2UGIA

Protein mimicry of dna from crystal structures of the uracil glycosylase inhibitor protein and its complex with escherichia coli uracil-dna glycosylase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
b'TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE INHIBITOR
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Bacillus phage pbs2
molecule tags Hydrolase inhibitor
total genus 15
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2ugiA00
1UDII 1EUIC 2UUGC 1LQGC 1UGIA 1UGHI 2ZHXB 2J8XB 4LYLB 2UGIA 1UUGB 1LQMB
chains in the Genus database with same CATH superfamily
4Q53A 3CCU3 3AHWA 1ISKA 4N6MA 2F86B 3D3LA 5HOHA 4WFOA 1K734 1RLSA 2O9UX 3I563 1NB5I 3MG1A 1J2BA 1CEWI 1FUTA 1LXEA 1ULIB 2Z6BA 1I70A 2YFIB 2P38A 3F7SA 3LTBA 3PZWA 1IT8A 2BMOB 3BNDA 1IQYA 3OX9A 3WA3A 3GZRA 3URPA 1T3BA 3U97A 9RNTA 1D6ZA 5LC6A 3NV0B 3V98A 5IF6A 3FH1A 1B27A 1Y4KA 1OACA 3F8HA 4RNZA 1YJW3 3MWZA 2GU3A 2XGLA 1W6YA 4OUQA 1TRQA 1YVSA 1MOLA 5KP3A 3NUVA 3SX1A 4R80A 5ELUA 2UUGC 1RJOA 4L8PA 4GHOA 1QAFA 2INXA 3CXC2 4FCJA 1M904 1Q864 2P0XA 1ZO2A 4HZBB 3A5EA 2B24B 2Z77A 3FCSB 2GXFA 2QEX3 1LNIA 1BNIA 1NJI4 3DGMA 1EKMA 2Q07A 1LRAA 1I8VA 4O8SA 3WODG 4NPBA 2BIRA 1TIJA 3MYTA 4XB5A 4R4KA 4MJDA 3I553 5BXQA 4BU4A 3N54B 3HOHA 3SOYA 2WO0A 4KT3B 3S27A 3FLJA 1C54A 2Y73A 1MNLA 2GBXB 2BMQB 1RGLA 2O3OA 3F40A 1A2KA 3LT8A 1YGEA 2R41A 3CCE3 2C10A 1RN1A 3OV4A 4FCZA 4HVNA 1IVUA 5CXOA 4HM8B 1JBRA 1E3RA 1W01A 1ULJB 3OW22 2GEXA 1B2XA 2F4YA 3FZWA 4N6NB 3WDGB 1VQK3 1BUJA 4H3UA 1UUWB 2XRXB 3O8YA 3S5CA 3JUNA 2OQEC 2SBLA 1O7WB 1UCJA 5GSPA 3AMOB 3KZTA 1DE3A 1BIRA 1FYSA 1L5GB 1IQ8A 3MG3A 2I9WA 3MHEA 2BHMA 3KSPA 4EC6A 3CD63 3NBBA 6STDA 3D5IA 1W7CA 4K1UA 3HZPA 1UCIA 2BU4A 3NM7A 1E97A 3S67A 4LSOA 3CCV3 3CME3 1BNSA 3EJVA 3RDEA 1B20A 1HU9A 1OH0A 1C7HA 3JUMA 2F5WA 1IVXA 2H0HA 2IUKA 1BU4A 1CYVA 4HM0B 1G02A 3DY5A 1RGKA 3N8BA 4HAAA 3WHOA 1B21A 1BRJA 1GSPA 2CWVA 1BGSA 1YNVX 2CFDA 5DRVA 1Q40A 3FKAA 1ROVA 4N6OB 1B3SA 2W9QA 1B2UA 3LT9A 1KWIA 1W5ZA 1N9JA 2QGUA 3F14A 5AYRB 1VQL3 2F56A 2PNCA 2XH9A 1TTOA 2IYJA 3CNMA 3UL5A 2CHCA 1YJ93 1G96A 3BIRA 1NNVA 3Q1CA 7RNTA 3G0KA 4DKIA 1UW1A 3X40A 2RFRA 2GBWB 3JUPA 1BRKA 4TX4A 3FG4A 1FGRA 4O2HA 2JDIH 1IVVA 4L7KA 3RNTA 1LQMB 4HM2B 1UDII 1JBSA 3GAXA 3FG1A 2KF6A 3F8XA 2KF5A 1G0TA 3DXOA 4J9AA 4KZ1A 3CC73 4GB5A 1VQ73 1BNJA 4RNTA 1SIHA 1UI7A 4HKVB 1JKGA 5G1KA 5IEPA 1JN5A 1IQXA 1QALA 4I5QA 3OWUA 4N6V0 1ZS7A 1SQWA 3F7XA 1M1K4 2W03A 2RGQA 3B4OA 3BU4A 1X1UA 4PEJA 4CDLA 2HMLB 4LGQA 1GMRA 1QMAA 3PS8A 3HK4A 3EN1B 1VZZA 3I0YA 2C4BA 3CCL3 1JBTA 1AV4A 3BNBA 1LOYA 3NXJA 3OWYA 3SVAA 2IY2A 4EV2A 3DMCA 4BL2A 1TFKA 1WMOA 1OPYA 1A90A 4BTXA 1B2SA 1N8QA 3G16A 3IMAB 3D79A 1Z1SA 3UJMA 3LOYA 3X42A 1S5AA 3LTDA 1LVNA 4HM1B 2CC3A 2L4VA 3ECFA 3LYGA 3RGRA 3NX0A 1I2GA 3T8NA 3NBRA 3D5GA 3MG2A 1RTUA 4EXRA 5KP4A 1OF5B 2BT3A 1U5OA 3Q90A 2CW9A 2H0IA 1BVIA 1O7MB 1W6CA 2FXTA 1JB2A 1RCLA 1GOYA 1AY7A 1VQO3 3UB1A 4K61A 1GY7A 1NDOB 4KVHA 1BNEA 4HM6B 2ZL8A 1VQ83 1DETA 2H0GA 3X3ZA 3AHSA 3EC9A 1YVBI 4R1KA 3EQQB 4WWUC 4JRFA 2CWUA 4MMYB 5I97A 1BSAA 5D83A 1K28A 1Q9EA 2E2TA 2ML6A 4FMCA 4J8TA 1IV7A 2AAEA 3EE1A 3LTAA 4RBNA 2MF7A 3RGAA 1BRGA 5A0OB 2F5MA 4FMAA 1M9GA 3SLUA 1BSDA 1ZX2A 2XFTA 4I4KA 4IPBA 1BSEA 3IJEB 2CX0A 2FNQA 3SYUA 4BTWA 2QA43 3D9RA 3EF8A 2KRTA 2WGOA 3EN8A 3PCSA 5M1AA 3K9MC 1TU5A 8CHOA 1BNFA 4KFDA 1IVWA 1K41A 4J5KA 3WA2X 1BRNL 1GOUA 3WMDA 4XBTA 3SXXA 5AIFA 3A76A 4FMBA 3EBTA 5BVBA 1ASKA 1F8NA 1N9EA 7STDA 5IG3A 3E99A 1CQSA 2W04A 3LXUX 5IG4A 3B8LA 1FGMA 5FGOA 1KD14 3SEDA 1BNRA 1AVLA 1DMQA 2W6JH 1W2ZA 2RBIA 3MKIA 3ROBA 1W02A 1W2B2 1HKXA 1I2FA 3QRDA 4HJLB 3F9SA 5IG0A 1DMNA 1GD4A 3EBYA 3STDA 1KQS2 2D42A 1PYLA 1FGTA 2YX9A 3JVCA 5IERA 1BNGA 1SIIA 3N9HA 3CNXA 4AKYA 3AGOA 3X3XA 4HYZA 1YIT3 4LYLB 3GZBA 2XSHB 1M1XB 2F99A 2FGTA 3KCHA 1MWTA 5ELJA 3FGYA 1NB3I 4K1VA 1IK3A 1AQZA 5JPUA 1CYUA 5M19A 1STDA 3T0UA 1N5PA 1QJGA 4HOHA 1NO3A 2CG0A 3B7CA 2W9PA 3FF2A 3GZXB 1Q7Y4 2GU1A 3LZAA 4FCMA 2A15A 3NQYA 3FF0A 5LC7A 4EV5A 1JV2B 2GEYA 3AGNA 1US1A 3HIGA 3K63A 2XSOB 1RMSA 7GSPA 2PZVA 5CF2A 1Q7HA 4NREA 3HI7A 1UI8A 3NM2A 4K90B 4QWTA 3ZG5A 2W2CA 1GY5A 3BB9A 1V58A 1VQP3 3OXAA 2F98A 5EEOA 1OHPA 1UGHI 5RNTA 4CCVA 3G8ZA 4J5GA 1DVCA 1GY6A 5G2GA 1JNQA 3ER7A 3GWRA 1WMPA 3H3HA 5IENA 3VSYA 1B2MA 2OWPA 3EHCA 3G4S3 1HYFA 1BSCA 5AYSC 1R4YA 2XEPA 3K7CA 1LQGC 3Q2PA 1UCKA 1RCKA 2KF4A 1YIJ3 3V99A 1U8CB 2J8XB 2BMRB 1Q814 4GSPA 1YI23 1SPUA 1JZOA 1JB4A 2IMJA 1Q40B 2HMKB 1GYBA 3PCRA 3G713 1TJDA 1RN4A 3S28A 3KKGA 1RGFA 1EUIC 1RN7A 5TGNA 1W6GA 4FMDA 3WR2A 4L8OA 3HIIA 4MEIA 4ILFA 3MSOA 4IT7A 4OVMA 4HBRA 4O02B 3CPOA 1KC84 1YHQ3 2ML5A 2E2UA 4BTYA 3GRDA 1T5YA 1PY3A 4WYKA 1RSNA 1PU4A 2RCDA 1RNBA 1IV9A 1OGZA 2Z7AA 1DVDA 2BO9B 5BU4A 1IYYA 1FUWA 3CC43 2UGIA 5CLKA 1A67A 2CFGA 2L1SA 5IW9A 2CX1A 1TFOA 2Y74A 1RGCA 1CH0A 2LQVA 1YJN3 3LTCA 4N6LA 5AIGA 4LZIA 1JKGB 3TDGA 1JN5B 1UUGB 3DH2A 2RSXA 1RNTA 3DGYA 4FR9A 3SOAA 1AVKA 1RRLA 2XGNA 3DGLA 1BRIA 1WMNA 2RNTA 3HX8A 3NV0A 3FG3A 2CWTA 2CFWA 1OUNA 3NQZA 3KN4A 4N6TA 5D81A 1VQ43 3OWSA 1X1XA 3DGNA 3DM8A 4X2HA 3QK9A 1YGWA 3LH4A 4WHAA 1ROAA 5FW5A 4ORLA 3CCS3 1E3VA 2OOVA 2HMOB 1GMPA 4AEQA 2K3DA 1BUQA 1FW7A 1GOVA 1R4CA 3PXMA 2CK3H 2QIYA 5EVHA 1QVG2 1FGQA 4AKZA 4EYCA 4G1MB 1BRSA 3KSED 4MMZB 3ZFZA 1UGIA 4BL3A 2OTL3 3PGBA 1BRHA 2UX0A 4CJNA 5AEWB 1VQ93 1HZ1A 1JB5A 1IDPA 2XF3A 2KXGA 2CFKA 2KF3A 2P05A 5HGRA 5M18A 2XFSA 4HM4B 2C11A 4HZ9B 1QVF2 1KSIA 5IEOA 3X41A 3CMA3 1FZUA 3L0RA 4JF8A 3GZYB 1N5HA 1RGHA 1QAKA 2OCTA 5STDA 1RGAA 3CCR3 1LNHA 2CFLA 4KFFA 1LOXA 2K0MA 3AMOA 4BIRA 2STDA 3BNEA 5BIRA 5JBSA 3EB8A 1RGGA 1BAOA 3K0ZA 3KIIA 1VQN3 3UNLA 2P09A 2CG1A 3S29A 1UUVB 1STFI 3ALAA 2R4IA 2W56A 3WOFB 1WTHA 1MGRA 2Z76A 3Q3FA 3BLZA 2WOHA 5DREA 4HM5B 4N6UA 3T8UA 1I0VA 4RZMA 2E2VA 1TRPA 1IT7A 2HMMB 1OHSA 2BNGA 3GSPA 3JUOA 5AIHA 2ZA4A 1Q42A 3CCQ3 1GD3A 1OCVA 1EQKA 4MMXB 1AR0A 3CCJ3 1D6UA 1X1YA 3V92A 3BNCA 4WP5A 1O7GB 1JRQA 1IU7A 2WGQA 1Q824 2B1XB 1FGOA 1W00A 2W0QA 2CH9A 3K5TA 1MWRA 3NBJA 6GSPA 1TUHA 3DZLA 4OK0A 5G1LA 2OTJ3 1DYUA 3CCM3 4STDA 3X3YA 2W56B 4HM7B 4EBGA 1I3IA 1EEJA 2D1WA 2HOHA 3FSDA 2HMNB 1WNHA 1JJ22 1RHLA 2OOVC 1A2VA 1BOXA 1TP6A 2ZDJA 2KCDA 1A2PA 1O7NB 2GSPA 1I2EA 3DGOA 2MC8A 3PYJA 2IUJA 1VQ63 1LOWA 1SJWA 3VGNA 1EA2A 1D6YA 1LOVA 4R9LA 1I0XA 3B4PA 4X2OA 3ZG0A 1RGEA 4U13A 1NWWA 4N3VA 1I3FA 5IG5A 1PFPA 1S723 4GL6A 3VF1A 1N8R4 3NHXA 5D82A 4O3VA 1VQM3 1UCLA 1RRHA 1V74A 1O7HB 2YFLB 4CPKA 5AEUB 5AIIA 3CPW2 1T2IA 4LEHA 3DUKA 1K8A4 3CU3A 6RNTA 3JUQA 2V1LA 1O7PB 2WOFA 1OHOA 2HMJB 4RNYA 5CF1A 2XR8B 4XBYA 1BSBA 1WQLB 1ZGXA 1JZDA 1T2HA 1VQQA 2JQ5A 2LYXA 4R9KA 4XDVA 2M7OA 5CK6A 1VQ53 1DMMA 1W4NA 2SARA 2ZHXB 3EX9A 2P0MA 3UL6A 4NHFA 4XBXA 3MPHA 1RKYA 2KAAA 1X1WA 1MWUA 3M8CA 1OF5A 1MGWA 4HM3B 3WOEB 2K54A 5AI1A 3H51A 1NU3A 1BANA 1K9M4 5EQLA 4IIAA 4H61A 1V57A 1MWSA 3D4AA 1OGXA 1FUSA 4XM4A 8RNTA 3KE7A 2CKFB 2OQEA 3CC23 3G6E3 2IA7A 1FA3A 1B2ZA 1GMQA 4ZM8A 4EW5A 5JPPA 3IPTA 3J7Yd 2YFJB 3U1WA 1GS3A 2AADA 4KFEA 3KFQC 2CIUA 4WYKB 5KP1A 4XDWA 1RDSA 1SARA 1EG9B 4LMIA 3LMLA
chains in the Genus database with same CATH topology
1UDII 1EUIC 2UUGC 1LQGC 1UGIA 1UGHI 2ZHXB 2J8XB 4LYLB 2UGIA 1UUGB 1LQMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDI I;  1EUI C;  2UUG C;  1LQG C;  1UGI A;  1UGH I;  2ZHX B;  2J8X B;  4LYL B;  2UGI A;  1UUG B;  1LQM B; 
#chains in the Genus database with same CATH topology
 4Q53 A;  3CCU 3;  3AHW A;  1ISK A;  4N6M A;  2F86 B;  3D3L A;  5HOH A;  4WFO A;  1K73 4;  1RLS A;  2O9U X;  3I56 3;  1NB5 I;  3MG1 A;  1J2B A;  1CEW I;  1FUT A;  1LXE A;  1ULI B;  2Z6B A;  1I70 A;  2YFI B;  2P38 A;  3F7S A;  3LTB A;  3PZW A;  1IT8 A;  2BMO B;  3BND A;  1IQY A;  3OX9 A;  3WA3 A;  3GZR A;  3URP A;  1T3B A;  3U97 A;  9RNT A;  1D6Z A;  5LC6 A;  3NV0 B;  3V98 A;  5IF6 A;  3FH1 A;  1B27 A;  1Y4K A;  1OAC A;  3F8H A;  4RNZ A;  1YJW 3;  3MWZ A;  2GU3 A;  2XGL A;  1W6Y A;  4OUQ A;  1TRQ A;  1YVS A;  1MOL A;  5KP3 A;  3NUV A;  3SX1 A;  4R80 A;  5ELU A;  2UUG C;  1RJO A;  4L8P A;  4GHO A;  1QAF A;  2INX A;  3CXC 2;  4FCJ A;  1M90 4;  1Q86 4;  2P0X A;  1ZO2 A;  4HZB B;  3A5E A;  2B24 B;  2Z77 A;  3FCS B;  2GXF A;  2QEX 3;  1LNI A;  1BNI A;  1NJI 4;  3DGM A;  1EKM A;  2Q07 A;  1LRA A;  1I8V A;  4O8S A;  3WOD G;  4NPB A;  2BIR A;  1TIJ A;  3MYT A;  4XB5 A;  4R4K A;  4MJD A;  3I55 3;  5BXQ A;  4BU4 A;  3N54 B;  3HOH A;  3SOY A;  2WO0 A;  4KT3 B;  3S27 A;  3FLJ A;  1C54 A;  2Y73 A;  1MNL A;  2GBX B;  2BMQ B;  1RGL A;  2O3O A;  3F40 A;  1A2K A;  3LT8 A;  1YGE A;  2R41 A;  3CCE 3;  2C10 A;  1RN1 A;  3OV4 A;  4FCZ A;  4HVN A;  1IVU A;  5CXO A;  4HM8 B;  1JBR A;  1E3R A;  1W01 A;  1ULJ B;  3OW2 2;  2GEX A;  1B2X A;  2F4Y A;  3FZW A;  4N6N B;  3WDG B;  1VQK 3;  1BUJ A;  4H3U A;  1UUW B;  2XRX B;  3O8Y A;  3S5C A;  3JUN A;  2OQE C;  2SBL A;  1O7W B;  1UCJ A;  5GSP A;  3AMO B;  3KZT A;  1DE3 A;  1BIR A;  1FYS A;  1L5G B;  1IQ8 A;  3MG3 A;  2I9W A;  3MHE A;  2BHM A;  3KSP A;  4EC6 A;  3CD6 3;  3NBB A;  6STD A;  3D5I A;  1W7C A;  4K1U A;  3HZP A;  1UCI A;  2BU4 A;  3NM7 A;  1E97 A;  3S67 A;  4LSO A;  3CCV 3;  3CME 3;  1BNS A;  3EJV A;  3RDE A;  1B20 A;  1HU9 A;  1OH0 A;  1C7H A;  3JUM A;  2F5W A;  1IVX A;  2H0H A;  2IUK A;  1BU4 A;  1CYV A;  4HM0 B;  1G02 A;  3DY5 A;  1RGK A;  3N8B A;  4HAA A;  3WHO A;  1B21 A;  1BRJ A;  1GSP A;  2CWV A;  1BGS A;  1YNV X;  2CFD A;  5DRV A;  1Q40 A;  3FKA A;  1ROV A;  4N6O B;  1B3S A;  2W9Q A;  1B2U A;  3LT9 A;  1KWI A;  1W5Z A;  1N9J A;  2QGU A;  3F14 A;  5AYR B;  1VQL 3;  2F56 A;  2PNC A;  2XH9 A;  1TTO A;  2IYJ A;  3CNM A;  3UL5 A;  2CHC A;  1YJ9 3;  1G96 A;  3BIR A;  1NNV A;  3Q1C A;  7RNT A;  3G0K A;  4DKI A;  1UW1 A;  3X40 A;  2RFR A;  2GBW B;  3JUP A;  1BRK A;  4TX4 A;  3FG4 A;  1FGR A;  4O2H A;  2JDI H;  1IVV A;  4L7K A;  3RNT A;  1LQM B;  4HM2 B;  1UDI I;  1JBS A;  3GAX A;  3FG1 A;  2KF6 A;  3F8X A;  2KF5 A;  1G0T A;  3DXO A;  4J9A A;  4KZ1 A;  3CC7 3;  4GB5 A;  1VQ7 3;  1BNJ A;  4RNT A;  1SIH A;  1UI7 A;  4HKV B;  1JKG A;  5G1K A;  5IEP A;  1JN5 A;  1IQX A;  1QAL A;  4I5Q A;  3OWU A;  4N6V 0;  1ZS7 A;  1SQW A;  3F7X A;  1M1K 4;  2W03 A;  2RGQ A;  3B4O A;  3BU4 A;  1X1U A;  4PEJ A;  4CDL A;  2HML B;  4LGQ A;  1GMR A;  1QMA A;  3PS8 A;  3HK4 A;  3EN1 B;  1VZZ A;  3I0Y A;  2C4B A;  3CCL 3;  1JBT A;  1AV4 A;  3BNB A;  1LOY A;  3NXJ A;  3OWY A;  3SVA A;  2IY2 A;  4EV2 A;  3DMC A;  4BL2 A;  1TFK A;  1WMO A;  1OPY A;  1A90 A;  4BTX A;  1B2S A;  1N8Q A;  3G16 A;  3IMA B;  3D79 A;  1Z1S A;  3UJM A;  3LOY A;  3X42 A;  1S5A A;  3LTD A;  1LVN A;  4HM1 B;  2CC3 A;  2L4V A;  3ECF A;  3LYG A;  3RGR A;  3NX0 A;  1I2G A;  3T8N A;  3NBR A;  3D5G A;  3MG2 A;  1RTU A;  4EXR A;  5KP4 A;  1OF5 B;  2BT3 A;  1U5O A;  3Q90 A;  2CW9 A;  2H0I A;  1BVI A;  1O7M B;  1W6C A;  2FXT A;  1JB2 A;  1RCL A;  1GOY A;  1AY7 A;  1VQO 3;  3UB1 A;  4K61 A;  1GY7 A;  1NDO B;  4KVH A;  1BNE A;  4HM6 B;  2ZL8 A;  1VQ8 3;  1DET A;  2H0G A;  3X3Z A;  3AHS A;  3EC9 A;  1YVB I;  4R1K A;  3EQQ B;  4WWU C;  4JRF A;  2CWU A;  4MMY B;  5I97 A;  1BSA A;  5D83 A;  1K28 A;  1Q9E A;  2E2T A;  2ML6 A;  4FMC A;  4J8T A;  1IV7 A;  2AAE A;  3EE1 A;  3LTA A;  4RBN A;  2MF7 A;  3RGA A;  1BRG A;  5A0O B;  2F5M A;  4FMA A;  1M9G A;  3SLU A;  1BSD A;  1ZX2 A;  2XFT A;  4I4K A;  4IPB A;  1BSE A;  3IJE B;  2CX0 A;  2FNQ A;  3SYU A;  4BTW A;  2QA4 3;  3D9R A;  3EF8 A;  2KRT A;  2WGO A;  3EN8 A;  3PCS A;  5M1A A;  3K9M C;  1TU5 A;  8CHO A;  1BNF A;  4KFD A;  1IVW A;  1K41 A;  4J5K A;  3WA2 X;  1BRN L;  1GOU A;  3WMD A;  4XBT A;  3SXX A;  5AIF A;  3A76 A;  4FMB A;  3EBT A;  5BVB A;  1ASK A;  1F8N A;  1N9E A;  7STD A;  5IG3 A;  3E99 A;  1CQS A;  2W04 A;  3LXU X;  5IG4 A;  3B8L A;  1FGM A;  5FGO A;  1KD1 4;  3SED A;  1BNR A;  1AVL A;  1DMQ A;  2W6J H;  1W2Z A;  2RBI A;  3MKI A;  3ROB A;  1W02 A;  1W2B 2;  1HKX A;  1I2F A;  3QRD A;  4HJL B;  3F9S A;  5IG0 A;  1DMN A;  1GD4 A;  3EBY A;  3STD A;  1KQS 2;  2D42 A;  1PYL A;  1FGT A;  2YX9 A;  3JVC A;  5IER A;  1BNG A;  1SII A;  3N9H A;  3CNX A;  4AKY A;  3AGO A;  3X3X A;  4HYZ A;  1YIT 3;  4LYL B;  3GZB A;  2XSH B;  1M1X B;  2F99 A;  2FGT A;  3KCH A;  1MWT A;  5ELJ A;  3FGY A;  1NB3 I;  4K1V A;  1IK3 A;  1AQZ A;  5JPU A;  1CYU A;  5M19 A;  1STD A;  3T0U A;  1N5P A;  1QJG A;  4HOH A;  1NO3 A;  2CG0 A;  3B7C A;  2W9P A;  3FF2 A;  3GZX B;  1Q7Y 4;  2GU1 A;  3LZA A;  4FCM A;  2A15 A;  3NQY A;  3FF0 A;  5LC7 A;  4EV5 A;  1JV2 B;  2GEY A;  3AGN A;  1US1 A;  3HIG A;  3K63 A;  2XSO B;  1RMS A;  7GSP A;  2PZV A;  5CF2 A;  1Q7H A;  4NRE A;  3HI7 A;  1UI8 A;  3NM2 A;  4K90 B;  4QWT A;  3ZG5 A;  2W2C A;  1GY5 A;  3BB9 A;  1V58 A;  1VQP 3;  3OXA A;  2F98 A;  5EEO A;  1OHP A;  1UGH I;  5RNT A;  4CCV A;  3G8Z A;  4J5G A;  1DVC A;  1GY6 A;  5G2G A;  1JNQ A;  3ER7 A;  3GWR A;  1WMP A;  3H3H A;  5IEN A;  3VSY A;  1B2M A;  2OWP A;  3EHC A;  3G4S 3;  1HYF A;  1BSC A;  5AYS C;  1R4Y A;  2XEP A;  3K7C A;  1LQG C;  3Q2P A;  1UCK A;  1RCK A;  2KF4 A;  1YIJ 3;  3V99 A;  1U8C B;  2J8X B;  2BMR B;  1Q81 4;  4GSP A;  1YI2 3;  1SPU A;  1JZO A;  1JB4 A;  2IMJ A;  1Q40 B;  2HMK B;  1GYB A;  3PCR A;  3G71 3;  1TJD A;  1RN4 A;  3S28 A;  3KKG A;  1RGF A;  1EUI C;  1RN7 A;  5TGN A;  1W6G A;  4FMD A;  3WR2 A;  4L8O A;  3HII A;  4MEI A;  4ILF A;  3MSO A;  4IT7 A;  4OVM A;  4HBR A;  4O02 B;  3CPO A;  1KC8 4;  1YHQ 3;  2ML5 A;  2E2U A;  4BTY A;  3GRD A;  1T5Y A;  1PY3 A;  4WYK A;  1RSN A;  1PU4 A;  2RCD A;  1RNB A;  1IV9 A;  1OGZ A;  2Z7A A;  1DVD A;  2BO9 B;  5BU4 A;  1IYY A;  1FUW A;  3CC4 3;  2UGI A;  5CLK A;  1A67 A;  2CFG A;  2L1S A;  5IW9 A;  2CX1 A;  1TFO A;  2Y74 A;  1RGC A;  1CH0 A;  2LQV A;  1YJN 3;  3LTC A;  4N6L A;  5AIG A;  4LZI A;  1JKG B;  3TDG A;  1JN5 B;  1UUG B;  3DH2 A;  2RSX A;  1RNT A;  3DGY A;  4FR9 A;  3SOA A;  1AVK A;  1RRL A;  2XGN A;  3DGL A;  1BRI A;  1WMN A;  2RNT A;  3HX8 A;  3NV0 A;  3FG3 A;  2CWT A;  2CFW A;  1OUN A;  3NQZ A;  3KN4 A;  4N6T A;  5D81 A;  1VQ4 3;  3OWS A;  1X1X A;  3DGN A;  3DM8 A;  4X2H A;  3QK9 A;  1YGW A;  3LH4 A;  4WHA A;  1ROA A;  5FW5 A;  4ORL A;  3CCS 3;  1E3V A;  2OOV A;  2HMO B;  1GMP A;  4AEQ A;  2K3D A;  1BUQ A;  1FW7 A;  1GOV A;  1R4C A;  3PXM A;  2CK3 H;  2QIY A;  5EVH A;  1QVG 2;  1FGQ A;  4AKZ A;  4EYC A;  4G1M B;  1BRS A;  3KSE D;  4MMZ B;  3ZFZ A;  1UGI A;  4BL3 A;  2OTL 3;  3PGB A;  1BRH A;  2UX0 A;  4CJN A;  5AEW B;  1VQ9 3;  1HZ1 A;  1JB5 A;  1IDP A;  2XF3 A;  2KXG A;  2CFK A;  2KF3 A;  2P05 A;  5HGR A;  5M18 A;  2XFS A;  4HM4 B;  2C11 A;  4HZ9 B;  1QVF 2;  1KSI A;  5IEO A;  3X41 A;  3CMA 3;  1FZU A;  3L0R A;  4JF8 A;  3GZY B;  1N5H A;  1RGH A;  1QAK A;  2OCT A;  5STD A;  1RGA A;  3CCR 3;  1LNH A;  2CFL A;  4KFF A;  1LOX A;  2K0M A;  3AMO A;  4BIR A;  2STD A;  3BNE A;  5BIR A;  5JBS A;  3EB8 A;  1RGG A;  1BAO A;  3K0Z A;  3KII A;  1VQN 3;  3UNL A;  2P09 A;  2CG1 A;  3S29 A;  1UUV B;  1STF I;  3ALA A;  2R4I A;  2W56 A;  3WOF B;  1WTH A;  1MGR A;  2Z76 A;  3Q3F A;  3BLZ A;  2WOH A;  5DRE A;  4HM5 B;  4N6U A;  3T8U A;  1I0V A;  4RZM A;  2E2V A;  1TRP A;  1IT7 A;  2HMM B;  1OHS A;  2BNG A;  3GSP A;  3JUO A;  5AIH A;  2ZA4 A;  1Q42 A;  3CCQ 3;  1GD3 A;  1OCV A;  1EQK A;  4MMX B;  1AR0 A;  3CCJ 3;  1D6U A;  1X1Y A;  3V92 A;  3BNC A;  4WP5 A;  1O7G B;  1JRQ A;  1IU7 A;  2WGQ A;  1Q82 4;  2B1X B;  1FGO A;  1W00 A;  2W0Q A;  2CH9 A;  3K5T A;  1MWR A;  3NBJ A;  6GSP A;  1TUH A;  3DZL A;  4OK0 A;  5G1L A;  2OTJ 3;  1DYU A;  3CCM 3;  4STD A;  3X3Y A;  2W56 B;  4HM7 B;  4EBG A;  1I3I A;  1EEJ A;  2D1W A;  2HOH A;  3FSD A;  2HMN B;  1WNH A;  1JJ2 2;  1RHL A;  2OOV C;  1A2V A;  1BOX A;  1TP6 A;  2ZDJ A;  2KCD A;  1A2P A;  1O7N B;  2GSP A;  1I2E A;  3DGO A;  2MC8 A;  3PYJ A;  2IUJ A;  1VQ6 3;  1LOW A;  1SJW A;  3VGN A;  1EA2 A;  1D6Y A;  1LOV A;  4R9L A;  1I0X A;  3B4P A;  4X2O A;  3ZG0 A;  1RGE A;  4U13 A;  1NWW A;  4N3V A;  1I3F A;  5IG5 A;  1PFP A;  1S72 3;  4GL6 A;  3VF1 A;  1N8R 4;  3NHX A;  5D82 A;  4O3V A;  1VQM 3;  1UCL A;  1RRH A;  1V74 A;  1O7H B;  2YFL B;  4CPK A;  5AEU B;  5AII A;  3CPW 2;  1T2I A;  4LEH A;  3DUK A;  1K8A 4;  3CU3 A;  6RNT A;  3JUQ A;  2V1L A;  1O7P B;  2WOF A;  1OHO A;  2HMJ B;  4RNY A;  5CF1 A;  2XR8 B;  4XBY A;  1BSB A;  1WQL B;  1ZGX A;  1JZD A;  1T2H A;  1VQQ A;  2JQ5 A;  2LYX A;  4R9K A;  4XDV A;  2M7O A;  5CK6 A;  1VQ5 3;  1DMM A;  1W4N A;  2SAR A;  2ZHX B;  3EX9 A;  2P0M A;  3UL6 A;  4NHF A;  4XBX A;  3MPH A;  1RKY A;  2KAA A;  1X1W A;  1MWU A;  3M8C A;  1OF5 A;  1MGW A;  4HM3 B;  3WOE B;  2K54 A;  5AI1 A;  3H51 A;  1NU3 A;  1BAN A;  1K9M 4;  5EQL A;  4IIA A;  4H61 A;  1V57 A;  1MWS A;  3D4A A;  1OGX A;  1FUS A;  4XM4 A;  8RNT A;  3KE7 A;  2CKF B;  2OQE A;  3CC2 3;  3G6E 3;  2IA7 A;  1FA3 A;  1B2Z A;  1GMQ A;  4ZM8 A;  4EW5 A;  5JPP A;  3IPT A;  3J7Y d;  2YFJ B;  3U1W A;  1GS3 A;  2AAD A;  4KFE A;  3KFQ C;  2CIU A;  4WYK B;  5KP1 A;  4XDW A;  1RDS A;  1SAR A;  1EG9 B;  4LMI A;  3LML A; 
#chains in the Genus database with same CATH homology
 1UDI I;  1EUI C;  2UUG C;  1LQG C;  1UGI A;  1UGH I;  2ZHX B;  2J8X B;  4LYL B;  2UGI A;  1UUG B;  1LQM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...