2UGIA

Protein mimicry of dna from crystal structures of the uracil glycosylase inhibitor protein and its complex with escherichia coli uracil-dna glycosylase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE INHIBITOR
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Bacillus phage pbs2
total genus 15
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2ugiA00
1LQGC 1UGIA 1UGHI 1UDII 2UGIA 2ZHXB 2UUGC 1EUIC 1LQMB 4LYLB 2J8XB 1UUGB
chains in the Genus database with same CATH superfamily
1NWWA 4FR9A 1CYVA 3LXUX 1BNGA 1BNRA 1RGAA 2D1WA 1JKGA 2H0HA 1JN5A 1BSCA 4N6MA 1VQ53 1FGOA 3G0KA 2CKFB 3I0YA 3LH4A 3MKIA 1I0XA 3Q1CA 3NM2A 1B2UA 3F40A 1PU4A 1DMMA 1ULJB 4N6LA 6GSPA 3BU4A 1RDSA 3HK4A 2F86B 3SYUA 1RSNA 3F9SA 4KFDA 5CXOA 1JB2A 1RN7A 2F4YA 3NHXA 2Z6BA 3OX9A 1PFPA 2HMOB 2IUJA 1FA3A 1MGRA 1DVCA 1BVIA 1PYLA 1Y4KA 1OCVA 1WQLB 1W02A 4K1UA 3UJMA 1T2HA 1ROAA 2YX9A 1DVDA 4NHFA 3JUNA 2IUKA 2E2VA 2W04A 5AI1A 3LYGA 3DXOA 1VQ63 4U13A 1DETA 1YGEA 1GMQA 3EBTA 1MWSA 1Q7HA 2XFTA 4L8PA 4CPKA 1LOVA 4KZ1A 4RNTA 3KE7A 4HZ9B 1Q40A 6STDA 3CCL3 1OHSA 1V58A 4CJNA 1I3IA 1RJOA 2RFRA 4LYLB 1BNEA 1MWUA 4WP5A 1AY7A 2C4BA 3PZWA 3QRDA 4H3UA 3KSPA 5AYSC 3IJEB 4XM4A 2XSOB 2YFIB 3D9RA 1EEJA 1I3FA 1MWRA 4HM0B 3SOYA 1B27A 2V1LA 1IQ8A 1YVBI 4ZM8A 2XR8B 1R4CA 3WR2A 4HM4B 2ZHXB 5A0OB 2K3DA 1A67A 2QEX3 1L5GB 1Q40B 1TJDA 1UUGB 1K9M4 1RCLA 3FSDA 1BIRA 2P0MA 4HM7B 2CG0A 3MG2A 1OGXA 4ILFA 1TU5A 3TDGA 2IY2A 1IV9A 2H0IA 2PZVA 2W9PA 2Z7AA 4J8TA 5KP3A 2OOVA 1RGHA 3MWZA 1NJI4 1B2MA 5AIHA 2SARA 1O7WB 1BRNL 1B2XA 5G1KA 1BRHA 4HKVB 1VQM3 4HBRA 1JNQA 3CNMA 3X41A 4BIRA 3JUPA 1TTOA 2GU3A 2XSHB 4BTYA 5IERA 4BU4A 2F98A 3FZWA 3G4S3 5AEWB 1RN1A 2K54A 3IPTA 3S28A 1IVWA 2HOHA 5JPPA 1SQWA 3KFQC 3LTDA 5CK6A 1UGIA 1BUJA 3WHOA 1O7GB 1QVG2 1VQQA 2QGUA 1R4YA 1WMNA 3DUKA 3O8YA 1GMRA 5G2GA 3BB9A 3FKAA 6RNTA 3DGNA 3ALAA 1YI23 1YIJ3 1JZDA 1I0VA 4AEQA 3SEDA 3OW22 1BSDA 4GL6A 2RSXA 1KD14 1Q7Y4 3L0RA 1TUHA 3NX0A 1K41A 2CFLA 3HIIA 3MG3A 4R4KA 2B24B 3CCE3 1YJN3 2UGIA 3CCV3 2F5MA 5FW5A 1EUIC 1M904 1E97A 2RNTA 1IK3A 1B21A 1W6CA 3T8UA 3IMAB 4MMZB 3CCS3 5HGRA 4XDWA 3MHEA 1NU3A 2W9QA 3EN8A 4EC6A 3EC9A 5M19A 2BT3A 2CWTA 4Q53A 7STDA 4IPBA 1HZ1A 2W2CA 4XBTA 2BMQB 2Y73A 4MJDA 5BU4A 2OTL3 1Q824 1V57A 4AKZA 5CF1A 3LTCA 1A2VA 1GOVA 5TGNA 2LQVA 1UUVB 3MYTA 3X3YA 3CMA3 3B8LA 1EKMA 1UCLA 3SX1A 3CME3 3K0ZA 1O7HB 8CHOA 1GOUA 4EV5A 2J8XB 1B20A 3VSYA 1LNHA 3K7CA 3CCJ3 1X1YA 1IVUA 2W56B 4PEJA 3NV0B 1WNHA 3N8BA 5EEOA 5IEOA 2KF4A 4NREA 1TFOA 3G8ZA 4HM8B 1ISKA 3KCHA 3STDA 3CU3A 3PS8A 1I8VA 1JV2B 1W2B2 1IQYA 1Q42A 3HIGA 1CH0A 2R4IA 5IG0A 1BSAA 1SIHA 1SPUA 2F99A 4TX4A 4QWTA 3X3XA 1W6YA 3EQQB 1GYBA 3NQYA 5M18A 4O2HA 1TIJA 3CC43 1BRKA 1W00A 4RZMA 2I9WA 3RDEA 4BL3A 5IF6A 2HMLB 2BMRB 5KP1A 5BVBA 4HZBB 4MMYB 4LMIA 1YJ93 1X1WA 5LC6A 2O9UX 5G1LA 2Z76A 1BSEA 1LQMB 3DGMA 2BIRA 2IA7A 1LRAA 3A5EA 1VQK3 3Q3FA 5EQLA 3DM8A 2OQEC 4EYCA 3A76A 2W6JH 1JKGB 1QJGA 1AVLA 3DGYA 1JN5B 2CG1A 3UNLA 1BAOA 2XRXB 5GSPA 2F56A 3GZXB 3I563 1GY7A 3PGBA 1A2KA 1I70A 1N8QA 3LT8A 2OTJ3 4AKYA 1IT7A 1FUSA 3BNCA 2O3OA 3HI7A 3NXJA 4HM1B 5I97A 1SARA 3KSED 1IDPA 1UI7A 1UW1A 3K9MC 1N5PA 3ZG5A 4FCZA 5DREA 3ZG0A 4L7KA 4R9KA 4HM6B 1EG9B 2HMKB 1O7NB 3AMOA 3FG3A 4LGQA 2D42A 4LZIA 1RGEA 3CCU3 3PCRA 3ECFA 4XB5A 2QA43 4WYKA 3F14A 3I553 2OCTA 3VF1A 4KT3B 1NDOB 3D79A 1OF5A 1AVKA 1OUNA 4R80A 5D81A 2KRTA 3G16A 3LTAA 2XGLA 2W03A 1BU4A 1W2ZA 2ZA4A 4GHOA 4G1MB 2GXFA 4X2OA 1GD4A 2WO0A 3V92A 5LC7A 1VQO3 1CQSA 2Y74A 4KFFA 1BGSA 2KXGA 4J5KA 4MMXB 5BIRA 1NB5I 1QVF2 3EX9A 4HOHA 1OH0A 2M7OA 1RN4A 5ELUA 1BSBA 1W01A 4IT7A 3WOFB 3KIIA 1OF5B 2YFJB 3PXMA 1JB5A 2JQ5A 1W5ZA 3DH2A 1QAKA 1C7HA 1GMPA 4I4KA 4N6TA 1BRSA 3URPA 3NBBA 3Q90A 4EXRA 1LVNA 1WMPA 2HMJB 2GSPA 2ML5A 3EBYA 3EN1B 4HM3B 2CIUA 3X42A 3AHSA 3NQZA 5DRVA 4OVMA 1IYYA 3EF8A 1MGWA 4DKIA 4H61A 1LOXA 5M1AA 1JB4A 4EW5A 1O7MB 1GSPA 3DZLA 3GZRA 3BLZA 4I5QA 4XBYA 1ZS7A 4N6OB 4LSOA 2OWPA 4GSPA 4ORLA 3WDGB 3FG4A 4HAAA 2CFKA 3CNXA 1M1XB 1ZX2A 2H0GA 3LT9A 3AGNA 1K734 1N9EA 1RLSA 3CCR3 3GSPA 3S67A 1GOYA 3UB1A 1RKYA 1U8CB 5AIIA 4K1VA 2GBXB 1AR0A 1OHOA 2AADA 3N9HA 4HYZA 1BRIA 4K61A 3DGOA 3OWSA 3X40A 2QIYA 3BIRA 1IQXA 2IYJA 1B2SA 3JUQA 3U1WA 5AEUB 1ASKA 2P05A 1BRJA 3F7XA 2K0MA 3K63A 3MPHA 5IW9A 3CD63 1I2GA 1YJW3 4FCJA 2XFSA 1K8A4 3WODG 1NO3A 3NUVA 1JBRA 1VQ93 3PYJA 1RGKA 2CX1A 1EA2A 3H3HA 3S29A 1FGMA 2CW9A 2L4VA 3UL6A 1OPYA 2C11A 3NBRA 3WMDA 1AV4A 1DE3A 1GY6A 4XDVA 1Q814 1SJWA 3KZTA 1ROVA 4RNYA 1M1K4 2XF3A 3AHWA 1K28A 4CCVA 1VZZA 3FCSB 1S5AA 1E3RA 4OUQA 3JVCA 1W4NA 3WA2X 3PCSA 2GBWB 1G0TA 2INXA 3KN4A 3WA3A 4R9LA 2CWVA 3OWUA 1STDA 3F7SA 2CX0A 1FGQA 1TFKA 2MC8A 1BUQA 1UGHI 5IG4A 1O7PB 1RCKA 2KF6A 3DMCA 5KP4A 2FGTA 1NNVA 1G02A 3FF2A 1GD3A 4J5GA 4N6UA 5AIFA 2CWUA 1T5YA 1W6GA 1VQ73 7RNTA 1DMQA 2XH9A 1RNBA 1VQ43 1IVXA 2F5WA 4O02B 2P09A 5JPUA 1YIT3 3D4AA 1UCJA 1FUTA 1VQL3 1U5OA 3NBJA 4RBNA 1CEWI 1US1A 1C54A 1HYFA 1TRQA 1KSIA 1D6YA 1ZO2A 3CCM3 4HVNA 1A90A 1VQP3 1ULIB 2CFGA 5STDA 3CC23 1KC84 2CC3A 1X1XA 4FMBA 4FMDA 3FLJA 1MWTA 1N8R4 1LQGC 1M9GA 1IV7A 4JRFA 3X3ZA 3V99A 1OGZA 3BNEA 3HOHA 2ML6A 4EBGA 2XGNA 2LYXA 1WMOA 1DYUA 3EB8A 1QAFA 1LOWA 3HX8A 5D82A 2OOVC 4WHAA 3CCQ3 1FGRA 2KF5A 5HOHA 2RCDA 2R41A 1E3VA 4HM2B 4LEHA 1Z1SA 1OHPA 4R1KA 2L1SA 2E2UA 5EVHA 3EHCA 1RGCA 1S723 2ZL8A 1RMSA 2B1XB 3GAXA 3GZYB 3SLUA 3G713 1B3SA 3Q2PA 1RNTA 1NB3I 4HJLB 1RGLA 3CPW2 3AMOB 1BNJA 3D5IA 2CH9A 1A2PA 2BO9B 8RNTA 1FGTA 1RGFA 4FCMA 2YFLB 2C10A 1RGGA 4WYKB 1KQS2 3RNTA 1JZOA 2FNQA 3CPOA 3EJVA 4X2HA 4FMAA 5D83A 7GSPA 1RRLA 1YNVX 1KWIA 1I2FA 1YHQ3 1FZUA 1LNIA 2ZDJA 1D6UA 1BNSA 2P38A 1MNLA 2HMMB 2OQEA 1YGWA 3OXAA 3G6E3 3DGLA 3EE1A 2BMOB 5CLKA 3FG1A 3BNBA 3LOYA 5IENA 1OACA 3LMLA 1QALA 2Z77A 2RBIA 1JBSA 3SXXA 3D5GA 1QMAA 1FYSA 3CXC2 2GEXA 3OWYA 4STDA 3B4OA 1V74A 1IU7A 1AQZA 3LTBA 2CFWA 2GU1A 2P0XA 3FF0A 3ZFZA 3SOAA 2RGQA 1JRQA 3UL5A 1JBTA 1MOLA 1N9JA 3D3LA 2WGQA 1TP6A 3B4PA 2KCDA 3BNDA 3KKGA 3RGRA 1IVVA 3QK9A 3H51A 1BRGA 2WGOA 5IG3A 4GB5A 3F8HA 2CHCA 4WFOA 1RRHA 5AYRB 3U97A 3VGNA 3J7Yd 3LZAA 1Q864 2PNCA 3JUMA 4KVHA 2BHMA 2E2TA 3K5TA 1IT8A 4FMCA 3RGAA 3NM7A 4KFEA 3B7CA 3S27A 2AAEA 1UDII 3DY5A 4CDLA 4O8SA 2KAAA 3GZBA 4BTWA 1UCIA 2XEPA 4J9AA 4XBXA 1GS3A 1W7CA 3S5CA 1G96A 1LXEA 3E99A 1ZGXA 3HZPA 1GY5A 3JUOA 5FGOA 5BXQA 4BTXA 3SVAA 5IG5A 4WWUC 2WOFA 1X1UA 2KF3A 3MSOA 4L8OA 5AIGA 3CC73 2CFDA 4O3VA 1WTHA 2FXTA 4BL2A 1HU9A 3T8NA 4IIAA 1TRPA 2UX0A 5IEPA 5CF2A 1BNFA 1FW7A 2Q07A 3GRDA 3WOEB 1JJ22 1VQN3 2W56A 3NV0A 1VQ83 2BU4A 3M8CA 4RNZA 3FH1A 2HMNB 1T2IA 2CK3H 2STDA 3N54B 1N5HA 1YVSA 3FGYA 4N6V0 5JBSA 2BNGA 3GWRA 2WOHA 2A15A 1BNIA 4EV2A 1SIIA 2JDIH 4N3VA 4HM5B 4OK0A 3ER7A 4N6NB 1J2BA 9RNTA 1LOYA 1UCKA 2GEYA 3OV4A 1BOXA 1STFI 3AGOA 2SBLA 3V98A 2IMJA 1D6ZA 3MG1A 2W0QA 5ELJA 1I2EA 4MEIA 3ROBA 1T3BA 1UI8A 1RHLA 2UUGC 1EQKA 1F8NA 1UUWB 2MF7A 1BANA 1RTUA 1PY3A 3T0UA 1B2ZA 1FUWA 1HKXA 3F8XA 1Q9EA 4K90B 1CYUA 4NPBA 4JF8A 5RNTA 1DMNA
chains in the Genus database with same CATH topology
1LQGC 1UGIA 1UGHI 1UDII 2UGIA 2ZHXB 2UUGC 1EUIC 1LQMB 4LYLB 2J8XB 1UUGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQG C;  1UGI A;  1UGH I;  1UDI I;  2UGI A;  2ZHX B;  2UUG C;  1EUI C;  1LQM B;  4LYL B;  2J8X B;  1UUG B; 
#chains in the Genus database with same CATH topology
 1NWW A;  4FR9 A;  1CYV A;  3LXU X;  1BNG A;  1BNR A;  1RGA A;  2D1W A;  1JKG A;  2H0H A;  1JN5 A;  1BSC A;  4N6M A;  1VQ5 3;  1FGO A;  3G0K A;  2CKF B;  3I0Y A;  3LH4 A;  3MKI A;  1I0X A;  3Q1C A;  3NM2 A;  1B2U A;  3F40 A;  1PU4 A;  1DMM A;  1ULJ B;  4N6L A;  6GSP A;  3BU4 A;  1RDS A;  3HK4 A;  2F86 B;  3SYU A;  1RSN A;  3F9S A;  4KFD A;  5CXO A;  1JB2 A;  1RN7 A;  2F4Y A;  3NHX A;  2Z6B A;  3OX9 A;  1PFP A;  2HMO B;  2IUJ A;  1FA3 A;  1MGR A;  1DVC A;  1BVI A;  1PYL A;  1Y4K A;  1OCV A;  1WQL B;  1W02 A;  4K1U A;  3UJM A;  1T2H A;  1ROA A;  2YX9 A;  1DVD A;  4NHF A;  3JUN A;  2IUK A;  2E2V A;  2W04 A;  5AI1 A;  3LYG A;  3DXO A;  1VQ6 3;  4U13 A;  1DET A;  1YGE A;  1GMQ A;  3EBT A;  1MWS A;  1Q7H A;  2XFT A;  4L8P A;  4CPK A;  1LOV A;  4KZ1 A;  4RNT A;  3KE7 A;  4HZ9 B;  1Q40 A;  6STD A;  3CCL 3;  1OHS A;  1V58 A;  4CJN A;  1I3I A;  1RJO A;  2RFR A;  4LYL B;  1BNE A;  1MWU A;  4WP5 A;  1AY7 A;  2C4B A;  3PZW A;  3QRD A;  4H3U A;  3KSP A;  5AYS C;  3IJE B;  4XM4 A;  2XSO B;  2YFI B;  3D9R A;  1EEJ A;  1I3F A;  1MWR A;  4HM0 B;  3SOY A;  1B27 A;  2V1L A;  1IQ8 A;  1YVB I;  4ZM8 A;  2XR8 B;  1R4C A;  3WR2 A;  4HM4 B;  2ZHX B;  5A0O B;  2K3D A;  1A67 A;  2QEX 3;  1L5G B;  1Q40 B;  1TJD A;  1UUG B;  1K9M 4;  1RCL A;  3FSD A;  1BIR A;  2P0M A;  4HM7 B;  2CG0 A;  3MG2 A;  1OGX A;  4ILF A;  1TU5 A;  3TDG A;  2IY2 A;  1IV9 A;  2H0I A;  2PZV A;  2W9P A;  2Z7A A;  4J8T A;  5KP3 A;  2OOV A;  1RGH A;  3MWZ A;  1NJI 4;  1B2M A;  5AIH A;  2SAR A;  1O7W B;  1BRN L;  1B2X A;  5G1K A;  1BRH A;  4HKV B;  1VQM 3;  4HBR A;  1JNQ A;  3CNM A;  3X41 A;  4BIR A;  3JUP A;  1TTO A;  2GU3 A;  2XSH B;  4BTY A;  5IER A;  4BU4 A;  2F98 A;  3FZW A;  3G4S 3;  5AEW B;  1RN1 A;  2K54 A;  3IPT A;  3S28 A;  1IVW A;  2HOH A;  5JPP A;  1SQW A;  3KFQ C;  3LTD A;  5CK6 A;  1UGI A;  1BUJ A;  3WHO A;  1O7G B;  1QVG 2;  1VQQ A;  2QGU A;  1R4Y A;  1WMN A;  3DUK A;  3O8Y A;  1GMR A;  5G2G A;  3BB9 A;  3FKA A;  6RNT A;  3DGN A;  3ALA A;  1YI2 3;  1YIJ 3;  1JZD A;  1I0V A;  4AEQ A;  3SED A;  3OW2 2;  1BSD A;  4GL6 A;  2RSX A;  1KD1 4;  1Q7Y 4;  3L0R A;  1TUH A;  3NX0 A;  1K41 A;  2CFL A;  3HII A;  3MG3 A;  4R4K A;  2B24 B;  3CCE 3;  1YJN 3;  2UGI A;  3CCV 3;  2F5M A;  5FW5 A;  1EUI C;  1M90 4;  1E97 A;  2RNT A;  1IK3 A;  1B21 A;  1W6C A;  3T8U A;  3IMA B;  4MMZ B;  3CCS 3;  5HGR A;  4XDW A;  3MHE A;  1NU3 A;  2W9Q A;  3EN8 A;  4EC6 A;  3EC9 A;  5M19 A;  2BT3 A;  2CWT A;  4Q53 A;  7STD A;  4IPB A;  1HZ1 A;  2W2C A;  4XBT A;  2BMQ B;  2Y73 A;  4MJD A;  5BU4 A;  2OTL 3;  1Q82 4;  1V57 A;  4AKZ A;  5CF1 A;  3LTC A;  1A2V A;  1GOV A;  5TGN A;  2LQV A;  1UUV B;  3MYT A;  3X3Y A;  3CMA 3;  3B8L A;  1EKM A;  1UCL A;  3SX1 A;  3CME 3;  3K0Z A;  1O7H B;  8CHO A;  1GOU A;  4EV5 A;  2J8X B;  1B20 A;  3VSY A;  1LNH A;  3K7C A;  3CCJ 3;  1X1Y A;  1IVU A;  2W56 B;  4PEJ A;  3NV0 B;  1WNH A;  3N8B A;  5EEO A;  5IEO A;  2KF4 A;  4NRE A;  1TFO A;  3G8Z A;  4HM8 B;  1ISK A;  3KCH A;  3STD A;  3CU3 A;  3PS8 A;  1I8V A;  1JV2 B;  1W2B 2;  1IQY A;  1Q42 A;  3HIG A;  1CH0 A;  2R4I A;  5IG0 A;  1BSA A;  1SIH A;  1SPU A;  2F99 A;  4TX4 A;  4QWT A;  3X3X A;  1W6Y A;  3EQQ B;  1GYB A;  3NQY A;  5M18 A;  4O2H A;  1TIJ A;  3CC4 3;  1BRK A;  1W00 A;  4RZM A;  2I9W A;  3RDE A;  4BL3 A;  5IF6 A;  2HML B;  2BMR B;  5KP1 A;  5BVB A;  4HZB B;  4MMY B;  4LMI A;  1YJ9 3;  1X1W A;  5LC6 A;  2O9U X;  5G1L A;  2Z76 A;  1BSE A;  1LQM B;  3DGM A;  2BIR A;  2IA7 A;  1LRA A;  3A5E A;  1VQK 3;  3Q3F A;  5EQL A;  3DM8 A;  2OQE C;  4EYC A;  3A76 A;  2W6J H;  1JKG B;  1QJG A;  1AVL A;  3DGY A;  1JN5 B;  2CG1 A;  3UNL A;  1BAO A;  2XRX B;  5GSP A;  2F56 A;  3GZX B;  3I56 3;  1GY7 A;  3PGB A;  1A2K A;  1I70 A;  1N8Q A;  3LT8 A;  2OTJ 3;  4AKY A;  1IT7 A;  1FUS A;  3BNC A;  2O3O A;  3HI7 A;  3NXJ A;  4HM1 B;  5I97 A;  1SAR A;  3KSE D;  1IDP A;  1UI7 A;  1UW1 A;  3K9M C;  1N5P A;  3ZG5 A;  4FCZ A;  5DRE A;  3ZG0 A;  4L7K A;  4R9K A;  4HM6 B;  1EG9 B;  2HMK B;  1O7N B;  3AMO A;  3FG3 A;  4LGQ A;  2D42 A;  4LZI A;  1RGE A;  3CCU 3;  3PCR A;  3ECF A;  4XB5 A;  2QA4 3;  4WYK A;  3F14 A;  3I55 3;  2OCT A;  3VF1 A;  4KT3 B;  1NDO B;  3D79 A;  1OF5 A;  1AVK A;  1OUN A;  4R80 A;  5D81 A;  2KRT A;  3G16 A;  3LTA A;  2XGL A;  2W03 A;  1BU4 A;  1W2Z A;  2ZA4 A;  4GHO A;  4G1M B;  2GXF A;  4X2O A;  1GD4 A;  2WO0 A;  3V92 A;  5LC7 A;  1VQO 3;  1CQS A;  2Y74 A;  4KFF A;  1BGS A;  2KXG A;  4J5K A;  4MMX B;  5BIR A;  1NB5 I;  1QVF 2;  3EX9 A;  4HOH A;  1OH0 A;  2M7O A;  1RN4 A;  5ELU A;  1BSB A;  1W01 A;  4IT7 A;  3WOF B;  3KII A;  1OF5 B;  2YFJ B;  3PXM A;  1JB5 A;  2JQ5 A;  1W5Z A;  3DH2 A;  1QAK A;  1C7H A;  1GMP A;  4I4K A;  4N6T A;  1BRS A;  3URP A;  3NBB A;  3Q90 A;  4EXR A;  1LVN A;  1WMP A;  2HMJ B;  2GSP A;  2ML5 A;  3EBY A;  3EN1 B;  4HM3 B;  2CIU A;  3X42 A;  3AHS A;  3NQZ A;  5DRV A;  4OVM A;  1IYY A;  3EF8 A;  1MGW A;  4DKI A;  4H61 A;  1LOX A;  5M1A A;  1JB4 A;  4EW5 A;  1O7M B;  1GSP A;  3DZL A;  3GZR A;  3BLZ A;  4I5Q A;  4XBY A;  1ZS7 A;  4N6O B;  4LSO A;  2OWP A;  4GSP A;  4ORL A;  3WDG B;  3FG4 A;  4HAA A;  2CFK A;  3CNX A;  1M1X B;  1ZX2 A;  2H0G A;  3LT9 A;  3AGN A;  1K73 4;  1N9E A;  1RLS A;  3CCR 3;  3GSP A;  3S67 A;  1GOY A;  3UB1 A;  1RKY A;  1U8C B;  5AII A;  4K1V A;  2GBX B;  1AR0 A;  1OHO A;  2AAD A;  3N9H A;  4HYZ A;  1BRI A;  4K61 A;  3DGO A;  3OWS A;  3X40 A;  2QIY A;  3BIR A;  1IQX A;  2IYJ A;  1B2S A;  3JUQ A;  3U1W A;  5AEU B;  1ASK A;  2P05 A;  1BRJ A;  3F7X A;  2K0M A;  3K63 A;  3MPH A;  5IW9 A;  3CD6 3;  1I2G A;  1YJW 3;  4FCJ A;  2XFS A;  1K8A 4;  3WOD G;  1NO3 A;  3NUV A;  1JBR A;  1VQ9 3;  3PYJ A;  1RGK A;  2CX1 A;  1EA2 A;  3H3H A;  3S29 A;  1FGM A;  2CW9 A;  2L4V A;  3UL6 A;  1OPY A;  2C11 A;  3NBR A;  3WMD A;  1AV4 A;  1DE3 A;  1GY6 A;  4XDV A;  1Q81 4;  1SJW A;  3KZT A;  1ROV A;  4RNY A;  1M1K 4;  2XF3 A;  3AHW A;  1K28 A;  4CCV A;  1VZZ A;  3FCS B;  1S5A A;  1E3R A;  4OUQ A;  3JVC A;  1W4N A;  3WA2 X;  3PCS A;  2GBW B;  1G0T A;  2INX A;  3KN4 A;  3WA3 A;  4R9L A;  2CWV A;  3OWU A;  1STD A;  3F7S A;  2CX0 A;  1FGQ A;  1TFK A;  2MC8 A;  1BUQ A;  1UGH I;  5IG4 A;  1O7P B;  1RCK A;  2KF6 A;  3DMC A;  5KP4 A;  2FGT A;  1NNV A;  1G02 A;  3FF2 A;  1GD3 A;  4J5G A;  4N6U A;  5AIF A;  2CWU A;  1T5Y A;  1W6G A;  1VQ7 3;  7RNT A;  1DMQ A;  2XH9 A;  1RNB A;  1VQ4 3;  1IVX A;  2F5W A;  4O02 B;  2P09 A;  5JPU A;  1YIT 3;  3D4A A;  1UCJ A;  1FUT A;  1VQL 3;  1U5O A;  3NBJ A;  4RBN A;  1CEW I;  1US1 A;  1C54 A;  1HYF A;  1TRQ A;  1KSI A;  1D6Y A;  1ZO2 A;  3CCM 3;  4HVN A;  1A90 A;  1VQP 3;  1ULI B;  2CFG A;  5STD A;  3CC2 3;  1KC8 4;  2CC3 A;  1X1X A;  4FMB A;  4FMD A;  3FLJ A;  1MWT A;  1N8R 4;  1LQG C;  1M9G A;  1IV7 A;  4JRF A;  3X3Z A;  3V99 A;  1OGZ A;  3BNE A;  3HOH A;  2ML6 A;  4EBG A;  2XGN A;  2LYX A;  1WMO A;  1DYU A;  3EB8 A;  1QAF A;  1LOW A;  3HX8 A;  5D82 A;  2OOV C;  4WHA A;  3CCQ 3;  1FGR A;  2KF5 A;  5HOH A;  2RCD A;  2R41 A;  1E3V A;  4HM2 B;  4LEH A;  1Z1S A;  1OHP A;  4R1K A;  2L1S A;  2E2U A;  5EVH A;  3EHC A;  1RGC A;  1S72 3;  2ZL8 A;  1RMS A;  2B1X B;  3GAX A;  3GZY B;  3SLU A;  3G71 3;  1B3S A;  3Q2P A;  1RNT A;  1NB3 I;  4HJL B;  1RGL A;  3CPW 2;  3AMO B;  1BNJ A;  3D5I A;  2CH9 A;  1A2P A;  2BO9 B;  8RNT A;  1FGT A;  1RGF A;  4FCM A;  2YFL B;  2C10 A;  1RGG A;  4WYK B;  1KQS 2;  3RNT A;  1JZO A;  2FNQ A;  3CPO A;  3EJV A;  4X2H A;  4FMA A;  5D83 A;  7GSP A;  1RRL A;  1YNV X;  1KWI A;  1I2F A;  1YHQ 3;  1FZU A;  1LNI A;  2ZDJ A;  1D6U A;  1BNS A;  2P38 A;  1MNL A;  2HMM B;  2OQE A;  1YGW A;  3OXA A;  3G6E 3;  3DGL A;  3EE1 A;  2BMO B;  5CLK A;  3FG1 A;  3BNB A;  3LOY A;  5IEN A;  1OAC A;  3LML A;  1QAL A;  2Z77 A;  2RBI A;  1JBS A;  3SXX A;  3D5G A;  1QMA A;  1FYS A;  3CXC 2;  2GEX A;  3OWY A;  4STD A;  3B4O A;  1V74 A;  1IU7 A;  1AQZ A;  3LTB A;  2CFW A;  2GU1 A;  2P0X A;  3FF0 A;  3ZFZ A;  3SOA A;  2RGQ A;  1JRQ A;  3UL5 A;  1JBT A;  1MOL A;  1N9J A;  3D3L A;  2WGQ A;  1TP6 A;  3B4P A;  2KCD A;  3BND A;  3KKG A;  3RGR A;  1IVV A;  3QK9 A;  3H51 A;  1BRG A;  2WGO A;  5IG3 A;  4GB5 A;  3F8H A;  2CHC A;  4WFO A;  1RRH A;  5AYR B;  3U97 A;  3VGN A;  3J7Y d;  3LZA A;  1Q86 4;  2PNC A;  3JUM A;  4KVH A;  2BHM A;  2E2T A;  3K5T A;  1IT8 A;  4FMC A;  3RGA A;  3NM7 A;  4KFE A;  3B7C A;  3S27 A;  2AAE A;  1UDI I;  3DY5 A;  4CDL A;  4O8S A;  2KAA A;  3GZB A;  4BTW A;  1UCI A;  2XEP A;  4J9A A;  4XBX A;  1GS3 A;  1W7C A;  3S5C A;  1G96 A;  1LXE A;  3E99 A;  1ZGX A;  3HZP A;  1GY5 A;  3JUO A;  5FGO A;  5BXQ A;  4BTX A;  3SVA A;  5IG5 A;  4WWU C;  2WOF A;  1X1U A;  2KF3 A;  3MSO A;  4L8O A;  5AIG A;  3CC7 3;  2CFD A;  4O3V A;  1WTH A;  2FXT A;  4BL2 A;  1HU9 A;  3T8N A;  4IIA A;  1TRP A;  2UX0 A;  5IEP A;  5CF2 A;  1BNF A;  1FW7 A;  2Q07 A;  3GRD A;  3WOE B;  1JJ2 2;  1VQN 3;  2W56 A;  3NV0 A;  1VQ8 3;  2BU4 A;  3M8C A;  4RNZ A;  3FH1 A;  2HMN B;  1T2I A;  2CK3 H;  2STD A;  3N54 B;  1N5H A;  1YVS A;  3FGY A;  4N6V 0;  5JBS A;  2BNG A;  3GWR A;  2WOH A;  2A15 A;  1BNI A;  4EV2 A;  1SII A;  2JDI H;  4N3V A;  4HM5 B;  4OK0 A;  3ER7 A;  4N6N B;  1J2B A;  9RNT A;  1LOY A;  1UCK A;  2GEY A;  3OV4 A;  1BOX A;  1STF I;  3AGO A;  2SBL A;  3V98 A;  2IMJ A;  1D6Z A;  3MG1 A;  2W0Q A;  5ELJ A;  1I2E A;  4MEI A;  3ROB A;  1T3B A;  1UI8 A;  1RHL A;  2UUG C;  1EQK A;  1F8N A;  1UUW B;  2MF7 A;  1BAN A;  1RTU A;  1PY3 A;  3T0U A;  1B2Z A;  1FUW A;  1HKX A;  3F8X A;  1Q9E A;  4K90 B;  1CYU A;  4NPB A;  4JF8 A;  5RNT A;  1DMN A; 
#chains in the Genus database with same CATH homology
 1LQG C;  1UGI A;  1UGH I;  1UDI I;  2UGI A;  2ZHX B;  2UUG C;  1EUI C;  1LQM B;  4LYL B;  2J8X B;  1UUG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...