5FGOA

Crystal structure of d. melanogaster pur-alpha repeat iii.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
PEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCEKMKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords CG1507-PB, isoform B
publication title Structural basis of nucleic-acid recognition and double-strand unwinding by the essential neuronal protein Pur-alpha.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 13
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.700 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5fgoA00
5FGOA 3N8BA 3NM7A
chains in the Genus database with same CATH superfamily
4NREA 3CXC2 1GOVA 3F40A 4HM0B 1TFKA 2E2TA 3IMAB 5TGNA 2F4YA 1S723 1DMNA 1BNJA 1UCIA 3DY5A 3UJMA 5M19A 3CCQ3 1DETA 4GL6A 2K54A 4NHFA 4WWUC 2YFLB 6RNTA 2ZL8A 1FYSA 3FG1A 4HBRA 2W9QA 3LMLA 1EQKA 3CD63 2QGUA 1DVCA 1WTHA 4HAAA 1AY7A 3T8NA 1W2B2 3AMOA 7GSPA 5IENA 2PZVA 2W9PA 1O7NB 3NV0A 1RGHA 3GWRA 4WYKA 1RNBA 1RMSA 3WDGB 3DGOA 3KSED 2P0XA 1Q7HA 1TP6A 4KT3B 3SVAA 4HOHA 1VQ43 1N9JA 1I2FA 3EN8A 1RTUA 3KN4A 4R80A 4XBTA 3T0UA 4DKIA 4MMXB 1QAFA 3DGLA 3TDGA 1I0VA 1LXEA 4EV2A 3UB1A 1GMPA 1GMRA 1JKGB 3K0ZA 3WMDA 1KC84 3Q2PA 2Y73A 3DMCA 1W6YA 1BU4A 5DREA 1BUQA 3T8UA 2CG0A 1JBRA 4LYLB 3ZG0A 1A2PA 2LYXA 5IEOA 2UX0A 1AV4A 2H0IA 2CFLA 2IUJA 3NQZA 1VQ93 2CX1A 1US1A 1K41A 3LOYA 1DYUA 3CCV3 1MGRA 1OHSA 1TRPA 1RN4A 2UUGC 3GZYB 4IPBA 4LZIA 3AHSA 5LC7A 3AHWA 3STDA 3MYTA 1YVBI 3Q1CA 3QK9A 3X3XA 1SIIA 1N5PA 1LVNA 2XFSA 1TTOA 1FGQA 1HZ1A 1UCKA 1ZS7A 3FGYA 1ZGXA 1ROAA 3FLJA 5FGOA 3WOFB 2XSOB 4Q53A 1YIT3 1YJ93 2OTL3 1GY5A 2OOVC 3BNEA 4N6TA 3X41A 2BU4A 2QIYA 3EE1A 2BMRB 2Z76A 1I2EA 1UDII 5D83A 5M1AA 1UW1A 1RN1A 1I8VA 6STDA 2KXGA 3AGNA 3BNCA 3HOHA 4CCVA 3A5EA 1YJN3 2UGIA 3BNDA 5ELJA 1QAKA 4QWTA 3L0RA 1VQO3 3ALAA 1SQWA 2Y74A 2RSXA 2IUKA 2W56B 2CIUA 1GMQA 2RNTA 3LH4A 3LTAA 3DXOA 2BT3A 1VQK3 1NB5I 1VQ63 2MF7A 2XSHB 2K0MA 1G0TA 1L5GB 1WMOA 1TU5A 2GEXA 2Z6BA 5BU4A 3EJVA 3GZRA 4FCJA 4ILFA 4R4KA 4O2HA 1RDSA 1EG9B 5BXQA 2R4IA 1Q40A 2XH9A 1JN5A 1YIJ3 3FSDA 4HM7B 4LSOA 3BB9A 1BRIA 4HYZA 2JQ5A 5HOHA 5RNTA 2O9UX 5JPUA 3LZAA 1I3FA 1HU9A 1HYFA 3VF1A 4L8PA 2XEPA 1BUJA 3OX9A 2RBIA 1LQMB 1Q814 1UGIA 3S28A 1BNEA 1OHOA 1B27A 1I0XA 2KF3A 4GSPA 4HM2B 2KF4A 2STDA 3KIIA 5DRVA 3CC43 1B2ZA 7STDA 2P0MA 3KE7A 4GB5A 3NUVA 1IVUA 1QALA 2RGQA 1RCLA 2YFIB 2W04A 4N6UA 3CPW2 1I3IA 1LRAA 1MWRA 1K734 5IERA 1T3BA 1RN7A 1W6GA 1BGSA 2WGQA 1RGKA 1F8NA 2L4VA 3OWUA 5G1KA 2OOVA 1JBTA 2C4BA 4FMDA 2YFJB 4OUQA 5M18A 3AGOA 1BRSA 1ASKA 2CX0A 3CNMA 3CCL3 1YI23 5EQLA 5G1LA 1UI8A 2WGOA 3NBJA 2ZDJA 3LT8A 5CXOA 1C7HA 5EVHA 3CC23 2KF5A 1RGEA 4RBNA 2ML6A 1BSEA 1GD3A 1U5OA 4FR9A 5BIRA 1ZO2A 2F99A 3CCR3 1ISKA 1LOYA 1OACA 4BTXA 1GS3A 4LMIA 3N8BA 1BRHA 1GSPA 1V58A 2HMJB 1GY7A 2HMMB 3BNBA 3LTBA 4WFOA 2JDIH 1RKYA 3VGNA 3WR2A 2E2VA 1VQ53 1BSDA 4PEJA 1N5HA 1JJ22 1YNVX 3CNXA 3I563 1FGTA 1NDOB 4JRFA 2Z7AA 4XBXA 3U97A 1BIRA 2CFWA 3KFQC 1DMQA 4XB5A 1RGFA 4WHAA 8RNTA 1RGCA 3MHEA 3RDEA 4HM3B 5AIHA 4XDVA 5KP3A 1NWWA 1QMAA 3H3HA 4J8TA 5AIGA 2CHCA 5AEWB 3LXUX 3EB8A 1VQM3 3EN1B 3KSPA 1T2HA 2FNQA 2IMJA 1BNIA 1OHPA 2F5WA 2Z77A 4KZ1A 5AIIA 3FCSB 3SEDA 1K8A4 2WOFA 1QVF2 1ROVA 3GZBA 1GOUA 3CU3A 1B2SA 2CK3H 1VQ73 1M904 2KCDA 1C54A 3N54B 5GSPA 1CYVA 2WO0A 1OF5B 1IVXA 2YX9A 3O8YA 4OK0A 1OGZA 1FZUA 5D82A 4I5QA 5AI1A 1R4YA 2RCDA 3PS8A 4XBYA 3URPA 1OGXA 1FA3A 1X1WA 2BO9B 1BSCA 1JNQA 3EQQB 2W56A 3G0KA 4IT7A 1PU4A 1GD4A 1BRJA 2F5MA 1M9GA 2OQEC 3NBRA 5EEOA 1FUTA 2ZHXB 2W03A 3D4AA 4O02B 4EC6A 1IU7A 3WOEB 1NJI4 1CQSA 2OCTA 3F8HA 1JV2B 1M1XB 1D6UA 1WMNA 2H0HA 3FG4A 2R41A 2ZA4A 3MG2A 4X2HA 5AYRB 3WHOA 4EV5A 3WA3A 3J7Yd 2D42A 1STFI 4HM6B 1W6CA 3BIRA 4H3UA 3BLZA 1A2VA 3F14A 1MGWA 2XFTA 2C11A 3NHXA 3ZFZA 2RFRA 1Q824 3HK4A 3CCU3 3CPOA 1TRQA 5CK6A 3B4PA 2BHMA 2CFDA 2FGTA 3S67A 4L8OA 3WA2X 3DZLA 1EKMA 4KVHA 1X1UA 2GEYA 3EX9A 1LNIA 4FCZA 4HM5B 4MMZB 1W4NA 1NB3I 1FW7A 1Q9EA 2M7OA 1A2KA 3HX8A 1K28A 3JUNA 4BTWA 3X42A 2GBXB 3AMOB 4CJNA 4L7KA 1TFOA 8CHOA 1O7MB 2E2UA 1RRLA 1RRHA 2XR8B 4X2OA 3NV0B 4FCMA 4HM8B 3S29A 3G713 1TJDA 2CKFB 1AR0A 1MNLA 1B3SA 3DGYA 1ULIB 7RNTA 1IK3A 1GOYA 4G1MB 1LOXA 3D79A 1IV9A 1BRNL 1YHQ3 1CYUA 1LOWA 4RZMA 4HM1B 3FZWA 5AIFA 4WP5A 2KRTA 5FW5A 3JUMA 3LTDA 1JBSA 5AEUB 3GSPA 4CPKA 2C10A 2B1XB 1LNHA 4CDLA 4N6OB 2OQEA 3A76A 1HKXA 1W00A 3KCHA 5BVBA 5CF2A 2CFKA 1VZZA 1AVLA 2O3OA 4R9LA 4HZBB 4R9KA 3DGMA 3HIGA 3RGRA 4EBGA 2K3DA 4EW5A 3MG1A 1O7PB 1JB2A 5JPPA 4NPBA 5IG3A 4J9AA 2XGNA 3SX1A 1UCJA 1BOXA 4K1VA 1RGGA 2XRXB 1VQN3 1SIHA 4LGQA 1NU3A 3H51A 4U13A 1MWUA 2MC8A 2HMOB 4KFFA 1GYBA 3ER7A 4HM4B 1V57A 4BL3A 3JUPA 2W2CA 4JF8A 3M8CA 2D1WA 1X1XA 2AADA 1VQL3 3Q90A 4EXRA 2J8XB 1A67A 1YGEA 3FF2A 1BNFA 1JKGA 1QJGA 1RSNA 3SOAA 3G6E3 3IPTA 2LQVA 3PZWA 5IG0A 3DM8A 1LOVA 3X3YA 3V98A 4O8SA 3KZTA 2CWUA 2SBLA 4BL2A 9RNTA 1Q42A 3EBYA 5AYSC 3K9MC 1SARA 1B2XA 3EHCA 3JUQA 3MWZA 1W5ZA 1BAOA 1KQS2 3D5IA 1PY3A 1IT7A 1NO3A 3MKIA 4N6LA 3D3LA 3FF0A 2QEX3 1Y4KA 2IYJA 4MMYB 3DGNA 3BU4A 1EEJA 1Q40B 4AKYA 1B20A 1JN5B 4LEHA 1N8R4 1DVDA 1RGAA 5G2GA 2Q07A 3PYJA 3SXXA 1R4CA 1SJWA 1X1YA 3F7SA 1MWSA 3RNTA 3K7CA 3CCE3 2IA7A 3N9HA 1KWIA 1IVVA 2CFGA 2GSPA 4XDWA 1O7GB 3SLUA 3PCRA 5LC6A 5A0OB 3I553 1IQXA 3DUKA 2BNGA 4KFEA 2B24B 5KP4A 1K9M4 1RCKA 4HZ9B 1UI7A 3LTCA 2HOHA 1FGRA 1Z1SA 1T5YA 4AEQA 4IIAA 1STDA 2HMKB 1W02A 3NQYA 1E3RA 4N6V0 4XM4A 5ELUA 4OVMA 5IEPA 2IY2A 2BMOB 1BVIA 1S5AA 1UCLA 1IT8A 2GU1A 1A90A 1JB4A 1WMPA 3LYGA 5JBSA 1RJOA 1FGOA 4BTYA 1W2ZA 1JZDA 2AAEA 1YVSA 2W0QA 2XF3A 1UUWB 3UL6A 2HMLB 2BMQB 2ML5A 2V1LA 3HZPA 3NBBA 3EF8A 1CH0A 1Q864 1EA2A 3G16A 3RGAA 1GY6A 3FH1A 1BRGA 4N3VA 1CEWI 2KAAA 3LT9A 4O3VA 3UNLA 3X3ZA 3HI7A 1RHLA 2F98A 1IDPA 1PFPA 3PXMA 1OH0A 1UGHI 3JVCA 1UUVB 3CC73 2PNCA 4RNTA 4HVNA 3S5CA 3K5TA 1W01A 3NX0A 3VSYA 1YGWA 5CF1A 2KF6A 4AKZA 6GSPA 3WODG 1I2GA 3HIIA 2XGLA 4ORLA 3X40A 1IYYA 3EC9A 1B2MA 1RGLA 5I97A 1NNVA 3U1WA 2CG1A 2A15A 4N6MA 1E97A 1IQ8A 3GZXB 4N6NB 3ECFA 4BIRA 1TIJA 1G96A 1TUHA 1D6ZA 2WOHA 5IG5A 1ZX2A 1BNGA 2P09A 4STDA 1N9EA 1J2BA 5D81A 3MPHA 1I70A 4WYKB 3QRDA 3V99A 2F86B 5IW9A 3CME3 1LQGC 1AVKA 1ULJB 2GU3A 3MSOA 1IV7A 2P05A 3OW22 1WNHA 3JUOA 5STDA 1IVWA 3NM2A 4K61A 3FKAA 3D9RA 4FMCA 1AQZA 3B8LA 2CC3A 3B7CA 4ZM8A 3Q3FA 1W7CA 4MEIA 3CCS3 3S27A 2L1SA 3NXJA 1RNTA 1RLSA 4K1UA 1T2IA 1B21A 3K63A 3CMA3 3KKGA 4EYCA 1MWTA 1BSBA 2P38A 4MJDA 2CWVA 4I4KA 4R1KA 5CLKA 2SARA 2GBWB 4KFDA 2FXTA 1Q7Y4 2OWPA 3F7XA 3PCSA 3I0YA 1SPUA 5HGRA 1G02A 1VQP3 1O7HB 3GRDA 3OWSA 5IF6A 1JB5A 1YJW3 1VQ83 3FG3A 1D6YA 3OV4A 4RNZA 3DH2A 3G8ZA 3D5GA 1KD14 5KP1A 3G4S3 1KSIA 3F9SA 1BRKA 2CH9A 3OXAA 1BNRA 1E3VA 1FUSA 1N8QA 2CWTA 1B2UA 4FMAA 3E99A 4J5GA 3PGBA 2OTJ3 1EUIC 1BSAA 1FGMA 1VQQA 3MG3A 1DMMA 3ZG5A 3OWYA 3ROBA 1UUGB 5IG4A 2W6JH 1QVG2 2I9WA 3NM7A 4BU4A 1JRQA 1OF5A 1BANA 2F56A 1JZOA 3SYUA 4GHOA 3CCM3 2INXA 2HMNB 1O7WB 1V74A 3V92A 2H0GA 1FUWA 1IQYA 1OUNA 1OPYA 2CW9A 3UL5A 4HKVB 2QA43 1BNSA 4FMBA 1DE3A 3GAXA 3SOYA 3B4OA 4K90B 1PYLA 3EBTA 3IJEB 1WQLB 4RNYA 1U8CB 3F8XA 2BIRA 4HJLB 2GXFA 4TX4A 1OCVA 4H61A 3CCJ3 4J5KA 1M1K4 1MOLA
chains in the Genus database with same CATH topology
4NREA 3CXC2 3F40A 4HM0B 1TFKA 2E2TA 3IMAB 5TGNA 1S723 1DMNA 3DY5A 3UJMA 3CCQ3 4GL6A 2K54A 4NHFA 4WWUC 2YFLB 2ZL8A 3FG1A 4HBRA 2W9QA 3LMLA 1EQKA 3CD63 2QGUA 1DVCA 1WTHA 3T8NA 1W2B2 3AMOA 5IENA 2PZVA 2W9PA 1O7NB 3NV0A 4WYKA 3GWRA 3WDGB 3DGOA 3KSED 2P0XA 3SVAA 1TP6A 1VQ43 1N9JA 3EN8A 3KN4A 4R80A 4XBTA 3T0UA 4MMXB 1QAFA 3DGLA 3TDGA 1LXEA 4EV2A 3UB1A 3WMDA 3K0ZA 1JKGB 1KC84 3Q2PA 2Y73A 3DMCA 1W6YA 5DREA 1BUQA 3T8UA 2CG0A 2LYXA 5IEOA 2UX0A 1AV4A 2CFLA 2IUJA 3NQZA 1VQ93 1US1A 1K41A 3LOYA 1DYUA 3CCV3 1OHSA 4IPBA 3GZYB 5LC7A 4LZIA 3STDA 3MYTA 1YVBI 3Q1CA 3QK9A 3X3XA 1SIIA 1N5PA 1LVNA 2XFSA 1FGQA 3FLJA 3FGYA 5FGOA 1ROAA 2OTL3 3WOFB 2XSOB 4Q53A 1YIT3 1YJ93 1GY5A 2OOVC 3BNEA 4N6TA 3X41A 3EE1A 2QIYA 2BMRB 2Z76A 5D83A 1UW1A 6STDA 2KXGA 3BNCA 4CCVA 1YJN3 3BNDA 5ELJA 1QAKA 4QWTA 3L0RA 1VQO3 3ALAA 1SQWA 2Y74A 2RSXA 2IUKA 2W56B 2CIUA 3LH4A 3LTAA 3DXOA 2BT3A 1VQK3 1NB5I 1VQ63 2MF7A 2XSHB 2K0MA 1L5GB 1TU5A 1WMOA 2Z6BA 2GEXA 3EJVA 3GZRA 4FCJA 4R4KA 4O2HA 1EG9B 5BXQA 2R4IA 1Q40A 2XH9A 1JN5A 1YIJ3 3FSDA 4HM7B 4LSOA 3BB9A 4HYZA 2JQ5A 2O9UX 5JPUA 3LZAA 1HU9A 3VF1A 4L8PA 2XEPA 3OX9A 1Q814 3S28A 1OHOA 4HM2B 2STDA 3KIIA 5DRVA 3CC43 7STDA 2P0MA 3KE7A 4GB5A 3NUVA 1IVUA 1QALA 2RGQA 2YFIB 2W04A 4N6UA 3CPW2 1K734 5IERA 1RN7A 1W6GA 2WGQA 1F8NA 2L4VA 3OWUA 2OOVA 4FMDA 2YFJB 4OUQA 3CNMA 1ASKA 3CCL3 1YI23 5EQLA 1UI8A 2WGOA 3NBJA 2ZDJA 3LT8A 5CXOA 1C7HA 5EVHA 3CC23 4RBNA 2ML6A 1GD3A 1U5OA 4FR9A 3CCR3 1ISKA 1ZO2A 2F99A 1OACA 4BTXA 1GS3A 4LMIA 3N8BA 2HMJB 1GY7A 2HMMB 3BNBA 3LTBA 4WFOA 2JDIH 1RKYA 3VGNA 2E2VA 1VQ53 4PEJA 1N5HA 1JJ22 3CNXA 3I563 1FGTA 1NDOB 4JRFA 2Z7AA 4XBXA 3U97A 3KFQC 2CFWA 4XB5A 1DMQA 4WHAA 3RDEA 3MHEA 4HM3B 5AIHA 4XDVA 5KP3A 1NWWA 1QMAA 3H3HA 4J8TA 5AIGA 2CHCA 5AEWB 3LXUX 3EB8A 1VQM3 3EN1B 3KSPA 2FNQA 2IMJA 1OHPA 2Z77A 4KZ1A 5AIIA 3FCSB 3SEDA 1K8A4 2WOFA 1QVF2 1ROVA 3GZBA 3CU3A 1VQ73 2CK3H 1M904 2KCDA 3N54B 1CYVA 2WO0A 1OF5B 1IVXA 2YX9A 3O8YA 4OK0A 1OGZA 5D82A 5AI1A 3PS8A 2RCDA 4XBYA 1OGXA 1FA3A 2BO9B 1JNQA 3EQQB 2W56A 3G0KA 4IT7A 1PU4A 1GD4A 1M9GA 2OQEC 3NBRA 5EEOA 4O02B 2W03A 4EC6A 1IU7A 3WOEB 1NJI4 1CQSA 2OCTA 3F8HA 1JV2B 1M1XB 1D6UA 1WMNA 3FG4A 3MG2A 5AYRB 4EV5A 4X2HA 3J7Yd 3WA3A 2D42A 1STFI 4HM6B 1W6CA 4H3UA 3BLZA 1A2VA 3F14A 3NHXA 2XFTA 2C11A 2RFRA 1Q824 3HK4A 3CCU3 3CPOA 5CK6A 3B4PA 2BHMA 2CFDA 2FGTA 3S67A 4L8OA 3WA2X 3DZLA 1EKMA 4KVHA 2GEYA 4FCZA 3EX9A 4HM5B 4MMZB 1W4NA 1NB3I 2M7OA 1A2KA 3HX8A 1K28A 3JUNA 4BTWA 3X42A 2GBXB 3AMOB 4L7KA 1TFOA 8CHOA 1O7MB 2E2UA 1RRLA 1RRHA 2XR8B 4X2OA 3NV0B 4FCMA 4HM8B 3S29A 3G713 2CKFB 1AR0A 1MNLA 1ULIB 1IK3A 4G1MB 1LOXA 1IV9A 1YHQ3 1CYUA 4RZMA 4HM1B 3FZWA 5AIFA 4WP5A 2KRTA 5FW5A 3JUMA 3LTDA 5AEUB 2C10A 2B1XB 1LNHA 4CDLA 4N6OB 2OQEA 3A76A 1HKXA 1W00A 5BVBA 5CF2A 2CFKA 1VZZA 1AVLA 2O3OA 4R9LA 4HZBB 4R9KA 3DGMA 3HIGA 3RGRA 4EBGA 3MG1A 1O7PB 1JB2A 5JPPA 5IG3A 4J9AA 2XGNA 3SX1A 4K1VA 2XRXB 1VQN3 1SIHA 4LGQA 1NU3A 3H51A 4U13A 2MC8A 2HMOB 4KFFA 1GYBA 3ER7A 4HM4B 3JUPA 2W2CA 4JF8A 3M8CA 2D1WA 1VQL3 3Q90A 4EXRA 1A67A 1YGEA 3FF2A 1JKGA 1QJGA 3SOAA 3G6E3 3IPTA 2LQVA 3PZWA 5IG0A 3DM8A 3X3YA 3V98A 4O8SA 3KZTA 2CWUA 2SBLA 1Q42A 3EBYA 5AYSC 3K9MC 3EHCA 3JUQA 3MWZA 1W5ZA 1KQS2 1IT7A 1NO3A 3MKIA 4N6LA 3D3LA 3FF0A 2QEX3 1Y4KA 4MMYB 3DGNA 1Q40B 4AKYA 1JN5B 4LEHA 1N8R4 1DVDA 5G2GA 2Q07A 3PYJA 3SXXA 1R4CA 1SJWA 3F7SA 3K7CA 3CCE3 2IA7A 3N9HA 1KWIA 1IVVA 2CFGA 4XDWA 1O7GB 3SLUA 3PCRA 5LC6A 5A0OB 3I553 1IQXA 3DUKA 2BNGA 4KFEA 2B24B 5KP4A 1K9M4 4HZ9B 1UI7A 3LTCA 1FGRA 1Z1SA 1T5YA 4AEQA 4IIAA 1STDA 2HMKB 1W02A 3NQYA 1E3RA 4N6V0 4XM4A 5ELUA 4OVMA 5IEPA 2BMOB 1S5AA 1IT8A 2GU1A 1A90A 1JB4A 1WMPA 3LYGA 5JBSA 1RJOA 1FGOA 4BTYA 1W2ZA 2W0QA 2XF3A 3UL6A 1UUWB 2HMLB 2ML5A 2BMQB 2V1LA 3HZPA 3NBBA 3EF8A 1Q864 1EA2A 3G16A 3RGAA 1GY6A 3FH1A 4N3VA 1CEWI 3LT9A 4O3VA 3UNLA 3X3ZA 3HI7A 2F98A 1IDPA 1PFPA 3PXMA 1OH0A 3JVCA 1UUVB 3CC73 2PNCA 4HVNA 3S5CA 3K5TA 1W01A 3NX0A 3VSYA 5CF1A 4AKZA 3WODG 3HIIA 2XGLA 4ORLA 3X40A 3EC9A 5I97A 3U1WA 2CG1A 2A15A 4N6MA 1E97A 1IQ8A 3GZXB 4N6NB 3ECFA 1TIJA 1G96A 1TUHA 1D6ZA 2WOHA 5IG5A 1ZX2A 4STDA 2P09A 1N9EA 1J2BA 5D81A 3MPHA 4WYKB 3V99A 3QRDA 2F86B 5IW9A 3CME3 1AVKA 1ULJB 2GU3A 3MSOA 1IV7A 2P05A 3OW22 1WNHA 3JUOA 5STDA 1IVWA 3NM2A 4K61A 3FKAA 3D9RA 4FMCA 3B8LA 2CC3A 3B7CA 4ZM8A 1W7CA 4MEIA 3CCS3 3S27A 3NXJA 4K1UA 3K63A 3CMA3 3KKGA 4EYCA 2P38A 4MJDA 2CWVA 4I4KA 4R1KA 5CLKA 2GBWB 4KFDA 2FXTA 1Q7Y4 2OWPA 3F7XA 3PCSA 3I0YA 1SPUA 5HGRA 1VQP3 1O7HB 3GRDA 3OWSA 5IF6A 1JB5A 1YJW3 1VQ83 3FG3A 1D6YA 3OV4A 4RNZA 3G8ZA 1KD14 5KP1A 3G4S3 1KSIA 3F9SA 2CH9A 3OXAA 1E3VA 1N8QA 2CWTA 4FMAA 3E99A 3PGBA 2OTJ3 1FGMA 3MG3A 1DMMA 3OWYA 3ROBA 5IG4A 2W6JH 1QVG2 2I9WA 3NM7A 1JRQA 1OF5A 3CCM3 2INXA 2HMNB 1O7WB 1V74A 3V92A 1FUWA 1IQYA 1OUNA 1OPYA 2CW9A 3UL5A 4HKVB 2QA43 4FMBA 3GAXA 3SOYA 3B4OA 4K90B 3EBTA 3IJEB 1WQLB 4RNYA 1U8CB 3F8XA 4HJLB 2GXFA 4TX4A 1OCVA 4H61A 3CCJ3 1M1K4 1MOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FGO A;  3N8B A;  3NM7 A; 
#chains in the Genus database with same CATH topology
 4NRE A;  3CXC 2;  1GOV A;  3F40 A;  4HM0 B;  1TFK A;  2E2T A;  3IMA B;  5TGN A;  2F4Y A;  1S72 3;  1DMN A;  1BNJ A;  1UCI A;  3DY5 A;  3UJM A;  5M19 A;  3CCQ 3;  1DET A;  4GL6 A;  2K54 A;  4NHF A;  4WWU C;  2YFL B;  6RNT A;  2ZL8 A;  1FYS A;  3FG1 A;  4HBR A;  2W9Q A;  3LML A;  1EQK A;  3CD6 3;  2QGU A;  1DVC A;  1WTH A;  4HAA A;  1AY7 A;  3T8N A;  1W2B 2;  3AMO A;  7GSP A;  5IEN A;  2PZV A;  2W9P A;  1O7N B;  3NV0 A;  1RGH A;  3GWR A;  4WYK A;  1RNB A;  1RMS A;  3WDG B;  3DGO A;  3KSE D;  2P0X A;  1Q7H A;  1TP6 A;  4KT3 B;  3SVA A;  4HOH A;  1VQ4 3;  1N9J A;  1I2F A;  3EN8 A;  1RTU A;  3KN4 A;  4R80 A;  4XBT A;  3T0U A;  4DKI A;  4MMX B;  1QAF A;  3DGL A;  3TDG A;  1I0V A;  1LXE A;  4EV2 A;  3UB1 A;  1GMP A;  1GMR A;  1JKG B;  3K0Z A;  3WMD A;  1KC8 4;  3Q2P A;  2Y73 A;  3DMC A;  1W6Y A;  1BU4 A;  5DRE A;  1BUQ A;  3T8U A;  2CG0 A;  1JBR A;  4LYL B;  3ZG0 A;  1A2P A;  2LYX A;  5IEO A;  2UX0 A;  1AV4 A;  2H0I A;  2CFL A;  2IUJ A;  3NQZ A;  1VQ9 3;  2CX1 A;  1US1 A;  1K41 A;  3LOY A;  1DYU A;  3CCV 3;  1MGR A;  1OHS A;  1TRP A;  1RN4 A;  2UUG C;  3GZY B;  4IPB A;  4LZI A;  3AHS A;  5LC7 A;  3AHW A;  3STD A;  3MYT A;  1YVB I;  3Q1C A;  3QK9 A;  3X3X A;  1SII A;  1N5P A;  1LVN A;  2XFS A;  1TTO A;  1FGQ A;  1HZ1 A;  1UCK A;  1ZS7 A;  3FGY A;  1ZGX A;  1ROA A;  3FLJ A;  5FGO A;  3WOF B;  2XSO B;  4Q53 A;  1YIT 3;  1YJ9 3;  2OTL 3;  1GY5 A;  2OOV C;  3BNE A;  4N6T A;  3X41 A;  2BU4 A;  2QIY A;  3EE1 A;  2BMR B;  2Z76 A;  1I2E A;  1UDI I;  5D83 A;  5M1A A;  1UW1 A;  1RN1 A;  1I8V A;  6STD A;  2KXG A;  3AGN A;  3BNC A;  3HOH A;  4CCV A;  3A5E A;  1YJN 3;  2UGI A;  3BND A;  5ELJ A;  1QAK A;  4QWT A;  3L0R A;  1VQO 3;  3ALA A;  1SQW A;  2Y74 A;  2RSX A;  2IUK A;  2W56 B;  2CIU A;  1GMQ A;  2RNT A;  3LH4 A;  3LTA A;  3DXO A;  2BT3 A;  1VQK 3;  1NB5 I;  1VQ6 3;  2MF7 A;  2XSH B;  2K0M A;  1G0T A;  1L5G B;  1WMO A;  1TU5 A;  2GEX A;  2Z6B A;  5BU4 A;  3EJV A;  3GZR A;  4FCJ A;  4ILF A;  4R4K A;  4O2H A;  1RDS A;  1EG9 B;  5BXQ A;  2R4I A;  1Q40 A;  2XH9 A;  1JN5 A;  1YIJ 3;  3FSD A;  4HM7 B;  4LSO A;  3BB9 A;  1BRI A;  4HYZ A;  2JQ5 A;  5HOH A;  5RNT A;  2O9U X;  5JPU A;  3LZA A;  1I3F A;  1HU9 A;  1HYF A;  3VF1 A;  4L8P A;  2XEP A;  1BUJ A;  3OX9 A;  2RBI A;  1LQM B;  1Q81 4;  1UGI A;  3S28 A;  1BNE A;  1OHO A;  1B27 A;  1I0X A;  2KF3 A;  4GSP A;  4HM2 B;  2KF4 A;  2STD A;  3KII A;  5DRV A;  3CC4 3;  1B2Z A;  7STD A;  2P0M A;  3KE7 A;  4GB5 A;  3NUV A;  1IVU A;  1QAL A;  2RGQ A;  1RCL A;  2YFI B;  2W04 A;  4N6U A;  3CPW 2;  1I3I A;  1LRA A;  1MWR A;  1K73 4;  5IER A;  1T3B A;  1RN7 A;  1W6G A;  1BGS A;  2WGQ A;  1RGK A;  1F8N A;  2L4V A;  3OWU A;  5G1K A;  2OOV A;  1JBT A;  2C4B A;  4FMD A;  2YFJ B;  4OUQ A;  5M18 A;  3AGO A;  1BRS A;  1ASK A;  2CX0 A;  3CNM A;  3CCL 3;  1YI2 3;  5EQL A;  5G1L A;  1UI8 A;  2WGO A;  3NBJ A;  2ZDJ A;  3LT8 A;  5CXO A;  1C7H A;  5EVH A;  3CC2 3;  2KF5 A;  1RGE A;  4RBN A;  2ML6 A;  1BSE A;  1GD3 A;  1U5O A;  4FR9 A;  5BIR A;  1ZO2 A;  2F99 A;  3CCR 3;  1ISK A;  1LOY A;  1OAC A;  4BTX A;  1GS3 A;  4LMI A;  3N8B A;  1BRH A;  1GSP A;  1V58 A;  2HMJ B;  1GY7 A;  2HMM B;  3BNB A;  3LTB A;  4WFO A;  2JDI H;  1RKY A;  3VGN A;  3WR2 A;  2E2V A;  1VQ5 3;  1BSD A;  4PEJ A;  1N5H A;  1JJ2 2;  1YNV X;  3CNX A;  3I56 3;  1FGT A;  1NDO B;  4JRF A;  2Z7A A;  4XBX A;  3U97 A;  1BIR A;  2CFW A;  3KFQ C;  1DMQ A;  4XB5 A;  1RGF A;  4WHA A;  8RNT A;  1RGC A;  3MHE A;  3RDE A;  4HM3 B;  5AIH A;  4XDV A;  5KP3 A;  1NWW A;  1QMA A;  3H3H A;  4J8T A;  5AIG A;  2CHC A;  5AEW B;  3LXU X;  3EB8 A;  1VQM 3;  3EN1 B;  3KSP A;  1T2H A;  2FNQ A;  2IMJ A;  1BNI A;  1OHP A;  2F5W A;  2Z77 A;  4KZ1 A;  5AII A;  3FCS B;  3SED A;  1K8A 4;  2WOF A;  1QVF 2;  1ROV A;  3GZB A;  1GOU A;  3CU3 A;  1B2S A;  2CK3 H;  1VQ7 3;  1M90 4;  2KCD A;  1C54 A;  3N54 B;  5GSP A;  1CYV A;  2WO0 A;  1OF5 B;  1IVX A;  2YX9 A;  3O8Y A;  4OK0 A;  1OGZ A;  1FZU A;  5D82 A;  4I5Q A;  5AI1 A;  1R4Y A;  2RCD A;  3PS8 A;  4XBY A;  3URP A;  1OGX A;  1FA3 A;  1X1W A;  2BO9 B;  1BSC A;  1JNQ A;  3EQQ B;  2W56 A;  3G0K A;  4IT7 A;  1PU4 A;  1GD4 A;  1BRJ A;  2F5M A;  1M9G A;  2OQE C;  3NBR A;  5EEO A;  1FUT A;  2ZHX B;  2W03 A;  3D4A A;  4O02 B;  4EC6 A;  1IU7 A;  3WOE B;  1NJI 4;  1CQS A;  2OCT A;  3F8H A;  1JV2 B;  1M1X B;  1D6U A;  1WMN A;  2H0H A;  3FG4 A;  2R41 A;  2ZA4 A;  3MG2 A;  4X2H A;  5AYR B;  3WHO A;  4EV5 A;  3WA3 A;  3J7Y d;  2D42 A;  1STF I;  4HM6 B;  1W6C A;  3BIR A;  4H3U A;  3BLZ A;  1A2V A;  3F14 A;  1MGW A;  2XFT A;  2C11 A;  3NHX A;  3ZFZ A;  2RFR A;  1Q82 4;  3HK4 A;  3CCU 3;  3CPO A;  1TRQ A;  5CK6 A;  3B4P A;  2BHM A;  2CFD A;  2FGT A;  3S67 A;  4L8O A;  3WA2 X;  3DZL A;  1EKM A;  4KVH A;  1X1U A;  2GEY A;  3EX9 A;  1LNI A;  4FCZ A;  4HM5 B;  4MMZ B;  1W4N A;  1NB3 I;  1FW7 A;  1Q9E A;  2M7O A;  1A2K A;  3HX8 A;  1K28 A;  3JUN A;  4BTW A;  3X42 A;  2GBX B;  3AMO B;  4CJN A;  4L7K A;  1TFO A;  8CHO A;  1O7M B;  2E2U A;  1RRL A;  1RRH A;  2XR8 B;  4X2O A;  3NV0 B;  4FCM A;  4HM8 B;  3S29 A;  3G71 3;  1TJD A;  2CKF B;  1AR0 A;  1MNL A;  1B3S A;  3DGY A;  1ULI B;  7RNT A;  1IK3 A;  1GOY A;  4G1M B;  1LOX A;  3D79 A;  1IV9 A;  1BRN L;  1YHQ 3;  1CYU A;  1LOW A;  4RZM A;  4HM1 B;  3FZW A;  5AIF A;  4WP5 A;  2KRT A;  5FW5 A;  3JUM A;  3LTD A;  1JBS A;  5AEU B;  3GSP A;  4CPK A;  2C10 A;  2B1X B;  1LNH A;  4CDL A;  4N6O B;  2OQE A;  3A76 A;  1HKX A;  1W00 A;  3KCH A;  5BVB A;  5CF2 A;  2CFK A;  1VZZ A;  1AVL A;  2O3O A;  4R9L A;  4HZB B;  4R9K A;  3DGM A;  3HIG A;  3RGR A;  4EBG A;  2K3D A;  4EW5 A;  3MG1 A;  1O7P B;  1JB2 A;  5JPP A;  4NPB A;  5IG3 A;  4J9A A;  2XGN A;  3SX1 A;  1UCJ A;  1BOX A;  4K1V A;  1RGG A;  2XRX B;  1VQN 3;  1SIH A;  4LGQ A;  1NU3 A;  3H51 A;  4U13 A;  1MWU A;  2MC8 A;  2HMO B;  4KFF A;  1GYB A;  3ER7 A;  4HM4 B;  1V57 A;  4BL3 A;  3JUP A;  2W2C A;  4JF8 A;  3M8C A;  2D1W A;  1X1X A;  2AAD A;  1VQL 3;  3Q90 A;  4EXR A;  2J8X B;  1A67 A;  1YGE A;  3FF2 A;  1BNF A;  1JKG A;  1QJG A;  1RSN A;  3SOA A;  3G6E 3;  3IPT A;  2LQV A;  3PZW A;  5IG0 A;  3DM8 A;  1LOV A;  3X3Y A;  3V98 A;  4O8S A;  3KZT A;  2CWU A;  2SBL A;  4BL2 A;  9RNT A;  1Q42 A;  3EBY A;  5AYS C;  3K9M C;  1SAR A;  1B2X A;  3EHC A;  3JUQ A;  3MWZ A;  1W5Z A;  1BAO A;  1KQS 2;  3D5I A;  1PY3 A;  1IT7 A;  1NO3 A;  3MKI A;  4N6L A;  3D3L A;  3FF0 A;  2QEX 3;  1Y4K A;  2IYJ A;  4MMY B;  3DGN A;  3BU4 A;  1EEJ A;  1Q40 B;  4AKY A;  1B20 A;  1JN5 B;  4LEH A;  1N8R 4;  1DVD A;  1RGA A;  5G2G A;  2Q07 A;  3PYJ A;  3SXX A;  1R4C A;  1SJW A;  1X1Y A;  3F7S A;  1MWS A;  3RNT A;  3K7C A;  3CCE 3;  2IA7 A;  3N9H A;  1KWI A;  1IVV A;  2CFG A;  2GSP A;  4XDW A;  1O7G B;  3SLU A;  3PCR A;  5LC6 A;  5A0O B;  3I55 3;  1IQX A;  3DUK A;  2BNG A;  4KFE A;  2B24 B;  5KP4 A;  1K9M 4;  1RCK A;  4HZ9 B;  1UI7 A;  3LTC A;  2HOH A;  1FGR A;  1Z1S A;  1T5Y A;  4AEQ A;  4IIA A;  1STD A;  2HMK B;  1W02 A;  3NQY A;  1E3R A;  4N6V 0;  4XM4 A;  5ELU A;  4OVM A;  5IEP A;  2IY2 A;  2BMO B;  1BVI A;  1S5A A;  1UCL A;  1IT8 A;  2GU1 A;  1A90 A;  1JB4 A;  1WMP A;  3LYG A;  5JBS A;  1RJO A;  1FGO A;  4BTY A;  1W2Z A;  1JZD A;  2AAE A;  1YVS A;  2W0Q A;  2XF3 A;  1UUW B;  3UL6 A;  2HML B;  2BMQ B;  2ML5 A;  2V1L A;  3HZP A;  3NBB A;  3EF8 A;  1CH0 A;  1Q86 4;  1EA2 A;  3G16 A;  3RGA A;  1GY6 A;  3FH1 A;  1BRG A;  4N3V A;  1CEW I;  2KAA A;  3LT9 A;  4O3V A;  3UNL A;  3X3Z A;  3HI7 A;  1RHL A;  2F98 A;  1IDP A;  1PFP A;  3PXM A;  1OH0 A;  1UGH I;  3JVC A;  1UUV B;  3CC7 3;  2PNC A;  4RNT A;  4HVN A;  3S5C A;  3K5T A;  1W01 A;  3NX0 A;  3VSY A;  1YGW A;  5CF1 A;  2KF6 A;  4AKZ A;  6GSP A;  3WOD G;  1I2G A;  3HII A;  2XGL A;  4ORL A;  3X40 A;  1IYY A;  3EC9 A;  1B2M A;  1RGL A;  5I97 A;  1NNV A;  3U1W A;  2CG1 A;  2A15 A;  4N6M A;  1E97 A;  1IQ8 A;  3GZX B;  4N6N B;  3ECF A;  4BIR A;  1TIJ A;  1G96 A;  1TUH A;  1D6Z A;  2WOH A;  5IG5 A;  1ZX2 A;  1BNG A;  2P09 A;  4STD A;  1N9E A;  1J2B A;  5D81 A;  3MPH A;  1I70 A;  4WYK B;  3QRD A;  3V99 A;  2F86 B;  5IW9 A;  3CME 3;  1LQG C;  1AVK A;  1ULJ B;  2GU3 A;  3MSO A;  1IV7 A;  2P05 A;  3OW2 2;  1WNH A;  3JUO A;  5STD A;  1IVW A;  3NM2 A;  4K61 A;  3FKA A;  3D9R A;  4FMC A;  1AQZ A;  3B8L A;  2CC3 A;  3B7C A;  4ZM8 A;  3Q3F A;  1W7C A;  4MEI A;  3CCS 3;  3S27 A;  2L1S A;  3NXJ A;  1RNT A;  1RLS A;  4K1U A;  1T2I A;  1B21 A;  3K63 A;  3CMA 3;  3KKG A;  4EYC A;  1MWT A;  1BSB A;  2P38 A;  4MJD A;  2CWV A;  4I4K A;  4R1K A;  5CLK A;  2SAR A;  2GBW B;  4KFD A;  2FXT A;  1Q7Y 4;  2OWP A;  3F7X A;  3PCS A;  3I0Y A;  1SPU A;  5HGR A;  1G02 A;  1VQP 3;  1O7H B;  3GRD A;  3OWS A;  5IF6 A;  1JB5 A;  1YJW 3;  1VQ8 3;  3FG3 A;  1D6Y A;  3OV4 A;  4RNZ A;  3DH2 A;  3G8Z A;  3D5G A;  1KD1 4;  5KP1 A;  3G4S 3;  1KSI A;  3F9S A;  1BRK A;  2CH9 A;  3OXA A;  1BNR A;  1E3V A;  1FUS A;  1N8Q A;  2CWT A;  1B2U A;  4FMA A;  3E99 A;  4J5G A;  3PGB A;  2OTJ 3;  1EUI C;  1BSA A;  1FGM A;  1VQQ A;  3MG3 A;  1DMM A;  3ZG5 A;  3OWY A;  3ROB A;  1UUG B;  5IG4 A;  2W6J H;  1QVG 2;  2I9W A;  3NM7 A;  4BU4 A;  1JRQ A;  1OF5 A;  1BAN A;  2F56 A;  1JZO A;  3SYU A;  4GHO A;  3CCM 3;  2INX A;  2HMN B;  1O7W B;  1V74 A;  3V92 A;  2H0G A;  1FUW A;  1IQY A;  1OUN A;  1OPY A;  2CW9 A;  3UL5 A;  4HKV B;  2QA4 3;  1BNS A;  4FMB A;  1DE3 A;  3GAX A;  3SOY A;  3B4O A;  4K90 B;  1PYL A;  3EBT A;  3IJE B;  1WQL B;  4RNY A;  1U8C B;  3F8X A;  2BIR A;  4HJL B;  2GXF A;  4TX4 A;  1OCV A;  4H61 A;  3CCJ 3;  4J5K A;  1M1K 4;  1MOL A; 
#chains in the Genus database with same CATH homology
 4NRE A;  3CXC 2;  3F40 A;  4HM0 B;  1TFK A;  2E2T A;  3IMA B;  5TGN A;  1S72 3;  1DMN A;  3DY5 A;  3UJM A;  3CCQ 3;  4GL6 A;  2K54 A;  4NHF A;  4WWU C;  2YFL B;  2ZL8 A;  3FG1 A;  4HBR A;  2W9Q A;  3LML A;  1EQK A;  3CD6 3;  2QGU A;  1DVC A;  1WTH A;  3T8N A;  1W2B 2;  3AMO A;  5IEN A;  2PZV A;  2W9P A;  1O7N B;  3NV0 A;  4WYK A;  3GWR A;  3WDG B;  3DGO A;  3KSE D;  2P0X A;  3SVA A;  1TP6 A;  1VQ4 3;  1N9J A;  3EN8 A;  3KN4 A;  4R80 A;  4XBT A;  3T0U A;  4MMX B;  1QAF A;  3DGL A;  3TDG A;  1LXE A;  4EV2 A;  3UB1 A;  3WMD A;  3K0Z A;  1JKG B;  1KC8 4;  3Q2P A;  2Y73 A;  3DMC A;  1W6Y A;  5DRE A;  1BUQ A;  3T8U A;  2CG0 A;  2LYX A;  5IEO A;  2UX0 A;  1AV4 A;  2CFL A;  2IUJ A;  3NQZ A;  1VQ9 3;  1US1 A;  1K41 A;  3LOY A;  1DYU A;  3CCV 3;  1OHS A;  4IPB A;  3GZY B;  5LC7 A;  4LZI A;  3STD A;  3MYT A;  1YVB I;  3Q1C A;  3QK9 A;  3X3X A;  1SII A;  1N5P A;  1LVN A;  2XFS A;  1FGQ A;  3FLJ A;  3FGY A;  5FGO A;  1ROA A;  2OTL 3;  3WOF B;  2XSO B;  4Q53 A;  1YIT 3;  1YJ9 3;  1GY5 A;  2OOV C;  3BNE A;  4N6T A;  3X41 A;  3EE1 A;  2QIY A;  2BMR B;  2Z76 A;  5D83 A;  1UW1 A;  6STD A;  2KXG A;  3BNC A;  4CCV A;  1YJN 3;  3BND A;  5ELJ A;  1QAK A;  4QWT A;  3L0R A;  1VQO 3;  3ALA A;  1SQW A;  2Y74 A;  2RSX A;  2IUK A;  2W56 B;  2CIU A;  3LH4 A;  3LTA A;  3DXO A;  2BT3 A;  1VQK 3;  1NB5 I;  1VQ6 3;  2MF7 A;  2XSH B;  2K0M A;  1L5G B;  1TU5 A;  1WMO A;  2Z6B A;  2GEX A;  3EJV A;  3GZR A;  4FCJ A;  4R4K A;  4O2H A;  1EG9 B;  5BXQ A;  2R4I A;  1Q40 A;  2XH9 A;  1JN5 A;  1YIJ 3;  3FSD A;  4HM7 B;  4LSO A;  3BB9 A;  4HYZ A;  2JQ5 A;  2O9U X;  5JPU A;  3LZA A;  1HU9 A;  3VF1 A;  4L8P A;  2XEP A;  3OX9 A;  1Q81 4;  3S28 A;  1OHO A;  4HM2 B;  2STD A;  3KII A;  5DRV A;  3CC4 3;  7STD A;  2P0M A;  3KE7 A;  4GB5 A;  3NUV A;  1IVU A;  1QAL A;  2RGQ A;  2YFI B;  2W04 A;  4N6U A;  3CPW 2;  1K73 4;  5IER A;  1RN7 A;  1W6G A;  2WGQ A;  1F8N A;  2L4V A;  3OWU A;  2OOV A;  4FMD A;  2YFJ B;  4OUQ A;  3CNM A;  1ASK A;  3CCL 3;  1YI2 3;  5EQL A;  1UI8 A;  2WGO A;  3NBJ A;  2ZDJ A;  3LT8 A;  5CXO A;  1C7H A;  5EVH A;  3CC2 3;  4RBN A;  2ML6 A;  1GD3 A;  1U5O A;  4FR9 A;  3CCR 3;  1ISK A;  1ZO2 A;  2F99 A;  1OAC A;  4BTX A;  1GS3 A;  4LMI A;  3N8B A;  2HMJ B;  1GY7 A;  2HMM B;  3BNB A;  3LTB A;  4WFO A;  2JDI H;  1RKY A;  3VGN A;  2E2V A;  1VQ5 3;  4PEJ A;  1N5H A;  1JJ2 2;  3CNX A;  3I56 3;  1FGT A;  1NDO B;  4JRF A;  2Z7A A;  4XBX A;  3U97 A;  3KFQ C;  2CFW A;  4XB5 A;  1DMQ A;  4WHA A;  3RDE A;  3MHE A;  4HM3 B;  5AIH A;  4XDV A;  5KP3 A;  1NWW A;  1QMA A;  3H3H A;  4J8T A;  5AIG A;  2CHC A;  5AEW B;  3LXU X;  3EB8 A;  1VQM 3;  3EN1 B;  3KSP A;  2FNQ A;  2IMJ A;  1OHP A;  2Z77 A;  4KZ1 A;  5AII A;  3FCS B;  3SED A;  1K8A 4;  2WOF A;  1QVF 2;  1ROV A;  3GZB A;  3CU3 A;  1VQ7 3;  2CK3 H;  1M90 4;  2KCD A;  3N54 B;  1CYV A;  2WO0 A;  1OF5 B;  1IVX A;  2YX9 A;  3O8Y A;  4OK0 A;  1OGZ A;  5D82 A;  5AI1 A;  3PS8 A;  2RCD A;  4XBY A;  1OGX A;  1FA3 A;  2BO9 B;  1JNQ A;  3EQQ B;  2W56 A;  3G0K A;  4IT7 A;  1PU4 A;  1GD4 A;  1M9G A;  2OQE C;  3NBR A;  5EEO A;  4O02 B;  2W03 A;  4EC6 A;  1IU7 A;  3WOE B;  1NJI 4;  1CQS A;  2OCT A;  3F8H A;  1JV2 B;  1M1X B;  1D6U A;  1WMN A;  3FG4 A;  3MG2 A;  5AYR B;  4EV5 A;  4X2H A;  3J7Y d;  3WA3 A;  2D42 A;  1STF I;  4HM6 B;  1W6C A;  4H3U A;  3BLZ A;  1A2V A;  3F14 A;  3NHX A;  2XFT A;  2C11 A;  2RFR A;  1Q82 4;  3HK4 A;  3CCU 3;  3CPO A;  5CK6 A;  3B4P A;  2BHM A;  2CFD A;  2FGT A;  3S67 A;  4L8O A;  3WA2 X;  3DZL A;  1EKM A;  4KVH A;  2GEY A;  4FCZ A;  3EX9 A;  4HM5 B;  4MMZ B;  1W4N A;  1NB3 I;  2M7O A;  1A2K A;  3HX8 A;  1K28 A;  3JUN A;  4BTW A;  3X42 A;  2GBX B;  3AMO B;  4L7K A;  1TFO A;  8CHO A;  1O7M B;  2E2U A;  1RRL A;  1RRH A;  2XR8 B;  4X2O A;  3NV0 B;  4FCM A;  4HM8 B;  3S29 A;  3G71 3;  2CKF B;  1AR0 A;  1MNL A;  1ULI B;  1IK3 A;  4G1M B;  1LOX A;  1IV9 A;  1YHQ 3;  1CYU A;  4RZM A;  4HM1 B;  3FZW A;  5AIF A;  4WP5 A;  2KRT A;  5FW5 A;  3JUM A;  3LTD A;  5AEU B;  2C10 A;  2B1X B;  1LNH A;  4CDL A;  4N6O B;  2OQE A;  3A76 A;  1HKX A;  1W00 A;  5BVB A;  5CF2 A;  2CFK A;  1VZZ A;  1AVL A;  2O3O A;  4R9L A;  4HZB B;  4R9K A;  3DGM A;  3HIG A;  3RGR A;  4EBG A;  3MG1 A;  1O7P B;  1JB2 A;  5JPP A;  5IG3 A;  4J9A A;  2XGN A;  3SX1 A;  4K1V A;  2XRX B;  1VQN 3;  1SIH A;  4LGQ A;  1NU3 A;  3H51 A;  4U13 A;  2MC8 A;  2HMO B;  4KFF A;  1GYB A;  3ER7 A;  4HM4 B;  3JUP A;  2W2C A;  4JF8 A;  3M8C A;  2D1W A;  1VQL 3;  3Q90 A;  4EXR A;  1A67 A;  1YGE A;  3FF2 A;  1JKG A;  1QJG A;  3SOA A;  3G6E 3;  3IPT A;  2LQV A;  3PZW A;  5IG0 A;  3DM8 A;  3X3Y A;  3V98 A;  4O8S A;  3KZT A;  2CWU A;  2SBL A;  1Q42 A;  3EBY A;  5AYS C;  3K9M C;  3EHC A;  3JUQ A;  3MWZ A;  1W5Z A;  1KQS 2;  1IT7 A;  1NO3 A;  3MKI A;  4N6L A;  3D3L A;  3FF0 A;  2QEX 3;  1Y4K A;  4MMY B;  3DGN A;  1Q40 B;  4AKY A;  1JN5 B;  4LEH A;  1N8R 4;  1DVD A;  5G2G A;  2Q07 A;  3PYJ A;  3SXX A;  1R4C A;  1SJW A;  3F7S A;  3K7C A;  3CCE 3;  2IA7 A;  3N9H A;  1KWI A;  1IVV A;  2CFG A;  4XDW A;  1O7G B;  3SLU A;  3PCR A;  5LC6 A;  5A0O B;  3I55 3;  1IQX A;  3DUK A;  2BNG A;  4KFE A;  2B24 B;  5KP4 A;  1K9M 4;  4HZ9 B;  1UI7 A;  3LTC A;  1FGR A;  1Z1S A;  1T5Y A;  4AEQ A;  4IIA A;  1STD A;  2HMK B;  1W02 A;  3NQY A;  1E3R A;  4N6V 0;  4XM4 A;  5ELU A;  4OVM A;  5IEP A;  2BMO B;  1S5A A;  1IT8 A;  2GU1 A;  1A90 A;  1JB4 A;  1WMP A;  3LYG A;  5JBS A;  1RJO A;  1FGO A;  4BTY A;  1W2Z A;  2W0Q A;  2XF3 A;  3UL6 A;  1UUW B;  2HML B;  2ML5 A;  2BMQ B;  2V1L A;  3HZP A;  3NBB A;  3EF8 A;  1Q86 4;  1EA2 A;  3G16 A;  3RGA A;  1GY6 A;  3FH1 A;  4N3V A;  1CEW I;  3LT9 A;  4O3V A;  3UNL A;  3X3Z A;  3HI7 A;  2F98 A;  1IDP A;  1PFP A;  3PXM A;  1OH0 A;  3JVC A;  1UUV B;  3CC7 3;  2PNC A;  4HVN A;  3S5C A;  3K5T A;  1W01 A;  3NX0 A;  3VSY A;  5CF1 A;  4AKZ A;  3WOD G;  3HII A;  2XGL A;  4ORL A;  3X40 A;  3EC9 A;  5I97 A;  3U1W A;  2CG1 A;  2A15 A;  4N6M A;  1E97 A;  1IQ8 A;  3GZX B;  4N6N B;  3ECF A;  1TIJ A;  1G96 A;  1TUH A;  1D6Z A;  2WOH A;  5IG5 A;  1ZX2 A;  4STD A;  2P09 A;  1N9E A;  1J2B A;  5D81 A;  3MPH A;  4WYK B;  3V99 A;  3QRD A;  2F86 B;  5IW9 A;  3CME 3;  1AVK A;  1ULJ B;  2GU3 A;  3MSO A;  1IV7 A;  2P05 A;  3OW2 2;  1WNH A;  3JUO A;  5STD A;  1IVW A;  3NM2 A;  4K61 A;  3FKA A;  3D9R A;  4FMC A;  3B8L A;  2CC3 A;  3B7C A;  4ZM8 A;  1W7C A;  4MEI A;  3CCS 3;  3S27 A;  3NXJ A;  4K1U A;  3K63 A;  3CMA 3;  3KKG A;  4EYC A;  2P38 A;  4MJD A;  2CWV A;  4I4K A;  4R1K A;  5CLK A;  2GBW B;  4KFD A;  2FXT A;  1Q7Y 4;  2OWP A;  3F7X A;  3PCS A;  3I0Y A;  1SPU A;  5HGR A;  1VQP 3;  1O7H B;  3GRD A;  3OWS A;  5IF6 A;  1JB5 A;  1YJW 3;  1VQ8 3;  3FG3 A;  1D6Y A;  3OV4 A;  4RNZ A;  3G8Z A;  1KD1 4;  5KP1 A;  3G4S 3;  1KSI A;  3F9S A;  2CH9 A;  3OXA A;  1E3V A;  1N8Q A;  2CWT A;  4FMA A;  3E99 A;  3PGB A;  2OTJ 3;  1FGM A;  3MG3 A;  1DMM A;  3OWY A;  3ROB A;  5IG4 A;  2W6J H;  1QVG 2;  2I9W A;  3NM7 A;  1JRQ A;  1OF5 A;  3CCM 3;  2INX A;  2HMN B;  1O7W B;  1V74 A;  3V92 A;  1FUW A;  1IQY A;  1OUN A;  1OPY A;  2CW9 A;  3UL5 A;  4HKV B;  2QA4 3;  4FMB A;  3GAX A;  3SOY A;  3B4O A;  4K90 B;  3EBT A;  3IJE B;  1WQL B;  4RNY A;  1U8C B;  3F8X A;  4HJL B;  2GXF A;  4TX4 A;  1OCV A;  4H61 A;  3CCJ 3;  1M1K 4;  1MOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...