5FGOA

Crystal structure of d. melanogaster pur-alpha repeat iii.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
PEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCEKMKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of nucleic-acid recognition and double-strand unwinding by the essential neuronal protein Pur-alpha.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords CG1507-PB, isoform B
total genus 13
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.700 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5fgoA00
3NM7A 5FGOA 3N8BA
chains in the Genus database with same CATH superfamily
1ZO2A 2CK3H 4HKVB 3V92A 1UUGB 2KXGA 4KFEA 1WMPA 1PFPA 2R41A 1X1WA 1B3SA 2ML6A 1YJW3 1CQSA 2W0QA 1VQ63 1K41A 1BVIA 2HMKB 3NXJA 1I0XA 1VQK3 3RGAA 1D6UA 3F40A 4FMAA 3NM2A 1GS3A 3LTBA 4PEJA 2HOHA 1R4YA 1TU5A 4K1UA 5KP3A 2A15A 1I70A 4EV2A 1C7HA 5G1KA 2K3DA 3BNBA 3BNCA 2UUGC 1JBTA 1HKXA 3F9SA 3BU4A 1N9JA 1EQKA 1UCLA 2FXTA 3D5GA 3HI7A 2R4IA 1WNHA 2KF3A 5AYRB 4EV5A 1DVDA 1BRSA 1K9M4 1V74A 3CCJ3 1K8A4 2LQVA 2C11A 3FF2A 1JBRA 1IQYA 1FYSA 6STDA 1W5ZA 4ILFA 3CCU3 1MWUA 1M1XB 1T2IA 2I9WA 2ZL8A 3JUNA 3S67A 2CG1A 3N8BA 4N6UA 4I5QA 2MF7A 4XDWA 1BUQA 5IEOA 1BRNL 1JZDA 1N5PA 3MHEA 1RN4A 2GSPA 1JZOA 3EB8A 3A76A 2Q07A 4EBGA 4GB5A 5D82A 2JQ5A 5HGRA 2HMLB 1WTHA 2ML5A 3T8UA 6GSPA 3B4OA 4LSOA 3BIRA 1JKGA 1RLSA 5KP4A 3IPTA 3IJEB 1X1YA 4N6NB 1RN1A 4R4KA 3TDGA 3SOAA 3PGBA 1SPUA 4J5GA 3LOYA 4GSPA 3U1WA 1OUNA 1W02A 1A2VA 2D1WA 5M19A 3MG2A 1W7CA 3QK9A 1W00A 2LYXA 1LRAA 5AIHA 4FR9A 4HM0B 3D79A 2RFRA 2OQEA 3SLUA 4AKYA 1TTOA 2CFWA 1VQP3 2BIRA 2OTL3 5DREA 2BO9B 2CX0A 1AV4A 1BSCA 1BIRA 3MPHA 3OV4A 4HM5B 4WYKA 5IF6A 2QEX3 3CCM3 3KSPA 1RCLA 4AEQA 3JUQA 2CC3A 3NBJA 5KP1A 1US1A 1BRHA 3JUOA 1UCKA 4MMXB 1YJN3 1WMNA 1YIJ3 1TIJA 2UX0A 1D6YA 3B4PA 3JVCA 3MG1A 3K5TA 2IUJA 3CXC2 5LC6A 4HM3B 2J8XB 3D3LA 3LMLA 1O7HB 3F8XA 5D81A 1M9GA 3S5CA 1GOVA 1A67A 3WOFB 1LNIA 1PYLA 2Z7AA 4LGQA 3DM8A 3DH2A 1QVG2 3X3YA 3B8LA 1X1XA 2CX1A 2OCTA 5M1AA 2OWPA 1BANA 1LOVA 1IV9A 2CIUA 2W56B 3S27A 3WMDA 4BTXA 2E2UA 1OHPA 1PY3A 2D42A 1G96A 3G713 1TRQA 2RBIA 2OQEC 5EQLA 1HU9A 1NO3A 2H0IA 4KVHA 1UI7A 2Z77A 1QVF2 2UGIA 4HM7B 3VGNA 2BMOB 1D6ZA 5G2GA 4RNZA 1STDA 4R1KA 1T5YA 2BHMA 5AEWB 8RNTA 1E97A 1VQQA 2GEXA 4KFFA 2H0HA 1RTUA 3WR2A 2QA43 1VZZA 1LVNA 1EG9B 3EBYA 5IG3A 3ZG0A 3FSDA 2C10A 1UGHI 2YFLB 1OHSA 1QALA 1BRGA 1IU7A 1MGWA 1N5HA 1RGFA 1V58A 2RSXA 2W9PA 1YIT3 3X3ZA 1W4NA 4EYCA 3NV0A 3A5EA 3DGYA 1GD3A 1TUHA 3DZLA 4GL6A 2GXFA 4OUQA 4X2OA 4KZ1A 4X2HA 1NWWA 2XSHB 3PCRA 2GBWB 4IIAA 3EX9A 1OGZA 4BTWA 4HM2B 1RGGA 3E99A 3SYUA 1T3BA 3CC43 2P0XA 3SEDA 3DGMA 5CF2A 1AQZA 1YI23 5IG0A 1B2SA 2IMJA 3URPA 4U13A 1I2GA 4GHOA 1STFI 1YGEA 4HAAA 4QWTA 5IENA 1Q824 3DGOA 1YHQ3 2AAEA 3KSED 5BU4A 4AKZA 3DGLA 1MOLA 1DMNA 2BT3A 3S29A 1EUIC 1UCIA 1BNIA 1JRQA 1I2EA 3F8HA 4XBYA 1BSAA 3BB9A 1C54A 1ISKA 1U5OA 2ZA4A 1RGKA 1YVBI 1ZX2A 3RNTA 5FGOA 5M18A 4K1VA 4WHAA 1HZ1A 3BLZA 4J9AA 3X40A 3D4AA 3HK4A 3G16A 1N8QA 1KQS2 3UNLA 1B21A 3Q90A 1NJI4 3CC23 3NQZA 4HVNA 1UI8A 3I563 4EW5A 3SVAA 4BU4A 2STDA 4WYKB 3AGOA 2Y73A 4XBXA 1FUSA 3EF8A 2QIYA 1GMPA 3ALAA 3GZYB 1T2HA 1O7WB 5JBSA 1UDII 1BSEA 2CWUA 1RGHA 3MKIA 4N6V0 3FG1A 2RGQA 2F86B 1MNLA 1LOWA 3BNEA 3CCR3 3H3HA 1KWIA 2OTJ3 3OWSA 4BL3A 1RNBA 9RNTA 3ZG5A 4HM8B 2YFIB 3LXUX 1QJGA 1RHLA 1TP6A 4LZIA 4HZBB 1BRJA 2SBLA 2O9UX 3G4S3 1SARA 2WGOA 2XH9A 4DKIA 1QMAA 3S28A 3T0UA 3FLJA 4MMZB 1FGRA 2WO0A 1BNFA 1O7NB 4KFDA 1LXEA 3OXAA 3Q3FA 3D5IA 3KZTA 3F7XA 2WOFA 3QRDA 3WDGB 4XM4A 3CPOA 2F4YA 3G6E3 2W2CA 5DRVA 1LQMB 1FUTA 3WODG 1BNJA 4K61A 1GY7A 1GD4A 1BUJA 4MMYB 1LOXA 2F5MA 2IUKA 3V98A 5G1LA 7GSPA 5BVBA 1TFOA 2ZDJA 2CWVA 3UL5A 1I3FA 1VQO3 1G0TA 1MGRA 4N6OB 6RNTA 3X3XA 3EN1B 5ELUA 2IY2A 3UL6A 3K63A 1CYVA 1GY6A 2YX9A 5EEOA 1RSNA 3G0KA 1I8VA 4MJDA 2XSOB 5IEPA 1FGTA 1W2ZA 3CNMA 1WMOA 1UCJA 4RBNA 1Q40A 3LH4A 3CU3A 1TFKA 1KSIA 3NX0A 3Q1CA 4WWUC 1KD14 4BL2A 1DETA 2XFTA 3I553 4R9KA 1JN5A 4O8SA 4O02B 1RNTA 1Q42A 3AHWA 2FGTA 2KRTA 1JV2B 2GEYA 1AVLA 1BRIA 1AVKA 1OCVA 1RCKA 2BU4A 4G1MB 1N8R4 4HJLB 1NB5I 3DMCA 2CKFB 3HOHA 3PYJA 5TGNA 5I97A 3CD63 2XF3A 1WQLB 3MWZA 3ER7A 4CPKA 1O7GB 3F7SA 1VQ53 1JBSA 2Z76A 3EBTA 2WGQA 1IQXA 3V99A 1IVXA 2W9QA 3LT9A 3NUVA 3OX9A 4Q53A 2CFDA 1IVUA 1RDSA 2PZVA 3FZWA 1FGMA 4O2HA 1MWTA 2OOVC 4R9LA 4I4KA 1ZGXA 3WA2X 1BRKA 3OW22 3X42A 1HYFA 1RGAA 1GSPA 1L5GB 2XFSA 4XBTA 1IT7A 1R4CA 1JN5B 2HMNB 2W04A 2P09A 3FCSB 3KCHA 4J5KA 4K90B 1FA3A 2GU1A 2RNTA 4FMCA 1N9EA 8CHOA 2BMRB 4EXRA 3KFQC 1GOYA 3OWUA 1Q7HA 5AIGA 2CFGA 4IT7A 4RNTA 4XDVA 1M1K4 3ECFA 1E3VA 4BIRA 3JUMA 2KCDA 1RGLA 4FCZA 1MWRA 4MEIA 2XGLA 4JF8A 3CCQ3 4IPBA 2KF6A 3T8NA 1EEJA 3HIGA 1GMRA 1ROVA 3UJMA 1ULJB 3BNDA 3EN8A 1A90A 1IVVA 5AEUB 2IA7A 4RNYA 4HM4B 3STDA 3NBBA 1Z1SA 3JUPA 3GAXA 4CDLA 1B2ZA 4EC6A 1Q814 3NHXA 3IMAB 1V57A 3K7CA 1CYUA 2OOVA 3PS8A 2XEPA 2W6JH 3WHOA 1PU4A 4CCVA 1B20A 1FZUA 2E2VA 1MWSA 2IYJA 2K0MA 3O8YA 1GOUA 5BXQA 4JRFA 5BIRA 1NB3I 2XR8B 5CF1A 1DMQA 5ELJA 3CCV3 2PNCA 4BTYA 3G8ZA 4ORLA 4OK0A 1BOXA 1LOYA 2CHCA 3FG4A 3GZBA 2AADA 2KAAA 5AIFA 3VF1A 2Z6BA 1JB2A 2F98A 4N6TA 1S5AA 5IG4A 1KC84 2F5WA 3DY5A 3GWRA 3AMOA 1S723 3N54B 3PXMA 3CNXA 1OH0A 3WA3A 5JPPA 5FW5A 1JJ22 5GSPA 1ASKA 3EQQB 1DMMA 1A2PA 3EC9A 2E2TA 4LEHA 1I0VA 1ROAA 1K734 2INXA 4L7KA 1QAKA 1BSDA 2L1SA 1SIIA 3SX1A 1NU3A 1UW1A 1B27A 2P0MA 2P38A 2WOHA 2JDIH 4OVMA 2CFKA 5AYSC 2CWTA 2KF5A 1BNRA 5AIIA 1YVSA 1GMQA 4FMBA 1F8NA 1JNQA 3LTCA 3N9HA 5EVHA 2XRXB 5IERA 4HYZA 1RGEA 1RRHA 3AMOB 3KE7A 2W03A 1I2FA 3RDEA 5CLKA 2SARA 3HZPA 3F14A 4H61A 3MSOA 4NHFA 1JB4A 1UUVB 2YFJB 3CC73 2RCDA 1O7PB 2F99A 1DYUA 3EE1A 5STDA 3PZWA 4O3VA 2KF4A 1OF5A 1SQWA 3X41A 2F56A 7STDA 1FGQA 1CH0A 1JKGB 5CXOA 1RKYA 4L8OA 1TJDA 2L4VA 1A2KA 2M7OA 3L0RA 3LYGA 1Q7Y4 4LYLB 1IVWA 1JB5A 3OWYA 5AI1A 2FNQA 1VQL3 2C4BA 4STDA 1LQGC 3DGNA 1K28A 3FH1A 1RGCA 4WFOA 3VSYA 4NPBA 3FF0A 3CMA3 5LC7A 2BMQB 3LTDA 1Q40B 3Q2PA 1GY5A 3RGRA 3U97A 1G02A 1E3RA 1X1UA 1W01A 3DUKA 4H3UA 4HBRA 3J7Yd 3NM7A 3DXOA 3MG3A 3ZFZA 5JPUA 3K9MC 3LTAA 2MC8A 3LZAA 5A0OB 4KT3B 1RMSA 1M904 1TRPA 4LMIA 1B2UA 1VQ43 1FGOA 1LNHA 2V1LA 3CCE3 1VQ73 1BNEA 1RJOA 4N3VA 4XB5A 3SOYA 3CCL3 1B2XA 3GZRA 3I0YA 3NV0B 1IV7A 3KKGA 4R80A 3KN4A 3MYTA 1I3IA 5IW9A 5CK6A 3PCSA 1W6GA 4HM1B 1OPYA 3UB1A 3HIIA 1IT8A 1DVCA 1BAOA 4FCMA 4CJNA 1B2MA 2CG0A 2P05A 1Q9EA 1AR0A 1BSBA 1NNVA 1W6CA 2K54A 4NREA 4WP5A 1VQM3 3H51A 1OGXA 1IYYA 3CPW2 1RN7A 4FMDA 1RRLA 1YNVX 3B7CA 1FW7A 2BNGA 4FCJA 4TX4A 2GU3A 3EJVA 5D83A 1UGIA 1Y4KA 2HMOB 3ROBA 1VQ83 1YGWA 2CFLA 2GBXB 3D9RA 1CEWI 5IG5A 3M8CA 1NDOB 2HMJB 2O3OA 5HOHA 1J2BA 4J8TA 3NBRA 1IK3A 1UUWB 7RNTA 3CCS3 3FG3A 4N6MA 3NQYA 1OACA 3GZXB 3K0ZA 1W2B2 3GSPA 1U8CB 2W56A 3WOEB 3AGNA 2H0GA 1BNSA 1YJ93 1BU4A 1ZS7A 1QAFA 2XGNA 1SIHA 1OF5B 1IQ8A 1BGSA 3GRDA 3SXXA 1OHOA 3KIIA 2B24B 2CH9A 1DE3A 3LT8A 1AY7A 2QGUA 4L8PA 2Y74A 1VQN3 3CME3 2B1XB 3FKAA 4ZM8A 1VQ93 2ZHXB 1SJWA 1BNGA 1GYBA 4N6LA 2CW9A 1IDPA 3AHSA 3EHCA 4HZ9B 5RNTA 4RZMA 3HX8A 1O7MB 4HOHA 1EA2A 2HMMB 1Q864 1ULIB 1FUWA 1EKMA 3FGYA 1W6YA 4HM6B
chains in the Genus database with same CATH topology
1ZO2A 2CK3H 4HKVB 3V92A 2KXGA 4KFEA 1WMPA 1PFPA 1YJW3 2ML6A 1CQSA 2W0QA 1VQ63 1K41A 2HMKB 3NXJA 1VQK3 3RGAA 1D6UA 3F40A 4FMAA 3NM2A 1GS3A 3LTBA 4PEJA 1TU5A 4K1UA 5KP3A 2A15A 4EV2A 1C7HA 3BNBA 3BNCA 1HKXA 3F9SA 1N9JA 1EQKA 2FXTA 3HI7A 2R4IA 1WNHA 5AYRB 4EV5A 1DVDA 1K9M4 1V74A 3CCJ3 1K8A4 2LQVA 2C11A 3FF2A 1IQYA 6STDA 1W5ZA 3CCU3 2I9WA 1M1XB 3JUNA 2ZL8A 3S67A 2CG1A 3N8BA 4N6UA 4XDWA 2MF7A 1BUQA 5IEOA 1N5PA 3MHEA 3EB8A 3A76A 2Q07A 4EBGA 4GB5A 5D82A 2JQ5A 5HGRA 2HMLB 1WTHA 2ML5A 3T8UA 3B4OA 4LSOA 5KP4A 1JKGA 3IPTA 3IJEB 4N6NB 4R4KA 3TDGA 3SOAA 3PGBA 1SPUA 3LOYA 3U1WA 1OUNA 1W02A 1A2VA 2D1WA 3MG2A 1W7CA 3QK9A 1W00A 2LYXA 5AIHA 4FR9A 4HM0B 3SLUA 2RFRA 2OQEA 4AKYA 2CFWA 1VQP3 2OTL3 5DREA 2BO9B 3MPHA 1AV4A 4HM5B 4WYKA 3OV4A 5IF6A 2QEX3 3CCM3 3KSPA 4AEQA 3JUQA 2CC3A 3NBJA 5KP1A 1US1A 3JUOA 1YJN3 4MMXB 1WMNA 1YIJ3 1TIJA 2UX0A 1D6YA 3B4PA 3JVCA 3MG1A 3K5TA 2IUJA 3CXC2 5LC6A 4HM3B 3D3LA 3LMLA 1O7HB 3F8XA 5D81A 1M9GA 3S5CA 1A67A 3WOFB 2Z7AA 4LGQA 3DM8A 1QVG2 3X3YA 3B8LA 2OCTA 2OWPA 1IV9A 2CIUA 2W56B 3S27A 3WMDA 4BTXA 2E2UA 1OHPA 2D42A 1G96A 3G713 2OQEC 5EQLA 1HU9A 1NO3A 4KVHA 1UI7A 2Z77A 1QVF2 4HM7B 3VGNA 2BMOB 1D6ZA 5G2GA 4RNZA 1STDA 4R1KA 1T5YA 2BHMA 5AEWB 1E97A 2GEXA 4KFFA 2QA43 1VZZA 1LVNA 1EG9B 3EBYA 5IG3A 3FSDA 2C10A 2YFLB 1OHSA 1QALA 1IU7A 2RSXA 1N5HA 2W9PA 3B7CA 1YIT3 3X3ZA 1W4NA 4EYCA 3NV0A 1GD3A 1TUHA 3DZLA 4GL6A 2GXFA 4OUQA 4X2OA 4KZ1A 4X2HA 1NWWA 2XSHB 3PCRA 2GBWB 4IIAA 3EX9A 1OGZA 4BTWA 4HM2B 3E99A 3CC43 2P0XA 3SEDA 3DGMA 5CF2A 1YI23 5IG0A 2IMJA 4U13A 4QWTA 1STFI 1YGEA 5IENA 1Q824 3DGOA 1YHQ3 3KSED 4AKZA 3DGLA 1MOLA 1DMNA 2BT3A 3S29A 1JRQA 3F8HA 4XBYA 3BB9A 1ISKA 1U5OA 1ZX2A 1YVBI 5FGOA 4K1VA 4WHAA 3BLZA 4J9AA 3X40A 3HK4A 3G16A 1N8QA 1KQS2 3UNLA 1NJI4 3Q90A 3CC23 3NQZA 4HVNA 1UI8A 3I563 3SVAA 2STDA 4WYKB 2Y73A 4XBXA 3EF8A 2QIYA 3ALAA 3GZYB 1O7WB 5JBSA 2CWUA 3MKIA 4N6V0 3FG1A 2RGQA 2F86B 1MNLA 3CCR3 3BNEA 3H3HA 1KWIA 2OTJ3 3OWSA 4HM8B 2YFIB 3LXUX 1QJGA 1TP6A 4LZIA 4HZBB 2SBLA 2O9UX 3G4S3 2WGOA 2XH9A 1QMAA 3S28A 3T0UA 3FLJA 4MMZB 1FGRA 2WO0A 1O7NB 4KFDA 1LXEA 3OXAA 3KZTA 3F7XA 2WOFA 3QRDA 3WDGB 4XM4A 3CPOA 3G6E3 2W2CA 5DRVA 3WODG 4K61A 1GY7A 1GD4A 4MMYB 1LOXA 3V98A 2IUKA 5BVBA 1TFOA 2ZDJA 2CWVA 3UL5A 1VQO3 4N6OB 3X3XA 3EN1B 5ELUA 3UL6A 3K63A 1CYVA 1GY6A 2YX9A 5EEOA 3G0KA 4MJDA 2XSOB 5IEPA 1FGTA 1W2ZA 3CNMA 1WMOA 4RBNA 1Q40A 3LH4A 3CU3A 1TFKA 1KSIA 3NX0A 3Q1CA 4WWUC 1KD14 2XFTA 3I553 4R9KA 1JN5A 4O8SA 4O02B 1Q42A 2FGTA 2KRTA 1JV2B 2GEYA 1AVLA 1AVKA 1OCVA 4G1MB 1N8R4 1NB5I 4HJLB 3DMCA 2CKFB 3PYJA 5TGNA 5I97A 3CD63 2XF3A 1WQLB 3MWZA 3ER7A 1O7GB 3F7SA 1VQ53 2Z76A 3EBTA 2WGQA 1IQXA 3V99A 1IVXA 2W9QA 3LT9A 3NUVA 3OX9A 4Q53A 2CFDA 1IVUA 2PZVA 3FZWA 1FGMA 4O2HA 2OOVC 4R9LA 4I4KA 3WA2X 3OW22 3X42A 1L5GB 2XFSA 4XBTA 1IT7A 1R4CA 1JN5B 2HMNB 2W04A 2P09A 3FCSB 4K90B 1FA3A 2GU1A 4FMCA 1N9EA 8CHOA 2BMRB 4EXRA 3KFQC 3OWUA 5AIGA 2CFGA 4IT7A 1M1K4 4XDVA 3ECFA 1E3VA 3JUMA 2KCDA 4FCZA 4MEIA 2XGLA 4JF8A 3CCQ3 4IPBA 3T8NA 3HIGA 1ROVA 3UJMA 1ULJB 3BNDA 3EN8A 1A90A 1IVVA 5AEUB 2IA7A 4RNYA 4HM4B 3STDA 3NBBA 1Z1SA 3JUPA 3GAXA 4CDLA 4EC6A 1Q814 3NHXA 3IMAB 1CYUA 3K7CA 2OOVA 3PS8A 2XEPA 2W6JH 1PU4A 4CCVA 3O8YA 5BXQA 2E2VA 2K0MA 4JRFA 1NB3I 2XR8B 5CF1A 1DMQA 5ELJA 3CCV3 2PNCA 4BTYA 3G8ZA 4ORLA 4OK0A 2CHCA 3FG4A 3GZBA 3VF1A 5AIFA 2Z6BA 1JB2A 2F98A 4N6TA 1S5AA 5IG4A 1KC84 3DY5A 3GWRA 3AMOA 1S723 3N54B 3PXMA 3CNXA 1OH0A 3WA3A 5JPPA 5FW5A 1JJ22 1ASKA 3EQQB 1DMMA 3EC9A 2E2TA 4LEHA 1ROAA 1K734 2INXA 4L7KA 1QAKA 1SIIA 3SX1A 1NU3A 1UW1A 2P0MA 2P38A 2WOHA 2JDIH 4OVMA 2CFKA 5AYSC 2CWTA 5AIIA 4FMBA 1F8NA 1JNQA 3LTCA 3N9HA 5EVHA 2XRXB 5IERA 4HYZA 1RRHA 3AMOB 3KE7A 2W03A 3RDEA 5CLKA 3HZPA 3F14A 4H61A 3MSOA 4NHFA 1JB4A 1UUVB 2YFJB 3CC73 2RCDA 1O7PB 2F99A 1DYUA 3EE1A 5STDA 3PZWA 4O3VA 1OF5A 1SQWA 3X41A 7STDA 1RKYA 1FGQA 5CXOA 1JKGB 4L8OA 2L4VA 3L0RA 1A2KA 2M7OA 3LYGA 1Q7Y4 1VQL3 5AI1A 1IVWA 1JB5A 3OWYA 2FNQA 4STDA 3DGNA 3FH1A 1K28A 4WFOA 3VSYA 3FF0A 3CMA3 5LC7A 2BMQB 3LTDA 1Q40B 3Q2PA 1GY5A 3RGRA 3U97A 3DUKA 1E3RA 4H3UA 1W01A 3J7Yd 4HBRA 3NM7A 3DXOA 3MG3A 5JPUA 3K9MC 3LTAA 2MC8A 3LZAA 5A0OB 1M904 4LMIA 1VQ43 1FGOA 1LNHA 2V1LA 3CCE3 1VQ73 1RJOA 4XB5A 4N3VA 3SOYA 3CCL3 3I0YA 3GZRA 3NV0B 4R80A 1IV7A 3KKGA 3KN4A 3MYTA 5IW9A 5CK6A 3PCSA 1W6GA 4HM1B 1OPYA 3UB1A 3HIIA 1IT8A 1DVCA 4FCMA 2CG0A 2P05A 1AR0A 2K54A 1VQM3 1W6CA 4NREA 4WP5A 3H51A 1OGXA 3CPW2 1RN7A 4FMDA 1RRLA 2BNGA 4FCJA 4TX4A 2GU3A 3EJVA 5D83A 2HMOB 1Y4KA 3ROBA 1VQ83 2CFLA 2GBXB 3D9RA 1CEWI 5IG5A 3M8CA 1NDOB 2HMJB 2O3OA 1J2BA 4J8TA 3NBRA 1IK3A 1UUWB 3CCS3 3FG3A 4N6MA 3NQYA 1OACA 3GZXB 3K0ZA 1W2B2 1U8CB 2W56A 3WOEB 1YJ93 1QAFA 2XGNA 1SIHA 1OF5B 1IQ8A 3GRDA 3SXXA 1OHOA 3KIIA 2B24B 2CH9A 3LT8A 2QGUA 4L8PA 2Y74A 1VQN3 3CME3 2B1XB 3FKAA 4ZM8A 1VQ93 1SJWA 1GYBA 4N6LA 2CW9A 1IDPA 3EHCA 4HZ9B 4RZMA 3HX8A 1O7MB 1FUWA 1EA2A 2HMMB 1Q864 1ULIB 1EKMA 3FGYA 1W6YA 4HM6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NM7 A;  5FGO A;  3N8B A; 
#chains in the Genus database with same CATH topology
 1ZO2 A;  2CK3 H;  4HKV B;  3V92 A;  1UUG B;  2KXG A;  4KFE A;  1WMP A;  1PFP A;  2R41 A;  1X1W A;  1B3S A;  2ML6 A;  1YJW 3;  1CQS A;  2W0Q A;  1VQ6 3;  1K41 A;  1BVI A;  2HMK B;  3NXJ A;  1I0X A;  1VQK 3;  3RGA A;  1D6U A;  3F40 A;  4FMA A;  3NM2 A;  1GS3 A;  3LTB A;  4PEJ A;  2HOH A;  1R4Y A;  1TU5 A;  4K1U A;  5KP3 A;  2A15 A;  1I70 A;  4EV2 A;  1C7H A;  5G1K A;  2K3D A;  3BNB A;  3BNC A;  2UUG C;  1JBT A;  1HKX A;  3F9S A;  3BU4 A;  1N9J A;  1EQK A;  1UCL A;  2FXT A;  3D5G A;  3HI7 A;  2R4I A;  1WNH A;  2KF3 A;  5AYR B;  4EV5 A;  1DVD A;  1BRS A;  1K9M 4;  1V74 A;  3CCJ 3;  1K8A 4;  2LQV A;  2C11 A;  3FF2 A;  1JBR A;  1IQY A;  1FYS A;  6STD A;  1W5Z A;  4ILF A;  3CCU 3;  1MWU A;  1M1X B;  1T2I A;  2I9W A;  2ZL8 A;  3JUN A;  3S67 A;  2CG1 A;  3N8B A;  4N6U A;  4I5Q A;  2MF7 A;  4XDW A;  1BUQ A;  5IEO A;  1BRN L;  1JZD A;  1N5P A;  3MHE A;  1RN4 A;  2GSP A;  1JZO A;  3EB8 A;  3A76 A;  2Q07 A;  4EBG A;  4GB5 A;  5D82 A;  2JQ5 A;  5HGR A;  2HML B;  1WTH A;  2ML5 A;  3T8U A;  6GSP A;  3B4O A;  4LSO A;  3BIR A;  1JKG A;  1RLS A;  5KP4 A;  3IPT A;  3IJE B;  1X1Y A;  4N6N B;  1RN1 A;  4R4K A;  3TDG A;  3SOA A;  3PGB A;  1SPU A;  4J5G A;  3LOY A;  4GSP A;  3U1W A;  1OUN A;  1W02 A;  1A2V A;  2D1W A;  5M19 A;  3MG2 A;  1W7C A;  3QK9 A;  1W00 A;  2LYX A;  1LRA A;  5AIH A;  4FR9 A;  4HM0 B;  3D79 A;  2RFR A;  2OQE A;  3SLU A;  4AKY A;  1TTO A;  2CFW A;  1VQP 3;  2BIR A;  2OTL 3;  5DRE A;  2BO9 B;  2CX0 A;  1AV4 A;  1BSC A;  1BIR A;  3MPH A;  3OV4 A;  4HM5 B;  4WYK A;  5IF6 A;  2QEX 3;  3CCM 3;  3KSP A;  1RCL A;  4AEQ A;  3JUQ A;  2CC3 A;  3NBJ A;  5KP1 A;  1US1 A;  1BRH A;  3JUO A;  1UCK A;  4MMX B;  1YJN 3;  1WMN A;  1YIJ 3;  1TIJ A;  2UX0 A;  1D6Y A;  3B4P A;  3JVC A;  3MG1 A;  3K5T A;  2IUJ A;  3CXC 2;  5LC6 A;  4HM3 B;  2J8X B;  3D3L A;  3LML A;  1O7H B;  3F8X A;  5D81 A;  1M9G A;  3S5C A;  1GOV A;  1A67 A;  3WOF B;  1LNI A;  1PYL A;  2Z7A A;  4LGQ A;  3DM8 A;  3DH2 A;  1QVG 2;  3X3Y A;  3B8L A;  1X1X A;  2CX1 A;  2OCT A;  5M1A A;  2OWP A;  1BAN A;  1LOV A;  1IV9 A;  2CIU A;  2W56 B;  3S27 A;  3WMD A;  4BTX A;  2E2U A;  1OHP A;  1PY3 A;  2D42 A;  1G96 A;  3G71 3;  1TRQ A;  2RBI A;  2OQE C;  5EQL A;  1HU9 A;  1NO3 A;  2H0I A;  4KVH A;  1UI7 A;  2Z77 A;  1QVF 2;  2UGI A;  4HM7 B;  3VGN A;  2BMO B;  1D6Z A;  5G2G A;  4RNZ A;  1STD A;  4R1K A;  1T5Y A;  2BHM A;  5AEW B;  8RNT A;  1E97 A;  1VQQ A;  2GEX A;  4KFF A;  2H0H A;  1RTU A;  3WR2 A;  2QA4 3;  1VZZ A;  1LVN A;  1EG9 B;  3EBY A;  5IG3 A;  3ZG0 A;  3FSD A;  2C10 A;  1UGH I;  2YFL B;  1OHS A;  1QAL A;  1BRG A;  1IU7 A;  1MGW A;  1N5H A;  1RGF A;  1V58 A;  2RSX A;  2W9P A;  1YIT 3;  3X3Z A;  1W4N A;  4EYC A;  3NV0 A;  3A5E A;  3DGY A;  1GD3 A;  1TUH A;  3DZL A;  4GL6 A;  2GXF A;  4OUQ A;  4X2O A;  4KZ1 A;  4X2H A;  1NWW A;  2XSH B;  3PCR A;  2GBW B;  4IIA A;  3EX9 A;  1OGZ A;  4BTW A;  4HM2 B;  1RGG A;  3E99 A;  3SYU A;  1T3B A;  3CC4 3;  2P0X A;  3SED A;  3DGM A;  5CF2 A;  1AQZ A;  1YI2 3;  5IG0 A;  1B2S A;  2IMJ A;  3URP A;  4U13 A;  1I2G A;  4GHO A;  1STF I;  1YGE A;  4HAA A;  4QWT A;  5IEN A;  1Q82 4;  3DGO A;  1YHQ 3;  2AAE A;  3KSE D;  5BU4 A;  4AKZ A;  3DGL A;  1MOL A;  1DMN A;  2BT3 A;  3S29 A;  1EUI C;  1UCI A;  1BNI A;  1JRQ A;  1I2E A;  3F8H A;  4XBY A;  1BSA A;  3BB9 A;  1C54 A;  1ISK A;  1U5O A;  2ZA4 A;  1RGK A;  1YVB I;  1ZX2 A;  3RNT A;  5FGO A;  5M18 A;  4K1V A;  4WHA A;  1HZ1 A;  3BLZ A;  4J9A A;  3X40 A;  3D4A A;  3HK4 A;  3G16 A;  1N8Q A;  1KQS 2;  3UNL A;  1B21 A;  3Q90 A;  1NJI 4;  3CC2 3;  3NQZ A;  4HVN A;  1UI8 A;  3I56 3;  4EW5 A;  3SVA A;  4BU4 A;  2STD A;  4WYK B;  3AGO A;  2Y73 A;  4XBX A;  1FUS A;  3EF8 A;  2QIY A;  1GMP A;  3ALA A;  3GZY B;  1T2H A;  1O7W B;  5JBS A;  1UDI I;  1BSE A;  2CWU A;  1RGH A;  3MKI A;  4N6V 0;  3FG1 A;  2RGQ A;  2F86 B;  1MNL A;  1LOW A;  3BNE A;  3CCR 3;  3H3H A;  1KWI A;  2OTJ 3;  3OWS A;  4BL3 A;  1RNB A;  9RNT A;  3ZG5 A;  4HM8 B;  2YFI B;  3LXU X;  1QJG A;  1RHL A;  1TP6 A;  4LZI A;  4HZB B;  1BRJ A;  2SBL A;  2O9U X;  3G4S 3;  1SAR A;  2WGO A;  2XH9 A;  4DKI A;  1QMA A;  3S28 A;  3T0U A;  3FLJ A;  4MMZ B;  1FGR A;  2WO0 A;  1BNF A;  1O7N B;  4KFD A;  1LXE A;  3OXA A;  3Q3F A;  3D5I A;  3KZT A;  3F7X A;  2WOF A;  3QRD A;  3WDG B;  4XM4 A;  3CPO A;  2F4Y A;  3G6E 3;  2W2C A;  5DRV A;  1LQM B;  1FUT A;  3WOD G;  1BNJ A;  4K61 A;  1GY7 A;  1GD4 A;  1BUJ A;  4MMY B;  1LOX A;  2F5M A;  2IUK A;  3V98 A;  5G1L A;  7GSP A;  5BVB A;  1TFO A;  2ZDJ A;  2CWV A;  3UL5 A;  1I3F A;  1VQO 3;  1G0T A;  1MGR A;  4N6O B;  6RNT A;  3X3X A;  3EN1 B;  5ELU A;  2IY2 A;  3UL6 A;  3K63 A;  1CYV A;  1GY6 A;  2YX9 A;  5EEO A;  1RSN A;  3G0K A;  1I8V A;  4MJD A;  2XSO B;  5IEP A;  1FGT A;  1W2Z A;  3CNM A;  1WMO A;  1UCJ A;  4RBN A;  1Q40 A;  3LH4 A;  3CU3 A;  1TFK A;  1KSI A;  3NX0 A;  3Q1C A;  4WWU C;  1KD1 4;  4BL2 A;  1DET A;  2XFT A;  3I55 3;  4R9K A;  1JN5 A;  4O8S A;  4O02 B;  1RNT A;  1Q42 A;  3AHW A;  2FGT A;  2KRT A;  1JV2 B;  2GEY A;  1AVL A;  1BRI A;  1AVK A;  1OCV A;  1RCK A;  2BU4 A;  4G1M B;  1N8R 4;  4HJL B;  1NB5 I;  3DMC A;  2CKF B;  3HOH A;  3PYJ A;  5TGN A;  5I97 A;  3CD6 3;  2XF3 A;  1WQL B;  3MWZ A;  3ER7 A;  4CPK A;  1O7G B;  3F7S A;  1VQ5 3;  1JBS A;  2Z76 A;  3EBT A;  2WGQ A;  1IQX A;  3V99 A;  1IVX A;  2W9Q A;  3LT9 A;  3NUV A;  3OX9 A;  4Q53 A;  2CFD A;  1IVU A;  1RDS A;  2PZV A;  3FZW A;  1FGM A;  4O2H A;  1MWT A;  2OOV C;  4R9L A;  4I4K A;  1ZGX A;  3WA2 X;  1BRK A;  3OW2 2;  3X42 A;  1HYF A;  1RGA A;  1GSP A;  1L5G B;  2XFS A;  4XBT A;  1IT7 A;  1R4C A;  1JN5 B;  2HMN B;  2W04 A;  2P09 A;  3FCS B;  3KCH A;  4J5K A;  4K90 B;  1FA3 A;  2GU1 A;  2RNT A;  4FMC A;  1N9E A;  8CHO A;  2BMR B;  4EXR A;  3KFQ C;  1GOY A;  3OWU A;  1Q7H A;  5AIG A;  2CFG A;  4IT7 A;  4RNT A;  4XDV A;  1M1K 4;  3ECF A;  1E3V A;  4BIR A;  3JUM A;  2KCD A;  1RGL A;  4FCZ A;  1MWR A;  4MEI A;  2XGL A;  4JF8 A;  3CCQ 3;  4IPB A;  2KF6 A;  3T8N A;  1EEJ A;  3HIG A;  1GMR A;  1ROV A;  3UJM A;  1ULJ B;  3BND A;  3EN8 A;  1A90 A;  1IVV A;  5AEU B;  2IA7 A;  4RNY A;  4HM4 B;  3STD A;  3NBB A;  1Z1S A;  3JUP A;  3GAX A;  4CDL A;  1B2Z A;  4EC6 A;  1Q81 4;  3NHX A;  3IMA B;  1V57 A;  3K7C A;  1CYU A;  2OOV A;  3PS8 A;  2XEP A;  2W6J H;  3WHO A;  1PU4 A;  4CCV A;  1B20 A;  1FZU A;  2E2V A;  1MWS A;  2IYJ A;  2K0M A;  3O8Y A;  1GOU A;  5BXQ A;  4JRF A;  5BIR A;  1NB3 I;  2XR8 B;  5CF1 A;  1DMQ A;  5ELJ A;  3CCV 3;  2PNC A;  4BTY A;  3G8Z A;  4ORL A;  4OK0 A;  1BOX A;  1LOY A;  2CHC A;  3FG4 A;  3GZB A;  2AAD A;  2KAA A;  5AIF A;  3VF1 A;  2Z6B A;  1JB2 A;  2F98 A;  4N6T A;  1S5A A;  5IG4 A;  1KC8 4;  2F5W A;  3DY5 A;  3GWR A;  3AMO A;  1S72 3;  3N54 B;  3PXM A;  3CNX A;  1OH0 A;  3WA3 A;  5JPP A;  5FW5 A;  1JJ2 2;  5GSP A;  1ASK A;  3EQQ B;  1DMM A;  1A2P A;  3EC9 A;  2E2T A;  4LEH A;  1I0V A;  1ROA A;  1K73 4;  2INX A;  4L7K A;  1QAK A;  1BSD A;  2L1S A;  1SII A;  3SX1 A;  1NU3 A;  1UW1 A;  1B27 A;  2P0M A;  2P38 A;  2WOH A;  2JDI H;  4OVM A;  2CFK A;  5AYS C;  2CWT A;  2KF5 A;  1BNR A;  5AII A;  1YVS A;  1GMQ A;  4FMB A;  1F8N A;  1JNQ A;  3LTC A;  3N9H A;  5EVH A;  2XRX B;  5IER A;  4HYZ A;  1RGE A;  1RRH A;  3AMO B;  3KE7 A;  2W03 A;  1I2F A;  3RDE A;  5CLK A;  2SAR A;  3HZP A;  3F14 A;  4H61 A;  3MSO A;  4NHF A;  1JB4 A;  1UUV B;  2YFJ B;  3CC7 3;  2RCD A;  1O7P B;  2F99 A;  1DYU A;  3EE1 A;  5STD A;  3PZW A;  4O3V A;  2KF4 A;  1OF5 A;  1SQW A;  3X41 A;  2F56 A;  7STD A;  1FGQ A;  1CH0 A;  1JKG B;  5CXO A;  1RKY A;  4L8O A;  1TJD A;  2L4V A;  1A2K A;  2M7O A;  3L0R A;  3LYG A;  1Q7Y 4;  4LYL B;  1IVW A;  1JB5 A;  3OWY A;  5AI1 A;  2FNQ A;  1VQL 3;  2C4B A;  4STD A;  1LQG C;  3DGN A;  1K28 A;  3FH1 A;  1RGC A;  4WFO A;  3VSY A;  4NPB A;  3FF0 A;  3CMA 3;  5LC7 A;  2BMQ B;  3LTD A;  1Q40 B;  3Q2P A;  1GY5 A;  3RGR A;  3U97 A;  1G02 A;  1E3R A;  1X1U A;  1W01 A;  3DUK A;  4H3U A;  4HBR A;  3J7Y d;  3NM7 A;  3DXO A;  3MG3 A;  3ZFZ A;  5JPU A;  3K9M C;  3LTA A;  2MC8 A;  3LZA A;  5A0O B;  4KT3 B;  1RMS A;  1M90 4;  1TRP A;  4LMI A;  1B2U A;  1VQ4 3;  1FGO A;  1LNH A;  2V1L A;  3CCE 3;  1VQ7 3;  1BNE A;  1RJO A;  4N3V A;  4XB5 A;  3SOY A;  3CCL 3;  1B2X A;  3GZR A;  3I0Y A;  3NV0 B;  1IV7 A;  3KKG A;  4R80 A;  3KN4 A;  3MYT A;  1I3I A;  5IW9 A;  5CK6 A;  3PCS A;  1W6G A;  4HM1 B;  1OPY A;  3UB1 A;  3HII A;  1IT8 A;  1DVC A;  1BAO A;  4FCM A;  4CJN A;  1B2M A;  2CG0 A;  2P05 A;  1Q9E A;  1AR0 A;  1BSB A;  1NNV A;  1W6C A;  2K54 A;  4NRE A;  4WP5 A;  1VQM 3;  3H51 A;  1OGX A;  1IYY A;  3CPW 2;  1RN7 A;  4FMD A;  1RRL A;  1YNV X;  3B7C A;  1FW7 A;  2BNG A;  4FCJ A;  4TX4 A;  2GU3 A;  3EJV A;  5D83 A;  1UGI A;  1Y4K A;  2HMO B;  3ROB A;  1VQ8 3;  1YGW A;  2CFL A;  2GBX B;  3D9R A;  1CEW I;  5IG5 A;  3M8C A;  1NDO B;  2HMJ B;  2O3O A;  5HOH A;  1J2B A;  4J8T A;  3NBR A;  1IK3 A;  1UUW B;  7RNT A;  3CCS 3;  3FG3 A;  4N6M A;  3NQY A;  1OAC A;  3GZX B;  3K0Z A;  1W2B 2;  3GSP A;  1U8C B;  2W56 A;  3WOE B;  3AGN A;  2H0G A;  1BNS A;  1YJ9 3;  1BU4 A;  1ZS7 A;  1QAF A;  2XGN A;  1SIH A;  1OF5 B;  1IQ8 A;  1BGS A;  3GRD A;  3SXX A;  1OHO A;  3KII A;  2B24 B;  2CH9 A;  1DE3 A;  3LT8 A;  1AY7 A;  2QGU A;  4L8P A;  2Y74 A;  1VQN 3;  3CME 3;  2B1X B;  3FKA A;  4ZM8 A;  1VQ9 3;  2ZHX B;  1SJW A;  1BNG A;  1GYB A;  4N6L A;  2CW9 A;  1IDP A;  3AHS A;  3EHC A;  4HZ9 B;  5RNT A;  4RZM A;  3HX8 A;  1O7M B;  4HOH A;  1EA2 A;  2HMM B;  1Q86 4;  1ULI B;  1FUW A;  1EKM A;  3FGY A;  1W6Y A;  4HM6 B; 
#chains in the Genus database with same CATH homology
 1ZO2 A;  2CK3 H;  4HKV B;  3V92 A;  2KXG A;  4KFE A;  1WMP A;  1PFP A;  1YJW 3;  2ML6 A;  1CQS A;  2W0Q A;  1VQ6 3;  1K41 A;  2HMK B;  3NXJ A;  1VQK 3;  3RGA A;  1D6U A;  3F40 A;  4FMA A;  3NM2 A;  1GS3 A;  3LTB A;  4PEJ A;  1TU5 A;  4K1U A;  5KP3 A;  2A15 A;  4EV2 A;  1C7H A;  3BNB A;  3BNC A;  1HKX A;  3F9S A;  1N9J A;  1EQK A;  2FXT A;  3HI7 A;  2R4I A;  1WNH A;  5AYR B;  4EV5 A;  1DVD A;  1K9M 4;  1V74 A;  3CCJ 3;  1K8A 4;  2LQV A;  2C11 A;  3FF2 A;  1IQY A;  6STD A;  1W5Z A;  3CCU 3;  2I9W A;  1M1X B;  3JUN A;  2ZL8 A;  3S67 A;  2CG1 A;  3N8B A;  4N6U A;  4XDW A;  2MF7 A;  1BUQ A;  5IEO A;  1N5P A;  3MHE A;  3EB8 A;  3A76 A;  2Q07 A;  4EBG A;  4GB5 A;  5D82 A;  2JQ5 A;  5HGR A;  2HML B;  1WTH A;  2ML5 A;  3T8U A;  3B4O A;  4LSO A;  5KP4 A;  1JKG A;  3IPT A;  3IJE B;  4N6N B;  4R4K A;  3TDG A;  3SOA A;  3PGB A;  1SPU A;  3LOY A;  3U1W A;  1OUN A;  1W02 A;  1A2V A;  2D1W A;  3MG2 A;  1W7C A;  3QK9 A;  1W00 A;  2LYX A;  5AIH A;  4FR9 A;  4HM0 B;  3SLU A;  2RFR A;  2OQE A;  4AKY A;  2CFW A;  1VQP 3;  2OTL 3;  5DRE A;  2BO9 B;  3MPH A;  1AV4 A;  4HM5 B;  4WYK A;  3OV4 A;  5IF6 A;  2QEX 3;  3CCM 3;  3KSP A;  4AEQ A;  3JUQ A;  2CC3 A;  3NBJ A;  5KP1 A;  1US1 A;  3JUO A;  1YJN 3;  4MMX B;  1WMN A;  1YIJ 3;  1TIJ A;  2UX0 A;  1D6Y A;  3B4P A;  3JVC A;  3MG1 A;  3K5T A;  2IUJ A;  3CXC 2;  5LC6 A;  4HM3 B;  3D3L A;  3LML A;  1O7H B;  3F8X A;  5D81 A;  1M9G A;  3S5C A;  1A67 A;  3WOF B;  2Z7A A;  4LGQ A;  3DM8 A;  1QVG 2;  3X3Y A;  3B8L A;  2OCT A;  2OWP A;  1IV9 A;  2CIU A;  2W56 B;  3S27 A;  3WMD A;  4BTX A;  2E2U A;  1OHP A;  2D42 A;  1G96 A;  3G71 3;  2OQE C;  5EQL A;  1HU9 A;  1NO3 A;  4KVH A;  1UI7 A;  2Z77 A;  1QVF 2;  4HM7 B;  3VGN A;  2BMO B;  1D6Z A;  5G2G A;  4RNZ A;  1STD A;  4R1K A;  1T5Y A;  2BHM A;  5AEW B;  1E97 A;  2GEX A;  4KFF A;  2QA4 3;  1VZZ A;  1LVN A;  1EG9 B;  3EBY A;  5IG3 A;  3FSD A;  2C10 A;  2YFL B;  1OHS A;  1QAL A;  1IU7 A;  2RSX A;  1N5H A;  2W9P A;  3B7C A;  1YIT 3;  3X3Z A;  1W4N A;  4EYC A;  3NV0 A;  1GD3 A;  1TUH A;  3DZL A;  4GL6 A;  2GXF A;  4OUQ A;  4X2O A;  4KZ1 A;  4X2H A;  1NWW A;  2XSH B;  3PCR A;  2GBW B;  4IIA A;  3EX9 A;  1OGZ A;  4BTW A;  4HM2 B;  3E99 A;  3CC4 3;  2P0X A;  3SED A;  3DGM A;  5CF2 A;  1YI2 3;  5IG0 A;  2IMJ A;  4U13 A;  4QWT A;  1STF I;  1YGE A;  5IEN A;  1Q82 4;  3DGO A;  1YHQ 3;  3KSE D;  4AKZ A;  3DGL A;  1MOL A;  1DMN A;  2BT3 A;  3S29 A;  1JRQ A;  3F8H A;  4XBY A;  3BB9 A;  1ISK A;  1U5O A;  1ZX2 A;  1YVB I;  5FGO A;  4K1V A;  4WHA A;  3BLZ A;  4J9A A;  3X40 A;  3HK4 A;  3G16 A;  1N8Q A;  1KQS 2;  3UNL A;  1NJI 4;  3Q90 A;  3CC2 3;  3NQZ A;  4HVN A;  1UI8 A;  3I56 3;  3SVA A;  2STD A;  4WYK B;  2Y73 A;  4XBX A;  3EF8 A;  2QIY A;  3ALA A;  3GZY B;  1O7W B;  5JBS A;  2CWU A;  3MKI A;  4N6V 0;  3FG1 A;  2RGQ A;  2F86 B;  1MNL A;  3CCR 3;  3BNE A;  3H3H A;  1KWI A;  2OTJ 3;  3OWS A;  4HM8 B;  2YFI B;  3LXU X;  1QJG A;  1TP6 A;  4LZI A;  4HZB B;  2SBL A;  2O9U X;  3G4S 3;  2WGO A;  2XH9 A;  1QMA A;  3S28 A;  3T0U A;  3FLJ A;  4MMZ B;  1FGR A;  2WO0 A;  1O7N B;  4KFD A;  1LXE A;  3OXA A;  3KZT A;  3F7X A;  2WOF A;  3QRD A;  3WDG B;  4XM4 A;  3CPO A;  3G6E 3;  2W2C A;  5DRV A;  3WOD G;  4K61 A;  1GY7 A;  1GD4 A;  4MMY B;  1LOX A;  3V98 A;  2IUK A;  5BVB A;  1TFO A;  2ZDJ A;  2CWV A;  3UL5 A;  1VQO 3;  4N6O B;  3X3X A;  3EN1 B;  5ELU A;  3UL6 A;  3K63 A;  1CYV A;  1GY6 A;  2YX9 A;  5EEO A;  3G0K A;  4MJD A;  2XSO B;  5IEP A;  1FGT A;  1W2Z A;  3CNM A;  1WMO A;  4RBN A;  1Q40 A;  3LH4 A;  3CU3 A;  1TFK A;  1KSI A;  3NX0 A;  3Q1C A;  4WWU C;  1KD1 4;  2XFT A;  3I55 3;  4R9K A;  1JN5 A;  4O8S A;  4O02 B;  1Q42 A;  2FGT A;  2KRT A;  1JV2 B;  2GEY A;  1AVL A;  1AVK A;  1OCV A;  4G1M B;  1N8R 4;  1NB5 I;  4HJL B;  3DMC A;  2CKF B;  3PYJ A;  5TGN A;  5I97 A;  3CD6 3;  2XF3 A;  1WQL B;  3MWZ A;  3ER7 A;  1O7G B;  3F7S A;  1VQ5 3;  2Z76 A;  3EBT A;  2WGQ A;  1IQX A;  3V99 A;  1IVX A;  2W9Q A;  3LT9 A;  3NUV A;  3OX9 A;  4Q53 A;  2CFD A;  1IVU A;  2PZV A;  3FZW A;  1FGM A;  4O2H A;  2OOV C;  4R9L A;  4I4K A;  3WA2 X;  3OW2 2;  3X42 A;  1L5G B;  2XFS A;  4XBT A;  1IT7 A;  1R4C A;  1JN5 B;  2HMN B;  2W04 A;  2P09 A;  3FCS B;  4K90 B;  1FA3 A;  2GU1 A;  4FMC A;  1N9E A;  8CHO A;  2BMR B;  4EXR A;  3KFQ C;  3OWU A;  5AIG A;  2CFG A;  4IT7 A;  1M1K 4;  4XDV A;  3ECF A;  1E3V A;  3JUM A;  2KCD A;  4FCZ A;  4MEI A;  2XGL A;  4JF8 A;  3CCQ 3;  4IPB A;  3T8N A;  3HIG A;  1ROV A;  3UJM A;  1ULJ B;  3BND A;  3EN8 A;  1A90 A;  1IVV A;  5AEU B;  2IA7 A;  4RNY A;  4HM4 B;  3STD A;  3NBB A;  1Z1S A;  3JUP A;  3GAX A;  4CDL A;  4EC6 A;  1Q81 4;  3NHX A;  3IMA B;  1CYU A;  3K7C A;  2OOV A;  3PS8 A;  2XEP A;  2W6J H;  1PU4 A;  4CCV A;  3O8Y A;  5BXQ A;  2E2V A;  2K0M A;  4JRF A;  1NB3 I;  2XR8 B;  5CF1 A;  1DMQ A;  5ELJ A;  3CCV 3;  2PNC A;  4BTY A;  3G8Z A;  4ORL A;  4OK0 A;  2CHC A;  3FG4 A;  3GZB A;  3VF1 A;  5AIF A;  2Z6B A;  1JB2 A;  2F98 A;  4N6T A;  1S5A A;  5IG4 A;  1KC8 4;  3DY5 A;  3GWR A;  3AMO A;  1S72 3;  3N54 B;  3PXM A;  3CNX A;  1OH0 A;  3WA3 A;  5JPP A;  5FW5 A;  1JJ2 2;  1ASK A;  3EQQ B;  1DMM A;  3EC9 A;  2E2T A;  4LEH A;  1ROA A;  1K73 4;  2INX A;  4L7K A;  1QAK A;  1SII A;  3SX1 A;  1NU3 A;  1UW1 A;  2P0M A;  2P38 A;  2WOH A;  2JDI H;  4OVM A;  2CFK A;  5AYS C;  2CWT A;  5AII A;  4FMB A;  1F8N A;  1JNQ A;  3LTC A;  3N9H A;  5EVH A;  2XRX B;  5IER A;  4HYZ A;  1RRH A;  3AMO B;  3KE7 A;  2W03 A;  3RDE A;  5CLK A;  3HZP A;  3F14 A;  4H61 A;  3MSO A;  4NHF A;  1JB4 A;  1UUV B;  2YFJ B;  3CC7 3;  2RCD A;  1O7P B;  2F99 A;  1DYU A;  3EE1 A;  5STD A;  3PZW A;  4O3V A;  1OF5 A;  1SQW A;  3X41 A;  7STD A;  1RKY A;  1FGQ A;  5CXO A;  1JKG B;  4L8O A;  2L4V A;  3L0R A;  1A2K A;  2M7O A;  3LYG A;  1Q7Y 4;  1VQL 3;  5AI1 A;  1IVW A;  1JB5 A;  3OWY A;  2FNQ A;  4STD A;  3DGN A;  3FH1 A;  1K28 A;  4WFO A;  3VSY A;  3FF0 A;  3CMA 3;  5LC7 A;  2BMQ B;  3LTD A;  1Q40 B;  3Q2P A;  1GY5 A;  3RGR A;  3U97 A;  3DUK A;  1E3R A;  4H3U A;  1W01 A;  3J7Y d;  4HBR A;  3NM7 A;  3DXO A;  3MG3 A;  5JPU A;  3K9M C;  3LTA A;  2MC8 A;  3LZA A;  5A0O B;  1M90 4;  4LMI A;  1VQ4 3;  1FGO A;  1LNH A;  2V1L A;  3CCE 3;  1VQ7 3;  1RJO A;  4XB5 A;  4N3V A;  3SOY A;  3CCL 3;  3I0Y A;  3GZR A;  3NV0 B;  4R80 A;  1IV7 A;  3KKG A;  3KN4 A;  3MYT A;  5IW9 A;  5CK6 A;  3PCS A;  1W6G A;  4HM1 B;  1OPY A;  3UB1 A;  3HII A;  1IT8 A;  1DVC A;  4FCM A;  2CG0 A;  2P05 A;  1AR0 A;  2K54 A;  1VQM 3;  1W6C A;  4NRE A;  4WP5 A;  3H51 A;  1OGX A;  3CPW 2;  1RN7 A;  4FMD A;  1RRL A;  2BNG A;  4FCJ A;  4TX4 A;  2GU3 A;  3EJV A;  5D83 A;  2HMO B;  1Y4K A;  3ROB A;  1VQ8 3;  2CFL A;  2GBX B;  3D9R A;  1CEW I;  5IG5 A;  3M8C A;  1NDO B;  2HMJ B;  2O3O A;  1J2B A;  4J8T A;  3NBR A;  1IK3 A;  1UUW B;  3CCS 3;  3FG3 A;  4N6M A;  3NQY A;  1OAC A;  3GZX B;  3K0Z A;  1W2B 2;  1U8C B;  2W56 A;  3WOE B;  1YJ9 3;  1QAF A;  2XGN A;  1SIH A;  1OF5 B;  1IQ8 A;  3GRD A;  3SXX A;  1OHO A;  3KII A;  2B24 B;  2CH9 A;  3LT8 A;  2QGU A;  4L8P A;  2Y74 A;  1VQN 3;  3CME 3;  2B1X B;  3FKA A;  4ZM8 A;  1VQ9 3;  1SJW A;  1GYB A;  4N6L A;  2CW9 A;  1IDP A;  3EHC A;  4HZ9 B;  4RZM A;  3HX8 A;  1O7M B;  1FUW A;  1EA2 A;  2HMM B;  1Q86 4;  1ULI B;  1EKM A;  3FGY A;  1W6Y A;  4HM6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...