5FGOA

Crystal structure of d. melanogaster pur-alpha repeat iii.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
b'PEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCEKMKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CG1507-PB, isoform B
molecule tags Dna binding protein
source organism Drosophila melanogaster
publication title Structural basis of nucleic-acid recognition and double-strand unwinding by the essential neuronal protein Pur-alpha.
pubmed doi rcsb
total genus 13
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.700 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5fgoA00
3N8BA 3NM7A 5FGOA
chains in the Genus database with same CATH superfamily
1QVG2 1ASKA 3V92A 1YNVX 4O2HA 4R9LA 4KZ1A 4KFEA 2ZL8A 1YIT3 1LNIA 3GRDA 1W2ZA 3M8CA 3KCHA 1PFPA 1D6ZA 3DMCA 1BRSA 4HM1B 1DVCA 4HOHA 1UCIA 2IY2A 3OWUA 3NV0A 1BRHA 1DMNA 1OHOA 1UI7A 2Y74A 1K41A 3G0KA 4AEQA 1J2BA 1NJI4 2Z6BA 5JPUA 5AI1A 3NQYA 4STDA 1M1XB 2HMLB 1KWIA 1BAOA 1VQN3 1BGSA 3OWYA 3VGNA 4MEIA 3J7Yd 3S27A 3BLZA 2KAAA 3CCU3 4RNTA 4NPBA 2K54A 1B21A 1RN7A 2WOFA 4MMXB 4R1KA 2W56A 1YJ93 1DE3A 3AHSA 1Q864 1W00A 3H51A 1VQM3 4N3VA 1UGHI 3PS8A 5IEOA 3S29A 1JBSA 1VQ93 1JB4A 1K9M4 1ZGXA 4HM6B 1ULIB 3FH1A 1GSPA 3S28A 2BNGA 1N5HA 2IUKA 5BU4A 1S5AA 3NHXA 1YJN3 1I0XA 1MWUA 1WTHA 3DZLA 4CPKA 4EV5A 1T2IA 1BRIA 3V99A 2W0QA 2HOHA 2F56A 1CEWI 1NWWA 3PCSA 1S723 1MWTA 2CG0A 3DGMA 4HYZA 2XFSA 3HIIA 1EUIC 3X3ZA 5FGOA 1STFI 4KFFA 1GMPA 1ISKA 1LRAA 4WFOA 2GEYA 1CYUA 1JNQA 1Q40A 3WOEB 3SXXA 3D9RA 1VZZA 1RMSA 5BIRA 1RRLA 1RSNA 2UUGC 3LZAA 5AYRB 3B4PA 3EN8A 5JBSA 2RBIA 3MWZA 1N9EA 5DREA 2ZHXB 1B2UA 1Q42A 3DGOA 1EA2A 2FGTA 3KSPA 1RCLA 3K0ZA 3AMOB 4KVHA 3T8UA 3BNEA 1W6YA 2CWUA 4O02B 1DMQA 5IG0A 3T0UA 2CX0A 3FZWA 3WODG 3CCL3 2LQVA 1Q9EA 1AR0A 3CC73 1RN4A 2W04A 4HVNA 5EVHA 3AGOA 3GZBA 1TFOA 1JKGB 4OUQA 1C7HA 2XRXB 4I4KA 2KXGA 1E3RA 3DGYA 3PCRA 1LVNA 5IEPA 1AV4A 1O7MB 1TTOA 3NXJA 4HKVB 3JUPA 3WA2X 2QEX3 3FG4A 1OPYA 4LSOA 3MYTA 4FCZA 2OTJ3 4BTYA 3EC9A 1VQ83 4KFDA 1W5ZA 1RNTA 1UCKA 5IG3A 3JUMA 4R4KA 2KRTA 1N8R4 4N6OB 4H61A 3HX8A 3CCM3 1IQXA 1FGRA 1OHPA 3EBTA 1RGCA 2P09A 3RGAA 3SOYA 1RNBA 1RLSA 2CIUA 2W6JH 4XBYA 3PYJA 1BANA 2R41A 3ZG5A 4G1MB 1OCVA 4WP5A 4EYCA 6STDA 1RGEA 3I0YA 8RNTA 3Q2PA 5KP1A 4XBXA 1GOVA 1IV9A 3ZFZA 1M1K4 3NV0B 1CQSA 3X3YA 1KSIA 1IK3A 1SIHA 2F4YA 2PZVA 2CC3A 2QIYA 3CME3 2RGQA 1BOXA 1JB2A 1QAKA 2F99A 4WWUC 1FUWA 3NM7A 4LZIA 3F40A 4J9AA 2CWTA 3EQQB 2B24B 1IVVA 3HZPA 3GZRA 4N6TA 2OTL3 4GL6A 5D82A 1BSBA 1I3FA 4N6V0 5ELJA 3OX9A 5FW5A 2HMKB 3WOFB 3MKIA 4LGQA 1TUHA 1GOUA 2XH9A 4LEHA 2XSOB 3IPTA 2OWPA 3LT8A 1X1WA 4FCJA 1T3BA 3Q1CA 5I97A 3N8BA 2XEPA 3E99A 3NBBA 2V1LA 1WMNA 1QAFA 1BRJA 5D83A 1W6CA 3G6E3 1I2EA 4XDVA 1IVXA 4TX4A 3D3LA 3BU4A 3NUVA 1CYVA 2C11A 1OGXA 2IUJA 3CD63 1AVKA 2F5MA 1OF5A 1OACA 4BTXA 4MJDA 3FF0A 3CC43 3F9SA 4XBTA 1SIIA 5AIIA 3CCR3 1GOYA 4RBNA 1GMQA 1K28A 4O3VA 3KFQC 4IIAA 2RFRA 1GD3A 2CH9A 1MGRA 1GMRA 2Z77A 2AADA 3B4OA 3CMA3 2A15A 2E2TA 1LNHA 2CG1A 2HMMB 4GSPA 3GZXB 1KD14 1TRQA 4FMCA 1TP6A 3KE7A 2JQ5A 3LYGA 3MHEA 4CCVA 2H0GA 5CF1A 1OHSA 2XSHB 1UCLA 2D42A 3KZTA 4RNYA 5M1AA 1NB3I 1OUNA 1RGFA 1ZO2A 4R9KA 4MMZB 3A76A 3HK4A 2WGOA 5A0OB 3CU3A 1QMAA 1FZUA 2ZA4A 1RKYA 1RDSA 1YJW3 3RGRA 1VQO3 1LOXA 2D1WA 3WDGB 1BUJA 2L1SA 2LYXA 4EXRA 2GXFA 3SYUA 1ULJB 1V57A 1N8QA 3F7XA 3JUQA 3DH2A 4XB5A 4QWTA 1IT7A 3K9MC 2Y73A 5M18A 5CXOA 1NU3A 3LTBA 4N6NB 1W4NA 1K734 3WHOA 2OCTA 3LTCA 3ECFA 1JZDA 1AVLA 2UX0A 1A67A 1FUSA 3X3XA 1VQ53 1WMPA 5HOHA 2O9UX 5ELUA 2L4VA 1JN5A 1UUWB 3QRDA 1AQZA 1IV7A 4FMAA 3TDGA 3BIRA 4DKIA 2BU4A 4NREA 1E97A 1O7PB 1BRGA 3D4AA 3ROBA 3U97A 3IMAB 1YGWA 2E2UA 3O8YA 4EV2A 4IPBA 7STDA 3BNDA 4HBRA 3KKGA 5IENA 1HKXA 3OV4A 5IERA 3I563 1Z1SA 3BNCA 4JF8A 4RZMA 2INXA 4EC6A 1VQK3 1JZOA 1IT8A 1LOVA 2CK3H 2ML5A 3DGLA 4HM2B 1VQL3 4N6LA 5CK6A 3Q3FA 3F7SA 2BMOB 1MOLA 2KCDA 1UUGB 1BUQA 3GAXA 1NO3A 2BMQB 3AHWA 8CHOA 5IG4A 1TRPA 5EEOA 1DETA 4BU4A 3KIIA 5G1LA 3FF2A 3FSDA 4N6MA 3K7CA 3JVCA 1FGMA 3HOHA 1WMOA 1UDII 1U5OA 3UNLA 3SLUA 1I2FA 1B3SA 2AAEA 3FG1A 3Q90A 3LTAA 5G1KA 1O7WB 3NQZA 3D5IA 6RNTA 5KP4A 2CKFB 1OH0A 3CCS3 1ROAA 2GU1A 3F14A 1Q40B 3F8XA 3ER7A 4K1VA 3MG3A 2HMOB 3MG1A 2HMNB 3EX9A 4HM0B 5IF6A 4EBGA 1BVIA 2CFWA 1LOWA 2BIRA 3PZWA 2F86B 2K0MA 1RGGA 2C4BA 1BSCA 1TIJA 2BO9B 2CWVA 2KF4A 2P0XA 3EHCA 1B27A 3URPA 2IYJA 4CJNA 1D6UA 4KT3B 3QK9A 4X2OA 1M904 4HAAA 1GS3A 3X40A 2I9WA 3U1WA 5M19A 1OF5B 1UGIA 2R4IA 1GD4A 3EE1A 2KF3A 1FGOA 1BNIA 2CW9A 1FGTA 2OQEC 3LXUX 3OWSA 2XR8B 2OQEA 4RNZA 1X1YA 3B8LA 5GSPA 4JRFA 1X1XA 1W6GA 3CPW2 1JKGA 4OVMA 1QVF2 3X42A 1UCJA 3WMDA 3MSOA 4IT7A 1MGWA 2GBXB 5LC6A 1FUTA 1Q824 5EQLA 1BNGA 1IQYA 1TFKA 1Y4KA 1UW1A 4U13A 3ZG0A 4NHFA 2W2CA 4HZ9B 3GSPA 4HM5B 4BL3A 3UL6A 1MWRA 1UI8A 1BRKA 3FKAA 1C54A 1Q7HA 1I8VA 5AEWB 1DYUA 4FMBA 1D6YA 1RCKA 1HZ1A 5CLKA 3EF8A 1TJDA 4J5KA 3EBYA 5AIFA 3DM8A 5LC7A 3WR2A 3MPHA 3D5GA 2YFLB 1YGEA 1TU5A 1IQ8A 2YFJB 3UL5A 3G16A 3JUNA 2Z76A 1L5GB 4HJLB 2XFTA 4R80A 2XGNA 3I553 2YX9A 2QGUA 2W56B 3LTDA 3OW22 3CXC2 1I3IA 1I70A 1BSAA 4X2HA 2F5WA 1GYBA 1QALA 1B2MA 3NBRA 3NM2A 4HM8B 2BHMA 2M7OA 3RDEA 4I5QA 3EB8A 4OK0A 4LMIA 3EJVA 5AIGA 2O3OA 2HMJB 2RSXA 1RRHA 3SX1A 3CCE3 3L0RA 4WYKB 1CH0A 1W7CA 2P0MA 3F8HA 4HM3B 5HGRA 4BIRA 3NBJA 9RNTA 3G4S3 1IVUA 4L8OA 1JN5B 4FR9A 5AYSC 1BNJA 1G02A 2QA43 2KF6A 1US1A 4J8TA 6GSPA 1O7NB 1ZS7A 2J8XB 1BSDA 3K5TA 4CDLA 3HI7A 4L8PA 1BNRA 2Z7AA 4GHOA 4XM4A 2H0IA 4EW5A 1YI23 3SOAA 3FLJA 3CCV3 2SBLA 5BVBA 3RNTA 1IVWA 2H0HA 1KQS2 2CHCA 1A90A 1IYYA 2ZDJA 1VQP3 3KSED 1Q7Y4 1B2XA 4BL2A 3S67A 2YFIB 7RNTA 1V58A 3CNXA 1EG9B 1JRQA 5CF2A 1GY5A 1BNSA 1PY3A 1M9GA 4FCMA 1LOYA 3LOYA 4WYKA 2WOHA 1MNLA 3FGYA 1GY7A 1JV2B 1RHLA 2JDIH 2PNCA 3K63A 3LT9A 1RJOA 3JUOA 5G2GA 3CPOA 3CCJ3 2B1XB 1UUVB 1FGQA 3H3HA 1RN1A 3V98A 4PEJA 1VQ73 5JPPA 3GZYB 1NNVA 3UJMA 2XF3A 3X41A 1IU7A 1JB5A 3DGNA 1BSEA 2IA7A 3WA3A 2P05A 3CC23 1WNHA 1DVDA 1JBRA 2WGQA 1VQQA 1NDOB 1YVSA 1FW7A 1G0TA 1NB5I 4HZBB 1SPUA 1R4YA 2K3DA 1A2VA 4ILFA 1RGHA 1W02A 3HIGA 1ROVA 4J5GA 1HU9A 2SARA 3S5CA 1FYSA 3SEDA 4AKZA 2Q07A 1W2B2 1I2GA 1N9JA 4K1UA 2KF5A 3FCSB 1RGKA 2WO0A 1SARA 3KN4A 1GY6A 3IJEB 5RNTA 1E3VA 1STDA 2CFGA 2STDA 1N5PA 2BMRB 7GSPA 2E2VA 3ALAA 1I0VA 1VQ43 1V74A 2CFKA 3VF1A 1PU4A 2GU3A 5KP3A 1YIJ3 1B20A 1EQKA 3LMLA 1VQ63 3UB1A 3FG3A 1F8NA 1EEJA 4LYLB 1K8A4 3G8ZA 3VSYA 1BNEA 2W9PA 4MMYB 4BTWA 5IG5A 1A2PA 2GSPA 3DUKA 3PGBA 5DRVA 1BNFA 1O7GB 4AKYA 2FXTA 4K90B 5STDA 3LH4A 2W03A 1PYLA 1HYFA 1YHQ3 1EKMA 1RTUA 3AMOA 2P38A 3BNBA 3BB9A 3MG2A 3PXMA 1FA3A 1IDPA 1X1UA 2BT3A 1T2HA 3G713 2FNQA 4XDWA 5IW9A 3A5EA 1YVBI 1B2ZA 1BU4A 1SJWA 3DY5A 1RGAA 2MC8A 1ZX2A 4HM4B 5D81A 1JBTA 3B7CA 3T8NA 2OOVC 3DXOA 4HM7B 4ZM8A 3N9HA 2MF7A 2GBWB 2ML6A 1BIRA 1LXEA 1WQLB 1G96A 1U8CB 2RNTA 2W9QA 1W01A 4N6UA 1Q814 1JJ22 1DMMA 3GWRA 1AY7A 1RGLA 2CX1A 2GEXA 4ORLA 5BXQA 5TGNA 1A2KA 2F98A 4L7KA 3CCQ3 4WHAA 1MWSA 1OGZA 4Q53A 1LQGC 1B2SA 1R4CA 2C10A 3AGNA 3N54B 3OXAA 5AIHA 1O7HB 2CFLA 2XGLA 2OOVA 3NX0A 3STDA 3SVAA 1KC84 1T5YA 2IMJA 3CNMA 4H3UA 1BRNL 2RCDA 4O8SA 4FMDA 5AEUB 1QJGA 4K61A 1SQWA 3D79A 3EN1B 4GB5A 2UGIA 2CFDA 1LQMB
chains in the Genus database with same CATH topology
1QVG2 1ASKA 3V92A 4O2HA 4R9LA 4KZ1A 4KFEA 2ZL8A 1YIT3 3GRDA 1W2ZA 3M8CA 1PFPA 1D6ZA 3DMCA 4HM1B 1DVCA 3OWUA 3NV0A 1DMNA 1OHOA 1UI7A 2Y74A 1K41A 3G0KA 4AEQA 1J2BA 1NJI4 2Z6BA 5JPUA 5AI1A 3NQYA 4STDA 1M1XB 2HMLB 1KWIA 1VQN3 3OWYA 3VGNA 4MEIA 3J7Yd 3S27A 3BLZA 3CCU3 2K54A 4MMXB 1RN7A 2WOFA 4R1KA 1YJ93 2W56A 1Q864 1W00A 3H51A 1VQM3 4N3VA 3S29A 3PS8A 5IEOA 1VQ93 1JB4A 1K9M4 4HM6B 1ULIB 3FH1A 3S28A 2BNGA 1N5HA 2IUKA 1S5AA 3NHXA 1YJN3 1WTHA 3DZLA 4EV5A 3V99A 2W0QA 1CEWI 1NWWA 3PCSA 1S723 2CG0A 3DGMA 4HYZA 2XFSA 3HIIA 3X3ZA 5FGOA 1STFI 4KFFA 1ISKA 4WFOA 2GEYA 1CYUA 1JNQA 1Q40A 3WOEB 3SXXA 3D9RA 1VZZA 1RRLA 3LZAA 5AYRB 3B4PA 3EN8A 5JBSA 3MWZA 1N9EA 5DREA 1Q42A 3DGOA 1EA2A 2FGTA 3KSPA 4KVHA 3K0ZA 3AMOB 3T8UA 3BNEA 1W6YA 2CWUA 4O02B 1DMQA 5IG0A 3T0UA 3FZWA 3WODG 3CCL3 2LQVA 1AR0A 3CC73 2W04A 4HVNA 5EVHA 3GZBA 1TFOA 1JKGB 4OUQA 1C7HA 2XRXB 4I4KA 2KXGA 1E3RA 3PCRA 1LVNA 5IEPA 1AV4A 1O7MB 3NXJA 4HKVB 3WA2X 3JUPA 2QEX3 3FG4A 1OPYA 4LSOA 3MYTA 4FCZA 2OTJ3 4BTYA 3EC9A 1VQ83 4KFDA 1W5ZA 5IG3A 3JUMA 4R4KA 2KRTA 1N8R4 4N6OB 4H61A 3HX8A 3CCM3 1IQXA 1FGRA 1OHPA 3EBTA 2P09A 3RGAA 3SOYA 2CIUA 2W6JH 4XBYA 3PYJA 4G1MB 1OCVA 4WP5A 4EYCA 6STDA 3I0YA 5KP1A 3Q2PA 4XBXA 1IV9A 1M1K4 3NV0B 1CQSA 3X3YA 1KSIA 1IK3A 1SIHA 2PZVA 2CC3A 2QIYA 3CME3 2RGQA 1JB2A 1QAKA 2F99A 4WWUC 1FUWA 3NM7A 4LZIA 3F40A 4J9AA 2CWTA 3EQQB 2B24B 1IVVA 3HZPA 3GZRA 4N6TA 2OTL3 4GL6A 5D82A 5ELJA 4N6V0 3OX9A 5FW5A 2HMKB 3WOFB 3MKIA 4LGQA 1TUHA 2XH9A 4LEHA 2XSOB 3IPTA 2OWPA 3LT8A 4FCJA 3Q1CA 5I97A 3N8BA 2XEPA 3E99A 3NBBA 2V1LA 1WMNA 1QAFA 5D83A 1W6CA 3G6E3 4XDVA 1IVXA 4TX4A 3D3LA 3NUVA 1CYVA 2C11A 1OGXA 2IUJA 3CD63 1AVKA 1OF5A 1OACA 4BTXA 4MJDA 3FF0A 3CC43 3F9SA 4XBTA 1SIIA 5AIIA 3CCR3 4RBNA 1K28A 4O3VA 3KFQC 4IIAA 2RFRA 1GD3A 2CH9A 2Z77A 3CMA3 3B4OA 2A15A 2E2TA 1LNHA 2CG1A 2HMMB 3GZXB 1KD14 4FMCA 1TP6A 3KE7A 2JQ5A 3LYGA 3MHEA 4CCVA 5CF1A 1OHSA 2XSHB 2D42A 3KZTA 4RNYA 1NB3I 1OUNA 1ZO2A 4R9KA 4MMZB 3A76A 3HK4A 2WGOA 5A0OB 3CU3A 1QMAA 1RKYA 1YJW3 3RGRA 1VQO3 1LOXA 2D1WA 3WDGB 2LYXA 4EXRA 2GXFA 1ULJB 1N8QA 3F7XA 3JUQA 4XB5A 4QWTA 1IT7A 3K9MC 2Y73A 1K734 5CXOA 1NU3A 3LTBA 4N6NB 1W4NA 2OCTA 3LTCA 3ECFA 1AVLA 2UX0A 1A67A 3X3XA 1VQ53 1WMPA 2O9UX 5ELUA 2L4VA 1JN5A 1UUWB 3QRDA 1IV7A 4FMAA 3TDGA 4NREA 1E97A 1O7PB 3ROBA 3U97A 3IMAB 2E2UA 3O8YA 4EV2A 4IPBA 7STDA 3BNDA 4HBRA 3KKGA 5IENA 1HKXA 3OV4A 5IERA 3I563 1Z1SA 3BNCA 4JF8A 4RZMA 2INXA 4EC6A 1VQK3 1IT8A 2CK3H 2ML5A 3DGLA 4HM2B 1VQL3 4N6LA 5CK6A 3F7SA 2BMOB 1MOLA 2KCDA 1BUQA 3GAXA 1NO3A 2BMQB 8CHOA 5IG4A 5EEOA 3KIIA 3FF2A 3FSDA 4N6MA 3K7CA 3JVCA 1FGMA 1WMOA 1U5OA 3UNLA 3SLUA 3FG1A 3Q90A 3LTAA 1O7WB 3NQZA 5KP4A 2CKFB 1OH0A 3CCS3 1ROAA 2GU1A 3F14A 1Q40B 3F8XA 3ER7A 4K1VA 3MG3A 2HMOB 3MG1A 2HMNB 3EX9A 4HM0B 5IF6A 4EBGA 2CFWA 3PZWA 2F86B 2K0MA 1TIJA 2BO9B 2CWVA 2P0XA 3EHCA 1D6UA 3QK9A 4X2OA 1M904 1GS3A 3X40A 2I9WA 3U1WA 1OF5B 2R4IA 1GD4A 3EE1A 1FGOA 2OQEC 2CW9A 1FGTA 3LXUX 3OWSA 2XR8B 2OQEA 4RNZA 3B8LA 4JRFA 1W6GA 3CPW2 1JKGA 4OVMA 1QVF2 3X42A 3WMDA 3MSOA 4IT7A 2GBXB 5LC6A 1Q824 5EQLA 1IQYA 1TFKA 1Y4KA 1UW1A 4U13A 4NHFA 2W2CA 4HZ9B 4HM5B 3UL6A 3FKAA 1UI8A 5AEWB 1DYUA 4FMBA 1D6YA 5CLKA 3EF8A 3EBYA 5AIFA 3DM8A 5LC7A 3MPHA 2YFLB 1YGEA 1TU5A 1IQ8A 2YFJB 3UL5A 3G16A 3JUNA 2Z76A 1L5GB 4HJLB 2XFTA 4R80A 2XGNA 3I553 2YX9A 2QGUA 2W56B 3LTDA 3OW22 3CXC2 4X2HA 1GYBA 1QALA 3NBRA 3NM2A 4HM8B 2BHMA 2M7OA 3RDEA 3EB8A 4OK0A 4LMIA 3EJVA 5AIGA 2O3OA 2HMJB 2RSXA 1RRHA 3SX1A 3CCE3 3L0RA 4WYKB 1W7CA 2P0MA 3F8HA 4HM3B 5HGRA 3G4S3 3NBJA 1IVUA 4L8OA 1JN5B 4FR9A 5AYSC 2QA43 1US1A 4J8TA 1O7NB 3K5TA 4CDLA 3HI7A 4L8PA 2Z7AA 4XM4A 1YI23 3SOAA 3FLJA 3CCV3 2SBLA 5BVBA 1IVWA 1KQS2 2CHCA 1A90A 2ZDJA 1VQP3 3KSED 1Q7Y4 3S67A 2YFIB 3CNXA 1EG9B 1JRQA 5CF2A 1GY5A 1M9GA 4FCMA 3LOYA 4WYKA 2WOHA 1MNLA 3FGYA 1GY7A 1JV2B 2JDIH 3K63A 2PNCA 3LT9A 1RJOA 3JUOA 5G2GA 3CPOA 3CCJ3 2B1XB 1UUVB 1FGQA 3H3HA 3V98A 4PEJA 1VQ73 5JPPA 3GZYB 3UJMA 2XF3A 3X41A 1IU7A 1JB5A 3DGNA 3CC23 2IA7A 3WA3A 2P05A 1DVDA 1WNHA 2WGQA 1NDOB 1NB5I 4HZBB 1SPUA 1A2VA 1W02A 3HIGA 1ROVA 3SEDA 1HU9A 4AKZA 3S5CA 2Q07A 1W2B2 1N9JA 4K1UA 3FCSB 2WO0A 3KN4A 1GY6A 3IJEB 1E3VA 1STDA 2CFGA 2STDA 1N5PA 2BMRB 2E2VA 3ALAA 1VQ43 1V74A 2CFKA 3VF1A 1PU4A 2GU3A 5KP3A 1YIJ3 1EQKA 3LMLA 1VQ63 3UB1A 3FG3A 1F8NA 1K8A4 3G8ZA 3VSYA 2W9PA 4MMYB 4BTWA 5IG5A 3DUKA 3PGBA 5DRVA 1O7GB 4AKYA 2FXTA 4K90B 5STDA 3LH4A 2W03A 1YHQ3 1EKMA 3AMOA 3BNBA 2P38A 3MG2A 3BB9A 3PXMA 1FA3A 1IDPA 2BT3A 3G713 2FNQA 4XDWA 5IW9A 1YVBI 1SJWA 3DY5A 2MC8A 1ZX2A 4HM4B 5D81A 3B7CA 3T8NA 2OOVC 3DXOA 4HM7B 4ZM8A 3N9HA 2MF7A 2GBWB 2ML6A 2W9QA 1LXEA 1WQLB 1G96A 1U8CB 4N6UA 1Q814 1W01A 1JJ22 1DMMA 3GWRA 2GEXA 4ORLA 5BXQA 5TGNA 1A2KA 2F98A 4L7KA 3CCQ3 4WHAA 1OGZA 4Q53A 5AIHA 1R4CA 2C10A 3N54B 3OXAA 3STDA 1O7HB 2CFLA 2XGLA 2OOVA 3NX0A 3SVAA 1KC84 1T5YA 2IMJA 3CNMA 4H3UA 2RCDA 4O8SA 4FMDA 5AEUB 1QJGA 4K61A 1SQWA 3EN1B 4GB5A 2CFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N8B A;  3NM7 A;  5FGO A; 
#chains in the Genus database with same CATH topology
 1QVG 2;  1ASK A;  3V92 A;  1YNV X;  4O2H A;  4R9L A;  4KZ1 A;  4KFE A;  2ZL8 A;  1YIT 3;  1LNI A;  3GRD A;  1W2Z A;  3M8C A;  3KCH A;  1PFP A;  1D6Z A;  3DMC A;  1BRS A;  4HM1 B;  1DVC A;  4HOH A;  1UCI A;  2IY2 A;  3OWU A;  3NV0 A;  1BRH A;  1DMN A;  1OHO A;  1UI7 A;  2Y74 A;  1K41 A;  3G0K A;  4AEQ A;  1J2B A;  1NJI 4;  2Z6B A;  5JPU A;  5AI1 A;  3NQY A;  4STD A;  1M1X B;  2HML B;  1KWI A;  1BAO A;  1VQN 3;  1BGS A;  3OWY A;  3VGN A;  4MEI A;  3J7Y d;  3S27 A;  3BLZ A;  2KAA A;  3CCU 3;  4RNT A;  4NPB A;  2K54 A;  1B21 A;  1RN7 A;  2WOF A;  4MMX B;  4R1K A;  2W56 A;  1YJ9 3;  1DE3 A;  3AHS A;  1Q86 4;  1W00 A;  3H51 A;  1VQM 3;  4N3V A;  1UGH I;  3PS8 A;  5IEO A;  3S29 A;  1JBS A;  1VQ9 3;  1JB4 A;  1K9M 4;  1ZGX A;  4HM6 B;  1ULI B;  3FH1 A;  1GSP A;  3S28 A;  2BNG A;  1N5H A;  2IUK A;  5BU4 A;  1S5A A;  3NHX A;  1YJN 3;  1I0X A;  1MWU A;  1WTH A;  3DZL A;  4CPK A;  4EV5 A;  1T2I A;  1BRI A;  3V99 A;  2W0Q A;  2HOH A;  2F56 A;  1CEW I;  1NWW A;  3PCS A;  1S72 3;  1MWT A;  2CG0 A;  3DGM A;  4HYZ A;  2XFS A;  3HII A;  1EUI C;  3X3Z A;  5FGO A;  1STF I;  4KFF A;  1GMP A;  1ISK A;  1LRA A;  4WFO A;  2GEY A;  1CYU A;  1JNQ A;  1Q40 A;  3WOE B;  3SXX A;  3D9R A;  1VZZ A;  1RMS A;  5BIR A;  1RRL A;  1RSN A;  2UUG C;  3LZA A;  5AYR B;  3B4P A;  3EN8 A;  5JBS A;  2RBI A;  3MWZ A;  1N9E A;  5DRE A;  2ZHX B;  1B2U A;  1Q42 A;  3DGO A;  1EA2 A;  2FGT A;  3KSP A;  1RCL A;  3K0Z A;  3AMO B;  4KVH A;  3T8U A;  3BNE A;  1W6Y A;  2CWU A;  4O02 B;  1DMQ A;  5IG0 A;  3T0U A;  2CX0 A;  3FZW A;  3WOD G;  3CCL 3;  2LQV A;  1Q9E A;  1AR0 A;  3CC7 3;  1RN4 A;  2W04 A;  4HVN A;  5EVH A;  3AGO A;  3GZB A;  1TFO A;  1JKG B;  4OUQ A;  1C7H A;  2XRX B;  4I4K A;  2KXG A;  1E3R A;  3DGY A;  3PCR A;  1LVN A;  5IEP A;  1AV4 A;  1O7M B;  1TTO A;  3NXJ A;  4HKV B;  3JUP A;  3WA2 X;  2QEX 3;  3FG4 A;  1OPY A;  4LSO A;  3MYT A;  4FCZ A;  2OTJ 3;  4BTY A;  3EC9 A;  1VQ8 3;  4KFD A;  1W5Z A;  1RNT A;  1UCK A;  5IG3 A;  3JUM A;  4R4K A;  2KRT A;  1N8R 4;  4N6O B;  4H61 A;  3HX8 A;  3CCM 3;  1IQX A;  1FGR A;  1OHP A;  3EBT A;  1RGC A;  2P09 A;  3RGA A;  3SOY A;  1RNB A;  1RLS A;  2CIU A;  2W6J H;  4XBY A;  3PYJ A;  1BAN A;  2R41 A;  3ZG5 A;  4G1M B;  1OCV A;  4WP5 A;  4EYC A;  6STD A;  1RGE A;  3I0Y A;  8RNT A;  3Q2P A;  5KP1 A;  4XBX A;  1GOV A;  1IV9 A;  3ZFZ A;  1M1K 4;  3NV0 B;  1CQS A;  3X3Y A;  1KSI A;  1IK3 A;  1SIH A;  2F4Y A;  2PZV A;  2CC3 A;  2QIY A;  3CME 3;  2RGQ A;  1BOX A;  1JB2 A;  1QAK A;  2F99 A;  4WWU C;  1FUW A;  3NM7 A;  4LZI A;  3F40 A;  4J9A A;  2CWT A;  3EQQ B;  2B24 B;  1IVV A;  3HZP A;  3GZR A;  4N6T A;  2OTL 3;  4GL6 A;  5D82 A;  1BSB A;  1I3F A;  4N6V 0;  5ELJ A;  3OX9 A;  5FW5 A;  2HMK B;  3WOF B;  3MKI A;  4LGQ A;  1TUH A;  1GOU A;  2XH9 A;  4LEH A;  2XSO B;  3IPT A;  2OWP A;  3LT8 A;  1X1W A;  4FCJ A;  1T3B A;  3Q1C A;  5I97 A;  3N8B A;  2XEP A;  3E99 A;  3NBB A;  2V1L A;  1WMN A;  1QAF A;  1BRJ A;  5D83 A;  1W6C A;  3G6E 3;  1I2E A;  4XDV A;  1IVX A;  4TX4 A;  3D3L A;  3BU4 A;  3NUV A;  1CYV A;  2C11 A;  1OGX A;  2IUJ A;  3CD6 3;  1AVK A;  2F5M A;  1OF5 A;  1OAC A;  4BTX A;  4MJD A;  3FF0 A;  3CC4 3;  3F9S A;  4XBT A;  1SII A;  5AII A;  3CCR 3;  1GOY A;  4RBN A;  1GMQ A;  1K28 A;  4O3V A;  3KFQ C;  4IIA A;  2RFR A;  1GD3 A;  2CH9 A;  1MGR A;  1GMR A;  2Z77 A;  2AAD A;  3B4O A;  3CMA 3;  2A15 A;  2E2T A;  1LNH A;  2CG1 A;  2HMM B;  4GSP A;  3GZX B;  1KD1 4;  1TRQ A;  4FMC A;  1TP6 A;  3KE7 A;  2JQ5 A;  3LYG A;  3MHE A;  4CCV A;  2H0G A;  5CF1 A;  1OHS A;  2XSH B;  1UCL A;  2D42 A;  3KZT A;  4RNY A;  5M1A A;  1NB3 I;  1OUN A;  1RGF A;  1ZO2 A;  4R9K A;  4MMZ B;  3A76 A;  3HK4 A;  2WGO A;  5A0O B;  3CU3 A;  1QMA A;  1FZU A;  2ZA4 A;  1RKY A;  1RDS A;  1YJW 3;  3RGR A;  1VQO 3;  1LOX A;  2D1W A;  3WDG B;  1BUJ A;  2L1S A;  2LYX A;  4EXR A;  2GXF A;  3SYU A;  1ULJ B;  1V57 A;  1N8Q A;  3F7X A;  3JUQ A;  3DH2 A;  4XB5 A;  4QWT A;  1IT7 A;  3K9M C;  2Y73 A;  5M18 A;  5CXO A;  1NU3 A;  3LTB A;  4N6N B;  1W4N A;  1K73 4;  3WHO A;  2OCT A;  3LTC A;  3ECF A;  1JZD A;  1AVL A;  2UX0 A;  1A67 A;  1FUS A;  3X3X A;  1VQ5 3;  1WMP A;  5HOH A;  2O9U X;  5ELU A;  2L4V A;  1JN5 A;  1UUW B;  3QRD A;  1AQZ A;  1IV7 A;  4FMA A;  3TDG A;  3BIR A;  4DKI A;  2BU4 A;  4NRE A;  1E97 A;  1O7P B;  1BRG A;  3D4A A;  3ROB A;  3U97 A;  3IMA B;  1YGW A;  2E2U A;  3O8Y A;  4EV2 A;  4IPB A;  7STD A;  3BND A;  4HBR A;  3KKG A;  5IEN A;  1HKX A;  3OV4 A;  5IER A;  3I56 3;  1Z1S A;  3BNC A;  4JF8 A;  4RZM A;  2INX A;  4EC6 A;  1VQK 3;  1JZO A;  1IT8 A;  1LOV A;  2CK3 H;  2ML5 A;  3DGL A;  4HM2 B;  1VQL 3;  4N6L A;  5CK6 A;  3Q3F A;  3F7S A;  2BMO B;  1MOL A;  2KCD A;  1UUG B;  1BUQ A;  3GAX A;  1NO3 A;  2BMQ B;  3AHW A;  8CHO A;  5IG4 A;  1TRP A;  5EEO A;  1DET A;  4BU4 A;  3KII A;  5G1L A;  3FF2 A;  3FSD A;  4N6M A;  3K7C A;  3JVC A;  1FGM A;  3HOH A;  1WMO A;  1UDI I;  1U5O A;  3UNL A;  3SLU A;  1I2F A;  1B3S A;  2AAE A;  3FG1 A;  3Q90 A;  3LTA A;  5G1K A;  1O7W B;  3NQZ A;  3D5I A;  6RNT A;  5KP4 A;  2CKF B;  1OH0 A;  3CCS 3;  1ROA A;  2GU1 A;  3F14 A;  1Q40 B;  3F8X A;  3ER7 A;  4K1V A;  3MG3 A;  2HMO B;  3MG1 A;  2HMN B;  3EX9 A;  4HM0 B;  5IF6 A;  4EBG A;  1BVI A;  2CFW A;  1LOW A;  2BIR A;  3PZW A;  2F86 B;  2K0M A;  1RGG A;  2C4B A;  1BSC A;  1TIJ A;  2BO9 B;  2CWV A;  2KF4 A;  2P0X A;  3EHC A;  1B27 A;  3URP A;  2IYJ A;  4CJN A;  1D6U A;  4KT3 B;  3QK9 A;  4X2O A;  1M90 4;  4HAA A;  1GS3 A;  3X40 A;  2I9W A;  3U1W A;  5M19 A;  1OF5 B;  1UGI A;  2R4I A;  1GD4 A;  3EE1 A;  2KF3 A;  1FGO A;  1BNI A;  2CW9 A;  1FGT A;  2OQE C;  3LXU X;  3OWS A;  2XR8 B;  2OQE A;  4RNZ A;  1X1Y A;  3B8L A;  5GSP A;  4JRF A;  1X1X A;  1W6G A;  3CPW 2;  1JKG A;  4OVM A;  1QVF 2;  3X42 A;  1UCJ A;  3WMD A;  3MSO A;  4IT7 A;  1MGW A;  2GBX B;  5LC6 A;  1FUT A;  1Q82 4;  5EQL A;  1BNG A;  1IQY A;  1TFK A;  1Y4K A;  1UW1 A;  4U13 A;  3ZG0 A;  4NHF A;  2W2C A;  4HZ9 B;  3GSP A;  4HM5 B;  4BL3 A;  3UL6 A;  1MWR A;  1UI8 A;  1BRK A;  3FKA A;  1C54 A;  1Q7H A;  1I8V A;  5AEW B;  1DYU A;  4FMB A;  1D6Y A;  1RCK A;  1HZ1 A;  5CLK A;  3EF8 A;  1TJD A;  4J5K A;  3EBY A;  5AIF A;  3DM8 A;  5LC7 A;  3WR2 A;  3MPH A;  3D5G A;  2YFL B;  1YGE A;  1TU5 A;  1IQ8 A;  2YFJ B;  3UL5 A;  3G16 A;  3JUN A;  2Z76 A;  1L5G B;  4HJL B;  2XFT A;  4R80 A;  2XGN A;  3I55 3;  2YX9 A;  2QGU A;  2W56 B;  3LTD A;  3OW2 2;  3CXC 2;  1I3I A;  1I70 A;  1BSA A;  4X2H A;  2F5W A;  1GYB A;  1QAL A;  1B2M A;  3NBR A;  3NM2 A;  4HM8 B;  2BHM A;  2M7O A;  3RDE A;  4I5Q A;  3EB8 A;  4OK0 A;  4LMI A;  3EJV A;  5AIG A;  2O3O A;  2HMJ B;  2RSX A;  1RRH A;  3SX1 A;  3CCE 3;  3L0R A;  4WYK B;  1CH0 A;  1W7C A;  2P0M A;  3F8H A;  4HM3 B;  5HGR A;  4BIR A;  3NBJ A;  9RNT A;  3G4S 3;  1IVU A;  4L8O A;  1JN5 B;  4FR9 A;  5AYS C;  1BNJ A;  1G02 A;  2QA4 3;  2KF6 A;  1US1 A;  4J8T A;  6GSP A;  1O7N B;  1ZS7 A;  2J8X B;  1BSD A;  3K5T A;  4CDL A;  3HI7 A;  4L8P A;  1BNR A;  2Z7A A;  4GHO A;  4XM4 A;  2H0I A;  4EW5 A;  1YI2 3;  3SOA A;  3FLJ A;  3CCV 3;  2SBL A;  5BVB A;  3RNT A;  1IVW A;  2H0H A;  1KQS 2;  2CHC A;  1A90 A;  1IYY A;  2ZDJ A;  1VQP 3;  3KSE D;  1Q7Y 4;  1B2X A;  4BL2 A;  3S67 A;  2YFI B;  7RNT A;  1V58 A;  3CNX A;  1EG9 B;  1JRQ A;  5CF2 A;  1GY5 A;  1BNS A;  1PY3 A;  1M9G A;  4FCM A;  1LOY A;  3LOY A;  4WYK A;  2WOH A;  1MNL A;  3FGY A;  1GY7 A;  1JV2 B;  1RHL A;  2JDI H;  2PNC A;  3K63 A;  3LT9 A;  1RJO A;  3JUO A;  5G2G A;  3CPO A;  3CCJ 3;  2B1X B;  1UUV B;  1FGQ A;  3H3H A;  1RN1 A;  3V98 A;  4PEJ A;  1VQ7 3;  5JPP A;  3GZY B;  1NNV A;  3UJM A;  2XF3 A;  3X41 A;  1IU7 A;  1JB5 A;  3DGN A;  1BSE A;  2IA7 A;  3WA3 A;  2P05 A;  3CC2 3;  1WNH A;  1DVD A;  1JBR A;  2WGQ A;  1VQQ A;  1NDO B;  1YVS A;  1FW7 A;  1G0T A;  1NB5 I;  4HZB B;  1SPU A;  1R4Y A;  2K3D A;  1A2V A;  4ILF A;  1RGH A;  1W02 A;  3HIG A;  1ROV A;  4J5G A;  1HU9 A;  2SAR A;  3S5C A;  1FYS A;  3SED A;  4AKZ A;  2Q07 A;  1W2B 2;  1I2G A;  1N9J A;  4K1U A;  2KF5 A;  3FCS B;  1RGK A;  2WO0 A;  1SAR A;  3KN4 A;  1GY6 A;  3IJE B;  5RNT A;  1E3V A;  1STD A;  2CFG A;  2STD A;  1N5P A;  2BMR B;  7GSP A;  2E2V A;  3ALA A;  1I0V A;  1VQ4 3;  1V74 A;  2CFK A;  3VF1 A;  1PU4 A;  2GU3 A;  5KP3 A;  1YIJ 3;  1B20 A;  1EQK A;  3LML A;  1VQ6 3;  3UB1 A;  3FG3 A;  1F8N A;  1EEJ A;  4LYL B;  1K8A 4;  3G8Z A;  3VSY A;  1BNE A;  2W9P A;  4MMY B;  4BTW A;  5IG5 A;  1A2P A;  2GSP A;  3DUK A;  3PGB A;  5DRV A;  1BNF A;  1O7G B;  4AKY A;  2FXT A;  4K90 B;  5STD A;  3LH4 A;  2W03 A;  1PYL A;  1HYF A;  1YHQ 3;  1EKM A;  1RTU A;  3AMO A;  2P38 A;  3BNB A;  3BB9 A;  3MG2 A;  3PXM A;  1FA3 A;  1IDP A;  1X1U A;  2BT3 A;  1T2H A;  3G71 3;  2FNQ A;  4XDW A;  5IW9 A;  3A5E A;  1YVB I;  1B2Z A;  1BU4 A;  1SJW A;  3DY5 A;  1RGA A;  2MC8 A;  1ZX2 A;  4HM4 B;  5D81 A;  1JBT A;  3B7C A;  3T8N A;  2OOV C;  3DXO A;  4HM7 B;  4ZM8 A;  3N9H A;  2MF7 A;  2GBW B;  2ML6 A;  1BIR A;  1LXE A;  1WQL B;  1G96 A;  1U8C B;  2RNT A;  2W9Q A;  1W01 A;  4N6U A;  1Q81 4;  1JJ2 2;  1DMM A;  3GWR A;  1AY7 A;  1RGL A;  2CX1 A;  2GEX A;  4ORL A;  5BXQ A;  5TGN A;  1A2K A;  2F98 A;  4L7K A;  3CCQ 3;  4WHA A;  1MWS A;  1OGZ A;  4Q53 A;  1LQG C;  1B2S A;  1R4C A;  2C10 A;  3AGN A;  3N54 B;  3OXA A;  5AIH A;  1O7H B;  2CFL A;  2XGL A;  2OOV A;  3NX0 A;  3STD A;  3SVA A;  1KC8 4;  1T5Y A;  2IMJ A;  3CNM A;  4H3U A;  1BRN L;  2RCD A;  4O8S A;  4FMD A;  5AEU B;  1QJG A;  4K61 A;  1SQW A;  3D79 A;  3EN1 B;  4GB5 A;  2UGI A;  2CFD A;  1LQM B; 
#chains in the Genus database with same CATH homology
 1QVG 2;  1ASK A;  3V92 A;  4O2H A;  4R9L A;  4KZ1 A;  4KFE A;  2ZL8 A;  1YIT 3;  3GRD A;  1W2Z A;  3M8C A;  1PFP A;  1D6Z A;  3DMC A;  4HM1 B;  1DVC A;  3OWU A;  3NV0 A;  1DMN A;  1OHO A;  1UI7 A;  2Y74 A;  1K41 A;  3G0K A;  4AEQ A;  1J2B A;  1NJI 4;  2Z6B A;  5JPU A;  5AI1 A;  3NQY A;  4STD A;  1M1X B;  2HML B;  1KWI A;  1VQN 3;  3OWY A;  3VGN A;  4MEI A;  3J7Y d;  3S27 A;  3BLZ A;  3CCU 3;  2K54 A;  4MMX B;  1RN7 A;  2WOF A;  4R1K A;  1YJ9 3;  2W56 A;  1Q86 4;  1W00 A;  3H51 A;  1VQM 3;  4N3V A;  3S29 A;  3PS8 A;  5IEO A;  1VQ9 3;  1JB4 A;  1K9M 4;  4HM6 B;  1ULI B;  3FH1 A;  3S28 A;  2BNG A;  1N5H A;  2IUK A;  1S5A A;  3NHX A;  1YJN 3;  1WTH A;  3DZL A;  4EV5 A;  3V99 A;  2W0Q A;  1CEW I;  1NWW A;  3PCS A;  1S72 3;  2CG0 A;  3DGM A;  4HYZ A;  2XFS A;  3HII A;  3X3Z A;  5FGO A;  1STF I;  4KFF A;  1ISK A;  4WFO A;  2GEY A;  1CYU A;  1JNQ A;  1Q40 A;  3WOE B;  3SXX A;  3D9R A;  1VZZ A;  1RRL A;  3LZA A;  5AYR B;  3B4P A;  3EN8 A;  5JBS A;  3MWZ A;  1N9E A;  5DRE A;  1Q42 A;  3DGO A;  1EA2 A;  2FGT A;  3KSP A;  4KVH A;  3K0Z A;  3AMO B;  3T8U A;  3BNE A;  1W6Y A;  2CWU A;  4O02 B;  1DMQ A;  5IG0 A;  3T0U A;  3FZW A;  3WOD G;  3CCL 3;  2LQV A;  1AR0 A;  3CC7 3;  2W04 A;  4HVN A;  5EVH A;  3GZB A;  1TFO A;  1JKG B;  4OUQ A;  1C7H A;  2XRX B;  4I4K A;  2KXG A;  1E3R A;  3PCR A;  1LVN A;  5IEP A;  1AV4 A;  1O7M B;  3NXJ A;  4HKV B;  3WA2 X;  3JUP A;  2QEX 3;  3FG4 A;  1OPY A;  4LSO A;  3MYT A;  4FCZ A;  2OTJ 3;  4BTY A;  3EC9 A;  1VQ8 3;  4KFD A;  1W5Z A;  5IG3 A;  3JUM A;  4R4K A;  2KRT A;  1N8R 4;  4N6O B;  4H61 A;  3HX8 A;  3CCM 3;  1IQX A;  1FGR A;  1OHP A;  3EBT A;  2P09 A;  3RGA A;  3SOY A;  2CIU A;  2W6J H;  4XBY A;  3PYJ A;  4G1M B;  1OCV A;  4WP5 A;  4EYC A;  6STD A;  3I0Y A;  5KP1 A;  3Q2P A;  4XBX A;  1IV9 A;  1M1K 4;  3NV0 B;  1CQS A;  3X3Y A;  1KSI A;  1IK3 A;  1SIH A;  2PZV A;  2CC3 A;  2QIY A;  3CME 3;  2RGQ A;  1JB2 A;  1QAK A;  2F99 A;  4WWU C;  1FUW A;  3NM7 A;  4LZI A;  3F40 A;  4J9A A;  2CWT A;  3EQQ B;  2B24 B;  1IVV A;  3HZP A;  3GZR A;  4N6T A;  2OTL 3;  4GL6 A;  5D82 A;  5ELJ A;  4N6V 0;  3OX9 A;  5FW5 A;  2HMK B;  3WOF B;  3MKI A;  4LGQ A;  1TUH A;  2XH9 A;  4LEH A;  2XSO B;  3IPT A;  2OWP A;  3LT8 A;  4FCJ A;  3Q1C A;  5I97 A;  3N8B A;  2XEP A;  3E99 A;  3NBB A;  2V1L A;  1WMN A;  1QAF A;  5D83 A;  1W6C A;  3G6E 3;  4XDV A;  1IVX A;  4TX4 A;  3D3L A;  3NUV A;  1CYV A;  2C11 A;  1OGX A;  2IUJ A;  3CD6 3;  1AVK A;  1OF5 A;  1OAC A;  4BTX A;  4MJD A;  3FF0 A;  3CC4 3;  3F9S A;  4XBT A;  1SII A;  5AII A;  3CCR 3;  4RBN A;  1K28 A;  4O3V A;  3KFQ C;  4IIA A;  2RFR A;  1GD3 A;  2CH9 A;  2Z77 A;  3CMA 3;  3B4O A;  2A15 A;  2E2T A;  1LNH A;  2CG1 A;  2HMM B;  3GZX B;  1KD1 4;  4FMC A;  1TP6 A;  3KE7 A;  2JQ5 A;  3LYG A;  3MHE A;  4CCV A;  5CF1 A;  1OHS A;  2XSH B;  2D42 A;  3KZT A;  4RNY A;  1NB3 I;  1OUN A;  1ZO2 A;  4R9K A;  4MMZ B;  3A76 A;  3HK4 A;  2WGO A;  5A0O B;  3CU3 A;  1QMA A;  1RKY A;  1YJW 3;  3RGR A;  1VQO 3;  1LOX A;  2D1W A;  3WDG B;  2LYX A;  4EXR A;  2GXF A;  1ULJ B;  1N8Q A;  3F7X A;  3JUQ A;  4XB5 A;  4QWT A;  1IT7 A;  3K9M C;  2Y73 A;  1K73 4;  5CXO A;  1NU3 A;  3LTB A;  4N6N B;  1W4N A;  2OCT A;  3LTC A;  3ECF A;  1AVL A;  2UX0 A;  1A67 A;  3X3X A;  1VQ5 3;  1WMP A;  2O9U X;  5ELU A;  2L4V A;  1JN5 A;  1UUW B;  3QRD A;  1IV7 A;  4FMA A;  3TDG A;  4NRE A;  1E97 A;  1O7P B;  3ROB A;  3U97 A;  3IMA B;  2E2U A;  3O8Y A;  4EV2 A;  4IPB A;  7STD A;  3BND A;  4HBR A;  3KKG A;  5IEN A;  1HKX A;  3OV4 A;  5IER A;  3I56 3;  1Z1S A;  3BNC A;  4JF8 A;  4RZM A;  2INX A;  4EC6 A;  1VQK 3;  1IT8 A;  2CK3 H;  2ML5 A;  3DGL A;  4HM2 B;  1VQL 3;  4N6L A;  5CK6 A;  3F7S A;  2BMO B;  1MOL A;  2KCD A;  1BUQ A;  3GAX A;  1NO3 A;  2BMQ B;  8CHO A;  5IG4 A;  5EEO A;  3KII A;  3FF2 A;  3FSD A;  4N6M A;  3K7C A;  3JVC A;  1FGM A;  1WMO A;  1U5O A;  3UNL A;  3SLU A;  3FG1 A;  3Q90 A;  3LTA A;  1O7W B;  3NQZ A;  5KP4 A;  2CKF B;  1OH0 A;  3CCS 3;  1ROA A;  2GU1 A;  3F14 A;  1Q40 B;  3F8X A;  3ER7 A;  4K1V A;  3MG3 A;  2HMO B;  3MG1 A;  2HMN B;  3EX9 A;  4HM0 B;  5IF6 A;  4EBG A;  2CFW A;  3PZW A;  2F86 B;  2K0M A;  1TIJ A;  2BO9 B;  2CWV A;  2P0X A;  3EHC A;  1D6U A;  3QK9 A;  4X2O A;  1M90 4;  1GS3 A;  3X40 A;  2I9W A;  3U1W A;  1OF5 B;  2R4I A;  1GD4 A;  3EE1 A;  1FGO A;  2OQE C;  2CW9 A;  1FGT A;  3LXU X;  3OWS A;  2XR8 B;  2OQE A;  4RNZ A;  3B8L A;  4JRF A;  1W6G A;  3CPW 2;  1JKG A;  4OVM A;  1QVF 2;  3X42 A;  3WMD A;  3MSO A;  4IT7 A;  2GBX B;  5LC6 A;  1Q82 4;  5EQL A;  1IQY A;  1TFK A;  1Y4K A;  1UW1 A;  4U13 A;  4NHF A;  2W2C A;  4HZ9 B;  4HM5 B;  3UL6 A;  3FKA A;  1UI8 A;  5AEW B;  1DYU A;  4FMB A;  1D6Y A;  5CLK A;  3EF8 A;  3EBY A;  5AIF A;  3DM8 A;  5LC7 A;  3MPH A;  2YFL B;  1YGE A;  1TU5 A;  1IQ8 A;  2YFJ B;  3UL5 A;  3G16 A;  3JUN A;  2Z76 A;  1L5G B;  4HJL B;  2XFT A;  4R80 A;  2XGN A;  3I55 3;  2YX9 A;  2QGU A;  2W56 B;  3LTD A;  3OW2 2;  3CXC 2;  4X2H A;  1GYB A;  1QAL A;  3NBR A;  3NM2 A;  4HM8 B;  2BHM A;  2M7O A;  3RDE A;  3EB8 A;  4OK0 A;  4LMI A;  3EJV A;  5AIG A;  2O3O A;  2HMJ B;  2RSX A;  1RRH A;  3SX1 A;  3CCE 3;  3L0R A;  4WYK B;  1W7C A;  2P0M A;  3F8H A;  4HM3 B;  5HGR A;  3G4S 3;  3NBJ A;  1IVU A;  4L8O A;  1JN5 B;  4FR9 A;  5AYS C;  2QA4 3;  1US1 A;  4J8T A;  1O7N B;  3K5T A;  4CDL A;  3HI7 A;  4L8P A;  2Z7A A;  4XM4 A;  1YI2 3;  3SOA A;  3FLJ A;  3CCV 3;  2SBL A;  5BVB A;  1IVW A;  1KQS 2;  2CHC A;  1A90 A;  2ZDJ A;  1VQP 3;  3KSE D;  1Q7Y 4;  3S67 A;  2YFI B;  3CNX A;  1EG9 B;  1JRQ A;  5CF2 A;  1GY5 A;  1M9G A;  4FCM A;  3LOY A;  4WYK A;  2WOH A;  1MNL A;  3FGY A;  1GY7 A;  1JV2 B;  2JDI H;  3K63 A;  2PNC A;  3LT9 A;  1RJO A;  3JUO A;  5G2G A;  3CPO A;  3CCJ 3;  2B1X B;  1UUV B;  1FGQ A;  3H3H A;  3V98 A;  4PEJ A;  1VQ7 3;  5JPP A;  3GZY B;  3UJM A;  2XF3 A;  3X41 A;  1IU7 A;  1JB5 A;  3DGN A;  3CC2 3;  2IA7 A;  3WA3 A;  2P05 A;  1DVD A;  1WNH A;  2WGQ A;  1NDO B;  1NB5 I;  4HZB B;  1SPU A;  1A2V A;  1W02 A;  3HIG A;  1ROV A;  3SED A;  1HU9 A;  4AKZ A;  3S5C A;  2Q07 A;  1W2B 2;  1N9J A;  4K1U A;  3FCS B;  2WO0 A;  3KN4 A;  1GY6 A;  3IJE B;  1E3V A;  1STD A;  2CFG A;  2STD A;  1N5P A;  2BMR B;  2E2V A;  3ALA A;  1VQ4 3;  1V74 A;  2CFK A;  3VF1 A;  1PU4 A;  2GU3 A;  5KP3 A;  1YIJ 3;  1EQK A;  3LML A;  1VQ6 3;  3UB1 A;  3FG3 A;  1F8N A;  1K8A 4;  3G8Z A;  3VSY A;  2W9P A;  4MMY B;  4BTW A;  5IG5 A;  3DUK A;  3PGB A;  5DRV A;  1O7G B;  4AKY A;  2FXT A;  4K90 B;  5STD A;  3LH4 A;  2W03 A;  1YHQ 3;  1EKM A;  3AMO A;  3BNB A;  2P38 A;  3MG2 A;  3BB9 A;  3PXM A;  1FA3 A;  1IDP A;  2BT3 A;  3G71 3;  2FNQ A;  4XDW A;  5IW9 A;  1YVB I;  1SJW A;  3DY5 A;  2MC8 A;  1ZX2 A;  4HM4 B;  5D81 A;  3B7C A;  3T8N A;  2OOV C;  3DXO A;  4HM7 B;  4ZM8 A;  3N9H A;  2MF7 A;  2GBW B;  2ML6 A;  2W9Q A;  1LXE A;  1WQL B;  1G96 A;  1U8C B;  4N6U A;  1Q81 4;  1W01 A;  1JJ2 2;  1DMM A;  3GWR A;  2GEX A;  4ORL A;  5BXQ A;  5TGN A;  1A2K A;  2F98 A;  4L7K A;  3CCQ 3;  4WHA A;  1OGZ A;  4Q53 A;  5AIH A;  1R4C A;  2C10 A;  3N54 B;  3OXA A;  3STD A;  1O7H B;  2CFL A;  2XGL A;  2OOV A;  3NX0 A;  3SVA A;  1KC8 4;  1T5Y A;  2IMJ A;  3CNM A;  4H3U A;  2RCD A;  4O8S A;  4FMD A;  5AEU B;  1QJG A;  4K61 A;  1SQW A;  3EN1 B;  4GB5 A;  2CFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...