4HM6B

Naphthalene 1,2-dioxygenase bound to phenetole
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to phenetole
rcsb
source organism Pseudomonas sp. c18
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm6B00
1Q40A 2UX0A 3T8UA 4KVHA 3HZPA 2Z76A 3I0YA 3EC9A 4WYKA 1ZO2A 1Q42A 3NUVA 4FCMA 4LGQA 4XBTA 3FH1A 3GZXB 3MG2A 4HM1B 3A76A 1ULIB 3G0KA 1ISKA 1GYBA 1O7MB 4FCJA 3F14A 1WQLB 1Q40B 3JUOA 3NHXA 2XSOB 5CF1A 3MG1A 5AIFA 1STDA 1IDPA 4WYKB 4IIAA 1DMNA 1GY6A 5JPUA 1O7NB 1OGXA 1ASKA 3GZRA 3WMDA 1VZZA 1E3RA 3OXAA 2CHCA 5D82A 2F99A 3HX8A 3LZAA 3FZWA 3EHCA 3G8ZA 5STDA 3F9SA 3EBTA 3VGNA 4CDLA 4GB5A 5AEWB 2BMRB 1S5AA 4HM8B 2W2CA 4H3UA 4X2HA 4LMIA 1C7HA 3GRDA 5AIHA 1GY7A 4HVNA 5CXOA 3HK4A 4XDVA 1JB2A 4XBXA 1A2KA 2RCDA 3EJVA 3KSPA 3NM2A 4HM2B 4J9AA 5BVBA 3CNMA 2A15A 3MYTA 2OWPA 3F40A 1OGZA 3JUQA 1Z1SA 5BXQA 4HM3B 4X2OA 3JUMA 2GBWB 5IEOA 3EQQB 1DMMA 2I9WA 1OUNA 4Q53A 1QMAA 3CNXA 3MG3A 8CHOA 2XRXB 3KKGA 2GBXB 4XDWA 3S5CA 3G16A 1O7HB 2GEYA 3FF2A 5G2GA 3FLJA 3B8LA 6STDA 2Z77A 1W6YA 4ORLA 4R1KA 4I4KA 1UUWB 5IG4A 3EF8A 7STDA 4OVMA 3F7SA 3JUPA 4K1UA 3RGAA 3FGYA 2BMQB 2RFRA 3D9RA 3DM8A 4HZ9B 2QIYA 3UNLA 5AEUB 1NWWA 2STDA 3KE7A 4HM4B 4HZBB 3EX9A 1U5OA 3K7CA 4RZMA 3ROBA 4J8TA 1JN5A 2GXFA 3CU3A 5D81A 1QJGA 3F8HA 1ZX2A 5KP1A 4XB5A 3SEDA 2YFJB 3EN8A 1OHSA 2F86B 3NV0A 1K41A 3EN1B 1GS3A 2K54A 3NBRA 3BLZA 1TUHA 3UJMA 3DMCA 3VSYA 3Q90A 3ECFA 1JN5B 3ER7A 1TP6A 3M8CA 3DXOA 2YFLB 5CK6A 3NXJA 2GEXA 3H3HA 3GWRA 3EBYA 3K0ZA 1OCVA 3OWSA 2BMOB 3NV0B 3OV4A 3DZLA 4K1VA 3GZYB 2HMLB 1HKXA 5IG3A 4N3VA 5KP3A 2BNGA 1OF5A 4STDA 3BB9A 3CPOA 2HMJB 5D83A 3F8XA 1NU3A 1SJWA 5EVHA 4L7KA 4PEJA 1O7PB 3LYGA 5IF6A 3H51A 3MSOA 5CF2A 2HMNB 5IG0A 1OF5B 3SOYA 2HMMB 3B4PA 1E97A 2R4IA 1ULJB 1OH0A 3E99A 1GY5A 3OWYA 1OHOA 1JB4A 4HKVB 3OX9A 5AIGA 1W02A 1EG9B 5IG5A 4WP5A 1EA2A 3GZBA 3B7CA 5AIIA 2HMKB 3RGRA 2INXA 1NDOB 2CKFB 4HM7B 2B24B 4U13A 2F98A 5IEPA 5JPPA 4HM5B 2XSHB 3IPTA 1UUVB 5AI1A 2XR8B 1AR0A 5IENA 2HMOB 5IERA 4WWUC 2IMJA 5CLKA 3STDA 1JKGA 1BUQA 3F7XA 3JUNA 4LEHA 5KP4A 1E3VA 5HGRA 2YFIB 1DMQA 1W01A 2RGQA 5DRVA 3T8NA 1O7GB 4HM0B 1OHPA 5FW5A 1JKGB 5DREA 1CQSA 3FF0A 3KZTA 4HM6B 2B1XB 2Z7AA 4XM4A 3FSDA 1O7WB 4R9KA 3MKIA 1OPYA 3MHEA 2QGUA 4OUQA 4HJLB 1W00A 2JQ5A 2PZVA 4L8PA 3FKAA 4L8OA 3SOAA 3DUKA 1JB5A 4XBYA 5TGNA 3B4OA 3OWUA 4MJDA 4R9LA
chains in the Genus database with same CATH superfamily
1N9JA 2E2TA 1Q40A 3DGMA 2UX0A 3X40A 3T8UA 1I70A 1JBRA 4KVHA 2RSXA 3HZPA 4FMDA 2Z76A 1VQL3 3I0YA 3X3YA 2CWUA 1MNLA 3EC9A 2UUGC 3I563 4AKZA 2C11A 3AGNA 2CH9A 1CYVA 4WYKA 1ZO2A 1BRHA 1GD3A 1Q814 2OTJ3 1Q42A 3NUVA 4FCMA 4LGQA 4XBTA 4ILFA 3FH1A 1RN4A 3GZXB 3MG2A 4HM1B 3A76A 2BIRA 3CD63 1UCIA 2KF3A 4O02B 1ULIB 1TFOA 1IVXA 1LQMB 7GSPA 1I8VA 1SIHA 3G0KA 3CCQ3 1A90A 3QK9A 1G0TA 1LOXA 1ISKA 1GYBA 1O7MB 5G1KA 4FCJA 1RN1A 3F14A 3LT9A 2OTL3 1PU4A 1WQLB 1MWTA 4LYLB 4O8SA 1B2ZA 1Q40B 1QVF2 2IY2A 3JUOA 3NHXA 1JZOA 4WHAA 3X3XA 2XSOB 5CF1A 1DE3A 3LTBA 5A0OB 3MG1A 3MPHA 1UCKA 5AIFA 3URPA 2F4YA 1B21A 1IDPA 1STDA 4EXRA 5EEOA 1EQKA 3PGBA 4WYKB 4IIAA 2CW9A 3PS8A 2CWTA 1DMNA 1GY6A 3V99A 2FXTA 2C10A 3GAXA 1O7NB 5JPUA 1RNBA 2XGLA 1OGXA 3KFQC 1YGWA 1ASKA 3DY5A 1GSPA 3GZRA 3D3LA 3KCHA 1NJI4 4HAAA 5G1LA 1YIJ3 1W6CA 2GU1A 3WMDA 1E3RA 1VZZA 3WODG 3OXAA 4R80A 2CHCA 5D82A 2F99A 3HX8A 3DH2A 1HU9A 4N6LA 1NO3A 3S28A 3ZG5A 3BNBA 3L0RA 3S67A 3SXXA 1I3FA 3LZAA 4TX4A 3FZWA 2BO9B 5AYRB 3EHCA 3G8ZA 1BNGA 3WHOA 3QRDA 5STDA 3F9SA 1FUWA 3EBTA 5LC7A 3LH4A 2P09A 1BANA 2W6JH 3IMAB 3VGNA 3WA2X 4CDLA 1K734 4GB5A 1FGTA 1WMOA 1MWUA 4AEQA 4GHOA 4HOHA 5AEWB 3Q1CA 4JRFA 1BSDA 4K61A 1RKYA 2UGIA 1RGCA 2KXGA 2W0QA 2K0MA 4N6OB 1LQGC 2BMRB 1V57A 1S5AA 2CFGA 2W2CA 4HM8B 1I3IA 4H3UA 4X2HA 2OQEC 1W4NA 1VQ73 4LMIA 2AAEA 3I553 1C7HA 2WGQA 2BU4A 4O2HA 1DYUA 3GRDA 4BU4A 1ZS7A 4IPBA 5AIHA 1RCKA 1GY7A 4HVNA 5CXOA 4EYCA 1F8NA 3HK4A 1I2FA 4XDVA 1JB2A 1A2PA 4XBXA 1NB5I 1A2KA 1UI8A 1A67A 2SBLA 2RCDA 4ZM8A 4CCVA 3EJVA 3KSPA 1IV9A 1BU4A 1YIT3 2FNQA 1SQWA 3NM2A 2GU3A 1B20A 2IUJA 1BSAA 3NQYA 3K9MC 1GOVA 1N8R4 4HM2B 2OCTA 2RBIA 1RGKA 4J9AA 1T3BA 5BVBA 1QALA 3CNMA 2A15A 3MYTA 1V58A 2OWPA 3EB8A 3D5IA 5I97A 4GL6A 1RTUA 3F40A 1GMQA 1OGZA 2L1SA 4R4KA 1VQ83 2KF6A 2XFTA 3DGLA 3JUQA 1Z1SA 5BXQA 1BNIA 1BNJA 1UGIA 3WDGB 4HM3B 1VQQA 3PCSA 4KFDA 1BNEA 4X2OA 3WA3A 3JUMA 1LVNA 2W04A 1JBTA 1FA3A 2GBWB 2J8XB 5IEOA 2WOHA 1W2ZA 4FMAA 3EQQB 1UCJA 1AQZA 1EKMA 2FGTA 1DMMA 3BU4A 3RNTA 2I9WA 1OUNA 3N9HA 4Q53A 1QMAA 1X1UA 3CC73 1MWRA 5BIRA 1VQ93 1PFPA 3SLUA 3A5EA 3CNXA 1EEJA 3MG3A 2CX0A 3AHSA 8CHOA 1N8QA 2XRXB 2YX9A 1R4CA 3KKGA 4J5GA 2GBXB 4OK0A 4XDWA 2F5MA 4O3VA 3S5CA 1RGEA 4KFFA 3G16A 1N5HA 6GSPA 1HYFA 5BU4A 1VQP3 1O7HB 2GEYA 1IK3A 1SPUA 3CCV3 1CEWI 3FF2A 5G2GA 3OW22 3KN4A 3N8BA 3FLJA 3B8LA 1N5PA 4FR9A 1RSNA 1RCLA 6STDA 2BHMA 2Z77A 3NQZA 1RGHA 4KT3B 1K9M4 1KSIA 1W6YA 4ORLA 4R1KA 4I4KA 1UUWB 2CC3A 3T0UA 3S29A 1M1XB 3PYJA 5IG4A 1MOLA 3EF8A 9RNTA 7STDA 4OVMA 4FMBA 1JRQA 2LYXA 1W7CA 3F7SA 4EV5A 3JUPA 1B27A 2OOVC 4K1UA 3TDGA 3RGAA 3FGYA 1WMPA 2BMQB 2RFRA 1TIJA 3D9RA 3DM8A 4HYZA 4BL3A 4HZ9B 3LTAA 3D79A 4RNYA 2QIYA 3LMLA 3K63A 1GMRA 4GSPA 1US1A 3UNLA 5AEUB 5M1AA 1B2UA 1NWWA 1OACA 2W03A 1TRPA 2O9UX 4CJNA 1YGEA 2STDA 1IT7A 2ZDJA 3KE7A 3Q3FA 4HM4B 1EUIC 4HZBB 3EX9A 1U5OA 3K7CA 1RN7A 4RZMA 3ROBA 3U1WA 2PNCA 4J8TA 1BVIA 2ZA4A 4BTWA 1BRKA 1JN5A 1GD4A 1M9GA 2GXFA 2IYJA 3UL5A 1V74A 1SIIA 1GOUA 3CU3A 5D81A 1BUJA 1QJGA 1ZX2A 3F8HA 5KP1A 4XB5A 5GSPA 3SEDA 1WTHA 3CCM3 1T2HA 2YFJB 3EN8A 3O8YA 3X41A 1UI7A 1OHSA 1YNVX 2F86B 2KCDA 1IU7A 1K41A 3NV0A 1PY3A 2K3DA 1FZUA 1FGOA 2CWVA 3EN1B 4H61A 1VQ53 1BNRA 1QVG2 4N6V0 3N54B 1D6ZA 1B3SA 1T5YA 3X3ZA 1GS3A 2OQEA 1K8A4 1JNQA 3WR2A 2K54A 1SARA 3NBRA 3BLZA 3PXMA 1YVSA 1TUHA 3EE1A 1BSBA 3DMCA 3HIGA 2XFSA 3Q90A 3UJMA 1IT8A 3VSYA 1B2SA 2HOHA 2W56A 3ECFA 1RHLA 1JN5B 4I5QA 3ER7A 1JBSA 1LOVA 1TP6A 4MMZB 3IJEB 3M8CA 3CCL3 2LQVA 7RNTA 3DXOA 3FCSB 2YFLB 5CK6A 1IYYA 3NXJA 2C4BA 2GEXA 3H3HA 1YJN3 1BRSA 1X1XA 3GWRA 1BGSA 2KF5A 1A2VA 1IQYA 1W2B2 1KD14 3EBYA 3K0ZA 3FG3A 1OCVA 1RGLA 1X1YA 1RDSA 3OWSA 1D6YA 1UDII 2BMOB 3NV0B 2XEPA 3NBBA 2GSPA 2H0GA 1PYLA 3OV4A 3CCS3 3DZLA 5RNTA 1BRGA 1LRAA 3CCJ3 3AMOA 4K1VA 5ELJA 2IA7A 1YI23 3NM7A 3GZYB 3CPW2 2HMLB 2Y73A 2CFKA 1HKXA 1R4YA 1BSEA 2E2VA 2M7OA 1Q824 5IG3A 1DVCA 2W56B 4N3VA 5KP3A 1Q7Y4 2BNGA 2P38A 1OF5A 1BSCA 2XGNA 1FGMA 3U97A 3CMA3 4STDA 3BB9A 3CPOA 3JVCA 4J5KA 1LNIA 2HMJB 4N6MA 5D83A 3F8XA 1NU3A 1SJWA 5EVHA 1QAKA 4LZIA 1STFI 3SYUA 1AVLA 2WOFA 1W5ZA 3K5TA 3NX0A 4L7KA 4PEJA 1RLSA 1X1WA 1VQM3 1O7PB 4FCZA 3NBJA 1BOXA 3AMOB 2ZHXB 2ZL8A 3LYGA 4HBRA 5LC6A 5IF6A 5M18A 2CG0A 1I0XA 2E2UA 3H51A 3ALAA 3HIIA 3MSOA 1KQS2 1TRQA 5CF2A 2HMNB 3DGOA 1JV2B 1UCLA 5IG0A 1NNVA 1OF5B 4RNTA 3UB1A 4K90B 4BTXA 1BNFA 1S723 2R41A 1YHQ3 1ROAA 1RRLA 1RGAA 3SOYA 2HMMB 3ZFZA 1VQK3 3AGOA 3B4PA 1I2EA 4EBGA 1UW1A 1M1K4 1YJ93 1I2GA 1E97A 2R4IA 2W9PA 2SARA 1ULJB 3MWZA 4BTYA 1OH0A 1L5GB 3LT8A 3E99A 1BIRA 2CFLA 4N6UA 3CME3 1GY5A 6RNTA 3VF1A 2Y74A 3FG1A 1BRJA 1HZ1A 5M19A 2AADA 3OWYA 1JJ22 1OHOA 4NPBA 1JB4A 4HKVB 3OX9A 1LOYA 3BNDA 3SVAA 5AIGA 1W02A 1EG9B 1FGRA 5IG5A 4NREA 1RGFA 1WNHA 1EA2A 3GZBA 4WP5A 2QEX3 2CK3H 2W9QA 3B7CA 4WFOA 3LOYA 2KAAA 2P0MA 3Q2PA 3X42A 2OOVA 5AIIA 3KSED 1MWSA 1RJOA 2HMKB 3D5GA 3RGRA 3BNEA 2INXA 1M904 3UL6A 1NDOB 1KC84 2CKFB 4HM7B 2B24B 1YJW3 2ML5A 1QAFA 2F98A 4U13A 5IW9A 1CH0A 2Z6BA 4RNZA 4FMCA 1VQN3 1TFKA 2KF4A 3BIRA 4LSOA 1J2BA 3CCU3 1IVVA 1N9EA 1TJDA 3SX1A 1BRIA 5IEPA 5JPPA 1YVBI 1BRNL 5ELUA 4HM5B 2XSHB 2XF3A 1DVDA 3IPTA 3PZWA 1Q7HA 1UUVB 5AI1A 3D4AA 3DGNA 2P0XA 4AKYA 1B2XA 2O3OA 2XR8B 3GSPA 3DGYA 3CXC2 5FGOA 8RNTA 1IVWA 3G713 1AR0A 5IENA 5AYSC 5JBSA 2HMOB 3J7Yd 5IERA 4WWUC 2IMJA 1KWIA 1T2IA 5CLKA 3CC43 3STDA 3CCE3 1AY7A 3HI7A 3BNCA 2CIUA 1JKGA 4NHFA 1B2MA 3V98A 4KZ1A 1FUTA 1TTOA 2H0HA 3PCRA 4EV2A 1BUQA 3CC23 3G6E3 3F7XA 1LOWA 1LXEA 1RGGA 3HOHA 3JUNA 3V92A 3WOFB 1CYUA 2BT3A 4LEHA 1WMNA 1UGHI 4JF8A 5KP4A 4CPKA 2WO0A 1E3VA 1VQ63 4IT7A 4QWTA 5HGRA 5EQLA 2F5WA 2YFIB 1DMQA 4DKIA 1RNTA 2XH9A 1W01A 1FUSA 2RGQA 2MC8A 5DRVA 3G4S3 2MF7A 3T8NA 3RDEA 1FW7A 4RBNA 1TU5A 1BAOA 1O7GB 3AHWA 1G96A 4HM0B 2CG1A 5HOHA 1FGQA 4N6NB 1OHPA 3KIIA 4MEIA 4BL2A 1LNHA 2JDIH 4EW5A 1FYSA 5FW5A 2IUKA 3LXUX 2CX1A 1RRHA 3FG4A 1JKGB 1ZGXA 1UUGB 3WOEB 4G1MB 5DREA 1CQSA 3FF0A 3KZTA 4HM6B 4MMYB 1IVUA 1I0VA 2P05A 1Q864 1U8CB 2V1LA 1IQXA 2B1XB 1MGRA 1RMSA 2H0IA 1DETA 1D6UA 2L4VA 1JZDA 3LTDA 2Z7AA 4XM4A 2RNTA 3FSDA 1K28A 3S27A 1VQ43 1O7WB 4R9KA 3MKIA 2CFWA 2QA43 1OPYA 1MGWA 1ROVA 1W6GA 2F56A 2QGUA 3MHEA 1AVKA 3CCR3 4N6TA 1GMPA 4OUQA 4BIRA 3ZG0A 1IQ8A 1G02A 4HJLB 1W00A 1AV4A 2D42A 1VQO3 2ML6A 3LTCA 1Q9EA 1IV7A 2CFDA 1NB3I 2JQ5A 2PZVA 2Q07A 4L8PA 4MMXB 1C54A 3FKAA 2KRTA 4L8OA 3SOAA 2D1WA 3DUKA 2WGOA 1JB5A 4XBYA 1BNSA 1GOYA 3B4OA 5TGNA 1Y4KA 3OWUA 4MJDA 4R9LA 4EC6A 4KFEA
chains in the Genus database with same CATH topology
1N9JA 2E2TA 1Q40A 3DGMA 2UX0A 3X40A 3T8UA 4KVHA 2RSXA 3HZPA 4FMDA 2Z76A 1VQL3 3I0YA 3X3YA 2CWUA 1MNLA 3EC9A 3I563 4AKZA 2C11A 2CH9A 1CYVA 4WYKA 1ZO2A 1GD3A 1Q814 2OTJ3 1Q42A 3NUVA 4FCMA 4LGQA 4XBTA 3FH1A 3GZXB 3MG2A 4HM1B 3CD63 3A76A 4O02B 1ULIB 1TFOA 1IVXA 1SIHA 3G0KA 3CCQ3 1A90A 3QK9A 1LOXA 1ISKA 1GYBA 1O7MB 4FCJA 3F14A 3LT9A 2OTL3 1PU4A 1WQLB 4O8SA 1QVF2 1Q40B 3JUOA 3NHXA 4WHAA 3X3XA 2XSOB 5CF1A 3LTBA 5A0OB 3MG1A 3MPHA 5AIFA 1STDA 1IDPA 4EXRA 1EQKA 5EEOA 3PGBA 4WYKB 4IIAA 2CW9A 3PS8A 2CWTA 1DMNA 1GY6A 3V99A 2FXTA 2C10A 3GAXA 1O7NB 5JPUA 2XGLA 1OGXA 3KFQC 1ASKA 3DY5A 3GZRA 3D3LA 1NJI4 1YIJ3 1W6CA 2GU1A 3WMDA 1E3RA 1VZZA 3WODG 3OXAA 4R80A 2CHCA 5D82A 2F99A 3HX8A 1HU9A 4N6LA 1NO3A 3S28A 3BNBA 3L0RA 3S67A 3SXXA 4TX4A 3LZAA 3FZWA 2BO9B 5AYRB 3EHCA 3G8ZA 3QRDA 5STDA 3F9SA 1FUWA 3EBTA 5LC7A 3LH4A 2P09A 2W6JH 3IMAB 3VGNA 3WA2X 4CDLA 1K734 4GB5A 1FGTA 1WMOA 4AEQA 5AEWB 3Q1CA 4JRFA 4K61A 1RKYA 2KXGA 2W0QA 2K0MA 4N6OB 2BMRB 1S5AA 2CFGA 2W2CA 4HM8B 4H3UA 4X2HA 1VQ73 2OQEC 1W4NA 4LMIA 3I553 1C7HA 2WGQA 4O2HA 1DYUA 3GRDA 4IPBA 5AIHA 1GY7A 4HVNA 5CXOA 4EYCA 1F8NA 3HK4A 4XDVA 1JB2A 4XBXA 1NB5I 1A2KA 1UI8A 1A67A 2SBLA 2RCDA 4ZM8A 4CCVA 3EJVA 3KSPA 1IV9A 1YIT3 2FNQA 1SQWA 3NM2A 2GU3A 2IUJA 3NQYA 3K9MC 1N8R4 4HM2B 2OCTA 4J9AA 5BVBA 1QALA 3CNMA 2A15A 3MYTA 2OWPA 3EB8A 5I97A 4GL6A 3F40A 1OGZA 4R4KA 1VQ83 2XFTA 3DGLA 3JUQA 1Z1SA 5BXQA 3WDGB 4HM3B 3PCSA 4KFDA 4X2OA 3WA3A 3JUMA 1LVNA 2W04A 1FA3A 2GBWB 5IEOA 2WOHA 1W2ZA 4FMAA 3EQQB 1EKMA 2FGTA 1DMMA 2I9WA 1OUNA 3N9HA 4Q53A 1QMAA 3CC73 1VQ93 1PFPA 3SLUA 3CNXA 3MG3A 8CHOA 1N8QA 2XRXB 2YX9A 1R4CA 3KKGA 2GBXB 4OK0A 4XDWA 4O3VA 3S5CA 4KFFA 3G16A 1N5HA 1VQP3 1O7HB 2GEYA 1IK3A 1SPUA 3CCV3 1CEWI 3FF2A 5G2GA 3OW22 3KN4A 3N8BA 3FLJA 3B8LA 1N5PA 4FR9A 6STDA 2BHMA 2Z77A 3NQZA 1K9M4 1KSIA 1W6YA 4ORLA 4R1KA 4I4KA 1UUWB 2CC3A 3T0UA 3S29A 1M1XB 3PYJA 5IG4A 1MOLA 3EF8A 7STDA 4OVMA 4FMBA 1JRQA 2LYXA 1W7CA 3F7SA 4EV5A 3JUPA 2OOVC 4K1UA 3TDGA 3RGAA 3FGYA 1WMPA 2BMQB 2RFRA 1TIJA 3D9RA 3DM8A 4HYZA 4HZ9B 3LTAA 4RNYA 2QIYA 3LMLA 3K63A 1US1A 3UNLA 5AEUB 1NWWA 1OACA 2W03A 2O9UX 1YGEA 2STDA 1IT7A 2ZDJA 3KE7A 4HM4B 4HZBB 3EX9A 1U5OA 3K7CA 1RN7A 4RZMA 3ROBA 3U1WA 2PNCA 4J8TA 4BTWA 1JN5A 1GD4A 1M9GA 2GXFA 3UL5A 1V74A 1SIIA 3CU3A 5D81A 1ZX2A 1QJGA 3F8HA 5KP1A 4XB5A 3SEDA 1WTHA 3CCM3 2YFJB 3EN8A 3O8YA 3X41A 1UI7A 1OHSA 2F86B 2KCDA 1IU7A 1K41A 3NV0A 2CWVA 1FGOA 3EN1B 4H61A 1VQ53 1QVG2 4N6V0 3N54B 1D6ZA 1T5YA 3X3ZA 1GS3A 2OQEA 1K8A4 1JNQA 2K54A 3NBRA 3BLZA 3PXMA 1TUHA 3EE1A 3DMCA 3HIGA 3UJMA 2XFSA 3Q90A 3VSYA 1IT8A 2W56A 3ECFA 1JN5B 3ER7A 4MMZB 1TP6A 3IJEB 3M8CA 3CCL3 2LQVA 3DXOA 3FCSB 2YFLB 5CK6A 3NXJA 2GEXA 3H3HA 1YJN3 3GWRA 1A2VA 1IQYA 1W2B2 1KD14 3EBYA 3K0ZA 3FG3A 1OCVA 3OWSA 1D6YA 2BMOB 3NV0B 2XEPA 3NBBA 3OV4A 3CCS3 3DZLA 3CCJ3 3AMOA 4K1VA 5ELJA 2IA7A 1YI23 3NM7A 3GZYB 3CPW2 2HMLB 2Y73A 2CFKA 1HKXA 2E2VA 2M7OA 1Q824 5IG3A 1DVCA 2W56B 4N3VA 5KP3A 1Q7Y4 2BNGA 2P38A 1OF5A 2XGNA 1FGMA 3U97A 3CMA3 4STDA 3BB9A 3CPOA 3JVCA 2HMJB 4N6MA 5D83A 3F8XA 1NU3A 1SJWA 5EVHA 1QAKA 4LZIA 1STFI 1AVLA 2WOFA 1W5ZA 3K5TA 3NX0A 4L7KA 4PEJA 1VQM3 1O7PB 4FCZA 3NBJA 3AMOB 2ZL8A 3LYGA 4HBRA 5LC6A 5IF6A 2CG0A 2E2UA 3H51A 3ALAA 3HIIA 3MSOA 1KQS2 5CF2A 2HMNB 3DGOA 1JV2B 5IG0A 1OF5B 3UB1A 4K90B 4BTXA 1S723 1YHQ3 1ROAA 1RRLA 3SOYA 2HMMB 1VQK3 3B4PA 4EBGA 1UW1A 1M1K4 1YJ93 1E97A 2R4IA 2W9PA 1ULJB 3MWZA 4BTYA 1OH0A 1L5GB 3LT8A 3E99A 2CFLA 3CME3 4N6UA 1GY5A 3VF1A 2Y74A 3FG1A 3OWYA 1JJ22 1OHOA 1JB4A 4HKVB 3OX9A 3BNDA 3SVAA 5AIGA 1W02A 1EG9B 1FGRA 5IG5A 4NREA 1WNHA 4WP5A 1EA2A 3GZBA 2QEX3 2CK3H 2W9QA 3B7CA 4WFOA 3LOYA 2P0MA 3Q2PA 3X42A 2OOVA 5AIIA 3KSED 1RJOA 2HMKB 3RGRA 1M904 3BNEA 2INXA 3UL6A 1NDOB 1KC84 2CKFB 4HM7B 2B24B 1YJW3 2ML5A 1QAFA 2F98A 4U13A 5IW9A 2Z6BA 1VQN3 4RNZA 4FMCA 1TFKA 4LSOA 1J2BA 3CCU3 1IVVA 1N9EA 3SX1A 5IEPA 5JPPA 1YVBI 5ELUA 4HM5B 2XSHB 2XF3A 1DVDA 3IPTA 3PZWA 1UUVB 5AI1A 3DGNA 2P0XA 4AKYA 2O3OA 2XR8B 3CXC2 5FGOA 3G713 1IVWA 1AR0A 5IENA 5AYSC 5JBSA 2HMOB 3J7Yd 5IERA 4WWUC 2IMJA 1KWIA 5CLKA 3CC43 3STDA 3CCE3 3HI7A 3BNCA 2CIUA 1JKGA 4NHFA 3V98A 4KZ1A 3PCRA 4EV2A 1BUQA 3CC23 3G6E3 3F7XA 1LXEA 3V92A 3JUNA 3WOFB 1CYUA 2BT3A 4LEHA 1WMNA 4JF8A 5KP4A 2WO0A 1E3VA 1VQ63 4IT7A 4QWTA 5HGRA 5EQLA 2YFIB 1DMQA 2XH9A 1W01A 2RGQA 2MC8A 5DRVA 3G4S3 2MF7A 3T8NA 3RDEA 4RBNA 1TU5A 1O7GB 1G96A 4HM0B 2CG1A 1FGQA 4N6NB 1OHPA 3KIIA 4MEIA 1LNHA 2JDIH 5FW5A 2IUKA 3LXUX 1RRHA 3FG4A 1JKGB 3WOEB 4G1MB 5DREA 1CQSA 3FF0A 3KZTA 4HM6B 4MMYB 1IVUA 2P05A 1Q864 1U8CB 2V1LA 1IQXA 2B1XB 1D6UA 2L4VA 3LTDA 2Z7AA 4XM4A 3FSDA 3S27A 1K28A 1VQ43 1O7WB 4R9KA 3MKIA 2CFWA 2QA43 1OPYA 1ROVA 1W6GA 3MHEA 3CCR3 2QGUA 1AVKA 4N6TA 4OUQA 1IQ8A 4HJLB 1W00A 1AV4A 2D42A 1VQO3 2ML6A 3LTCA 1IV7A 2CFDA 1NB3I 2JQ5A 2PZVA 2Q07A 4L8PA 4MMXB 3FKAA 2KRTA 4L8OA 3SOAA 2D1WA 3DUKA 2WGOA 1JB5A 4XBYA 5TGNA 3B4OA 1Y4KA 3OWUA 4MJDA 4R9LA 4EC6A 4KFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q40 A;  2UX0 A;  3T8U A;  4KVH A;  3HZP A;  2Z76 A;  3I0Y A;  3EC9 A;  4WYK A;  1ZO2 A;  1Q42 A;  3NUV A;  4FCM A;  4LGQ A;  4XBT A;  3FH1 A;  3GZX B;  3MG2 A;  4HM1 B;  3A76 A;  1ULI B;  3G0K A;  1ISK A;  1GYB A;  1O7M B;  4FCJ A;  3F14 A;  1WQL B;  1Q40 B;  3JUO A;  3NHX A;  2XSO B;  5CF1 A;  3MG1 A;  5AIF A;  1STD A;  1IDP A;  4WYK B;  4IIA A;  1DMN A;  1GY6 A;  5JPU A;  1O7N B;  1OGX A;  1ASK A;  3GZR A;  3WMD A;  1VZZ A;  1E3R A;  3OXA A;  2CHC A;  5D82 A;  2F99 A;  3HX8 A;  3LZA A;  3FZW A;  3EHC A;  3G8Z A;  5STD A;  3F9S A;  3EBT A;  3VGN A;  4CDL A;  4GB5 A;  5AEW B;  2BMR B;  1S5A A;  4HM8 B;  2W2C A;  4H3U A;  4X2H A;  4LMI A;  1C7H A;  3GRD A;  5AIH A;  1GY7 A;  4HVN A;  5CXO A;  3HK4 A;  4XDV A;  1JB2 A;  4XBX A;  1A2K A;  2RCD A;  3EJV A;  3KSP A;  3NM2 A;  4HM2 B;  4J9A A;  5BVB A;  3CNM A;  2A15 A;  3MYT A;  2OWP A;  3F40 A;  1OGZ A;  3JUQ A;  1Z1S A;  5BXQ A;  4HM3 B;  4X2O A;  3JUM A;  2GBW B;  5IEO A;  3EQQ B;  1DMM A;  2I9W A;  1OUN A;  4Q53 A;  1QMA A;  3CNX A;  3MG3 A;  8CHO A;  2XRX B;  3KKG A;  2GBX B;  4XDW A;  3S5C A;  3G16 A;  1O7H B;  2GEY A;  3FF2 A;  5G2G A;  3FLJ A;  3B8L A;  6STD A;  2Z77 A;  1W6Y A;  4ORL A;  4R1K A;  4I4K A;  1UUW B;  5IG4 A;  3EF8 A;  7STD A;  4OVM A;  3F7S A;  3JUP A;  4K1U A;  3RGA A;  3FGY A;  2BMQ B;  2RFR A;  3D9R A;  3DM8 A;  4HZ9 B;  2QIY A;  3UNL A;  5AEU B;  1NWW A;  2STD A;  3KE7 A;  4HM4 B;  4HZB B;  3EX9 A;  1U5O A;  3K7C A;  4RZM A;  3ROB A;  4J8T A;  1JN5 A;  2GXF A;  3CU3 A;  5D81 A;  1QJG A;  3F8H A;  1ZX2 A;  5KP1 A;  4XB5 A;  3SED A;  2YFJ B;  3EN8 A;  1OHS A;  2F86 B;  3NV0 A;  1K41 A;  3EN1 B;  1GS3 A;  2K54 A;  3NBR A;  3BLZ A;  1TUH A;  3UJM A;  3DMC A;  3VSY A;  3Q90 A;  3ECF A;  1JN5 B;  3ER7 A;  1TP6 A;  3M8C A;  3DXO A;  2YFL B;  5CK6 A;  3NXJ A;  2GEX A;  3H3H A;  3GWR A;  3EBY A;  3K0Z A;  1OCV A;  3OWS A;  2BMO B;  3NV0 B;  3OV4 A;  3DZL A;  4K1V A;  3GZY B;  2HML B;  1HKX A;  5IG3 A;  4N3V A;  5KP3 A;  2BNG A;  1OF5 A;  4STD A;  3BB9 A;  3CPO A;  2HMJ B;  5D83 A;  3F8X A;  1NU3 A;  1SJW A;  5EVH A;  4L7K A;  4PEJ A;  1O7P B;  3LYG A;  5IF6 A;  3H51 A;  3MSO A;  5CF2 A;  2HMN B;  5IG0 A;  1OF5 B;  3SOY A;  2HMM B;  3B4P A;  1E97 A;  2R4I A;  1ULJ B;  1OH0 A;  3E99 A;  1GY5 A;  3OWY A;  1OHO A;  1JB4 A;  4HKV B;  3OX9 A;  5AIG A;  1W02 A;  1EG9 B;  5IG5 A;  4WP5 A;  1EA2 A;  3GZB A;  3B7C A;  5AII A;  2HMK B;  3RGR A;  2INX A;  1NDO B;  2CKF B;  4HM7 B;  2B24 B;  4U13 A;  2F98 A;  5IEP A;  5JPP A;  4HM5 B;  2XSH B;  3IPT A;  1UUV B;  5AI1 A;  2XR8 B;  1AR0 A;  5IEN A;  2HMO B;  5IER A;  4WWU C;  2IMJ A;  5CLK A;  3STD A;  1JKG A;  1BUQ A;  3F7X A;  3JUN A;  4LEH A;  5KP4 A;  1E3V A;  5HGR A;  2YFI B;  1DMQ A;  1W01 A;  2RGQ A;  5DRV A;  3T8N A;  1O7G B;  4HM0 B;  1OHP A;  5FW5 A;  1JKG B;  5DRE A;  1CQS A;  3FF0 A;  3KZT A;  4HM6 B;  2B1X B;  2Z7A A;  4XM4 A;  3FSD A;  1O7W B;  4R9K A;  3MKI A;  1OPY A;  3MHE A;  2QGU A;  4OUQ A;  4HJL B;  1W00 A;  2JQ5 A;  2PZV A;  4L8P A;  3FKA A;  4L8O A;  3SOA A;  3DUK A;  1JB5 A;  4XBY A;  5TGN A;  3B4O A;  3OWU A;  4MJD A;  4R9L A; 
#chains in the Genus database with same CATH topology
 1N9J A;  2E2T A;  1Q40 A;  3DGM A;  2UX0 A;  3X40 A;  3T8U A;  1I70 A;  1JBR A;  4KVH A;  2RSX A;  3HZP A;  4FMD A;  2Z76 A;  1VQL 3;  3I0Y A;  3X3Y A;  2CWU A;  1MNL A;  3EC9 A;  2UUG C;  3I56 3;  4AKZ A;  2C11 A;  3AGN A;  2CH9 A;  1CYV A;  4WYK A;  1ZO2 A;  1BRH A;  1GD3 A;  1Q81 4;  2OTJ 3;  1Q42 A;  3NUV A;  4FCM A;  4LGQ A;  4XBT A;  4ILF A;  3FH1 A;  1RN4 A;  3GZX B;  3MG2 A;  4HM1 B;  3A76 A;  2BIR A;  3CD6 3;  1UCI A;  2KF3 A;  4O02 B;  1ULI B;  1TFO A;  1IVX A;  1LQM B;  7GSP A;  1I8V A;  1SIH A;  3G0K A;  3CCQ 3;  1A90 A;  3QK9 A;  1G0T A;  1LOX A;  1ISK A;  1GYB A;  1O7M B;  5G1K A;  4FCJ A;  1RN1 A;  3F14 A;  3LT9 A;  2OTL 3;  1PU4 A;  1WQL B;  1MWT A;  4LYL B;  4O8S A;  1B2Z A;  1Q40 B;  1QVF 2;  2IY2 A;  3JUO A;  3NHX A;  1JZO A;  4WHA A;  3X3X A;  2XSO B;  5CF1 A;  1DE3 A;  3LTB A;  5A0O B;  3MG1 A;  3MPH A;  1UCK A;  5AIF A;  3URP A;  2F4Y A;  1B21 A;  1IDP A;  1STD A;  4EXR A;  5EEO A;  1EQK A;  3PGB A;  4WYK B;  4IIA A;  2CW9 A;  3PS8 A;  2CWT A;  1DMN A;  1GY6 A;  3V99 A;  2FXT A;  2C10 A;  3GAX A;  1O7N B;  5JPU A;  1RNB A;  2XGL A;  1OGX A;  3KFQ C;  1YGW A;  1ASK A;  3DY5 A;  1GSP A;  3GZR A;  3D3L A;  3KCH A;  1NJI 4;  4HAA A;  5G1L A;  1YIJ 3;  1W6C A;  2GU1 A;  3WMD A;  1E3R A;  1VZZ A;  3WOD G;  3OXA A;  4R80 A;  2CHC A;  5D82 A;  2F99 A;  3HX8 A;  3DH2 A;  1HU9 A;  4N6L A;  1NO3 A;  3S28 A;  3ZG5 A;  3BNB A;  3L0R A;  3S67 A;  3SXX A;  1I3F A;  3LZA A;  4TX4 A;  3FZW A;  2BO9 B;  5AYR B;  3EHC A;  3G8Z A;  1BNG A;  3WHO A;  3QRD A;  5STD A;  3F9S A;  1FUW A;  3EBT A;  5LC7 A;  3LH4 A;  2P09 A;  1BAN A;  2W6J H;  3IMA B;  3VGN A;  3WA2 X;  4CDL A;  1K73 4;  4GB5 A;  1FGT A;  1WMO A;  1MWU A;  4AEQ A;  4GHO A;  4HOH A;  5AEW B;  3Q1C A;  4JRF A;  1BSD A;  4K61 A;  1RKY A;  2UGI A;  1RGC A;  2KXG A;  2W0Q A;  2K0M A;  4N6O B;  1LQG C;  2BMR B;  1V57 A;  1S5A A;  2CFG A;  2W2C A;  4HM8 B;  1I3I A;  4H3U A;  4X2H A;  2OQE C;  1W4N A;  1VQ7 3;  4LMI A;  2AAE A;  3I55 3;  1C7H A;  2WGQ A;  2BU4 A;  4O2H A;  1DYU A;  3GRD A;  4BU4 A;  1ZS7 A;  4IPB A;  5AIH A;  1RCK A;  1GY7 A;  4HVN A;  5CXO A;  4EYC A;  1F8N A;  3HK4 A;  1I2F A;  4XDV A;  1JB2 A;  1A2P A;  4XBX A;  1NB5 I;  1A2K A;  1UI8 A;  1A67 A;  2SBL A;  2RCD A;  4ZM8 A;  4CCV A;  3EJV A;  3KSP A;  1IV9 A;  1BU4 A;  1YIT 3;  2FNQ A;  1SQW A;  3NM2 A;  2GU3 A;  1B20 A;  2IUJ A;  1BSA A;  3NQY A;  3K9M C;  1GOV A;  1N8R 4;  4HM2 B;  2OCT A;  2RBI A;  1RGK A;  4J9A A;  1T3B A;  5BVB A;  1QAL A;  3CNM A;  2A15 A;  3MYT A;  1V58 A;  2OWP A;  3EB8 A;  3D5I A;  5I97 A;  4GL6 A;  1RTU A;  3F40 A;  1GMQ A;  1OGZ A;  2L1S A;  4R4K A;  1VQ8 3;  2KF6 A;  2XFT A;  3DGL A;  3JUQ A;  1Z1S A;  5BXQ A;  1BNI A;  1BNJ A;  1UGI A;  3WDG B;  4HM3 B;  1VQQ A;  3PCS A;  4KFD A;  1BNE A;  4X2O A;  3WA3 A;  3JUM A;  1LVN A;  2W04 A;  1JBT A;  1FA3 A;  2GBW B;  2J8X B;  5IEO A;  2WOH A;  1W2Z A;  4FMA A;  3EQQ B;  1UCJ A;  1AQZ A;  1EKM A;  2FGT A;  1DMM A;  3BU4 A;  3RNT A;  2I9W A;  1OUN A;  3N9H A;  4Q53 A;  1QMA A;  1X1U A;  3CC7 3;  1MWR A;  5BIR A;  1VQ9 3;  1PFP A;  3SLU A;  3A5E A;  3CNX A;  1EEJ A;  3MG3 A;  2CX0 A;  3AHS A;  8CHO A;  1N8Q A;  2XRX B;  2YX9 A;  1R4C A;  3KKG A;  4J5G A;  2GBX B;  4OK0 A;  4XDW A;  2F5M A;  4O3V A;  3S5C A;  1RGE A;  4KFF A;  3G16 A;  1N5H A;  6GSP A;  1HYF A;  5BU4 A;  1VQP 3;  1O7H B;  2GEY A;  1IK3 A;  1SPU A;  3CCV 3;  1CEW I;  3FF2 A;  5G2G A;  3OW2 2;  3KN4 A;  3N8B A;  3FLJ A;  3B8L A;  1N5P A;  4FR9 A;  1RSN A;  1RCL A;  6STD A;  2BHM A;  2Z77 A;  3NQZ A;  1RGH A;  4KT3 B;  1K9M 4;  1KSI A;  1W6Y A;  4ORL A;  4R1K A;  4I4K A;  1UUW B;  2CC3 A;  3T0U A;  3S29 A;  1M1X B;  3PYJ A;  5IG4 A;  1MOL A;  3EF8 A;  9RNT A;  7STD A;  4OVM A;  4FMB A;  1JRQ A;  2LYX A;  1W7C A;  3F7S A;  4EV5 A;  3JUP A;  1B27 A;  2OOV C;  4K1U A;  3TDG A;  3RGA A;  3FGY A;  1WMP A;  2BMQ B;  2RFR A;  1TIJ A;  3D9R A;  3DM8 A;  4HYZ A;  4BL3 A;  4HZ9 B;  3LTA A;  3D79 A;  4RNY A;  2QIY A;  3LML A;  3K63 A;  1GMR A;  4GSP A;  1US1 A;  3UNL A;  5AEU B;  5M1A A;  1B2U A;  1NWW A;  1OAC A;  2W03 A;  1TRP A;  2O9U X;  4CJN A;  1YGE A;  2STD A;  1IT7 A;  2ZDJ A;  3KE7 A;  3Q3F A;  4HM4 B;  1EUI C;  4HZB B;  3EX9 A;  1U5O A;  3K7C A;  1RN7 A;  4RZM A;  3ROB A;  3U1W A;  2PNC A;  4J8T A;  1BVI A;  2ZA4 A;  4BTW A;  1BRK A;  1JN5 A;  1GD4 A;  1M9G A;  2GXF A;  2IYJ A;  3UL5 A;  1V74 A;  1SII A;  1GOU A;  3CU3 A;  5D81 A;  1BUJ A;  1QJG A;  1ZX2 A;  3F8H A;  5KP1 A;  4XB5 A;  5GSP A;  3SED A;  1WTH A;  3CCM 3;  1T2H A;  2YFJ B;  3EN8 A;  3O8Y A;  3X41 A;  1UI7 A;  1OHS A;  1YNV X;  2F86 B;  2KCD A;  1IU7 A;  1K41 A;  3NV0 A;  1PY3 A;  2K3D A;  1FZU A;  1FGO A;  2CWV A;  3EN1 B;  4H61 A;  1VQ5 3;  1BNR A;  1QVG 2;  4N6V 0;  3N54 B;  1D6Z A;  1B3S A;  1T5Y A;  3X3Z A;  1GS3 A;  2OQE A;  1K8A 4;  1JNQ A;  3WR2 A;  2K54 A;  1SAR A;  3NBR A;  3BLZ A;  3PXM A;  1YVS A;  1TUH A;  3EE1 A;  1BSB A;  3DMC A;  3HIG A;  2XFS A;  3Q90 A;  3UJM A;  1IT8 A;  3VSY A;  1B2S A;  2HOH A;  2W56 A;  3ECF A;  1RHL A;  1JN5 B;  4I5Q A;  3ER7 A;  1JBS A;  1LOV A;  1TP6 A;  4MMZ B;  3IJE B;  3M8C A;  3CCL 3;  2LQV A;  7RNT A;  3DXO A;  3FCS B;  2YFL B;  5CK6 A;  1IYY A;  3NXJ A;  2C4B A;  2GEX A;  3H3H A;  1YJN 3;  1BRS A;  1X1X A;  3GWR A;  1BGS A;  2KF5 A;  1A2V A;  1IQY A;  1W2B 2;  1KD1 4;  3EBY A;  3K0Z A;  3FG3 A;  1OCV A;  1RGL A;  1X1Y A;  1RDS A;  3OWS A;  1D6Y A;  1UDI I;  2BMO B;  3NV0 B;  2XEP A;  3NBB A;  2GSP A;  2H0G A;  1PYL A;  3OV4 A;  3CCS 3;  3DZL A;  5RNT A;  1BRG A;  1LRA A;  3CCJ 3;  3AMO A;  4K1V A;  5ELJ A;  2IA7 A;  1YI2 3;  3NM7 A;  3GZY B;  3CPW 2;  2HML B;  2Y73 A;  2CFK A;  1HKX A;  1R4Y A;  1BSE A;  2E2V A;  2M7O A;  1Q82 4;  5IG3 A;  1DVC A;  2W56 B;  4N3V A;  5KP3 A;  1Q7Y 4;  2BNG A;  2P38 A;  1OF5 A;  1BSC A;  2XGN A;  1FGM A;  3U97 A;  3CMA 3;  4STD A;  3BB9 A;  3CPO A;  3JVC A;  4J5K A;  1LNI A;  2HMJ B;  4N6M A;  5D83 A;  3F8X A;  1NU3 A;  1SJW A;  5EVH A;  1QAK A;  4LZI A;  1STF I;  3SYU A;  1AVL A;  2WOF A;  1W5Z A;  3K5T A;  3NX0 A;  4L7K A;  4PEJ A;  1RLS A;  1X1W A;  1VQM 3;  1O7P B;  4FCZ A;  3NBJ A;  1BOX A;  3AMO B;  2ZHX B;  2ZL8 A;  3LYG A;  4HBR A;  5LC6 A;  5IF6 A;  5M18 A;  2CG0 A;  1I0X A;  2E2U A;  3H51 A;  3ALA A;  3HII A;  3MSO A;  1KQS 2;  1TRQ A;  5CF2 A;  2HMN B;  3DGO A;  1JV2 B;  1UCL A;  5IG0 A;  1NNV A;  1OF5 B;  4RNT A;  3UB1 A;  4K90 B;  4BTX A;  1BNF A;  1S72 3;  2R41 A;  1YHQ 3;  1ROA A;  1RRL A;  1RGA A;  3SOY A;  2HMM B;  3ZFZ A;  1VQK 3;  3AGO A;  3B4P A;  1I2E A;  4EBG A;  1UW1 A;  1M1K 4;  1YJ9 3;  1I2G A;  1E97 A;  2R4I A;  2W9P A;  2SAR A;  1ULJ B;  3MWZ A;  4BTY A;  1OH0 A;  1L5G B;  3LT8 A;  3E99 A;  1BIR A;  2CFL A;  4N6U A;  3CME 3;  1GY5 A;  6RNT A;  3VF1 A;  2Y74 A;  3FG1 A;  1BRJ A;  1HZ1 A;  5M19 A;  2AAD A;  3OWY A;  1JJ2 2;  1OHO A;  4NPB A;  1JB4 A;  4HKV B;  3OX9 A;  1LOY A;  3BND A;  3SVA A;  5AIG A;  1W02 A;  1EG9 B;  1FGR A;  5IG5 A;  4NRE A;  1RGF A;  1WNH A;  1EA2 A;  3GZB A;  4WP5 A;  2QEX 3;  2CK3 H;  2W9Q A;  3B7C A;  4WFO A;  3LOY A;  2KAA A;  2P0M A;  3Q2P A;  3X42 A;  2OOV A;  5AII A;  3KSE D;  1MWS A;  1RJO A;  2HMK B;  3D5G A;  3RGR A;  3BNE A;  2INX A;  1M90 4;  3UL6 A;  1NDO B;  1KC8 4;  2CKF B;  4HM7 B;  2B24 B;  1YJW 3;  2ML5 A;  1QAF A;  2F98 A;  4U13 A;  5IW9 A;  1CH0 A;  2Z6B A;  4RNZ A;  4FMC A;  1VQN 3;  1TFK A;  2KF4 A;  3BIR A;  4LSO A;  1J2B A;  3CCU 3;  1IVV A;  1N9E A;  1TJD A;  3SX1 A;  1BRI A;  5IEP A;  5JPP A;  1YVB I;  1BRN L;  5ELU A;  4HM5 B;  2XSH B;  2XF3 A;  1DVD A;  3IPT A;  3PZW A;  1Q7H A;  1UUV B;  5AI1 A;  3D4A A;  3DGN A;  2P0X A;  4AKY A;  1B2X A;  2O3O A;  2XR8 B;  3GSP A;  3DGY A;  3CXC 2;  5FGO A;  8RNT A;  1IVW A;  3G71 3;  1AR0 A;  5IEN A;  5AYS C;  5JBS A;  2HMO B;  3J7Y d;  5IER A;  4WWU C;  2IMJ A;  1KWI A;  1T2I A;  5CLK A;  3CC4 3;  3STD A;  3CCE 3;  1AY7 A;  3HI7 A;  3BNC A;  2CIU A;  1JKG A;  4NHF A;  1B2M A;  3V98 A;  4KZ1 A;  1FUT A;  1TTO A;  2H0H A;  3PCR A;  4EV2 A;  1BUQ A;  3CC2 3;  3G6E 3;  3F7X A;  1LOW A;  1LXE A;  1RGG A;  3HOH A;  3JUN A;  3V92 A;  3WOF B;  1CYU A;  2BT3 A;  4LEH A;  1WMN A;  1UGH I;  4JF8 A;  5KP4 A;  4CPK A;  2WO0 A;  1E3V A;  1VQ6 3;  4IT7 A;  4QWT A;  5HGR A;  5EQL A;  2F5W A;  2YFI B;  1DMQ A;  4DKI A;  1RNT A;  2XH9 A;  1W01 A;  1FUS A;  2RGQ A;  2MC8 A;  5DRV A;  3G4S 3;  2MF7 A;  3T8N A;  3RDE A;  1FW7 A;  4RBN A;  1TU5 A;  1BAO A;  1O7G B;  3AHW A;  1G96 A;  4HM0 B;  2CG1 A;  5HOH A;  1FGQ A;  4N6N B;  1OHP A;  3KII A;  4MEI A;  4BL2 A;  1LNH A;  2JDI H;  4EW5 A;  1FYS A;  5FW5 A;  2IUK A;  3LXU X;  2CX1 A;  1RRH A;  3FG4 A;  1JKG B;  1ZGX A;  1UUG B;  3WOE B;  4G1M B;  5DRE A;  1CQS A;  3FF0 A;  3KZT A;  4HM6 B;  4MMY B;  1IVU A;  1I0V A;  2P05 A;  1Q86 4;  1U8C B;  2V1L A;  1IQX A;  2B1X B;  1MGR A;  1RMS A;  2H0I A;  1DET A;  1D6U A;  2L4V A;  1JZD A;  3LTD A;  2Z7A A;  4XM4 A;  2RNT A;  3FSD A;  1K28 A;  3S27 A;  1VQ4 3;  1O7W B;  4R9K A;  3MKI A;  2CFW A;  2QA4 3;  1OPY A;  1MGW A;  1ROV A;  1W6G A;  2F56 A;  2QGU A;  3MHE A;  1AVK A;  3CCR 3;  4N6T A;  1GMP A;  4OUQ A;  4BIR A;  3ZG0 A;  1IQ8 A;  1G02 A;  4HJL B;  1W00 A;  1AV4 A;  2D42 A;  1VQO 3;  2ML6 A;  3LTC A;  1Q9E A;  1IV7 A;  2CFD A;  1NB3 I;  2JQ5 A;  2PZV A;  2Q07 A;  4L8P A;  4MMX B;  1C54 A;  3FKA A;  2KRT A;  4L8O A;  3SOA A;  2D1W A;  3DUK A;  2WGO A;  1JB5 A;  4XBY A;  1BNS A;  1GOY A;  3B4O A;  5TGN A;  1Y4K A;  3OWU A;  4MJD A;  4R9L A;  4EC6 A;  4KFE A; 
#chains in the Genus database with same CATH homology
 1N9J A;  2E2T A;  1Q40 A;  3DGM A;  2UX0 A;  3X40 A;  3T8U A;  4KVH A;  2RSX A;  3HZP A;  4FMD A;  2Z76 A;  1VQL 3;  3I0Y A;  3X3Y A;  2CWU A;  1MNL A;  3EC9 A;  3I56 3;  4AKZ A;  2C11 A;  2CH9 A;  1CYV A;  4WYK A;  1ZO2 A;  1GD3 A;  1Q81 4;  2OTJ 3;  1Q42 A;  3NUV A;  4FCM A;  4LGQ A;  4XBT A;  3FH1 A;  3GZX B;  3MG2 A;  4HM1 B;  3CD6 3;  3A76 A;  4O02 B;  1ULI B;  1TFO A;  1IVX A;  1SIH A;  3G0K A;  3CCQ 3;  1A90 A;  3QK9 A;  1LOX A;  1ISK A;  1GYB A;  1O7M B;  4FCJ A;  3F14 A;  3LT9 A;  2OTL 3;  1PU4 A;  1WQL B;  4O8S A;  1QVF 2;  1Q40 B;  3JUO A;  3NHX A;  4WHA A;  3X3X A;  2XSO B;  5CF1 A;  3LTB A;  5A0O B;  3MG1 A;  3MPH A;  5AIF A;  1STD A;  1IDP A;  4EXR A;  1EQK A;  5EEO A;  3PGB A;  4WYK B;  4IIA A;  2CW9 A;  3PS8 A;  2CWT A;  1DMN A;  1GY6 A;  3V99 A;  2FXT A;  2C10 A;  3GAX A;  1O7N B;  5JPU A;  2XGL A;  1OGX A;  3KFQ C;  1ASK A;  3DY5 A;  3GZR A;  3D3L A;  1NJI 4;  1YIJ 3;  1W6C A;  2GU1 A;  3WMD A;  1E3R A;  1VZZ A;  3WOD G;  3OXA A;  4R80 A;  2CHC A;  5D82 A;  2F99 A;  3HX8 A;  1HU9 A;  4N6L A;  1NO3 A;  3S28 A;  3BNB A;  3L0R A;  3S67 A;  3SXX A;  4TX4 A;  3LZA A;  3FZW A;  2BO9 B;  5AYR B;  3EHC A;  3G8Z A;  3QRD A;  5STD A;  3F9S A;  1FUW A;  3EBT A;  5LC7 A;  3LH4 A;  2P09 A;  2W6J H;  3IMA B;  3VGN A;  3WA2 X;  4CDL A;  1K73 4;  4GB5 A;  1FGT A;  1WMO A;  4AEQ A;  5AEW B;  3Q1C A;  4JRF A;  4K61 A;  1RKY A;  2KXG A;  2W0Q A;  2K0M A;  4N6O B;  2BMR B;  1S5A A;  2CFG A;  2W2C A;  4HM8 B;  4H3U A;  4X2H A;  1VQ7 3;  2OQE C;  1W4N A;  4LMI A;  3I55 3;  1C7H A;  2WGQ A;  4O2H A;  1DYU A;  3GRD A;  4IPB A;  5AIH A;  1GY7 A;  4HVN A;  5CXO A;  4EYC A;  1F8N A;  3HK4 A;  4XDV A;  1JB2 A;  4XBX A;  1NB5 I;  1A2K A;  1UI8 A;  1A67 A;  2SBL A;  2RCD A;  4ZM8 A;  4CCV A;  3EJV A;  3KSP A;  1IV9 A;  1YIT 3;  2FNQ A;  1SQW A;  3NM2 A;  2GU3 A;  2IUJ A;  3NQY A;  3K9M C;  1N8R 4;  4HM2 B;  2OCT A;  4J9A A;  5BVB A;  1QAL A;  3CNM A;  2A15 A;  3MYT A;  2OWP A;  3EB8 A;  5I97 A;  4GL6 A;  3F40 A;  1OGZ A;  4R4K A;  1VQ8 3;  2XFT A;  3DGL A;  3JUQ A;  1Z1S A;  5BXQ A;  3WDG B;  4HM3 B;  3PCS A;  4KFD A;  4X2O A;  3WA3 A;  3JUM A;  1LVN A;  2W04 A;  1FA3 A;  2GBW B;  5IEO A;  2WOH A;  1W2Z A;  4FMA A;  3EQQ B;  1EKM A;  2FGT A;  1DMM A;  2I9W A;  1OUN A;  3N9H A;  4Q53 A;  1QMA A;  3CC7 3;  1VQ9 3;  1PFP A;  3SLU A;  3CNX A;  3MG3 A;  8CHO A;  1N8Q A;  2XRX B;  2YX9 A;  1R4C A;  3KKG A;  2GBX B;  4OK0 A;  4XDW A;  4O3V A;  3S5C A;  4KFF A;  3G16 A;  1N5H A;  1VQP 3;  1O7H B;  2GEY A;  1IK3 A;  1SPU A;  3CCV 3;  1CEW I;  3FF2 A;  5G2G A;  3OW2 2;  3KN4 A;  3N8B A;  3FLJ A;  3B8L A;  1N5P A;  4FR9 A;  6STD A;  2BHM A;  2Z77 A;  3NQZ A;  1K9M 4;  1KSI A;  1W6Y A;  4ORL A;  4R1K A;  4I4K A;  1UUW B;  2CC3 A;  3T0U A;  3S29 A;  1M1X B;  3PYJ A;  5IG4 A;  1MOL A;  3EF8 A;  7STD A;  4OVM A;  4FMB A;  1JRQ A;  2LYX A;  1W7C A;  3F7S A;  4EV5 A;  3JUP A;  2OOV C;  4K1U A;  3TDG A;  3RGA A;  3FGY A;  1WMP A;  2BMQ B;  2RFR A;  1TIJ A;  3D9R A;  3DM8 A;  4HYZ A;  4HZ9 B;  3LTA A;  4RNY A;  2QIY A;  3LML A;  3K63 A;  1US1 A;  3UNL A;  5AEU B;  1NWW A;  1OAC A;  2W03 A;  2O9U X;  1YGE A;  2STD A;  1IT7 A;  2ZDJ A;  3KE7 A;  4HM4 B;  4HZB B;  3EX9 A;  1U5O A;  3K7C A;  1RN7 A;  4RZM A;  3ROB A;  3U1W A;  2PNC A;  4J8T A;  4BTW A;  1JN5 A;  1GD4 A;  1M9G A;  2GXF A;  3UL5 A;  1V74 A;  1SII A;  3CU3 A;  5D81 A;  1ZX2 A;  1QJG A;  3F8H A;  5KP1 A;  4XB5 A;  3SED A;  1WTH A;  3CCM 3;  2YFJ B;  3EN8 A;  3O8Y A;  3X41 A;  1UI7 A;  1OHS A;  2F86 B;  2KCD A;  1IU7 A;  1K41 A;  3NV0 A;  2CWV A;  1FGO A;  3EN1 B;  4H61 A;  1VQ5 3;  1QVG 2;  4N6V 0;  3N54 B;  1D6Z A;  1T5Y A;  3X3Z A;  1GS3 A;  2OQE A;  1K8A 4;  1JNQ A;  2K54 A;  3NBR A;  3BLZ A;  3PXM A;  1TUH A;  3EE1 A;  3DMC A;  3HIG A;  3UJM A;  2XFS A;  3Q90 A;  3VSY A;  1IT8 A;  2W56 A;  3ECF A;  1JN5 B;  3ER7 A;  4MMZ B;  1TP6 A;  3IJE B;  3M8C A;  3CCL 3;  2LQV A;  3DXO A;  3FCS B;  2YFL B;  5CK6 A;  3NXJ A;  2GEX A;  3H3H A;  1YJN 3;  3GWR A;  1A2V A;  1IQY A;  1W2B 2;  1KD1 4;  3EBY A;  3K0Z A;  3FG3 A;  1OCV A;  3OWS A;  1D6Y A;  2BMO B;  3NV0 B;  2XEP A;  3NBB A;  3OV4 A;  3CCS 3;  3DZL A;  3CCJ 3;  3AMO A;  4K1V A;  5ELJ A;  2IA7 A;  1YI2 3;  3NM7 A;  3GZY B;  3CPW 2;  2HML B;  2Y73 A;  2CFK A;  1HKX A;  2E2V A;  2M7O A;  1Q82 4;  5IG3 A;  1DVC A;  2W56 B;  4N3V A;  5KP3 A;  1Q7Y 4;  2BNG A;  2P38 A;  1OF5 A;  2XGN A;  1FGM A;  3U97 A;  3CMA 3;  4STD A;  3BB9 A;  3CPO A;  3JVC A;  2HMJ B;  4N6M A;  5D83 A;  3F8X A;  1NU3 A;  1SJW A;  5EVH A;  1QAK A;  4LZI A;  1STF I;  1AVL A;  2WOF A;  1W5Z A;  3K5T A;  3NX0 A;  4L7K A;  4PEJ A;  1VQM 3;  1O7P B;  4FCZ A;  3NBJ A;  3AMO B;  2ZL8 A;  3LYG A;  4HBR A;  5LC6 A;  5IF6 A;  2CG0 A;  2E2U A;  3H51 A;  3ALA A;  3HII A;  3MSO A;  1KQS 2;  5CF2 A;  2HMN B;  3DGO A;  1JV2 B;  5IG0 A;  1OF5 B;  3UB1 A;  4K90 B;  4BTX A;  1S72 3;  1YHQ 3;  1ROA A;  1RRL A;  3SOY A;  2HMM B;  1VQK 3;  3B4P A;  4EBG A;  1UW1 A;  1M1K 4;  1YJ9 3;  1E97 A;  2R4I A;  2W9P A;  1ULJ B;  3MWZ A;  4BTY A;  1OH0 A;  1L5G B;  3LT8 A;  3E99 A;  2CFL A;  3CME 3;  4N6U A;  1GY5 A;  3VF1 A;  2Y74 A;  3FG1 A;  3OWY A;  1JJ2 2;  1OHO A;  1JB4 A;  4HKV B;  3OX9 A;  3BND A;  3SVA A;  5AIG A;  1W02 A;  1EG9 B;  1FGR A;  5IG5 A;  4NRE A;  1WNH A;  4WP5 A;  1EA2 A;  3GZB A;  2QEX 3;  2CK3 H;  2W9Q A;  3B7C A;  4WFO A;  3LOY A;  2P0M A;  3Q2P A;  3X42 A;  2OOV A;  5AII A;  3KSE D;  1RJO A;  2HMK B;  3RGR A;  1M90 4;  3BNE A;  2INX A;  3UL6 A;  1NDO B;  1KC8 4;  2CKF B;  4HM7 B;  2B24 B;  1YJW 3;  2ML5 A;  1QAF A;  2F98 A;  4U13 A;  5IW9 A;  2Z6B A;  1VQN 3;  4RNZ A;  4FMC A;  1TFK A;  4LSO A;  1J2B A;  3CCU 3;  1IVV A;  1N9E A;  3SX1 A;  5IEP A;  5JPP A;  1YVB I;  5ELU A;  4HM5 B;  2XSH B;  2XF3 A;  1DVD A;  3IPT A;  3PZW A;  1UUV B;  5AI1 A;  3DGN A;  2P0X A;  4AKY A;  2O3O A;  2XR8 B;  3CXC 2;  5FGO A;  3G71 3;  1IVW A;  1AR0 A;  5IEN A;  5AYS C;  5JBS A;  2HMO B;  3J7Y d;  5IER A;  4WWU C;  2IMJ A;  1KWI A;  5CLK A;  3CC4 3;  3STD A;  3CCE 3;  3HI7 A;  3BNC A;  2CIU A;  1JKG A;  4NHF A;  3V98 A;  4KZ1 A;  3PCR A;  4EV2 A;  1BUQ A;  3CC2 3;  3G6E 3;  3F7X A;  1LXE A;  3V92 A;  3JUN A;  3WOF B;  1CYU A;  2BT3 A;  4LEH A;  1WMN A;  4JF8 A;  5KP4 A;  2WO0 A;  1E3V A;  1VQ6 3;  4IT7 A;  4QWT A;  5HGR A;  5EQL A;  2YFI B;  1DMQ A;  2XH9 A;  1W01 A;  2RGQ A;  2MC8 A;  5DRV A;  3G4S 3;  2MF7 A;  3T8N A;  3RDE A;  4RBN A;  1TU5 A;  1O7G B;  1G96 A;  4HM0 B;  2CG1 A;  1FGQ A;  4N6N B;  1OHP A;  3KII A;  4MEI A;  1LNH A;  2JDI H;  5FW5 A;  2IUK A;  3LXU X;  1RRH A;  3FG4 A;  1JKG B;  3WOE B;  4G1M B;  5DRE A;  1CQS A;  3FF0 A;  3KZT A;  4HM6 B;  4MMY B;  1IVU A;  2P05 A;  1Q86 4;  1U8C B;  2V1L A;  1IQX A;  2B1X B;  1D6U A;  2L4V A;  3LTD A;  2Z7A A;  4XM4 A;  3FSD A;  3S27 A;  1K28 A;  1VQ4 3;  1O7W B;  4R9K A;  3MKI A;  2CFW A;  2QA4 3;  1OPY A;  1ROV A;  1W6G A;  3MHE A;  3CCR 3;  2QGU A;  1AVK A;  4N6T A;  4OUQ A;  1IQ8 A;  4HJL B;  1W00 A;  1AV4 A;  2D42 A;  1VQO 3;  2ML6 A;  3LTC A;  1IV7 A;  2CFD A;  1NB3 I;  2JQ5 A;  2PZV A;  2Q07 A;  4L8P A;  4MMX B;  3FKA A;  2KRT A;  4L8O A;  3SOA A;  2D1W A;  3DUK A;  2WGO A;  1JB5 A;  4XBY A;  5TGN A;  3B4O A;  1Y4K A;  3OWU A;  4MJD A;  4R9L A;  4EC6 A;  4KFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...