5FGOA

Crystal structure of d. melanogaster pur-alpha repeat iii.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
PEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCEKMKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of nucleic-acid recognition and double-strand unwinding by the essential neuronal protein Pur-alpha.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords CG1507-PB, isoform B
total genus 13
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.700 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5fgoA00
3NM7A 3N8BA 5FGOA
chains in the Genus database with same CATH superfamily
4FCJA 3CCU3 1D6ZA 3FKAA 4N6UA 4BIRA 1BNEA 5AEUB 2RCDA 5IF6A 5JBSA 5G1LA 2KXGA 3OXAA 4GL6A 2P0MA 3BLZA 3CC23 1ZS7A 5STDA 2YFJB 2FXTA 3PGBA 1B20A 1OF5B 1EG9B 2ZA4A 1RHLA 3WR2A 3RGAA 1O7GB 1CEWI 3VGNA 3CCJ3 5M1AA 2RGQA 1CQSA 2QGUA 1IT8A 1DYUA 1DETA 1LXEA 3ZFZA 4U13A 1BNJA 1S723 1VQ63 1I3FA 1U5OA 4L8PA 4R4KA 1OPYA 2W56A 5AYSC 1BSCA 5A0OB 2O9UX 3DGLA 3Q3FA 5IERA 3CD63 4EW5A 2ZDJA 4N3VA 3ALAA 1GY6A 1A90A 5FW5A 1IK3A 1KQS2 1UUVB 3JUNA 1O7PB 4EBGA 3EJVA 1LQGC 4GSPA 2CWTA 4MJDA 1C7HA 1I0XA 3Q90A 3CCM3 1N8QA 2F4YA 1W00A 4N6MA 1PYLA 1QALA 4STDA 3WOFB 1O7MB 3KZTA 2JQ5A 3AGOA 3UNLA 3U1WA 1BNSA 2HMNB 4WWUC 1WQLB 3NM2A 5IG0A 4KFDA 4MMXB 3B4PA 4HVNA 2QIYA 2YX9A 4KZ1A 1VQQA 5IW9A 1VQK3 1OGZA 1Q42A 2WOHA 4CDLA 5JPPA 5CXOA 5RNTA 1RRLA 1QVG2 3E99A 1E3VA 2KF3A 3I553 1RLSA 3M8CA 3S27A 5EQLA 5CF1A 1IVVA 2AADA 1YVBI 4RNYA 3EC9A 1DMMA 3NUVA 3D3LA 3X41A 4H3UA 1LOYA 1W02A 1BRGA 2J8XB 4HKVB 2Z77A 1IVWA 1UI7A 4O2HA 1I8VA 2K54A 4XBYA 3TDGA 3WOEB 1WMNA 1X1UA 2CFKA 1ROVA 5G1KA 1EQKA 5BXQA 2XRXB 5I97A 1WMOA 2W56B 2BMQB 2BMRB 3B7CA 3N54B 1O7HB 3S67A 1BRIA 1LOWA 2MC8A 3L0RA 2KCDA 3FSDA 1TTOA 1Q7HA 1RGKA 2CW9A 2CHCA 1BSEA 2IYJA 3LTAA 3NX0A 4HZBB 4OUQA 5AIGA 3CC73 3K7CA 3RNTA 2CX0A 1JB4A 1GOYA 1G0TA 3G8ZA 5AIIA 5DREA 1WMPA 1TRPA 4H61A 1JB5A 2SARA 3T0UA 2XFSA 3OWSA 3FG3A 4BTYA 1U8CB 3GAXA 1N5HA 1UUWB 1GMRA 2XSOB 4IPBA 1BUQA 1SJWA 4I5QA 3NQYA 1OHSA 1Q40B 1W01A 3EHCA 1X1XA 3EQQB 1G02A 3A76A 3EE1A 3WA2X 2P09A 1ULJB 1BSBA 4K1UA 4L7KA 3D4AA 3G4S3 1VQ83 3NBRA 2B1XB 3KE7A 2CKFB 3LT9A 1FUSA 2P38A 3DGNA 3GZYB 1QMAA 1TRQA 1MWSA 1FGQA 1CH0A 1BSAA 4R80A 3HX8A 1JNQA 5TGNA 1O7NB 3DXOA 5D82A 1RGHA 3O8YA 3MG3A 3AHSA 2Z6BA 5EEOA 1N8R4 1ISKA 4NHFA 4RZMA 4HJLB 1T2IA 1CYVA 2K0MA 2JDIH 1VQ73 1R4YA 2CH9A 4HM3B 3BU4A 4RNTA 2XH9A 4N6V0 3GRDA 1BSDA 1K41A 1B2UA 3MG2A 1BIRA 1GD3A 3WDGB 3K5TA 5G2GA 1OGXA 1RCKA 3WMDA 3HK4A 4HM7B 1IU7A 4HYZA 4FMBA 1W6YA 1FGRA 3K63A 1VQL3 3G6E3 1LVNA 2STDA 4ORLA 3IJEB 3CCS3 1NWWA 4OVMA 1RJOA 1V58A 1BGSA 1BU4A 5CF2A 1ZGXA 5ELJA 1B27A 1BRHA 2GEXA 2BO9B 3QK9A 1WTHA 2CWVA 1UUGB 5DRVA 3ZG0A 1PY3A 4FR9A 4HM6B 5AI1A 3AGNA 1JJ22 3V92A 3EB8A 3FH1A 4WHAA 3WODG 4LGQA 2KF4A 3DM8A 4XBTA 5LC7A 3J7Yd 3X3YA 1A2VA 3T8UA 1JN5A 4HM8B 3B8LA 4J8TA 7RNTA 2FNQA 2HMJB 2RNTA 1I0VA 1QVF2 3ROBA 2OWPA 1AV4A 9RNTA 1PFPA 1TUHA 3HOHA 2C11A 2BT3A 1OF5A 2W04A 3F8XA 1O7WB 2FGTA 1M1XB 2E2UA 2INXA 2Y73A 4CPKA 1N9JA 1OHPA 3B4OA 4CJNA 1UGIA 1UI8A 3G16A 3N9HA 3SLUA 2KF6A 2ZL8A 3N8BA 6RNTA 1I2FA 2AAEA 1IQ8A 5HGRA 2OTJ3 1K9M4 2W9QA 3SEDA 2F99A 1ZX2A 3PCRA 5M19A 3PCSA 4G1MB 1LQMB 3GZXB 3DY5A 1VQM3 2OOVC 2Q07A 4HZ9B 2LYXA 3KFQC 4MMYB 5BU4A 1VQP3 3X40A 5ELUA 3BB9A 2IMJA 3DGYA 1I2EA 1STDA 2RFRA 2M7OA 2XGNA 7STDA 1HU9A 1BRJA 3IPTA 1FZUA 3V99A 2R41A 1IV7A 2WGOA 3I0YA 5HOHA 1BNRA 1DE3A 1EKMA 1IV9A 1V74A 1IQXA 1BNIA 4IT7A 5CLKA 1Q9EA 2Y74A 3KIIA 8CHOA 1T2HA 2CFDA 2C4BA 4K90B 4OK0A 1X1WA 3SOYA 4HM2B 4EV2A 1E3RA 1ASKA 1UGHI 1I2GA 3AMOB 1C54A 1NDOB 2WO0A 3NHXA 4LZIA 4O3VA 2H0HA 3GSPA 1NU3A 3GZRA 4X2OA 1Q864 2IA7A 4Q53A 2E2VA 4WFOA 2CWUA 3KCHA 1VQ43 3MKIA 3CPOA 1J2BA 2HMLB 2XGLA 3Q1CA 5KP3A 4XDWA 4WP5A 2CFGA 3STDA 1IVXA 3KKGA 1GMPA 3F7SA 1VQN3 4XBXA 2Z76A 4KFFA 1OUNA 1BANA 1PU4A 1GY7A 1HKXA 3PYJA 1LOVA 4JRFA 5GSPA 1KD14 4LSOA 3DZLA 4I4KA 3SYUA 4J5GA 4WYKA 2OTL3 2OCTA 3EN8A 1MGWA 1YI23 1DVDA 4EV5A 3LH4A 2K3DA 4GHOA 1YIJ3 3LTBA 1V57A 1CYUA 3K0ZA 1I3IA 1B3SA 1LOXA 5IEPA 2W2CA 1Q814 2OOVA 1NNVA 2GBWB 3PS8A 3LT8A 5BIRA 3EF8A 3G713 4WYKB 1RGFA 3FG4A 3DGMA 1FYSA 5AIHA 1AVLA 3FGYA 1E97A 1KC84 1A67A 4LMIA 2H0IA 3LTDA 2LQVA 3U97A 2GU3A 7GSPA 3EBTA 1TFOA 1KWIA 2GU1A 2HOHA 2IUKA 3KSED 1RRHA 2XF3A 1N5PA 3MWZA 1NJI4 3BNEA 2OQEA 1K8A4 2UX0A 2WGQA 1W7CA 3PZWA 2GSPA 1UCJA 1B2MA 1RNTA 1BNFA 3CCV3 2CK3H 2IUJA 3SX1A 4HM1B 1Q40A 2GEYA 2R4IA 1B2XA 3CME3 4XDVA 2B24B 1JBRA 1FW7A 4FMCA 3G0KA 3LYGA 1OACA 2CIUA 1GMQA 1ROAA 1HZ1A 3FCSB 3OWYA 1M904 1RGCA 4HOHA 1VQ53 3CXC2 3S5CA 3AHWA 1NB3I 3HZPA 1Y4KA 3RGRA 3ER7A 1TIJA 1QJGA 3SVAA 2H0GA 1YVSA 2I9WA 2XFTA 1BAOA 4R9KA 2QA43 3BNBA 3F14A 1EEJA 3PXMA 3FF2A 1BRKA 3JUPA 4MEIA 2P0XA 3EN1B 1MWTA 3Q2PA 3MPHA 4MMZB 1Q7Y4 1GOVA 1STFI 1YIT3 1IYYA 1RN1A 4L8OA 1DMQA 3CCQ3 1W4NA 4NREA 4XB5A 1OH0A 4EC6A 3MG1A 1YJ93 4N6LA 4BL3A 1W6GA 3X42A 1FGOA 1A2PA 3MHEA 4BU4A 1G96A 1TFKA 2F86B 5AYRB 4N6TA 1W2B2 3T8NA 2F98A 3NBJA 1RGEA 5M18A 3CNMA 1JBSA 3D5IA 3MYTA 3ZG5A 2CX1A 3I563 1YGWA 2YFLB 1RKYA 2GXFA 3BNCA 3OWUA 4XM4A 1FUTA 2L1SA 4O02B 1SQWA 2SBLA 4EXRA 4DKIA 4KT3B 1B21A 3UL5A 2KF5A 4ILFA 1M1K4 2BMOB 4HM5B 1SPUA 3HIIA 3MSOA 4LYLB 1RGLA 1D6UA 3UB1A 1K734 3LOYA 4N6NB 5AIFA 3URPA 1RCLA 1YNVX 1BUJA 3HIGA 3LMLA 3EX9A 1FA3A 2CC3A 3KN4A 5KP4A 3OX9A 2W03A 4HBRA 2F56A 3VF1A 3FG1A 4J5KA 3X3ZA 2PNCA 1MGRA 1JZOA 1RGAA 2W0QA 1LRAA 2KAAA 5LC6A 1IQYA 5IG5A 1GY5A 3FZWA 3CPW2 3X3XA 3DUKA 5IG4A 2ZHXB 1JN5B 1FUWA 3UL6A 4KVHA 3CCR3 4FMAA 1B2SA 3DGOA 1N9EA 2OQEC 3D5GA 3H51A 1UDII 1Z1SA 2ML5A 3F7XA 4FCMA 3A5EA 3FF0A 4KFEA 3K9MC 1K28A 2BU4A 3LZAA 3BIRA 5IEOA 5D83A 1HYFA 1MOLA 1JRQA 1GYBA 1T3BA 2L4VA 1RTUA 1TP6A 1GD4A 1UW1A 2D1WA 2HMOB 2UUGC 2BHMA 1NO3A 3GWRA 4NPBA 1JBTA 1IDPA 1SIHA 3WA3A 1AVKA 2D42A 1LNIA 1VQ93 3F9SA 6GSPA 1IVUA 1UCIA 2A15A 5AEWB 4FCZA 4AKZA 6STDA 4R1KA 1QAFA 5BVBA 1F8NA 1GS3A 3JUOA 2F5WA 2RBIA 1SIIA 2MF7A 1JZDA 3ECFA 2QEX3 3AMOA 1MWRA 4N6OB 3V98A 1GSPA 4BTXA 3NM7A 1VQO3 3QRDA 1RNBA 3DMCA 1RN4A 3BNDA 1LNHA 2P05A 2O3OA 1OHOA 3WHOA 5JPUA 1D6YA 1US1A 4CCVA 1ZO2A 4K61A 1AQZA 1BRSA 1QAKA 4R9LA 1DMNA 2CFWA 3NQZA 1FGMA 3SOAA 3F8HA 1T5YA 1A2KA 2F5MA 1L5GB 3JUQA 4BTWA 1TU5A 4FMDA 2UGIA 2BIRA 1DVCA 3HI7A 4HM4B 3CCE3 1UCKA 1M9GA 1R4CA 1EA2A 1KSIA 1YGEA 2XEPA 4AKYA 5FGOA 4BL2A 2WOFA 4HAAA 1B2ZA 3D79A 1MNLA 3CMA3 4HM0B 3LTCA 3S28A 4AEQA 1VZZA 3KSPA 4QWTA 4IIAA 3D9RA 3H3HA 1EUIC 1BRNL 3OV4A 2PZVA 3CU3A 4O8SA 3GZBA 1S5AA 3JUMA 2CG1A 3VSYA 2Z7AA 1YJW3 1RGGA 5D81A 4K1VA 4EYCA 3CCL3 3F40A 2W6JH 1RDSA 1OCVA 1YHQ3 4JF8A 4J9AA 4RBNA 1JV2B 5KP1A 4ZM8A 1TJDA 3NV0B 4PEJA 4RNZA 3CC43 2W9PA 5EVHA 2ML6A 1YJN3 1RN7A 2XR8B 2RSXA 2HMMB 2IY2A 1W2ZA 1RSNA 1JKGB 1RMSA 2CFLA 5IG3A 8RNTA 1I70A 1WNHA 3SXXA 1MWUA 1ULIB 1NB5I 1IT7A 1SARA 1X1YA 2E2TA 4LEHA 3EBYA 1AR0A 2C10A 4X2HA 3RDEA 1BNGA 2KRTA 2YFIB 4TX4A 3S29A 3FLJA 1BVIA 1JB2A 2BNGA 3CNXA 1GOUA 1UCLA 4GB5A 1JKGA 3UJMA 3IMAB 5IENA 1AY7A 3DH2A 1FGTA 2GBXB 1W6CA 1Q824 3NBBA 2V1LA 1W5ZA 2XSHB 2CG0A 3JVCA 3NXJA 3LXUX 3NV0A 3OW22 1BOXA 5CK6A 2HMKB
chains in the Genus database with same CATH topology
4FCJA 3CCU3 1D6ZA 3FKAA 4N6UA 5AEUB 2RCDA 5IF6A 5JBSA 2KXGA 3OXAA 4GL6A 2P0MA 3BLZA 3CC23 5STDA 2YFJB 2FXTA 3PGBA 1OF5B 1EG9B 3RGAA 1O7GB 1CEWI 3VGNA 3CCJ3 2RGQA 1CQSA 2QGUA 1IT8A 1DYUA 1LXEA 4U13A 1VQ63 1S723 1U5OA 4L8PA 4R4KA 1OPYA 2W56A 5AYSC 5A0OB 2O9UX 3DGLA 5IERA 3CD63 2ZDJA 4N3VA 3ALAA 1GY6A 1A90A 5FW5A 1IK3A 1KQS2 1UUVB 3JUNA 1O7PB 4EBGA 3EJVA 2CWTA 4MJDA 1C7HA 3Q90A 3CCM3 1N8QA 4N6MA 1W00A 4STDA 1QALA 3WOFB 1O7MB 3KZTA 2JQ5A 3UNLA 3U1WA 2HMNB 4WWUC 1WQLB 3NM2A 5IG0A 4KFDA 4MMXB 3B4PA 4HVNA 2QIYA 2YX9A 4KZ1A 5IW9A 1VQK3 1OGZA 1Q42A 2WOHA 4CDLA 5JPPA 5CXOA 1RRLA 1QVG2 3E99A 1E3VA 3I553 3M8CA 3S27A 5EQLA 5CF1A 1IVVA 1YVBI 4RNYA 3EC9A 1DMMA 3NUVA 3D3LA 3X41A 4H3UA 1W02A 4HKVB 2Z77A 1IVWA 1UI7A 4O2HA 4XBYA 2K54A 3TDGA 3WOEB 1WMNA 2CFKA 1ROVA 1EQKA 5BXQA 2XRXB 5I97A 1WMOA 2W56B 2BMQB 2BMRB 3B7CA 3N54B 1O7HB 3S67A 2MC8A 3L0RA 2KCDA 3FSDA 2CHCA 2CW9A 3LTAA 4HZBB 3NX0A 5AIGA 3CC73 4OUQA 3K7CA 1JB4A 3G8ZA 5AIIA 5DREA 1WMPA 4H61A 1JB5A 3T0UA 2XFSA 3OWSA 3FG3A 4BTYA 1U8CB 3GAXA 1N5HA 1UUWB 2XSOB 4IPBA 1BUQA 1SJWA 3NQYA 3EHCA 1OHSA 1Q40B 1W01A 3EQQB 3A76A 3EE1A 3WA2X 2P09A 1ULJB 4K1UA 4L7KA 3G4S3 1VQ83 3NBRA 2B1XB 3KE7A 2CKFB 3LT9A 2P38A 3DGNA 3GZYB 1QMAA 1FGQA 4R80A 3HX8A 1JNQA 5TGNA 1O7NB 3DXOA 5D82A 3O8YA 3MG3A 1N8R4 2Z6BA 5EEOA 1ISKA 4NHFA 4RZMA 4HJLB 1CYVA 2K0MA 2JDIH 1VQ73 2CH9A 4HM3B 2XH9A 4N6V0 3GRDA 1K41A 3MG2A 1GD3A 3WDGB 3K5TA 5G2GA 1OGXA 3WMDA 3HK4A 4HM7B 1IU7A 4HYZA 4FMBA 1W6YA 1FGRA 3K63A 1VQL3 3G6E3 1LVNA 2STDA 4ORLA 3IJEB 3CCS3 1NWWA 4OVMA 1RJOA 5CF2A 5ELJA 2GEXA 2BO9B 3QK9A 1WTHA 2CWVA 5DRVA 4FR9A 4HM6B 5AI1A 1JJ22 3V92A 3EB8A 3FH1A 4WHAA 3WODG 4LGQA 5LC7A 3DM8A 4XBTA 3J7Yd 3X3YA 1A2VA 3T8UA 1JN5A 4HM8B 3B8LA 4J8TA 2FNQA 2HMJB 1QVF2 3ROBA 2OWPA 1AV4A 1PFPA 1TUHA 2C11A 2BT3A 1OF5A 2W04A 3F8XA 1O7WB 2FGTA 1M1XB 2E2UA 2INXA 2Y73A 1N9JA 1OHPA 3B4OA 1UI8A 3G16A 3N9HA 3SLUA 2ZL8A 3N8BA 1IQ8A 5HGRA 2OTJ3 1K9M4 2W9QA 3SEDA 2F99A 1ZX2A 3PCRA 3PCSA 4G1MB 3GZXB 3DY5A 1VQM3 2OOVC 2Q07A 4HZ9B 2LYXA 3KFQC 4MMYB 1VQP3 3X40A 5ELUA 3BB9A 2IMJA 1STDA 2RFRA 2M7OA 2XGNA 7STDA 1HU9A 3IPTA 3V99A 2WGOA 1IV7A 3I0YA 1EKMA 1IV9A 1IQXA 1V74A 4IT7A 5CLKA 2Y74A 3KIIA 8CHOA 2CFDA 4K90B 4OK0A 3SOYA 4HM2B 4EV2A 1E3RA 1ASKA 3AMOB 1NDOB 2WO0A 3NHXA 4LZIA 4O3VA 1NU3A 3GZRA 4X2OA 1Q864 2IA7A 4Q53A 2E2VA 4WFOA 2CWUA 1J2BA 1VQ43 3MKIA 3CPOA 2HMLB 2XGLA 3Q1CA 5KP3A 4XDWA 4WP5A 2CFGA 3STDA 1IVXA 3KKGA 3F7SA 1VQN3 4XBXA 2Z76A 4KFFA 1OUNA 1PU4A 1GY7A 1HKXA 3PYJA 4JRFA 1KD14 4LSOA 3DZLA 4I4KA 4WYKA 2OTL3 2OCTA 3EN8A 1DVDA 1YI23 4EV5A 3LH4A 1YIJ3 3LTBA 1CYUA 3K0ZA 1LOXA 5IEPA 2W2CA 1Q814 2OOVA 2GBWB 3PS8A 3LT8A 3EF8A 3G713 4WYKB 3FG4A 3DGMA 5AIHA 1AVLA 3FGYA 1E97A 1KC84 1A67A 4LMIA 3LTDA 3U97A 2LQVA 2GU3A 3EBTA 1TFOA 1KWIA 2GU1A 2IUKA 3KSED 1RRHA 2XF3A 1N5PA 3MWZA 1NJI4 3BNEA 2OQEA 1K8A4 2UX0A 2WGQA 1W7CA 3PZWA 3CCV3 2CK3H 2IUJA 3SX1A 4HM1B 1Q40A 2GEYA 2R4IA 3CME3 4XDVA 2B24B 4FMCA 3G0KA 3LYGA 1OACA 1ROAA 2CIUA 3FCSB 3OWYA 1M904 1VQ53 3CXC2 3S5CA 1NB3I 3HZPA 1Y4KA 3RGRA 3ER7A 1TIJA 1QJGA 3SVAA 2I9WA 2XFTA 2QA43 4R9KA 3BNBA 3F14A 3PXMA 3FF2A 3JUPA 4MEIA 2P0XA 3EN1B 3Q2PA 4MMZB 3MPHA 1Q7Y4 1STFI 1YIT3 4L8OA 1DMQA 3CCQ3 1W4NA 4NREA 4XB5A 1OH0A 4EC6A 3MG1A 1YJ93 4N6LA 1W6GA 3X42A 1FGOA 3MHEA 1G96A 1TFKA 2F86B 5AYRB 4N6TA 1W2B2 3T8NA 2F98A 3NBJA 3CNMA 3MYTA 3I563 2YFLB 1RKYA 2GXFA 3BNCA 3OWUA 4XM4A 4O02B 1SQWA 2SBLA 4EXRA 3UL5A 1M1K4 2BMOB 4HM5B 1SPUA 3HIIA 3MSOA 3UB1A 1K734 1D6UA 3LOYA 4N6NB 5AIFA 3HIGA 3LMLA 3EX9A 1FA3A 2CC3A 3KN4A 5KP4A 3OX9A 2W03A 4HBRA 3VF1A 3FG1A 3X3ZA 2PNCA 5LC6A 2W0QA 1IQYA 5IG5A 1GY5A 3FZWA 3CPW2 3X3XA 3DUKA 5IG4A 1FUWA 1JN5B 3UL6A 4KVHA 3CCR3 4FMAA 3DGOA 1N9EA 2OQEC 3H51A 2ML5A 1Z1SA 3F7XA 4FCMA 3FF0A 4KFEA 3K9MC 1K28A 3LZAA 5IEOA 5D83A 1MOLA 1JRQA 1GYBA 2L4VA 1TP6A 1UW1A 1GD4A 2HMOB 2D1WA 3GWRA 2BHMA 1NO3A 1IDPA 1SIHA 3WA3A 1AVKA 2D42A 1VQ93 3F9SA 1IVUA 2A15A 5AEWB 4FCZA 4AKZA 6STDA 4R1KA 1QAFA 5BVBA 1F8NA 1GS3A 3JUOA 1SIIA 2MF7A 2QEX3 3ECFA 3AMOA 4N6OB 3V98A 4BTXA 3NM7A 1VQO3 3QRDA 3DMCA 3BNDA 1LNHA 2P05A 2O3OA 1OHOA 5JPUA 1D6YA 1US1A 4CCVA 1ZO2A 4K61A 1QAKA 4R9LA 1DMNA 2CFWA 3NQZA 1FGMA 3SOAA 3F8HA 1T5YA 1A2KA 1L5GB 4BTWA 3JUQA 1TU5A 4FMDA 1DVCA 3HI7A 4HM4B 3CCE3 1M9GA 1R4CA 1KSIA 1EA2A 1YGEA 2XEPA 4AKYA 5FGOA 2WOFA 1MNLA 3CMA3 4HM0B 3LTCA 3S28A 4AEQA 1VZZA 3KSPA 4QWTA 4IIAA 3D9RA 3H3HA 3OV4A 2PZVA 3CU3A 4O8SA 3GZBA 1S5AA 3JUMA 2CG1A 3VSYA 2Z7AA 1YJW3 5D81A 4K1VA 4EYCA 3CCL3 3F40A 2W6JH 1OCVA 1YHQ3 4JF8A 4J9AA 4RBNA 1JV2B 5KP1A 4ZM8A 4PEJA 3NV0B 3CC43 4RNZA 2W9PA 5EVHA 2ML6A 1YJN3 1RN7A 2XR8B 2RSXA 2HMMB 1W2ZA 1JKGB 2CFLA 5IG3A 1WNHA 3SXXA 1ULIB 1NB5I 1IT7A 2E2TA 4LEHA 3EBYA 1AR0A 2C10A 4X2HA 3RDEA 2KRTA 2YFIB 4TX4A 3S29A 3FLJA 1JB2A 2BNGA 3CNXA 4GB5A 3UJMA 1JKGA 3IMAB 5IENA 1FGTA 2GBXB 1W6CA 1Q824 3NBBA 2V1LA 1W5ZA 2XSHB 2CG0A 3JVCA 3NXJA 3LXUX 3NV0A 3OW22 5CK6A 2HMKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NM7 A;  3N8B A;  5FGO A; 
#chains in the Genus database with same CATH topology
 4FCJ A;  3CCU 3;  1D6Z A;  3FKA A;  4N6U A;  4BIR A;  1BNE A;  5AEU B;  2RCD A;  5IF6 A;  5JBS A;  5G1L A;  2KXG A;  3OXA A;  4GL6 A;  2P0M A;  3BLZ A;  3CC2 3;  1ZS7 A;  5STD A;  2YFJ B;  2FXT A;  3PGB A;  1B20 A;  1OF5 B;  1EG9 B;  2ZA4 A;  1RHL A;  3WR2 A;  3RGA A;  1O7G B;  1CEW I;  3VGN A;  3CCJ 3;  5M1A A;  2RGQ A;  1CQS A;  2QGU A;  1IT8 A;  1DYU A;  1DET A;  1LXE A;  3ZFZ A;  4U13 A;  1BNJ A;  1S72 3;  1VQ6 3;  1I3F A;  1U5O A;  4L8P A;  4R4K A;  1OPY A;  2W56 A;  5AYS C;  1BSC A;  5A0O B;  2O9U X;  3DGL A;  3Q3F A;  5IER A;  3CD6 3;  4EW5 A;  2ZDJ A;  4N3V A;  3ALA A;  1GY6 A;  1A90 A;  5FW5 A;  1IK3 A;  1KQS 2;  1UUV B;  3JUN A;  1O7P B;  4EBG A;  3EJV A;  1LQG C;  4GSP A;  2CWT A;  4MJD A;  1C7H A;  1I0X A;  3Q90 A;  3CCM 3;  1N8Q A;  2F4Y A;  1W00 A;  4N6M A;  1PYL A;  1QAL A;  4STD A;  3WOF B;  1O7M B;  3KZT A;  2JQ5 A;  3AGO A;  3UNL A;  3U1W A;  1BNS A;  2HMN B;  4WWU C;  1WQL B;  3NM2 A;  5IG0 A;  4KFD A;  4MMX B;  3B4P A;  4HVN A;  2QIY A;  2YX9 A;  4KZ1 A;  1VQQ A;  5IW9 A;  1VQK 3;  1OGZ A;  1Q42 A;  2WOH A;  4CDL A;  5JPP A;  5CXO A;  5RNT A;  1RRL A;  1QVG 2;  3E99 A;  1E3V A;  2KF3 A;  3I55 3;  1RLS A;  3M8C A;  3S27 A;  5EQL A;  5CF1 A;  1IVV A;  2AAD A;  1YVB I;  4RNY A;  3EC9 A;  1DMM A;  3NUV A;  3D3L A;  3X41 A;  4H3U A;  1LOY A;  1W02 A;  1BRG A;  2J8X B;  4HKV B;  2Z77 A;  1IVW A;  1UI7 A;  4O2H A;  1I8V A;  2K54 A;  4XBY A;  3TDG A;  3WOE B;  1WMN A;  1X1U A;  2CFK A;  1ROV A;  5G1K A;  1EQK A;  5BXQ A;  2XRX B;  5I97 A;  1WMO A;  2W56 B;  2BMQ B;  2BMR B;  3B7C A;  3N54 B;  1O7H B;  3S67 A;  1BRI A;  1LOW A;  2MC8 A;  3L0R A;  2KCD A;  3FSD A;  1TTO A;  1Q7H A;  1RGK A;  2CW9 A;  2CHC A;  1BSE A;  2IYJ A;  3LTA A;  3NX0 A;  4HZB B;  4OUQ A;  5AIG A;  3CC7 3;  3K7C A;  3RNT A;  2CX0 A;  1JB4 A;  1GOY A;  1G0T A;  3G8Z A;  5AII A;  5DRE A;  1WMP A;  1TRP A;  4H61 A;  1JB5 A;  2SAR A;  3T0U A;  2XFS A;  3OWS A;  3FG3 A;  4BTY A;  1U8C B;  3GAX A;  1N5H A;  1UUW B;  1GMR A;  2XSO B;  4IPB A;  1BUQ A;  1SJW A;  4I5Q A;  3NQY A;  1OHS A;  1Q40 B;  1W01 A;  3EHC A;  1X1X A;  3EQQ B;  1G02 A;  3A76 A;  3EE1 A;  3WA2 X;  2P09 A;  1ULJ B;  1BSB A;  4K1U A;  4L7K A;  3D4A A;  3G4S 3;  1VQ8 3;  3NBR A;  2B1X B;  3KE7 A;  2CKF B;  3LT9 A;  1FUS A;  2P38 A;  3DGN A;  3GZY B;  1QMA A;  1TRQ A;  1MWS A;  1FGQ A;  1CH0 A;  1BSA A;  4R80 A;  3HX8 A;  1JNQ A;  5TGN A;  1O7N B;  3DXO A;  5D82 A;  1RGH A;  3O8Y A;  3MG3 A;  3AHS A;  2Z6B A;  5EEO A;  1N8R 4;  1ISK A;  4NHF A;  4RZM A;  4HJL B;  1T2I A;  1CYV A;  2K0M A;  2JDI H;  1VQ7 3;  1R4Y A;  2CH9 A;  4HM3 B;  3BU4 A;  4RNT A;  2XH9 A;  4N6V 0;  3GRD A;  1BSD A;  1K41 A;  1B2U A;  3MG2 A;  1BIR A;  1GD3 A;  3WDG B;  3K5T A;  5G2G A;  1OGX A;  1RCK A;  3WMD A;  3HK4 A;  4HM7 B;  1IU7 A;  4HYZ A;  4FMB A;  1W6Y A;  1FGR A;  3K63 A;  1VQL 3;  3G6E 3;  1LVN A;  2STD A;  4ORL A;  3IJE B;  3CCS 3;  1NWW A;  4OVM A;  1RJO A;  1V58 A;  1BGS A;  1BU4 A;  5CF2 A;  1ZGX A;  5ELJ A;  1B27 A;  1BRH A;  2GEX A;  2BO9 B;  3QK9 A;  1WTH A;  2CWV A;  1UUG B;  5DRV A;  3ZG0 A;  1PY3 A;  4FR9 A;  4HM6 B;  5AI1 A;  3AGN A;  1JJ2 2;  3V92 A;  3EB8 A;  3FH1 A;  4WHA A;  3WOD G;  4LGQ A;  2KF4 A;  3DM8 A;  4XBT A;  5LC7 A;  3J7Y d;  3X3Y A;  1A2V A;  3T8U A;  1JN5 A;  4HM8 B;  3B8L A;  4J8T A;  7RNT A;  2FNQ A;  2HMJ B;  2RNT A;  1I0V A;  1QVF 2;  3ROB A;  2OWP A;  1AV4 A;  9RNT A;  1PFP A;  1TUH A;  3HOH A;  2C11 A;  2BT3 A;  1OF5 A;  2W04 A;  3F8X A;  1O7W B;  2FGT A;  1M1X B;  2E2U A;  2INX A;  2Y73 A;  4CPK A;  1N9J A;  1OHP A;  3B4O A;  4CJN A;  1UGI A;  1UI8 A;  3G16 A;  3N9H A;  3SLU A;  2KF6 A;  2ZL8 A;  3N8B A;  6RNT A;  1I2F A;  2AAE A;  1IQ8 A;  5HGR A;  2OTJ 3;  1K9M 4;  2W9Q A;  3SED A;  2F99 A;  1ZX2 A;  3PCR A;  5M19 A;  3PCS A;  4G1M B;  1LQM B;  3GZX B;  3DY5 A;  1VQM 3;  2OOV C;  2Q07 A;  4HZ9 B;  2LYX A;  3KFQ C;  4MMY B;  5BU4 A;  1VQP 3;  3X40 A;  5ELU A;  3BB9 A;  2IMJ A;  3DGY A;  1I2E A;  1STD A;  2RFR A;  2M7O A;  2XGN A;  7STD A;  1HU9 A;  1BRJ A;  3IPT A;  1FZU A;  3V99 A;  2R41 A;  1IV7 A;  2WGO A;  3I0Y A;  5HOH A;  1BNR A;  1DE3 A;  1EKM A;  1IV9 A;  1V74 A;  1IQX A;  1BNI A;  4IT7 A;  5CLK A;  1Q9E A;  2Y74 A;  3KII A;  8CHO A;  1T2H A;  2CFD A;  2C4B A;  4K90 B;  4OK0 A;  1X1W A;  3SOY A;  4HM2 B;  4EV2 A;  1E3R A;  1ASK A;  1UGH I;  1I2G A;  3AMO B;  1C54 A;  1NDO B;  2WO0 A;  3NHX A;  4LZI A;  4O3V A;  2H0H A;  3GSP A;  1NU3 A;  3GZR A;  4X2O A;  1Q86 4;  2IA7 A;  4Q53 A;  2E2V A;  4WFO A;  2CWU A;  3KCH A;  1VQ4 3;  3MKI A;  3CPO A;  1J2B A;  2HML B;  2XGL A;  3Q1C A;  5KP3 A;  4XDW A;  4WP5 A;  2CFG A;  3STD A;  1IVX A;  3KKG A;  1GMP A;  3F7S A;  1VQN 3;  4XBX A;  2Z76 A;  4KFF A;  1OUN A;  1BAN A;  1PU4 A;  1GY7 A;  1HKX A;  3PYJ A;  1LOV A;  4JRF A;  5GSP A;  1KD1 4;  4LSO A;  3DZL A;  4I4K A;  3SYU A;  4J5G A;  4WYK A;  2OTL 3;  2OCT A;  3EN8 A;  1MGW A;  1YI2 3;  1DVD A;  4EV5 A;  3LH4 A;  2K3D A;  4GHO A;  1YIJ 3;  3LTB A;  1V57 A;  1CYU A;  3K0Z A;  1I3I A;  1B3S A;  1LOX A;  5IEP A;  2W2C A;  1Q81 4;  2OOV A;  1NNV A;  2GBW B;  3PS8 A;  3LT8 A;  5BIR A;  3EF8 A;  3G71 3;  4WYK B;  1RGF A;  3FG4 A;  3DGM A;  1FYS A;  5AIH A;  1AVL A;  3FGY A;  1E97 A;  1KC8 4;  1A67 A;  4LMI A;  2H0I A;  3LTD A;  2LQV A;  3U97 A;  2GU3 A;  7GSP A;  3EBT A;  1TFO A;  1KWI A;  2GU1 A;  2HOH A;  2IUK A;  3KSE D;  1RRH A;  2XF3 A;  1N5P A;  3MWZ A;  1NJI 4;  3BNE A;  2OQE A;  1K8A 4;  2UX0 A;  2WGQ A;  1W7C A;  3PZW A;  2GSP A;  1UCJ A;  1B2M A;  1RNT A;  1BNF A;  3CCV 3;  2CK3 H;  2IUJ A;  3SX1 A;  4HM1 B;  1Q40 A;  2GEY A;  2R4I A;  1B2X A;  3CME 3;  4XDV A;  2B24 B;  1JBR A;  1FW7 A;  4FMC A;  3G0K A;  3LYG A;  1OAC A;  2CIU A;  1GMQ A;  1ROA A;  1HZ1 A;  3FCS B;  3OWY A;  1M90 4;  1RGC A;  4HOH A;  1VQ5 3;  3CXC 2;  3S5C A;  3AHW A;  1NB3 I;  3HZP A;  1Y4K A;  3RGR A;  3ER7 A;  1TIJ A;  1QJG A;  3SVA A;  2H0G A;  1YVS A;  2I9W A;  2XFT A;  1BAO A;  4R9K A;  2QA4 3;  3BNB A;  3F14 A;  1EEJ A;  3PXM A;  3FF2 A;  1BRK A;  3JUP A;  4MEI A;  2P0X A;  3EN1 B;  1MWT A;  3Q2P A;  3MPH A;  4MMZ B;  1Q7Y 4;  1GOV A;  1STF I;  1YIT 3;  1IYY A;  1RN1 A;  4L8O A;  1DMQ A;  3CCQ 3;  1W4N A;  4NRE A;  4XB5 A;  1OH0 A;  4EC6 A;  3MG1 A;  1YJ9 3;  4N6L A;  4BL3 A;  1W6G A;  3X42 A;  1FGO A;  1A2P A;  3MHE A;  4BU4 A;  1G96 A;  1TFK A;  2F86 B;  5AYR B;  4N6T A;  1W2B 2;  3T8N A;  2F98 A;  3NBJ A;  1RGE A;  5M18 A;  3CNM A;  1JBS A;  3D5I A;  3MYT A;  3ZG5 A;  2CX1 A;  3I56 3;  1YGW A;  2YFL B;  1RKY A;  2GXF A;  3BNC A;  3OWU A;  4XM4 A;  1FUT A;  2L1S A;  4O02 B;  1SQW A;  2SBL A;  4EXR A;  4DKI A;  4KT3 B;  1B21 A;  3UL5 A;  2KF5 A;  4ILF A;  1M1K 4;  2BMO B;  4HM5 B;  1SPU A;  3HII A;  3MSO A;  4LYL B;  1RGL A;  1D6U A;  3UB1 A;  1K73 4;  3LOY A;  4N6N B;  5AIF A;  3URP A;  1RCL A;  1YNV X;  1BUJ A;  3HIG A;  3LML A;  3EX9 A;  1FA3 A;  2CC3 A;  3KN4 A;  5KP4 A;  3OX9 A;  2W03 A;  4HBR A;  2F56 A;  3VF1 A;  3FG1 A;  4J5K A;  3X3Z A;  2PNC A;  1MGR A;  1JZO A;  1RGA A;  2W0Q A;  1LRA A;  2KAA A;  5LC6 A;  1IQY A;  5IG5 A;  1GY5 A;  3FZW A;  3CPW 2;  3X3X A;  3DUK A;  5IG4 A;  2ZHX B;  1JN5 B;  1FUW A;  3UL6 A;  4KVH A;  3CCR 3;  4FMA A;  1B2S A;  3DGO A;  1N9E A;  2OQE C;  3D5G A;  3H51 A;  1UDI I;  1Z1S A;  2ML5 A;  3F7X A;  4FCM A;  3A5E A;  3FF0 A;  4KFE A;  3K9M C;  1K28 A;  2BU4 A;  3LZA A;  3BIR A;  5IEO A;  5D83 A;  1HYF A;  1MOL A;  1JRQ A;  1GYB A;  1T3B A;  2L4V A;  1RTU A;  1TP6 A;  1GD4 A;  1UW1 A;  2D1W A;  2HMO B;  2UUG C;  2BHM A;  1NO3 A;  3GWR A;  4NPB A;  1JBT A;  1IDP A;  1SIH A;  3WA3 A;  1AVK A;  2D42 A;  1LNI A;  1VQ9 3;  3F9S A;  6GSP A;  1IVU A;  1UCI A;  2A15 A;  5AEW B;  4FCZ A;  4AKZ A;  6STD A;  4R1K A;  1QAF A;  5BVB A;  1F8N A;  1GS3 A;  3JUO A;  2F5W A;  2RBI A;  1SII A;  2MF7 A;  1JZD A;  3ECF A;  2QEX 3;  3AMO A;  1MWR A;  4N6O B;  3V98 A;  1GSP A;  4BTX A;  3NM7 A;  1VQO 3;  3QRD A;  1RNB A;  3DMC A;  1RN4 A;  3BND A;  1LNH A;  2P05 A;  2O3O A;  1OHO A;  3WHO A;  5JPU A;  1D6Y A;  1US1 A;  4CCV A;  1ZO2 A;  4K61 A;  1AQZ A;  1BRS A;  1QAK A;  4R9L A;  1DMN A;  2CFW A;  3NQZ A;  1FGM A;  3SOA A;  3F8H A;  1T5Y A;  1A2K A;  2F5M A;  1L5G B;  3JUQ A;  4BTW A;  1TU5 A;  4FMD A;  2UGI A;  2BIR A;  1DVC A;  3HI7 A;  4HM4 B;  3CCE 3;  1UCK A;  1M9G A;  1R4C A;  1EA2 A;  1KSI A;  1YGE A;  2XEP A;  4AKY A;  5FGO A;  4BL2 A;  2WOF A;  4HAA A;  1B2Z A;  3D79 A;  1MNL A;  3CMA 3;  4HM0 B;  3LTC A;  3S28 A;  4AEQ A;  1VZZ A;  3KSP A;  4QWT A;  4IIA A;  3D9R A;  3H3H A;  1EUI C;  1BRN L;  3OV4 A;  2PZV A;  3CU3 A;  4O8S A;  3GZB A;  1S5A A;  3JUM A;  2CG1 A;  3VSY A;  2Z7A A;  1YJW 3;  1RGG A;  5D81 A;  4K1V A;  4EYC A;  3CCL 3;  3F40 A;  2W6J H;  1RDS A;  1OCV A;  1YHQ 3;  4JF8 A;  4J9A A;  4RBN A;  1JV2 B;  5KP1 A;  4ZM8 A;  1TJD A;  3NV0 B;  4PEJ A;  4RNZ A;  3CC4 3;  2W9P A;  5EVH A;  2ML6 A;  1YJN 3;  1RN7 A;  2XR8 B;  2RSX A;  2HMM B;  2IY2 A;  1W2Z A;  1RSN A;  1JKG B;  1RMS A;  2CFL A;  5IG3 A;  8RNT A;  1I70 A;  1WNH A;  3SXX A;  1MWU A;  1ULI B;  1NB5 I;  1IT7 A;  1SAR A;  1X1Y A;  2E2T A;  4LEH A;  3EBY A;  1AR0 A;  2C10 A;  4X2H A;  3RDE A;  1BNG A;  2KRT A;  2YFI B;  4TX4 A;  3S29 A;  3FLJ A;  1BVI A;  1JB2 A;  2BNG A;  3CNX A;  1GOU A;  1UCL A;  4GB5 A;  1JKG A;  3UJM A;  3IMA B;  5IEN A;  1AY7 A;  3DH2 A;  1FGT A;  2GBX B;  1W6C A;  1Q82 4;  3NBB A;  2V1L A;  1W5Z A;  2XSH B;  2CG0 A;  3JVC A;  3NXJ A;  3LXU X;  3NV0 A;  3OW2 2;  1BOX A;  5CK6 A;  2HMK B; 
#chains in the Genus database with same CATH homology
 4FCJ A;  3CCU 3;  1D6Z A;  3FKA A;  4N6U A;  5AEU B;  2RCD A;  5IF6 A;  5JBS A;  2KXG A;  3OXA A;  4GL6 A;  2P0M A;  3BLZ A;  3CC2 3;  5STD A;  2YFJ B;  2FXT A;  3PGB A;  1OF5 B;  1EG9 B;  3RGA A;  1O7G B;  1CEW I;  3VGN A;  3CCJ 3;  2RGQ A;  1CQS A;  2QGU A;  1IT8 A;  1DYU A;  1LXE A;  4U13 A;  1VQ6 3;  1S72 3;  1U5O A;  4L8P A;  4R4K A;  1OPY A;  2W56 A;  5AYS C;  5A0O B;  2O9U X;  3DGL A;  5IER A;  3CD6 3;  2ZDJ A;  4N3V A;  3ALA A;  1GY6 A;  1A90 A;  5FW5 A;  1IK3 A;  1KQS 2;  1UUV B;  3JUN A;  1O7P B;  4EBG A;  3EJV A;  2CWT A;  4MJD A;  1C7H A;  3Q90 A;  3CCM 3;  1N8Q A;  4N6M A;  1W00 A;  4STD A;  1QAL A;  3WOF B;  1O7M B;  3KZT A;  2JQ5 A;  3UNL A;  3U1W A;  2HMN B;  4WWU C;  1WQL B;  3NM2 A;  5IG0 A;  4KFD A;  4MMX B;  3B4P A;  4HVN A;  2QIY A;  2YX9 A;  4KZ1 A;  5IW9 A;  1VQK 3;  1OGZ A;  1Q42 A;  2WOH A;  4CDL A;  5JPP A;  5CXO A;  1RRL A;  1QVG 2;  3E99 A;  1E3V A;  3I55 3;  3M8C A;  3S27 A;  5EQL A;  5CF1 A;  1IVV A;  1YVB I;  4RNY A;  3EC9 A;  1DMM A;  3NUV A;  3D3L A;  3X41 A;  4H3U A;  1W02 A;  4HKV B;  2Z77 A;  1IVW A;  1UI7 A;  4O2H A;  4XBY A;  2K54 A;  3TDG A;  3WOE B;  1WMN A;  2CFK A;  1ROV A;  1EQK A;  5BXQ A;  2XRX B;  5I97 A;  1WMO A;  2W56 B;  2BMQ B;  2BMR B;  3B7C A;  3N54 B;  1O7H B;  3S67 A;  2MC8 A;  3L0R A;  2KCD A;  3FSD A;  2CHC A;  2CW9 A;  3LTA A;  4HZB B;  3NX0 A;  5AIG A;  3CC7 3;  4OUQ A;  3K7C A;  1JB4 A;  3G8Z A;  5AII A;  5DRE A;  1WMP A;  4H61 A;  1JB5 A;  3T0U A;  2XFS A;  3OWS A;  3FG3 A;  4BTY A;  1U8C B;  3GAX A;  1N5H A;  1UUW B;  2XSO B;  4IPB A;  1BUQ A;  1SJW A;  3NQY A;  3EHC A;  1OHS A;  1Q40 B;  1W01 A;  3EQQ B;  3A76 A;  3EE1 A;  3WA2 X;  2P09 A;  1ULJ B;  4K1U A;  4L7K A;  3G4S 3;  1VQ8 3;  3NBR A;  2B1X B;  3KE7 A;  2CKF B;  3LT9 A;  2P38 A;  3DGN A;  3GZY B;  1QMA A;  1FGQ A;  4R80 A;  3HX8 A;  1JNQ A;  5TGN A;  1O7N B;  3DXO A;  5D82 A;  3O8Y A;  3MG3 A;  1N8R 4;  2Z6B A;  5EEO A;  1ISK A;  4NHF A;  4RZM A;  4HJL B;  1CYV A;  2K0M A;  2JDI H;  1VQ7 3;  2CH9 A;  4HM3 B;  2XH9 A;  4N6V 0;  3GRD A;  1K41 A;  3MG2 A;  1GD3 A;  3WDG B;  3K5T A;  5G2G A;  1OGX A;  3WMD A;  3HK4 A;  4HM7 B;  1IU7 A;  4HYZ A;  4FMB A;  1W6Y A;  1FGR A;  3K63 A;  1VQL 3;  3G6E 3;  1LVN A;  2STD A;  4ORL A;  3IJE B;  3CCS 3;  1NWW A;  4OVM A;  1RJO A;  5CF2 A;  5ELJ A;  2GEX A;  2BO9 B;  3QK9 A;  1WTH A;  2CWV A;  5DRV A;  4FR9 A;  4HM6 B;  5AI1 A;  1JJ2 2;  3V92 A;  3EB8 A;  3FH1 A;  4WHA A;  3WOD G;  4LGQ A;  5LC7 A;  3DM8 A;  4XBT A;  3J7Y d;  3X3Y A;  1A2V A;  3T8U A;  1JN5 A;  4HM8 B;  3B8L A;  4J8T A;  2FNQ A;  2HMJ B;  1QVF 2;  3ROB A;  2OWP A;  1AV4 A;  1PFP A;  1TUH A;  2C11 A;  2BT3 A;  1OF5 A;  2W04 A;  3F8X A;  1O7W B;  2FGT A;  1M1X B;  2E2U A;  2INX A;  2Y73 A;  1N9J A;  1OHP A;  3B4O A;  1UI8 A;  3G16 A;  3N9H A;  3SLU A;  2ZL8 A;  3N8B A;  1IQ8 A;  5HGR A;  2OTJ 3;  1K9M 4;  2W9Q A;  3SED A;  2F99 A;  1ZX2 A;  3PCR A;  3PCS A;  4G1M B;  3GZX B;  3DY5 A;  1VQM 3;  2OOV C;  2Q07 A;  4HZ9 B;  2LYX A;  3KFQ C;  4MMY B;  1VQP 3;  3X40 A;  5ELU A;  3BB9 A;  2IMJ A;  1STD A;  2RFR A;  2M7O A;  2XGN A;  7STD A;  1HU9 A;  3IPT A;  3V99 A;  2WGO A;  1IV7 A;  3I0Y A;  1EKM A;  1IV9 A;  1IQX A;  1V74 A;  4IT7 A;  5CLK A;  2Y74 A;  3KII A;  8CHO A;  2CFD A;  4K90 B;  4OK0 A;  3SOY A;  4HM2 B;  4EV2 A;  1E3R A;  1ASK A;  3AMO B;  1NDO B;  2WO0 A;  3NHX A;  4LZI A;  4O3V A;  1NU3 A;  3GZR A;  4X2O A;  1Q86 4;  2IA7 A;  4Q53 A;  2E2V A;  4WFO A;  2CWU A;  1J2B A;  1VQ4 3;  3MKI A;  3CPO A;  2HML B;  2XGL A;  3Q1C A;  5KP3 A;  4XDW A;  4WP5 A;  2CFG A;  3STD A;  1IVX A;  3KKG A;  3F7S A;  1VQN 3;  4XBX A;  2Z76 A;  4KFF A;  1OUN A;  1PU4 A;  1GY7 A;  1HKX A;  3PYJ A;  4JRF A;  1KD1 4;  4LSO A;  3DZL A;  4I4K A;  4WYK A;  2OTL 3;  2OCT A;  3EN8 A;  1DVD A;  1YI2 3;  4EV5 A;  3LH4 A;  1YIJ 3;  3LTB A;  1CYU A;  3K0Z A;  1LOX A;  5IEP A;  2W2C A;  1Q81 4;  2OOV A;  2GBW B;  3PS8 A;  3LT8 A;  3EF8 A;  3G71 3;  4WYK B;  3FG4 A;  3DGM A;  5AIH A;  1AVL A;  3FGY A;  1E97 A;  1KC8 4;  1A67 A;  4LMI A;  3LTD A;  3U97 A;  2LQV A;  2GU3 A;  3EBT A;  1TFO A;  1KWI A;  2GU1 A;  2IUK A;  3KSE D;  1RRH A;  2XF3 A;  1N5P A;  3MWZ A;  1NJI 4;  3BNE A;  2OQE A;  1K8A 4;  2UX0 A;  2WGQ A;  1W7C A;  3PZW A;  3CCV 3;  2CK3 H;  2IUJ A;  3SX1 A;  4HM1 B;  1Q40 A;  2GEY A;  2R4I A;  3CME 3;  4XDV A;  2B24 B;  4FMC A;  3G0K A;  3LYG A;  1OAC A;  1ROA A;  2CIU A;  3FCS B;  3OWY A;  1M90 4;  1VQ5 3;  3CXC 2;  3S5C A;  1NB3 I;  3HZP A;  1Y4K A;  3RGR A;  3ER7 A;  1TIJ A;  1QJG A;  3SVA A;  2I9W A;  2XFT A;  2QA4 3;  4R9K A;  3BNB A;  3F14 A;  3PXM A;  3FF2 A;  3JUP A;  4MEI A;  2P0X A;  3EN1 B;  3Q2P A;  4MMZ B;  3MPH A;  1Q7Y 4;  1STF I;  1YIT 3;  4L8O A;  1DMQ A;  3CCQ 3;  1W4N A;  4NRE A;  4XB5 A;  1OH0 A;  4EC6 A;  3MG1 A;  1YJ9 3;  4N6L A;  1W6G A;  3X42 A;  1FGO A;  3MHE A;  1G96 A;  1TFK A;  2F86 B;  5AYR B;  4N6T A;  1W2B 2;  3T8N A;  2F98 A;  3NBJ A;  3CNM A;  3MYT A;  3I56 3;  2YFL B;  1RKY A;  2GXF A;  3BNC A;  3OWU A;  4XM4 A;  4O02 B;  1SQW A;  2SBL A;  4EXR A;  3UL5 A;  1M1K 4;  2BMO B;  4HM5 B;  1SPU A;  3HII A;  3MSO A;  3UB1 A;  1K73 4;  1D6U A;  3LOY A;  4N6N B;  5AIF A;  3HIG A;  3LML A;  3EX9 A;  1FA3 A;  2CC3 A;  3KN4 A;  5KP4 A;  3OX9 A;  2W03 A;  4HBR A;  3VF1 A;  3FG1 A;  3X3Z A;  2PNC A;  5LC6 A;  2W0Q A;  1IQY A;  5IG5 A;  1GY5 A;  3FZW A;  3CPW 2;  3X3X A;  3DUK A;  5IG4 A;  1FUW A;  1JN5 B;  3UL6 A;  4KVH A;  3CCR 3;  4FMA A;  3DGO A;  1N9E A;  2OQE C;  3H51 A;  2ML5 A;  1Z1S A;  3F7X A;  4FCM A;  3FF0 A;  4KFE A;  3K9M C;  1K28 A;  3LZA A;  5IEO A;  5D83 A;  1MOL A;  1JRQ A;  1GYB A;  2L4V A;  1TP6 A;  1UW1 A;  1GD4 A;  2HMO B;  2D1W A;  3GWR A;  2BHM A;  1NO3 A;  1IDP A;  1SIH A;  3WA3 A;  1AVK A;  2D42 A;  1VQ9 3;  3F9S A;  1IVU A;  2A15 A;  5AEW B;  4FCZ A;  4AKZ A;  6STD A;  4R1K A;  1QAF A;  5BVB A;  1F8N A;  1GS3 A;  3JUO A;  1SII A;  2MF7 A;  2QEX 3;  3ECF A;  3AMO A;  4N6O B;  3V98 A;  4BTX A;  3NM7 A;  1VQO 3;  3QRD A;  3DMC A;  3BND A;  1LNH A;  2P05 A;  2O3O A;  1OHO A;  5JPU A;  1D6Y A;  1US1 A;  4CCV A;  1ZO2 A;  4K61 A;  1QAK A;  4R9L A;  1DMN A;  2CFW A;  3NQZ A;  1FGM A;  3SOA A;  3F8H A;  1T5Y A;  1A2K A;  1L5G B;  4BTW A;  3JUQ A;  1TU5 A;  4FMD A;  1DVC A;  3HI7 A;  4HM4 B;  3CCE 3;  1M9G A;  1R4C A;  1KSI A;  1EA2 A;  1YGE A;  2XEP A;  4AKY A;  5FGO A;  2WOF A;  1MNL A;  3CMA 3;  4HM0 B;  3LTC A;  3S28 A;  4AEQ A;  1VZZ A;  3KSP A;  4QWT A;  4IIA A;  3D9R A;  3H3H A;  3OV4 A;  2PZV A;  3CU3 A;  4O8S A;  3GZB A;  1S5A A;  3JUM A;  2CG1 A;  3VSY A;  2Z7A A;  1YJW 3;  5D81 A;  4K1V A;  4EYC A;  3CCL 3;  3F40 A;  2W6J H;  1OCV A;  1YHQ 3;  4JF8 A;  4J9A A;  4RBN A;  1JV2 B;  5KP1 A;  4ZM8 A;  4PEJ A;  3NV0 B;  3CC4 3;  4RNZ A;  2W9P A;  5EVH A;  2ML6 A;  1YJN 3;  1RN7 A;  2XR8 B;  2RSX A;  2HMM B;  1W2Z A;  1JKG B;  2CFL A;  5IG3 A;  1WNH A;  3SXX A;  1ULI B;  1NB5 I;  1IT7 A;  2E2T A;  4LEH A;  3EBY A;  1AR0 A;  2C10 A;  4X2H A;  3RDE A;  2KRT A;  2YFI B;  4TX4 A;  3S29 A;  3FLJ A;  1JB2 A;  2BNG A;  3CNX A;  4GB5 A;  3UJM A;  1JKG A;  3IMA B;  5IEN A;  1FGT A;  2GBX B;  1W6C A;  1Q82 4;  3NBB A;  2V1L A;  1W5Z A;  2XSH B;  2CG0 A;  3JVC A;  3NXJ A;  3LXU X;  3NV0 A;  3OW2 2;  5CK6 A;  2HMK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...