP A;  1IT8 A;  4XM4 A;  2KAA A;  2OQE A;  4I5Q A;  1L5G B;  3X40 A;  3UNL A;  2FNQ A;  3UL5 A;  1GYB A;  1C7H A;  1VQM 3;  2HOH A;  2C4B A;  1I0V A;  1UI8 A;  1BRK A;  3B8L A;  1SAR A;  3NM2 A;  1F8N A;  3WOF B;  5KP3 A;  5M19 A;  2WO0 A;  1IVV A;  5KP4 A;  1BOX A;  1OPY A;  3MHE A;  1T2H A; 
#chains in the Genus database with same CATH homology
 3BU4 A;  4RNT A;  1LOW A;  3AGN A;  4J5K A;  1PY3 A;  2KF4 A;  1B20 A;  1RCL A;  1RGC A;  1BRH A;  3WHO A;  5RNT A;  1RGE A;  2F5W A;  1HYF A;  5BIR A;  5BU4 A;  3D5G A;  2KF5 A;  1GMR A;  1RSN A;  1BRG A;  4J5G A;  1BNR A;  1RMS A;  3DH2 A;  3AHS A;  1GOU A;  1RGA A;  3AGO A;  1X1W A;  1BRI A;  1BSA A;  1FUS A;  9RNT A;  1CH0 A;  1B3S A;  1FZU A;  1ZGX A;  2F5M A;  1TRQ A;  1BRJ A;  1UCL A;  4GSP A;  1BU4 A;  1DET A;  1I0X A;  2KF3 A;  1R4Y A;  1FYS A;  1GSP A;  1RHL A;  2GSP A;  1I2G A;  3D4A A;  4BU4 A;  1RN1 A;  5GSP A;  1UCJ A;  1BSB A;  1BSD A;  1BNE A;  1JBR A;  4GHO A;  1LOV A;  1B21 A;  1X1Y A;  3AHW A;  3A5E A;  1B2M A;  1RGK A;  1YVS A;  3KCH A;  5HOH A;  3Q3F A;  1T2I A;  6RNT A;  1TTO A;  1GMQ A;  3DGY A;  3HOH A;  1BNG A;  1I3I A;  3BIR A;  2AAE A;  2BIR A;  3GSP A;  4HOH A;  1DE3 A;  1Q9E A;  1IYY A;  1B2X A;  1FW7 A;  1RNT A;  7GSP A;  1GOY A;  1C54 A;  1RTU A;  1G02 A;  1I2F A;  1BRS A;  1MGW A;  1A2P A;  1MGR A;  1RN4 A;  1TRP A;  1UCI A;  1BAO A;  1X1X A;  1FUT A;  1YGW A;  1BSE A;  1LRA A;  3WR2 A;  1BSC A;  1RGL A;  2F4Y A;  6GSP A;  1BGS A;  7RNT A;  1BNF A;  1GOV A;  1B27 A;  1I3F A;  1GMP A;  2KF6 A;  2RBI A;  4HAA A;  3SYU A;  1BIR A;  1RGH A;  1BAN A;  1RGF A;  1BNJ A;  2AAD A;  1AQZ A;  1BUJ A;  1B2U A;  4BIR A;  1RCK A;  1BNS A;  1BRN L;  2F56 A;  1BNI A;  1RGG A;  1UCK A;  2RNT A;  1LNI A;  1I8V A;  1JBS A;  1RNB A;  2KAA A;  1AY7 A;  1X1U A;  2BU4 A;  1HZ1 A;  1B2S A;  8RNT A;  1RLS A;  1LOY A;  3RNT A;  1B2Z A;  2HOH A;  2C4B A;  1I0V A;  1JBT A;  1RDS A;  1BRK A;  1SAR A;  3URP A;  1I70 A;  1BVI A;  1I2E A;  3D5I A;  2ZA4 A;  1PYL A;  1BOX A;  2SAR A;  1T2H A;  1YNV X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...