5FGOA

Crystal structure of d. melanogaster pur-alpha repeat iii.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
b'PEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCEKMKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CG1507-PB, isoform B
publication title Structural basis of nucleic-acid recognition and double-strand unwinding by the essential neuronal protein Pur-alpha.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 13
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.700 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5fgoA00
3N8BA 3NM7A 5FGOA
chains in the Genus database with same CATH superfamily
1TRPA 1UGHI 3ECFA 3JUPA 5I97A 2CFDA 7RNTA 1T2HA 1JJ22 3AHSA 4K61A 3SOAA 1Q864 4JRFA 3GZYB 2C4BA 1RGAA 4N6UA 5CXOA 1LXEA 5EVHA 1W6CA 1JKGA 2RFRA 4Q53A 1N5PA 1QMAA 1C7HA 2R41A 4BU4A 3BU4A 1Q7HA 1B21A 1IQYA 1IQ8A 1LQMB 1OCVA 3NM2A 3CD63 1BVIA 1ULJB 4OVMA 4WP5A 5AIHA 4RNYA 5JBSA 1HYFA 1C54A 2W2CA 3EBYA 4O8SA 1O7WB 2OQEC 4FMDA 3CC23 2STDA 1OPYA 1YNVX 3EC9A 4CPKA 1K41A 1IV7A 3F8XA 3ZFZA 4N6NB 4L7KA 5HOHA 2CG1A 3WA2X 1BRSA 1QALA 2RCDA 1RGHA 1V74A 3PYJA 4G1MB 4CJNA 3HIIA 3FSDA 1PU4A 4ZM8A 1UCJA 3LOYA 1FW7A 3MG3A 2B1XB 4HM8B 4TX4A 1DVCA 2CIUA 4HM5B 1ZGXA 4HBRA 4KZ1A 5JPUA 2KF6A 4AEQA 3I563 2YFLB 1BIRA 1GY7A 1W6YA 3K9MC 4I4KA 3RGAA 4EYCA 2Z7AA 1A2PA 1D6ZA 3GZRA 4RZMA 3SXXA 5M1AA 1Q40A 2F56A 1LVNA 3RGRA 3D4AA 2P0XA 1W5ZA 3CME3 1NB5I 1UUGB 1JKGB 1JBSA 1IYYA 1VQO3 4EBGA 2MC8A 1RCLA 6GSPA 1G96A 1JB5A 1STDA 3FKAA 4HM3B 3CCV3 2FNQA 3OW22 1Q814 1UDII 1RN7A 3I0YA 3LT9A 4HM4B 1DMNA 3K7CA 4L8OA 1ISKA 3KN4A 1DVDA 2AADA 3M8CA 2W56A 3LTAA 3CCR3 2W9QA 8RNTA 4RNZA 4XBYA 1T5YA 1A67A 2QEX3 3RDEA 4RBNA 2ML5A 2ML6A 4K90B 1TP6A 4GB5A 3CPW2 1R4YA 2BNGA 2P0MA 2GEXA 4FCZA 1UUVB 3WOFB 3V92A 5AEUB 5IEOA 1YI23 1YIJ3 3HIGA 4LGQA 1BNFA 1G02A 1GD4A 2CWTA 2F98A 3F14A 2CWUA 3DGMA 5D82A 1O7MB 1RJOA 3JUMA 5AYSC 4J5KA 4PEJA 1TIJA 1I3IA 3DGYA 3NXJA 5A0OB 5IERA 3WA3A 1FGQA 4O2HA 3O8YA 2IA7A 4CDLA 1BNJA 2GU3A 3A76A 3SEDA 1Q40B 1Q42A 3UB1A 1RGFA 1YJ93 1W00A 4KFFA 5IW9A 3UL6A 4FMAA 1IT8A 1WMOA 3F9SA 3GWRA 4NHFA 2IY2A 1K734 2XFTA 2WOFA 2OTJ3 2IYJA 2CKFB 2IUJA 3S27A 1BNSA 2E2UA 4MMYB 1I8VA 3SOYA 1JBTA 9RNTA 1KQS2 1MGWA 3CCJ3 1RMSA 4MEIA 2ZHXB 1EKMA 2BT3A 1W4NA 3EE1A 3KIIA 5CF2A 1OHSA 1STFI 2W56B 3EHCA 1U8CB 3ER7A 3CPOA 3CCQ3 1ASKA 1E97A 1NB3I 3CCM3 5BVBA 3K5TA 1IVVA 5G2GA 1YJW3 1SJWA 3F7SA 3KKGA 4BL3A 4EW5A 2BHMA 1S5AA 2CW9A 3AGOA 3BNCA 2CC3A 4HZBB 1LNIA 2UUGC 3E99A 3PGBA 1EQKA 2XFSA 2GBXB 5IG3A 1T2IA 1VQL3 3JVCA 4MJDA 1LOVA 1YVSA 1IVWA 1JN5A 2FXTA 2KCDA 2XRXB 2Z76A 4HVNA 5GSPA 1W7CA 2LQVA 1NJI4 1JB2A 1FGRA 2P09A 3WODG 1QAKA 3NQZA 3VGNA 1IK3A 2QA43 1AVLA 1EA2A 2AAEA 1M904 1GMQA 3CCS3 1Q824 2YFJB 3KE7A 4NPBA 1GYBA 2KF3A 3IMAB 4OUQA 2CFLA 3WMDA 7GSPA 3ALAA 3NBJA 3NM7A 1YGEA 4FCJA 4XBTA 1UCLA 2XSHB 2CX0A 4WHAA 4X2HA 3KFQC 1BU4A 4LYLB 3DM8A 2H0HA 2W9PA 1LRAA 1BSBA 1VQM3 3MSOA 1VQ73 1HKXA 5IG0A 3AMOB 1O7HB 2CH9A 2WGOA 3DH2A 4XBXA 2BMRB 3DGOA 3D5IA 4R9KA 1YVBI 3VSYA 1VQP3 2KF5A 5ELUA 4R9LA 1RGCA 2F4YA 1AR0A 2WOHA 1Q7Y4 1E3VA 4R1KA 4HM0B 1UI7A 4FMBA 1OHOA 2KAAA 4GL6A 2IUKA 3Q2PA 3S5CA 4WFOA 1I2FA 2O9UX 1Z1SA 2Y73A 3N9HA 3CCL3 4N6LA 1WMNA 4KFEA 1GMRA 4CCVA 2Y74A 2W6JH 1JN5B 1I70A 4N3VA 4XDVA 5LC7A 7STDA 2HMJB 2R4IA 5BIRA 5DRVA 1KWIA 3CU3A 2MF7A 5ELJA 1FGTA 3EJVA 3G8ZA 2UGIA 5KP3A 5IEPA 3OWSA 3MG2A 3LT8A 2JDIH 3S29A 1VQ63 1SIHA 1ROVA 2L4VA 3V98A 1IVXA 1FGMA 2HMKB 3DXOA 3HZPA 3LMLA 1QJGA 3EBTA 3EN1B 1NDOB 1A2KA 4HM6B 1EUIC 1X1XA 1UW1A 1NO3A 1FUWA 1Q9EA 3EQQB 3H51A 3B7CA 1I2GA 1BRIA 1IU7A 1NU3A 1RGGA 1VQQA 2CWVA 3OWUA 1FZUA 1PY3A 4HZ9B 2GBWB 1MWSA 3B8LA 1VQ83 1NNVA 5EQLA 5LC6A 1DE3A 1RNTA 3F8HA 2XGNA 4ORLA 1FUTA 2P05A 3MWZA 3ROBA 2A15A 1CEWI 3D9RA 3J7Yd 1WMPA 2BMQB 1IV9A 1TFOA 1A90A 5RNTA 1WTHA 3B4PA 5M19A 1BSCA 2YX9A 1K9M4 1IQXA 3MKIA 3LTBA 4IIAA 3CC43 1MGRA 2HMOB 2OOVA 1BAOA 1RCKA 5TGNA 2BIRA 1O7GB 3OWYA 1M9GA 3FZWA 3G713 4LMIA 2HMMB 5JPPA 3EX9A 3LTCA 1LOWA 3N8BA 4KFDA 1BRNL 1ROAA 3NUVA 3SX1A 4LEHA 1RKYA 3ZG0A 4I5QA 4EV5A 4XB5A 2KF4A 3UJMA 4HM2B 1BRHA 1AQZA 1RNBA 4EV2A 5IG5A 1WQLB 1GD3A 3GSPA 3DZLA 3UNLA 4KVHA 1IDPA 1JZOA 1SARA 3T0UA 3SLUA 4J9AA 3AMOA 1S723 1O7NB 2K54A 1BOXA 1RGEA 3K63A 4GHOA 4H3UA 2F99A 1D6YA 1CYVA 1OGZA 3NHXA 4R4KA 1BGSA 1UCKA 5KP1A 1OUNA 3CC73 3FF2A 1EEJA 1M1XB 4QWTA 5AI1A 1GSPA 3FGYA 3NV0A 1KD14 1BUJA 3HI7A 4STDA 2FGTA 3MYTA 1YGWA 1UI8A 1IT7A 1OACA 4O3VA 3CXC2 2W03A 3TDGA 1JBRA 2RSXA 3EB8A 2BMOB 4O02B 2E2VA 3BNEA 3BB9A 3KSED 4N6V0 3VF1A 5BU4A 3DY5A 4N6MA 1QAFA 1SPUA 4AKYA 1RGLA 5CLKA 1E3RA 2BU4A 2K3DA 4N6TA 3T8NA 5IENA 2CX1A 2CFGA 4GSPA 3H3HA 1X1YA 3CCU3 3I553 1IVUA 1BSAA 2SBLA 1GMPA 5AEWB 1CH0A 4EXRA 1TJDA 3OV4A 2CHCA 3L0RA 4XM4A 3LZAA 1B20A 3FG1A 1BRJA 1LOYA 5AIFA 5BXQA 3MG1A 1RSNA 3F7XA 1MWTA 1SQWA 3D5GA 2XF3A 3GRDA 4RNTA 1RGKA 3WHOA 1RHLA 1K28A 3B4OA 2GEYA 2GSPA 3D79A 3KZTA 4DKIA 3NX0A 3QK9A 3Q3FA 1PFPA 1X1UA 1FGOA 2J8XB 5HGRA 3RNTA 2HMNB 3DMCA 2UX0A 2OTL3 1N8QA 3PCSA 1DMQA 1WNHA 1RTUA 3OXAA 1JNQA 3WR2A 1I0VA 1LQGC 2C10A 2ZL8A 3FCSB 3KCHA 3NV0B 2CFWA 8CHOA 1RRHA 5KP4A 1RN4A 2OWPA 1OHPA 1O7PB 1QVG2 1VQ93 1V58A 3JUNA 3GAXA 1W02A 3U97A 1TUHA 2F5MA 3S67A 3DUKA 2RNTA 3LTDA 3T8UA 4BIRA 1BNEA 1DMMA 3BLZA 4MMZB 3V99A 1W6GA 4BTWA 3LYGA 4IT7A 5STDA 3CMA3 4HM1B 1UCIA 1N9EA 3F40A 3K0ZA 1UGIA 2RGQA 3IPTA 5FGOA 1VQK3 2B24B 3ZG5A 1QVF2 2PZVA 3FLJA 3G6E3 1KC84 1GY6A 1NWWA 1ULIB 1LNHA 1EG9B 1YJN3 2WGQA 3BNBA 1BNGA 2K0MA 1GOUA 1MNLA 2OOVC 1BNRA 1B3SA 5G1LA 4OK0A 2E2TA 2H0IA 4LSOA 4JF8A 3STDA 1BSDA 6STDA 1ZX2A 1V57A 1BRGA 1GY5A 1JV2B 2IMJA 3OX9A 4LZIA 5AYRB 1YIT3 3QRDA 1I3FA 3SYUA 1X1WA 3KSPA 2H0GA 3IJEB 3DGNA 3FF0A 1BSEA 5D83A 4HYZA 1B27A 2XR8B 3HK4A 3EF8A 5DREA 2W04A 1TRQA 1CQSA 1AVKA 1VQ53 1RLSA 4FMCA 3BNDA 4WYKA 3WDGB 3WOEB 3X3YA 4BTYA 4EC6A 3JUOA 1MWRA 1RDSA 2F5WA 3PZWA 1FYSA 3GZBA 2OQEA 2M7OA 1US1A 1ZS7A 2XEPA 2KRTA 1J2BA 5AIGA 1JZDA 4KT3B 3CCE3 3G4S3 3URPA 4BTXA 5CK6A 1L5GB 1TFKA 4HAAA 1B2SA 2V1LA 1LOXA 4U13A 1HU9A 1BANA 2KXGA 4WWUC 5AIIA 3UL5A 4BL2A 2QGUA 1VQN3 1T3BA 2QIYA 1OF5A 3MHEA 5G1KA 3MPHA 5M18A 4MMXB 3HX8A 4XDWA 3FH1A 1AV4A 3SVAA 2WO0A 1RRLA 1N8R4 2JQ5A 1M1K4 1B2ZA 1Y4KA 3D3LA 5FW5A 1CYUA 1AY7A 3LH4A 4H61A 3EN8A 2F86B 4HKVB 2O3OA 2RBIA 1JB4A 3G0KA 1OGXA 1U5OA 1GS3A 2XSOB 1K8A4 1VZZA 4NREA 3NBRA 4N6OB 3DGLA 2C11A 2GXFA 1B2UA 1HZ1A 3G16A 3PCRA 3X3ZA 1G0TA 1BUQA 1JRQA 3X40A 1GOVA 3FG4A 4WYKB 4R80A 4K1VA 3FG3A 3HOHA 4HJLB 3N54B 2YFIB 1F8NA 3LXUX 1DYUA 1MOLA 2Z6BA 5D81A 2CK3H 2HOHA 2ZA4A 2ZDJA 3A5EA 3X42A 4AKZA 1W2B2 5IG4A 1N9JA 4K1UA 1GOYA 1MWUA 4FR9A 2BO9B 3U1WA 2XH9A 1W2ZA 3X41A 1B2MA 4IPBA 1VQ43 2D42A 1I2EA 5CF1A 3JUQA 2INXA 4ILFA 3BIRA 2XGLA 2Q07A 2Z77A 1I0XA 1OF5B 4X2OA 3CNXA 2SARA 2W0QA 1DETA 2LYXA 4J8TA 3S28A 1BRKA 5IF6A 2OCTA 1R4CA 4L8PA 3Q1CA 1D6UA 3Q90A 4HOHA 1TU5A 1OH0A 1UUWB 3AHWA 3PXMA 1YHQ3 1RN1A 1FUSA 3NQYA 2CFKA 4J5GA 3X3XA 2CG0A 3PS8A 1PYLA 2PNCA 3AGNA 2D1WA 2L1SA 3GZXB 1BNIA 1B2XA 6RNTA 1SIIA 1FA3A 2GU1A 2HMLB 1A2VA 4HM7B 5EEOA 1ZO2A 1KSIA 2I9WA 3CNMA 1W01A 4FCMA 1N5HA 3NBBA 1TTOA 2P38A
chains in the Genus database with same CATH topology
3ECFA 3JUPA 5I97A 2CFDA 1JJ22 4K61A 3SOAA 1Q864 4JRFA 3GZYB 4N6UA 5CXOA 1LXEA 5EVHA 1W6CA 1JKGA 2RFRA 4Q53A 1N5PA 1QMAA 1C7HA 1IQYA 1IQ8A 1OCVA 3NM2A 3CD63 5AIHA 1ULJB 4OVMA 4WP5A 5JBSA 4RNYA 2W2CA 3EBYA 4O8SA 1O7WB 2OQEC 4FMDA 3CC23 2STDA 1OPYA 3EC9A 1K41A 1IV7A 3F8XA 4N6NB 4L7KA 2CG1A 3WA2X 1QALA 2RCDA 3PYJA 1V74A 4G1MB 3HIIA 3FSDA 1PU4A 4ZM8A 3LOYA 3MG3A 2B1XB 4HM8B 4TX4A 1DVCA 2CIUA 4HM5B 4HBRA 4KZ1A 5JPUA 4AEQA 2YFLB 1GY7A 3K9MC 1W6YA 4I4KA 3RGAA 4EYCA 2Z7AA 1D6ZA 3GZRA 4RZMA 3SXXA 1Q40A 1LVNA 3RGRA 2P0XA 1W5ZA 3CME3 1NB5I 1JKGB 1VQO3 4EBGA 2MC8A 1G96A 1JB5A 1STDA 3FKAA 4HM3B 3CCV3 2FNQA 3OW22 1Q814 1RN7A 3I0YA 3LT9A 4HM4B 1DMNA 3K7CA 4L8OA 1ISKA 3KN4A 1DVDA 3M8CA 2W56A 3LTAA 3CCR3 2W9QA 4RNZA 4XBYA 1T5YA 1A67A 2QEX3 3RDEA 4RBNA 2ML5A 2ML6A 4K90B 1TP6A 4GB5A 3CPW2 2BNGA 2P0MA 2GEXA 4FCZA 1UUVB 3WOFB 3V92A 5AEUB 5IEOA 1YI23 1YIJ3 3HIGA 4LGQA 1GD4A 2CWTA 2F98A 5D82A 3F14A 2CWUA 3DGMA 1O7MB 1RJOA 3JUMA 5AYSC 4PEJA 1TIJA 3NXJA 5A0OB 5IERA 3WA3A 1FGQA 4O2HA 3O8YA 2IA7A 4CDLA 2GU3A 3A76A 3SEDA 1Q40B 1Q42A 3UB1A 1YJ93 1W00A 4KFFA 5IW9A 3UL6A 4FMAA 1IT8A 1WMOA 3F9SA 3GWRA 4NHFA 1K734 2XFTA 2WOFA 2OTJ3 2CKFB 2IUJA 3S27A 2E2UA 4MMYB 3SOYA 1KQS2 3CCJ3 4MEIA 1EKMA 2BT3A 1W4NA 3EE1A 3KIIA 5CF2A 1OHSA 1STFI 2W56B 3EHCA 1U8CB 3ER7A 3CPOA 3CCQ3 1ASKA 1E97A 1NB3I 3CCM3 5BVBA 3K5TA 1IVVA 5G2GA 1YJW3 1SJWA 3F7SA 3KKGA 2BHMA 1S5AA 2CW9A 3BNCA 2CC3A 4HZBB 3E99A 3PGBA 1EQKA 2XFSA 2GBXB 5IG3A 1VQL3 3JVCA 4MJDA 1IVWA 1JN5A 2FXTA 2KCDA 2XRXB 2Z76A 4HVNA 1W7CA 2LQVA 1NJI4 1JB2A 1FGRA 2P09A 3WODG 1QAKA 3NQZA 3VGNA 1IK3A 2QA43 1AVLA 1EA2A 1M904 3CCS3 1Q824 2YFJB 3KE7A 4OUQA 1GYBA 3WMDA 3IMAB 3I563 2CFLA 3ALAA 3NBJA 3NM7A 1YGEA 4FCJA 4XBTA 2XSHB 4WHAA 4X2HA 3KFQC 3DM8A 2W9PA 1VQM3 3MSOA 1VQ73 1HKXA 5IG0A 3AMOB 1O7HB 2CH9A 2WGOA 4XBXA 2BMRB 3DGOA 4R9KA 1YVBI 3VSYA 1VQP3 5ELUA 4R9LA 1AR0A 2WOHA 1Q7Y4 1E3VA 4R1KA 4HM0B 1UI7A 4FMBA 1OHOA 4GL6A 2IUKA 3Q2PA 3S5CA 4WFOA 2O9UX 1Z1SA 2Y73A 3N9HA 3CCL3 4N6LA 1WMNA 4KFEA 4CCVA 2Y74A 2W6JH 1JN5B 4N3VA 4XDVA 5LC7A 7STDA 2HMJB 2R4IA 5DRVA 1KWIA 3CU3A 2MF7A 5ELJA 1FGTA 3EJVA 3G8ZA 5KP3A 5IEPA 3OWSA 3MG2A 3LT8A 2JDIH 3S29A 1VQ63 1SIHA 1ROVA 3V98A 1IVXA 1FGMA 2HMKB 3DXOA 3HZPA 3LMLA 1QJGA 3EBTA 3EN1B 1NDOB 1A2KA 4HM6B 1UW1A 1NO3A 1FUWA 3EQQB 3H51A 3B7CA 1NU3A 1IU7A 2CWVA 3OWUA 4HZ9B 2GBWB 3B8LA 1VQ83 5EQLA 5LC6A 3F8HA 2XGNA 4ORLA 2P05A 3MWZA 3ROBA 2A15A 1CEWI 3D9RA 3J7Yd 1WMPA 2BMQB 1IV9A 1TFOA 1A90A 3B4PA 1WTHA 2YX9A 1K9M4 1IQXA 3MKIA 3LTBA 4IIAA 3CC43 2HMOB 2OOVA 5TGNA 1O7GB 3OWYA 1M9GA 3FZWA 3G713 4LMIA 2HMMB 5JPPA 3EX9A 3LTCA 3N8BA 4KFDA 1ROAA 3NUVA 3SX1A 4LEHA 1RKYA 4EV5A 4XB5A 3UJMA 4HM2B 5IG5A 1WQLB 1GD3A 3DZLA 3UNLA 4KVHA 1IDPA 3T0UA 3SLUA 4J9AA 3AMOA 1S723 1O7NB 2K54A 3K63A 4H3UA 2F99A 1D6YA 1CYVA 1OGZA 3NHXA 4R4KA 5KP1A 1OUNA 3CC73 3FF2A 1M1XB 4QWTA 5AI1A 3FGYA 3NV0A 1KD14 3HI7A 4STDA 2FGTA 3MYTA 1UI8A 1IT7A 1OACA 4O3VA 3CXC2 2W03A 3TDGA 2RSXA 3EB8A 2BMOB 4O02B 2E2VA 3BNEA 3BB9A 3KSED 4N6V0 3VF1A 3DY5A 4N6MA 1QAFA 1SPUA 4AKYA 5CLKA 1E3RA 4N6TA 3T8NA 5IENA 2CFGA 3H3HA 3CCU3 3I553 1IVUA 2SBLA 5AEWB 4EXRA 3OV4A 2CHCA 3L0RA 4XM4A 3LZAA 3FG1A 5AIFA 5BXQA 3MG1A 3F7XA 3GRDA 1SQWA 2XF3A 3X3ZA 3B4OA 1K28A 2GEYA 3KZTA 3NX0A 3QK9A 1PFPA 1FGOA 5HGRA 2HMNB 3DMCA 2UX0A 2OTL3 1N8QA 3PCSA 1DMQA 1WNHA 3OXAA 1JNQA 2ZL8A 3NV0B 2C10A 3FCSB 2CFWA 8CHOA 1RRHA 5KP4A 2OWPA 1OHPA 1O7PB 1QVG2 1VQ93 3JUNA 3GAXA 1W02A 3U97A 1TUHA 3S67A 3DUKA 3LTDA 3T8UA 3BLZA 1DMMA 4MMZB 3V99A 1W6GA 4BTWA 3LYGA 4IT7A 5STDA 3CMA3 4HM1B 3F40A 1N9EA 3K0ZA 5FGOA 2RGQA 3IPTA 1VQK3 1QVF2 2B24B 2PZVA 3FLJA 3G6E3 1KC84 1GY6A 1NWWA 1ULIB 1LNHA 1EG9B 1YJN3 2WGQA 3BNBA 2K0MA 1MNLA 2OOVC 4OK0A 2E2TA 4LSOA 3STDA 4JF8A 6STDA 1ZX2A 1GY5A 1JV2B 2IMJA 3OX9A 4LZIA 5AYRB 1YIT3 3QRDA 3KSPA 3IJEB 3DGNA 3FF0A 5D83A 4HYZA 2XR8B 3HK4A 3EF8A 5DREA 2W04A 1CQSA 1AVKA 1VQ53 4FMCA 4WYKA 3BNDA 3WDGB 3WOEB 3X3YA 4BTYA 4EC6A 3JUOA 3PZWA 3GZBA 2OQEA 2M7OA 1US1A 2XEPA 2KRTA 1J2BA 5AIGA 3CCE3 3G4S3 4BTXA 5CK6A 1L5GB 1TFKA 1N5HA 4EV2A 2V1LA 1LOXA 4U13A 1HU9A 2KXGA 4WWUC 5AIIA 3UL5A 1VQN3 2QGUA 2QIYA 1OF5A 3MHEA 3MPHA 4MMXB 3HX8A 4XDWA 3FH1A 1AV4A 3SVAA 2WO0A 1RRLA 1N8R4 2JQ5A 1M1K4 1Y4KA 3D3LA 5FW5A 1CYUA 3LH4A 4H61A 3EN8A 2F86B 4HKVB 2O3OA 1JB4A 3G0KA 1OGXA 1U5OA 1GS3A 2XSOB 1K8A4 1VZZA 4NREA 3NBRA 4N6OB 3DGLA 2C11A 2GXFA 3G16A 3PCRA 1BUQA 1JRQA 3X40A 3FG4A 4WYKB 4R80A 4K1VA 3FG3A 4HJLB 3N54B 2YFIB 1F8NA 3LXUX 1DYUA 1MOLA 2Z6BA 5D81A 2CK3H 3X42A 4AKZA 2ZDJA 1W2B2 5IG4A 1N9JA 4K1UA 3U1WA 4FR9A 2BO9B 2XH9A 1W2ZA 3X41A 4IPBA 1VQ43 2D42A 5CF1A 3JUQA 2INXA 2XGLA 2Q07A 2Z77A 1OF5B 4X2OA 3CNXA 2W0QA 2LYXA 4J8TA 3S28A 5IF6A 2OCTA 1R4CA 4L8PA 3Q1CA 1D6UA 3Q90A 1TU5A 1YHQ3 1OH0A 1UUWB 3PXMA 3NQYA 2CFKA 3X3XA 2CG0A 3PS8A 2PNCA 2D1WA 3GZXB 1SIIA 1FA3A 2GU1A 2HMLB 1A2VA 4HM7B 5EEOA 1ZO2A 1KSIA 2I9WA 3CNMA 1W01A 4FCMA 2L4VA 3NBBA 2P38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N8B A;  3NM7 A;  5FGO A; 
#chains in the Genus database with same CATH topology
 1TRP A;  1UGH I;  3ECF A;  3JUP A;  5I97 A;  2CFD A;  7RNT A;  1T2H A;  1JJ2 2;  3AHS A;  4K61 A;  3SOA A;  1Q86 4;  4JRF A;  3GZY B;  2C4B A;  1RGA A;  4N6U A;  5CXO A;  1LXE A;  5EVH A;  1W6C A;  1JKG A;  2RFR A;  4Q53 A;  1N5P A;  1QMA A;  1C7H A;  2R41 A;  4BU4 A;  3BU4 A;  1Q7H A;  1B21 A;  1IQY A;  1IQ8 A;  1LQM B;  1OCV A;  3NM2 A;  3CD6 3;  1BVI A;  1ULJ B;  4OVM A;  4WP5 A;  5AIH A;  4RNY A;  5JBS A;  1HYF A;  1C54 A;  2W2C A;  3EBY A;  4O8S A;  1O7W B;  2OQE C;  4FMD A;  3CC2 3;  2STD A;  1OPY A;  1YNV X;  3EC9 A;  4CPK A;  1K41 A;  1IV7 A;  3F8X A;  3ZFZ A;  4N6N B;  4L7K A;  5HOH A;  2CG1 A;  3WA2 X;  1BRS A;  1QAL A;  2RCD A;  1RGH A;  1V74 A;  3PYJ A;  4G1M B;  4CJN A;  3HII A;  3FSD A;  1PU4 A;  4ZM8 A;  1UCJ A;  3LOY A;  1FW7 A;  3MG3 A;  2B1X B;  4HM8 B;  4TX4 A;  1DVC A;  2CIU A;  4HM5 B;  1ZGX A;  4HBR A;  4KZ1 A;  5JPU A;  2KF6 A;  4AEQ A;  3I56 3;  2YFL B;  1BIR A;  1GY7 A;  1W6Y A;  3K9M C;  4I4K A;  3RGA A;  4EYC A;  2Z7A A;  1A2P A;  1D6Z A;  3GZR A;  4RZM A;  3SXX A;  5M1A A;  1Q40 A;  2F56 A;  1LVN A;  3RGR A;  3D4A A;  2P0X A;  1W5Z A;  3CME 3;  1NB5 I;  1UUG B;  1JKG B;  1JBS A;  1IYY A;  1VQO 3;  4EBG A;  2MC8 A;  1RCL A;  6GSP A;  1G96 A;  1JB5 A;  1STD A;  3FKA A;  4HM3 B;  3CCV 3;  2FNQ A;  3OW2 2;  1Q81 4;  1UDI I;  1RN7 A;  3I0Y A;  3LT9 A;  4HM4 B;  1DMN A;  3K7C A;  4L8O A;  1ISK A;  3KN4 A;  1DVD A;  2AAD A;  3M8C A;  2W56 A;  3LTA A;  3CCR 3;  2W9Q A;  8RNT A;  4RNZ A;  4XBY A;  1T5Y A;  1A67 A;  2QEX 3;  3RDE A;  4RBN A;  2ML5 A;  2ML6 A;  4K90 B;  1TP6 A;  4GB5 A;  3CPW 2;  1R4Y A;  2BNG A;  2P0M A;  2GEX A;  4FCZ A;  1UUV B;  3WOF B;  3V92 A;  5AEU B;  5IEO A;  1YI2 3;  1YIJ 3;  3HIG A;  4LGQ A;  1BNF A;  1G02 A;  1GD4 A;  2CWT A;  2F98 A;  3F14 A;  2CWU A;  3DGM A;  5D82 A;  1O7M B;  1RJO A;  3JUM A;  5AYS C;  4J5K A;  4PEJ A;  1TIJ A;  1I3I A;  3DGY A;  3NXJ A;  5A0O B;  5IER A;  3WA3 A;  1FGQ A;  4O2H A;  3O8Y A;  2IA7 A;  4CDL A;  1BNJ A;  2GU3 A;  3A76 A;  3SED A;  1Q40 B;  1Q42 A;  3UB1 A;  1RGF A;  1YJ9 3;  1W00 A;  4KFF A;  5IW9 A;  3UL6 A;  4FMA A;  1IT8 A;  1WMO A;  3F9S A;  3GWR A;  4NHF A;  2IY2 A;  1K73 4;  2XFT A;  2WOF A;  2OTJ 3;  2IYJ A;  2CKF B;  2IUJ A;  3S27 A;  1BNS A;  2E2U A;  4MMY B;  1I8V A;  3SOY A;  1JBT A;  9RNT A;  1KQS 2;  1MGW A;  3CCJ 3;  1RMS A;  4MEI A;  2ZHX B;  1EKM A;  2BT3 A;  1W4N A;  3EE1 A;  3KII A;  5CF2 A;  1OHS A;  1STF I;  2W56 B;  3EHC A;  1U8C B;  3ER7 A;  3CPO A;  3CCQ 3;  1ASK A;  1E97 A;  1NB3 I;  3CCM 3;  5BVB A;  3K5T A;  1IVV A;  5G2G A;  1YJW 3;  1SJW A;  3F7S A;  3KKG A;  4BL3 A;  4EW5 A;  2BHM A;  1S5A A;  2CW9 A;  3AGO A;  3BNC A;  2CC3 A;  4HZB B;  1LNI A;  2UUG C;  3E99 A;  3PGB A;  1EQK A;  2XFS A;  2GBX B;  5IG3 A;  1T2I A;  1VQL 3;  3JVC A;  4MJD A;  1LOV A;  1YVS A;  1IVW A;  1JN5 A;  2FXT A;  2KCD A;  2XRX B;  2Z76 A;  4HVN A;  5GSP A;  1W7C A;  2LQV A;  1NJI 4;  1JB2 A;  1FGR A;  2P09 A;  3WOD G;  1QAK A;  3NQZ A;  3VGN A;  1IK3 A;  2QA4 3;  1AVL A;  1EA2 A;  2AAE A;  1M90 4;  1GMQ A;  3CCS 3;  1Q82 4;  2YFJ B;  3KE7 A;  4NPB A;  1GYB A;  2KF3 A;  3IMA B;  4OUQ A;  2CFL A;  3WMD A;  7GSP A;  3ALA A;  3NBJ A;  3NM7 A;  1YGE A;  4FCJ A;  4XBT A;  1UCL A;  2XSH B;  2CX0 A;  4WHA A;  4X2H A;  3KFQ C;  1BU4 A;  4LYL B;  3DM8 A;  2H0H A;  2W9P A;  1LRA A;  1BSB A;  1VQM 3;  3MSO A;  1VQ7 3;  1HKX A;  5IG0 A;  3AMO B;  1O7H B;  2CH9 A;  2WGO A;  3DH2 A;  4XBX A;  2BMR B;  3DGO A;  3D5I A;  4R9K A;  1YVB I;  3VSY A;  1VQP 3;  2KF5 A;  5ELU A;  4R9L A;  1RGC A;  2F4Y A;  1AR0 A;  2WOH A;  1Q7Y 4;  1E3V A;  4R1K A;  4HM0 B;  1UI7 A;  4FMB A;  1OHO A;  2KAA A;  4GL6 A;  2IUK A;  3Q2P A;  3S5C A;  4WFO A;  1I2F A;  2O9U X;  1Z1S A;  2Y73 A;  3N9H A;  3CCL 3;  4N6L A;  1WMN A;  4KFE A;  1GMR A;  4CCV A;  2Y74 A;  2W6J H;  1JN5 B;  1I70 A;  4N3V A;  4XDV A;  5LC7 A;  7STD A;  2HMJ B;  2R4I A;  5BIR A;  5DRV A;  1KWI A;  3CU3 A;  2MF7 A;  5ELJ A;  1FGT A;  3EJV A;  3G8Z A;  2UGI A;  5KP3 A;  5IEP A;  3OWS A;  3MG2 A;  3LT8 A;  2JDI H;  3S29 A;  1VQ6 3;  1SIH A;  1ROV A;  2L4V A;  3V98 A;  1IVX A;  1FGM A;  2HMK B;  3DXO A;  3HZP A;  3LML A;  1QJG A;  3EBT A;  3EN1 B;  1NDO B;  1A2K A;  4HM6 B;  1EUI C;  1X1X A;  1UW1 A;  1NO3 A;  1FUW A;  1Q9E A;  3EQQ B;  3H51 A;  3B7C A;  1I2G A;  1BRI A;  1IU7 A;  1NU3 A;  1RGG A;  1VQQ A;  2CWV A;  3OWU A;  1FZU A;  1PY3 A;  4HZ9 B;  2GBW B;  1MWS A;  3B8L A;  1VQ8 3;  1NNV A;  5EQL A;  5LC6 A;  1DE3 A;  1RNT A;  3F8H A;  2XGN A;  4ORL A;  1FUT A;  2P05 A;  3MWZ A;  3ROB A;  2A15 A;  1CEW I;  3D9R A;  3J7Y d;  1WMP A;  2BMQ B;  1IV9 A;  1TFO A;  1A90 A;  5RNT A;  1WTH A;  3B4P A;  5M19 A;  1BSC A;  2YX9 A;  1K9M 4;  1IQX A;  3MKI A;  3LTB A;  4IIA A;  3CC4 3;  1MGR A;  2HMO B;  2OOV A;  1BAO A;  1RCK A;  5TGN A;  2BIR A;  1O7G B;  3OWY A;  1M9G A;  3FZW A;  3G71 3;  4LMI A;  2HMM B;  5JPP A;  3EX9 A;  3LTC A;  1LOW A;  3N8B A;  4KFD A;  1BRN L;  1ROA A;  3NUV A;  3SX1 A;  4LEH A;  1RKY A;  3ZG0 A;  4I5Q A;  4EV5 A;  4XB5 A;  2KF4 A;  3UJM A;  4HM2 B;  1BRH A;  1AQZ A;  1RNB A;  4EV2 A;  5IG5 A;  1WQL B;  1GD3 A;  3GSP A;  3DZL A;  3UNL A;  4KVH A;  1IDP A;  1JZO A;  1SAR A;  3T0U A;  3SLU A;  4J9A A;  3AMO A;  1S72 3;  1O7N B;  2K54 A;  1BOX A;  1RGE A;  3K63 A;  4GHO A;  4H3U A;  2F99 A;  1D6Y A;  1CYV A;  1OGZ A;  3NHX A;  4R4K A;  1BGS A;  1UCK A;  5KP1 A;  1OUN A;  3CC7 3;  3FF2 A;  1EEJ A;  1M1X B;  4QWT A;  5AI1 A;  1GSP A;  3FGY A;  3NV0 A;  1KD1 4;  1BUJ A;  3HI7 A;  4STD A;  2FGT A;  3MYT A;  1YGW A;  1UI8 A;  1IT7 A;  1OAC A;  4O3V A;  3CXC 2;  2W03 A;  3TDG A;  1JBR A;  2RSX A;  3EB8 A;  2BMO B;  4O02 B;  2E2V A;  3BNE A;  3BB9 A;  3KSE D;  4N6V 0;  3VF1 A;  5BU4 A;  3DY5 A;  4N6M A;  1QAF A;  1SPU A;  4AKY A;  1RGL A;  5CLK A;  1E3R A;  2BU4 A;  2K3D A;  4N6T A;  3T8N A;  5IEN A;  2CX1 A;  2CFG A;  4GSP A;  3H3H A;  1X1Y A;  3CCU 3;  3I55 3;  1IVU A;  1BSA A;  2SBL A;  1GMP A;  5AEW B;  1CH0 A;  4EXR A;  1TJD A;  3OV4 A;  2CHC A;  3L0R A;  4XM4 A;  3LZA A;  1B20 A;  3FG1 A;  1BRJ A;  1LOY A;  5AIF A;  5BXQ A;  3MG1 A;  1RSN A;  3F7X A;  1MWT A;  1SQW A;  3D5G A;  2XF3 A;  3GRD A;  4RNT A;  1RGK A;  3WHO A;  1RHL A;  1K28 A;  3B4O A;  2GEY A;  2GSP A;  3D79 A;  3KZT A;  4DKI A;  3NX0 A;  3QK9 A;  3Q3F A;  1PFP A;  1X1U A;  1FGO A;  2J8X B;  5HGR A;  3RNT A;  2HMN B;  3DMC A;  2UX0 A;  2OTL 3;  1N8Q A;  3PCS A;  1DMQ A;  1WNH A;  1RTU A;  3OXA A;  1JNQ A;  3WR2 A;  1I0V A;  1LQG C;  2C10 A;  2ZL8 A;  3FCS B;  3KCH A;  3NV0 B;  2CFW A;  8CHO A;  1RRH A;  5KP4 A;  1RN4 A;  2OWP A;  1OHP A;  1O7P B;  1QVG 2;  1VQ9 3;  1V58 A;  3JUN A;  3GAX A;  1W02 A;  3U97 A;  1TUH A;  2F5M A;  3S67 A;  3DUK A;  2RNT A;  3LTD A;  3T8U A;  4BIR A;  1BNE A;  1DMM A;  3BLZ A;  4MMZ B;  3V99 A;  1W6G A;  4BTW A;  3LYG A;  4IT7 A;  5STD A;  3CMA 3;  4HM1 B;  1UCI A;  1N9E A;  3F40 A;  3K0Z A;  1UGI A;  2RGQ A;  3IPT A;  5FGO A;  1VQK 3;  2B24 B;  3ZG5 A;  1QVF 2;  2PZV A;  3FLJ A;  3G6E 3;  1KC8 4;  1GY6 A;  1NWW A;  1ULI B;  1LNH A;  1EG9 B;  1YJN 3;  2WGQ A;  3BNB A;  1BNG A;  2K0M A;  1GOU A;  1MNL A;  2OOV C;  1BNR A;  1B3S A;  5G1L A;  4OK0 A;  2E2T A;  2H0I A;  4LSO A;  4JF8 A;  3STD A;  1BSD A;  6STD A;  1ZX2 A;  1V57 A;  1BRG A;  1GY5 A;  1JV2 B;  2IMJ A;  3OX9 A;  4LZI A;  5AYR B;  1YIT 3;  3QRD A;  1I3F A;  3SYU A;  1X1W A;  3KSP A;  2H0G A;  3IJE B;  3DGN A;  3FF0 A;  1BSE A;  5D83 A;  4HYZ A;  1B27 A;  2XR8 B;  3HK4 A;  3EF8 A;  5DRE A;  2W04 A;  1TRQ A;  1CQS A;  1AVK A;  1VQ5 3;  1RLS A;  4FMC A;  3BND A;  4WYK A;  3WDG B;  3WOE B;  3X3Y A;  4BTY A;  4EC6 A;  3JUO A;  1MWR A;  1RDS A;  2F5W A;  3PZW A;  1FYS A;  3GZB A;  2OQE A;  2M7O A;  1US1 A;  1ZS7 A;  2XEP A;  2KRT A;  1J2B A;  5AIG A;  1JZD A;  4KT3 B;  3CCE 3;  3G4S 3;  3URP A;  4BTX A;  5CK6 A;  1L5G B;  1TFK A;  4HAA A;  1B2S A;  2V1L A;  1LOX A;  4U13 A;  1HU9 A;  1BAN A;  2KXG A;  4WWU C;  5AII A;  3UL5 A;  4BL2 A;  2QGU A;  1VQN 3;  1T3B A;  2QIY A;  1OF5 A;  3MHE A;  5G1K A;  3MPH A;  5M18 A;  4MMX B;  3HX8 A;  4XDW A;  3FH1 A;  1AV4 A;  3SVA A;  2WO0 A;  1RRL A;  1N8R 4;  2JQ5 A;  1M1K 4;  1B2Z A;  1Y4K A;  3D3L A;  5FW5 A;  1CYU A;  1AY7 A;  3LH4 A;  4H61 A;  3EN8 A;  2F86 B;  4HKV B;  2O3O A;  2RBI A;  1JB4 A;  3G0K A;  1OGX A;  1U5O A;  1GS3 A;  2XSO B;  1K8A 4;  1VZZ A;  4NRE A;  3NBR A;  4N6O B;  3DGL A;  2C11 A;  2GXF A;  1B2U A;  1HZ1 A;  3G16 A;  3PCR A;  3X3Z A;  1G0T A;  1BUQ A;  1JRQ A;  3X40 A;  1GOV A;  3FG4 A;  4WYK B;  4R80 A;  4K1V A;  3FG3 A;  3HOH A;  4HJL B;  3N54 B;  2YFI B;  1F8N A;  3LXU X;  1DYU A;  1MOL A;  2Z6B A;  5D81 A;  2CK3 H;  2HOH A;  2ZA4 A;  2ZDJ A;  3A5E A;  3X42 A;  4AKZ A;  1W2B 2;  5IG4 A;  1N9J A;  4K1U A;  1GOY A;  1MWU A;  4FR9 A;  2BO9 B;  3U1W A;  2XH9 A;  1W2Z A;  3X41 A;  1B2M A;  4IPB A;  1VQ4 3;  2D42 A;  1I2E A;  5CF1 A;  3JUQ A;  2INX A;  4ILF A;  3BIR A;  2XGL A;  2Q07 A;  2Z77 A;  1I0X A;  1OF5 B;  4X2O A;  3CNX A;  2SAR A;  2W0Q A;  1DET A;  2LYX A;  4J8T A;  3S28 A;  1BRK A;  5IF6 A;  2OCT A;  1R4C A;  4L8P A;  3Q1C A;  1D6U A;  3Q90 A;  4HOH A;  1TU5 A;  1OH0 A;  1UUW B;  3AHW A;  3PXM A;  1YHQ 3;  1RN1 A;  1FUS A;  3NQY A;  2CFK A;  4J5G A;  3X3X A;  2CG0 A;  3PS8 A;  1PYL A;  2PNC A;  3AGN A;  2D1W A;  2L1S A;  3GZX B;  1BNI A;  1B2X A;  6RNT A;  1SII A;  1FA3 A;  2GU1 A;  2HML B;  1A2V A;  4HM7 B;  5EEO A;  1ZO2 A;  1KSI A;  2I9W A;  3CNM A;  1W01 A;  4FCM A;  1N5H A;  3NBB A;  1TTO A;  2P38 A; 
#chains in the Genus database with same CATH homology
 3ECF A;  3JUP A;  5I97 A;  2CFD A;  1JJ2 2;  4K61 A;  3SOA A;  1Q86 4;  4JRF A;  3GZY B;  4N6U A;  5CXO A;  1LXE A;  5EVH A;  1W6C A;  1JKG A;  2RFR A;  4Q53 A;  1N5P A;  1QMA A;  1C7H A;  1IQY A;  1IQ8 A;  1OCV A;  3NM2 A;  3CD6 3;  5AIH A;  1ULJ B;  4OVM A;  4WP5 A;  5JBS A;  4RNY A;  2W2C A;  3EBY A;  4O8S A;  1O7W B;  2OQE C;  4FMD A;  3CC2 3;  2STD A;  1OPY A;  3EC9 A;  1K41 A;  1IV7 A;  3F8X A;  4N6N B;  4L7K A;  2CG1 A;  3WA2 X;  1QAL A;  2RCD A;  3PYJ A;  1V74 A;  4G1M B;  3HII A;  3FSD A;  1PU4 A;  4ZM8 A;  3LOY A;  3MG3 A;  2B1X B;  4HM8 B;  4TX4 A;  1DVC A;  2CIU A;  4HM5 B;  4HBR A;  4KZ1 A;  5JPU A;  4AEQ A;  2YFL B;  1GY7 A;  3K9M C;  1W6Y A;  4I4K A;  3RGA A;  4EYC A;  2Z7A A;  1D6Z A;  3GZR A;  4RZM A;  3SXX A;  1Q40 A;  1LVN A;  3RGR A;  2P0X A;  1W5Z A;  3CME 3;  1NB5 I;  1JKG B;  1VQO 3;  4EBG A;  2MC8 A;  1G96 A;  1JB5 A;  1STD A;  3FKA A;  4HM3 B;  3CCV 3;  2FNQ A;  3OW2 2;  1Q81 4;  1RN7 A;  3I0Y A;  3LT9 A;  4HM4 B;  1DMN A;  3K7C A;  4L8O A;  1ISK A;  3KN4 A;  1DVD A;  3M8C A;  2W56 A;  3LTA A;  3CCR 3;  2W9Q A;  4RNZ A;  4XBY A;  1T5Y A;  1A67 A;  2QEX 3;  3RDE A;  4RBN A;  2ML5 A;  2ML6 A;  4K90 B;  1TP6 A;  4GB5 A;  3CPW 2;  2BNG A;  2P0M A;  2GEX A;  4FCZ A;  1UUV B;  3WOF B;  3V92 A;  5AEU B;  5IEO A;  1YI2 3;  1YIJ 3;  3HIG A;  4LGQ A;  1GD4 A;  2CWT A;  2F98 A;  5D82 A;  3F14 A;  2CWU A;  3DGM A;  1O7M B;  1RJO A;  3JUM A;  5AYS C;  4PEJ A;  1TIJ A;  3NXJ A;  5A0O B;  5IER A;  3WA3 A;  1FGQ A;  4O2H A;  3O8Y A;  2IA7 A;  4CDL A;  2GU3 A;  3A76 A;  3SED A;  1Q40 B;  1Q42 A;  3UB1 A;  1YJ9 3;  1W00 A;  4KFF A;  5IW9 A;  3UL6 A;  4FMA A;  1IT8 A;  1WMO A;  3F9S A;  3GWR A;  4NHF A;  1K73 4;  2XFT A;  2WOF A;  2OTJ 3;  2CKF B;  2IUJ A;  3S27 A;  2E2U A;  4MMY B;  3SOY A;  1KQS 2;  3CCJ 3;  4MEI A;  1EKM A;  2BT3 A;  1W4N A;  3EE1 A;  3KII A;  5CF2 A;  1OHS A;  1STF I;  2W56 B;  3EHC A;  1U8C B;  3ER7 A;  3CPO A;  3CCQ 3;  1ASK A;  1E97 A;  1NB3 I;  3CCM 3;  5BVB A;  3K5T A;  1IVV A;  5G2G A;  1YJW 3;  1SJW A;  3F7S A;  3KKG A;  2BHM A;  1S5A A;  2CW9 A;  3BNC A;  2CC3 A;  4HZB B;  3E99 A;  3PGB A;  1EQK A;  2XFS A;  2GBX B;  5IG3 A;  1VQL 3;  3JVC A;  4MJD A;  1IVW A;  1JN5 A;  2FXT A;  2KCD A;  2XRX B;  2Z76 A;  4HVN A;  1W7C A;  2LQV A;  1NJI 4;  1JB2 A;  1FGR A;  2P09 A;  3WOD G;  1QAK A;  3NQZ A;  3VGN A;  1IK3 A;  2QA4 3;  1AVL A;  1EA2 A;  1M90 4;  3CCS 3;  1Q82 4;  2YFJ B;  3KE7 A;  4OUQ A;  1GYB A;  3WMD A;  3IMA B;  3I56 3;  2CFL A;  3ALA A;  3NBJ A;  3NM7 A;  1YGE A;  4FCJ A;  4XBT A;  2XSH B;  4WHA A;  4X2H A;  3KFQ C;  3DM8 A;  2W9P A;  1VQM 3;  3MSO A;  1VQ7 3;  1HKX A;  5IG0 A;  3AMO B;  1O7H B;  2CH9 A;  2WGO A;  4XBX A;  2BMR B;  3DGO A;  4R9K A;  1YVB I;  3VSY A;  1VQP 3;  5ELU A;  4R9L A;  1AR0 A;  2WOH A;  1Q7Y 4;  1E3V A;  4R1K A;  4HM0 B;  1UI7 A;  4FMB A;  1OHO A;  4GL6 A;  2IUK A;  3Q2P A;  3S5C A;  4WFO A;  2O9U X;  1Z1S A;  2Y73 A;  3N9H A;  3CCL 3;  4N6L A;  1WMN A;  4KFE A;  4CCV A;  2Y74 A;  2W6J H;  1JN5 B;  4N3V A;  4XDV A;  5LC7 A;  7STD A;  2HMJ B;  2R4I A;  5DRV A;  1KWI A;  3CU3 A;  2MF7 A;  5ELJ A;  1FGT A;  3EJV A;  3G8Z A;  5KP3 A;  5IEP A;  3OWS A;  3MG2 A;  3LT8 A;  2JDI H;  3S29 A;  1VQ6 3;  1SIH A;  1ROV A;  3V98 A;  1IVX A;  1FGM A;  2HMK B;  3DXO A;  3HZP A;  3LML A;  1QJG A;  3EBT A;  3EN1 B;  1NDO B;  1A2K A;  4HM6 B;  1UW1 A;  1NO3 A;  1FUW A;  3EQQ B;  3H51 A;  3B7C A;  1NU3 A;  1IU7 A;  2CWV A;  3OWU A;  4HZ9 B;  2GBW B;  3B8L A;  1VQ8 3;  5EQL A;  5LC6 A;  3F8H A;  2XGN A;  4ORL A;  2P05 A;  3MWZ A;  3ROB A;  2A15 A;  1CEW I;  3D9R A;  3J7Y d;  1WMP A;  2BMQ B;  1IV9 A;  1TFO A;  1A90 A;  3B4P A;  1WTH A;  2YX9 A;  1K9M 4;  1IQX A;  3MKI A;  3LTB A;  4IIA A;  3CC4 3;  2HMO B;  2OOV A;  5TGN A;  1O7G B;  3OWY A;  1M9G A;  3FZW A;  3G71 3;  4LMI A;  2HMM B;  5JPP A;  3EX9 A;  3LTC A;  3N8B A;  4KFD A;  1ROA A;  3NUV A;  3SX1 A;  4LEH A;  1RKY A;  4EV5 A;  4XB5 A;  3UJM A;  4HM2 B;  5IG5 A;  1WQL B;  1GD3 A;  3DZL A;  3UNL A;  4KVH A;  1IDP A;  3T0U A;  3SLU A;  4J9A A;  3AMO A;  1S72 3;  1O7N B;  2K54 A;  3K63 A;  4H3U A;  2F99 A;  1D6Y A;  1CYV A;  1OGZ A;  3NHX A;  4R4K A;  5KP1 A;  1OUN A;  3CC7 3;  3FF2 A;  1M1X B;  4QWT A;  5AI1 A;  3FGY A;  3NV0 A;  1KD1 4;  3HI7 A;  4STD A;  2FGT A;  3MYT A;  1UI8 A;  1IT7 A;  1OAC A;  4O3V A;  3CXC 2;  2W03 A;  3TDG A;  2RSX A;  3EB8 A;  2BMO B;  4O02 B;  2E2V A;  3BNE A;  3BB9 A;  3KSE D;  4N6V 0;  3VF1 A;  3DY5 A;  4N6M A;  1QAF A;  1SPU A;  4AKY A;  5CLK A;  1E3R A;  4N6T A;  3T8N A;  5IEN A;  2CFG A;  3H3H A;  3CCU 3;  3I55 3;  1IVU A;  2SBL A;  5AEW B;  4EXR A;  3OV4 A;  2CHC A;  3L0R A;  4XM4 A;  3LZA A;  3FG1 A;  5AIF A;  5BXQ A;  3MG1 A;  3F7X A;  3GRD A;  1SQW A;  2XF3 A;  3X3Z A;  3B4O A;  1K28 A;  2GEY A;  3KZT A;  3NX0 A;  3QK9 A;  1PFP A;  1FGO A;  5HGR A;  2HMN B;  3DMC A;  2UX0 A;  2OTL 3;  1N8Q A;  3PCS A;  1DMQ A;  1WNH A;  3OXA A;  1JNQ A;  2ZL8 A;  3NV0 B;  2C10 A;  3FCS B;  2CFW A;  8CHO A;  1RRH A;  5KP4 A;  2OWP A;  1OHP A;  1O7P B;  1QVG 2;  1VQ9 3;  3JUN A;  3GAX A;  1W02 A;  3U97 A;  1TUH A;  3S67 A;  3DUK A;  3LTD A;  3T8U A;  3BLZ A;  1DMM A;  4MMZ B;  3V99 A;  1W6G A;  4BTW A;  3LYG A;  4IT7 A;  5STD A;  3CMA 3;  4HM1 B;  3F40 A;  1N9E A;  3K0Z A;  5FGO A;  2RGQ A;  3IPT A;  1VQK 3;  1QVF 2;  2B24 B;  2PZV A;  3FLJ A;  3G6E 3;  1KC8 4;  1GY6 A;  1NWW A;  1ULI B;  1LNH A;  1EG9 B;  1YJN 3;  2WGQ A;  3BNB A;  2K0M A;  1MNL A;  2OOV C;  4OK0 A;  2E2T A;  4LSO A;  3STD A;  4JF8 A;  6STD A;  1ZX2 A;  1GY5 A;  1JV2 B;  2IMJ A;  3OX9 A;  4LZI A;  5AYR B;  1YIT 3;  3QRD A;  3KSP A;  3IJE B;  3DGN A;  3FF0 A;  5D83 A;  4HYZ A;  2XR8 B;  3HK4 A;  3EF8 A;  5DRE A;  2W04 A;  1CQS A;  1AVK A;  1VQ5 3;  4FMC A;  4WYK A;  3BND A;  3WDG B;  3WOE B;  3X3Y A;  4BTY A;  4EC6 A;  3JUO A;  3PZW A;  3GZB A;  2OQE A;  2M7O A;  1US1 A;  2XEP A;  2KRT A;  1J2B A;  5AIG A;  3CCE 3;  3G4S 3;  4BTX A;  5CK6 A;  1L5G B;  1TFK A;  1N5H A;  4EV2 A;  2V1L A;  1LOX A;  4U13 A;  1HU9 A;  2KXG A;  4WWU C;  5AII A;  3UL5 A;  1VQN 3;  2QGU A;  2QIY A;  1OF5 A;  3MHE A;  3MPH A;  4MMX B;  3HX8 A;  4XDW A;  3FH1 A;  1AV4 A;  3SVA A;  2WO0 A;  1RRL A;  1N8R 4;  2JQ5 A;  1M1K 4;  1Y4K A;  3D3L A;  5FW5 A;  1CYU A;  3LH4 A;  4H61 A;  3EN8 A;  2F86 B;  4HKV B;  2O3O A;  1JB4 A;  3G0K A;  1OGX A;  1U5O A;  1GS3 A;  2XSO B;  1K8A 4;  1VZZ A;  4NRE A;  3NBR A;  4N6O B;  3DGL A;  2C11 A;  2GXF A;  3G16 A;  3PCR A;  1BUQ A;  1JRQ A;  3X40 A;  3FG4 A;  4WYK B;  4R80 A;  4K1V A;  3FG3 A;  4HJL B;  3N54 B;  2YFI B;  1F8N A;  3LXU X;  1DYU A;  1MOL A;  2Z6B A;  5D81 A;  2CK3 H;  3X42 A;  4AKZ A;  2ZDJ A;  1W2B 2;  5IG4 A;  1N9J A;  4K1U A;  3U1W A;  4FR9 A;  2BO9 B;  2XH9 A;  1W2Z A;  3X41 A;  4IPB A;  1VQ4 3;  2D42 A;  5CF1 A;  3JUQ A;  2INX A;  2XGL A;  2Q07 A;  2Z77 A;  1OF5 B;  4X2O A;  3CNX A;  2W0Q A;  2LYX A;  4J8T A;  3S28 A;  5IF6 A;  2OCT A;  1R4C A;  4L8P A;  3Q1C A;  1D6U A;  3Q90 A;  1TU5 A;  1YHQ 3;  1OH0 A;  1UUW B;  3PXM A;  3NQY A;  2CFK A;  3X3X A;  2CG0 A;  3PS8 A;  2PNC A;  2D1W A;  3GZX B;  1SII A;  1FA3 A;  2GU1 A;  2HML B;  1A2V A;  4HM7 B;  5EEO A;  1ZO2 A;  1KSI A;  2I9W A;  3CNM A;  1W01 A;  4FCM A;  2L4V A;  3NBB A;  2P38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...