2UGIA

Protein mimicry of dna from crystal structures of the uracil glycosylase inhibitor protein and its complex with escherichia coli uracil-dna glycosylase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE INHIBITOR
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Bacillus phage pbs2
molecule tags Hydrolase inhibitor
total genus 15
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2ugiA00
1LQMB 1UGHI 2J8XB 2UGIA 1EUIC 1UGIA 1UUGB 2ZHXB 1UDII 4LYLB 2UUGC 1LQGC
chains in the Genus database with same CATH superfamily
3LT9A 1N5PA 3H51A 4N6V0 2WOHA 1I2EA 2CH9A 3CCE3 3JUQA 2F5WA 3G713 1NJI4 1A2VA 2CC3A 2HMLB 1GSPA 1OHOA 3AMOA 3KFQC 4JRFA 3EJVA 1Q814 2HMNB 1N8QA 2O3OA 1PY3A 2HOHA 3PXMA 3EN1B 3V99A 4NHFA 1UCIA 1UCJA 1ROAA 4U13A 2D1WA 1T5YA 1G02A 1US1A 2WGQA 2UUGC 1Q40A 3DGOA 4RNZA 4WWUC 3FG4A 3X3ZA 3CD63 1IT8A 1OH0A 4NREA 1FGQA 1B27A 2C11A 3MPHA 1RLSA 4BIRA 1IK3A 3AHWA 3EB8A 1RGFA 1G0TA 4IT7A 4OK0A 1BRJA 1BGSA 2RGQA 4LMIA 8CHOA 2CFKA 1LQGC 4HBRA 4OVMA 3UB1A 3HIGA 3X42A 6RNTA 3B8LA 1BUJA 5D83A 2B24B 3FSDA 1C7HA 2CWVA 1BSBA 1ULIB 1IU7A 1O7WB 3S67A 3EHCA 3G6E3 3CPOA 2XFTA 1C54A 2XSOB 4GB5A 1AY7A 1VQ63 5GSPA 1MWSA 3CCL3 1UGIA 4R4KA 3GSPA 1OCVA 4HM6B 1I0VA 1RRHA 3Q3FA 2CW9A 1LOXA 1O7MB 2SARA 3WA2X 4BU4A 4L8PA 5IW9A 4N6MA 3AGOA 5ELJA 2Z76A 1YIT3 1QVG2 1WMPA 7GSPA 5AYRB 4HAAA 1W6YA 1TTOA 2FGTA 4MMYB 1OPYA 2CFWA 3Q90A 4HM3B 4CJNA 1FA3A 4LZIA 2JDIH 1DMNA 1YJ93 1RNTA 1B21A 1RGEA 4HM4B 1DVCA 4O3VA 4FCMA 3EC9A 4HM2B 1VQP3 2UGIA 2F4YA 5G1LA 1WNHA 1RGAA 1UUVB 1GOUA 5KP1A 1NO3A 5LC7A 5M1AA 2OOVA 2WO0A 4LSOA 1JN5A 2QGUA 3UNLA 3OW22 3HI7A 3F7XA 4K61A 1BNFA 4EW5A 4OUQA 1Q42A 2P0XA 4N6OB 3CNXA 3RGAA 5CLKA 1Q864 5TGNA 4HM5B 1FUWA 4N6TA 3SLUA 1ZX2A 2OQEA 3GAXA 1ISKA 3KZTA 1KQS2 3DH2A 1B2UA 2Z77A 3J7Yd 1RGLA 1DVDA 1JB2A 2YFJB 3DZLA 1LXEA 3F14A 3O8YA 1G96A 2FNQA 1IVXA 4WYKA 3BIRA 3NM7A 2C10A 2W56A 3JUMA 1BRSA 4TX4A 1V57A 1N5HA 5A0OB 2XRXB 4KVHA 1YGEA 3PCRA 4JF8A 4Q53A 3D5IA 3OV4A 1LNHA 5JPUA 3EE1A 4N6LA 3HX8A 1R4YA 2W6JH 3STDA 3CME3 1JZOA 3EQQB 1W5ZA 5JBSA 3GRDA 4CPKA 2RFRA 2XGNA 2YFIB 3FGYA 1RN4A 1GD4A 1YNVX 4FMAA 5M18A 1K41A 2WOFA 1QAFA 9RNTA 3LXUX 5JPPA 1ULJB 2CFDA 1GMRA 4HVNA 6STDA 4I4KA 1BRNL 3CU3A 2CX1A 3QRDA 2E2TA 2Z7AA 3JUNA 1IV7A 1BNGA 1ROVA 4FMBA 1MGWA 1RMSA 3LZAA 5BVBA 2P38A 3X40A 4AKYA 4RNYA 1TRQA 1EQKA 1GY6A 2OCTA 1W00A 4J5KA 1RGKA 1IYYA 1IVUA 5IENA 4XBXA 1X1WA 2F99A 4BL3A 3CC73 1B2MA 5RNTA 1RGCA 3IJEB 1Z1SA 1F8NA 1FGMA 2Q07A 5IF6A 1RRLA 2FXTA 2H0GA 3SVAA 1UGHI 3TDGA 1PU4A 1D6UA 1YJW3 1IQ8A 1CQSA 2KF5A 3WOEB 2KF6A 4O2HA 2IY2A 2H0HA 3B4PA 4XM4A 1OGZA 2XH9A 1WMOA 3MHEA 3NV0B 4X2HA 1AVKA 1O7PB 3VF1A 4AKZA 1V74A 3FG3A 1T2HA 5FGOA 2HMKB 3CCJ3 3BNEA 3OWYA 2CKFB 1RSNA 3WODG 4AEQA 3KCHA 2HMOB 3ECFA 1JNQA 1MWUA 3DY5A 4DKIA 3LH4A 1U5OA 3PGBA 1JBRA 1A2PA 1EUIC 2B1XB 2CK3H 4IPBA 2RSXA 1YHQ3 3KKGA 1B20A 5BIRA 2YFLB 1CYUA 1IQXA 1RN7A 4HKVB 3B4OA 1UI7A 3HK4A 1RGHA 1FZUA 2ZDJA 4X2OA 3U97A 4FCJA 4BTXA 1L5GB 2QA43 3NXJA 2KRTA 2V1LA 2P0MA 2GBXB 4R1KA 1K8A4 1BUQA 3NBJA 5EVHA 4HM7B 1K9M4 3OX9A 3F40A 3SOAA 5I97A 3RGRA 2K54A 3MSOA 1VQK3 5AYSC 2JQ5A 1RTUA 4KFFA 3RNTA 3NX0A 3CCU3 1EEJA 2BO9B 2KCDA 2H0IA 1QAKA 1LOWA 1T2IA 1UCLA 1TRPA 1A2KA 1W01A 1ZGXA 4XB5A 3SXXA 1FW7A 3ER7A 2BT3A 1Q7HA 2XGLA 3LMLA 4GHOA 4O8SA 4R80A 5HGRA 3VSYA 4L8OA 3DGLA 1AQZA 2A15A 3A76A 5CF2A 1JJ22 1W2ZA 1BSDA 1RHLA 3HIIA 1GMPA 4XDWA 1RDSA 5IEOA 3U1WA 3G8ZA 1O7NB 1Q9EA 1RGGA 1S5AA 2IYJA 3ZG5A 4XBTA 1X1UA 3QK9A 1TUHA 1UUGB 2STDA 1RJOA 4GSPA 2P05A 2CFGA 3N8BA 3S5CA 1YJN3 1BVIA 2HMMB 2GU1A 2W0QA 3GZRA 3DMCA 1SIIA 1LOYA 1W7CA 2Y74A 3AMOB 1N9JA 1UW1A 5EQLA 2BU4A 1DMMA 1JB5A 1NNVA 1GYBA 1N9EA 3NQZA 4KFEA 5G2GA 3BB9A 1M904 2I9WA 1RCLA 2CHCA 1WTHA 3F8XA 2BMRB 3B7CA 4STDA 3BLZA 3F9SA 1FUTA 3X41A 4HYZA 1YVSA 4H3UA 4BTWA 2D42A 3CCQ3 2OTL3 2R4IA 3FF0A 3FG1A 3IPTA 2IUKA 2KXGA 4O02B 4PEJA 1CH0A 2ZHXB 1OGXA 3ROBA 3S28A 1GOVA 3KSED 1S723 3CCS3 4KZ1A 3CXC2 1MWTA 1WQLB 1UI8A 3D5GA 3NV0A 3LTDA 1RN1A 4CDLA 3F7SA 1K734 5AI1A 3Q2PA 2E2UA 3LTCA 4LYLB 1VQQA 3WDGB 1OACA 2W04A 1A67A 2CIUA 2K3DA 3K0ZA 4EV2A 1VQL3 1FGTA 1VQ83 2ML5A 1TP6A 3I0YA 4EXRA 1IVVA 1Y4KA 1STDA 1BNRA 2GBWB 2XEPA 1D6ZA 4FMDA 2XFSA 2W03A 3L0RA 1M1K4 3SX1A 1TIJA 1FYSA 4RNTA 5IG0A 2MF7A 3SEDA 1TU5A 1OF5B 1VQO3 2QIYA 3GZBA 3FKAA 3SYUA 3CPW2 1KSIA 1O7GB 4J5GA 4QWTA 3UL5A 3NUVA 3NM2A 3Q1CA 3EBTA 3NBBA 3X3YA 1HU9A 1BU4A 1FGOA 1K28A 2CFLA 4ORLA 2OWPA 3D9RA 3LTAA 1Q7Y4 3URPA 5FW5A 1V58A 1W6CA 4K1VA 3OXAA 2MC8A 3ZFZA 1B2SA 1TFOA 2LYXA 1PYLA 4WP5A 1TJDA 2BIRA 3UJMA 1JZDA 1QJGA 3T8UA 3HOHA 3WR2A 1UUWB 2ZL8A 4NPBA 4ZM8A 1A90A 3CCM3 3V98A 3CC23 2IUJA 1EG9B 1T3BA 1WMNA 1U8CB 2BHMA 3K9MC 2GEYA 1JN5B 3DGYA 5CK6A 2CX0A 3LTBA 5IG3A 1NDOB 1GS3A 1SPUA 2Z6BA 3KIIA 3OWUA 3X3XA 1NWWA 1KC84 2XSHB 1LQMB 1DETA 1GY7A 1E3RA 1I0XA 3MKIA 2XR8B 1VQ93 4KFDA 3G16A 3GZXB 4K1UA 1GOYA 2HMJB 4ILFA 5D81A 5IEPA 1FUSA 3HZPA 2RNTA 2O9UX 5D82A 1CEWI 1QMAA 2L4VA 1OUNA 4CCVA 5IG4A 2L1SA 2CG1A 4WYKB 4WHAA 2CWTA 3JUOA 3LT8A 2CG0A 2W56B 4RZMA 4XBYA 3AGNA 3MYTA 1DMQA 2F5MA 2C4BA 2KF4A 4WFOA 3EBYA 1BRKA 1NB3I 5BXQA 1KWIA 2F86B 5CF1A 5M19A 3N54B 3BNDA 2RCDA 5DREA 3RDEA 1BRIA 1W6GA 1MGRA 1AV4A 1BNSA 4FR9A 4HZBB 4LGQA 5AEWB 6GSPA 2OTJ3 1BOXA 2UX0A 3N9HA 1I2GA 1VQ53 3FLJA 4I5QA 1MOLA 3FF2A 1IV9A 1GMQA 1NU3A 1QALA 1SQWA 4HM8B 4J9AA 3DGNA 4FCZA 2R41A 2F56A 2KAAA 3KN4A 3E99A 1N8R4 2IMJA 3K7CA 3CCR3 3NHXA 5IG5A 4LEHA 3FH1A 3EN8A 7RNTA 5AEUB 1EKMA 1AVLA 1R4CA 5G1KA 5AIHA 1JKGB 1E97A 1LVNA 5ELUA 5KP3A 3PYJA 4KT3B 3PS8A 3EX9A 1JBSA 1IT7A 2W9QA 5AIFA 3ZG0A 1B2XA 2OOVC 1EA2A 1OF5A 1HYFA 1GD3A 4IIAA 1BSCA 1SARA 2SBLA 3S27A 1M9GA 1LRAA 1W4NA 2F98A 1HKXA 4MEIA 4HZ9B 1MNLA 1JV2B 1IQYA 3A5EA 5LC6A 4BTYA 1UCKA 3G0KA 1BNEA 5AIGA 2OQEC 3SOYA 1J2BA 3D4AA 4R9KA 4N3VA 2ML6A 1B2ZA 1BNJA 1GY5A 2XF3A 1DYUA 2E2VA 2P09A 3CNMA 4HM0B 3CC43 1JB4A 1B3SA 1O7HB 1BNIA 2INXA 3JVCA 3LOYA 4GL6A 1AR0A 1BAOA 1JBTA 4N6UA 1OHPA 1PFPA 2W9PA 1Q40B 3UL6A 4EC6A 3K5TA 2GXFA 2WGOA 3LYGA 3VGNA 3F8HA 2K0MA 3WHOA 3G4S3 3GZYB 1YIJ3 1BRGA 3JUPA 2CWUA 1CYVA 1IDPA 3WOFB 4MMZB 5IERA 1DE3A 1W02A 2M7OA 3DGMA 2W2CA 4K90B 1YGWA 1RNBA 1OHSA 4EYCA 2YX9A 2RBIA 3DM8A 4G1MB 1VQN3 3I553 3BNCA 5EEOA 3WMDA 4J8TA 8RNTA 7STDA 3CMA3 1BIRA 3FCSB 1JRQA 1SJWA 3MG2A 3NQYA 4MMXB 1I3FA 1UDII 2BMOB 2LQVA 4BL2A 1MWRA 3S29A 3KE7A 3GWRA 4H61A 1ASKA 1VZZA 4HM1B 2BNGA 5DRVA 5STDA 1KD14 1LNIA 4MJDA 4HOHA 3MG3A 3ALAA 1W2B2 1I2FA 2ZA4A 1HZ1A 4XDVA 1BSAA 3D79A 5AIIA 5KP4A 1SIHA 5BU4A 2IA7A 3IMAB 1FGRA 1STFI 3T8NA 3EF8A 1I3IA 1ZS7A 2Y73A 2PZVA 3BNBA 1YI23 1RCKA 3PZWA 1LOVA 2AAEA 1D6YA 3DUKA 3H3HA 3MG1A 1Q824 3NBRA 3I563 2AADA 5HOHA 4RBNA 3PCSA 3BU4A 4L7KA 4EV5A 1I8VA 2PNCA 3DXOA 2BMQB 3AHSA 4EBGA 2J8XB 2GSPA 4N6NB 3V92A 3WA3A 2QEX3 1NB5I 1ZO2A 1VQ43 1YVBI 1BANA 1BSEA 4FMCA 1QVF2 3D3LA 1RKYA 3CCV3 2GU3A 3OWSA 1E3VA 3MWZA 2GEXA 3T0UA 3KSPA 1JKGA 1VQM3 1M1XB 1VQ73 4R9LA 1X1YA 1BRHA 3FZWA 3M8CA 1TFKA 1I70A 1IVWA 2KF3A 4HJLB 1X1XA 5CXOA 3K63A
chains in the Genus database with same CATH topology
1LQMB 1UGHI 2J8XB 2UGIA 1EUIC 1UGIA 1UUGB 2ZHXB 1UDII 4LYLB 2UUGC 1LQGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQM B;  1UGH I;  2J8X B;  2UGI A;  1EUI C;  1UGI A;  1UUG B;  2ZHX B;  1UDI I;  4LYL B;  2UUG C;  1LQG C; 
#chains in the Genus database with same CATH topology
 3LT9 A;  1N5P A;  3H51 A;  4N6V 0;  2WOH A;  1I2E A;  2CH9 A;  3CCE 3;  3JUQ A;  2F5W A;  3G71 3;  1NJI 4;  1A2V A;  2CC3 A;  2HML B;  1GSP A;  1OHO A;  3AMO A;  3KFQ C;  4JRF A;  3EJV A;  1Q81 4;  2HMN B;  1N8Q A;  2O3O A;  1PY3 A;  2HOH A;  3PXM A;  3EN1 B;  3V99 A;  4NHF A;  1UCI A;  1UCJ A;  1ROA A;  4U13 A;  2D1W A;  1T5Y A;  1G02 A;  1US1 A;  2WGQ A;  2UUG C;  1Q40 A;  3DGO A;  4RNZ A;  4WWU C;  3FG4 A;  3X3Z A;  3CD6 3;  1IT8 A;  1OH0 A;  4NRE A;  1FGQ A;  1B27 A;  2C11 A;  3MPH A;  1RLS A;  4BIR A;  1IK3 A;  3AHW A;  3EB8 A;  1RGF A;  1G0T A;  4IT7 A;  4OK0 A;  1BRJ A;  1BGS A;  2RGQ A;  4LMI A;  8CHO A;  2CFK A;  1LQG C;  4HBR A;  4OVM A;  3UB1 A;  3HIG A;  3X42 A;  6RNT A;  3B8L A;  1BUJ A;  5D83 A;  2B24 B;  3FSD A;  1C7H A;  2CWV A;  1BSB A;  1ULI B;  1IU7 A;  1O7W B;  3S67 A;  3EHC A;  3G6E 3;  3CPO A;  2XFT A;  1C54 A;  2XSO B;  4GB5 A;  1AY7 A;  1VQ6 3;  5GSP A;  1MWS A;  3CCL 3;  1UGI A;  4R4K A;  3GSP A;  1OCV A;  4HM6 B;  1I0V A;  1RRH A;  3Q3F A;  2CW9 A;  1LOX A;  1O7M B;  2SAR A;  3WA2 X;  4BU4 A;  4L8P A;  5IW9 A;  4N6M A;  3AGO A;  5ELJ A;  2Z76 A;  1YIT 3;  1QVG 2;  1WMP A;  7GSP A;  5AYR B;  4HAA A;  1W6Y A;  1TTO A;  2FGT A;  4MMY B;  1OPY A;  2CFW A;  3Q90 A;  4HM3 B;  4CJN A;  1FA3 A;  4LZI A;  2JDI H;  1DMN A;  1YJ9 3;  1RNT A;  1B21 A;  1RGE A;  4HM4 B;  1DVC A;  4O3V A;  4FCM A;  3EC9 A;  4HM2 B;  1VQP 3;  2UGI A;  2F4Y A;  5G1L A;  1WNH A;  1RGA A;  1UUV B;  1GOU A;  5KP1 A;  1NO3 A;  5LC7 A;  5M1A A;  2OOV A;  2WO0 A;  4LSO A;  1JN5 A;  2QGU A;  3UNL A;  3OW2 2;  3HI7 A;  3F7X A;  4K61 A;  1BNF A;  4EW5 A;  4OUQ A;  1Q42 A;  2P0X A;  4N6O B;  3CNX A;  3RGA A;  5CLK A;  1Q86 4;  5TGN A;  4HM5 B;  1FUW A;  4N6T A;  3SLU A;  1ZX2 A;  2OQE A;  3GAX A;  1ISK A;  3KZT A;  1KQS 2;  3DH2 A;  1B2U A;  2Z77 A;  3J7Y d;  1RGL A;  1DVD A;  1JB2 A;  2YFJ B;  3DZL A;  1LXE A;  3F14 A;  3O8Y A;  1G96 A;  2FNQ A;  1IVX A;  4WYK A;  3BIR A;  3NM7 A;  2C10 A;  2W56 A;  3JUM A;  1BRS A;  4TX4 A;  1V57 A;  1N5H A;  5A0O B;  2XRX B;  4KVH A;  1YGE A;  3PCR A;  4JF8 A;  4Q53 A;  3D5I A;  3OV4 A;  1LNH A;  5JPU A;  3EE1 A;  4N6L A;  3HX8 A;  1R4Y A;  2W6J H;  3STD A;  3CME 3;  1JZO A;  3EQQ B;  1W5Z A;  5JBS A;  3GRD A;  4CPK A;  2RFR A;  2XGN A;  2YFI B;  3FGY A;  1RN4 A;  1GD4 A;  1YNV X;  4FMA A;  5M18 A;  1K41 A;  2WOF A;  1QAF A;  9RNT A;  3LXU X;  5JPP A;  1ULJ B;  2CFD A;  1GMR A;  4HVN A;  6STD A;  4I4K A;  1BRN L;  3CU3 A;  2CX1 A;  3QRD A;  2E2T A;  2Z7A A;  3JUN A;  1IV7 A;  1BNG A;  1ROV A;  4FMB A;  1MGW A;  1RMS A;  3LZA A;  5BVB A;  2P38 A;  3X40 A;  4AKY A;  4RNY A;  1TRQ A;  1EQK A;  1GY6 A;  2OCT A;  1W00 A;  4J5K A;  1RGK A;  1IYY A;  1IVU A;  5IEN A;  4XBX A;  1X1W A;  2F99 A;  4BL3 A;  3CC7 3;  1B2M A;  5RNT A;  1RGC A;  3IJE B;  1Z1S A;  1F8N A;  1FGM A;  2Q07 A;  5IF6 A;  1RRL A;  2FXT A;  2H0G A;  3SVA A;  1UGH I;  3TDG A;  1PU4 A;  1D6U A;  1YJW 3;  1IQ8 A;  1CQS A;  2KF5 A;  3WOE B;  2KF6 A;  4O2H A;  2IY2 A;  2H0H A;  3B4P A;  4XM4 A;  1OGZ A;  2XH9 A;  1WMO A;  3MHE A;  3NV0 B;  4X2H A;  1AVK A;  1O7P B;  3VF1 A;  4AKZ A;  1V74 A;  3FG3 A;  1T2H A;  5FGO A;  2HMK B;  3CCJ 3;  3BNE A;  3OWY A;  2CKF B;  1RSN A;  3WOD G;  4AEQ A;  3KCH A;  2HMO B;  3ECF A;  1JNQ A;  1MWU A;  3DY5 A;  4DKI A;  3LH4 A;  1U5O A;  3PGB A;  1JBR A;  1A2P A;  1EUI C;  2B1X B;  2CK3 H;  4IPB A;  2RSX A;  1YHQ 3;  3KKG A;  1B20 A;  5BIR A;  2YFL B;  1CYU A;  1IQX A;  1RN7 A;  4HKV B;  3B4O A;  1UI7 A;  3HK4 A;  1RGH A;  1FZU A;  2ZDJ A;  4X2O A;  3U97 A;  4FCJ A;  4BTX A;  1L5G B;  2QA4 3;  3NXJ A;  2KRT A;  2V1L A;  2P0M A;  2GBX B;  4R1K A;  1K8A 4;  1BUQ A;  3NBJ A;  5EVH A;  4HM7 B;  1K9M 4;  3OX9 A;  3F40 A;  3SOA A;  5I97 A;  3RGR A;  2K54 A;  3MSO A;  1VQK 3;  5AYS C;  2JQ5 A;  1RTU A;  4KFF A;  3RNT A;  3NX0 A;  3CCU 3;  1EEJ A;  2BO9 B;  2KCD A;  2H0I A;  1QAK A;  1LOW A;  1T2I A;  1UCL A;  1TRP A;  1A2K A;  1W01 A;  1ZGX A;  4XB5 A;  3SXX A;  1FW7 A;  3ER7 A;  2BT3 A;  1Q7H A;  2XGL A;  3LML A;  4GHO A;  4O8S A;  4R80 A;  5HGR A;  3VSY A;  4L8O A;  3DGL A;  1AQZ A;  2A15 A;  3A76 A;  5CF2 A;  1JJ2 2;  1W2Z A;  1BSD A;  1RHL A;  3HII A;  1GMP A;  4XDW A;  1RDS A;  5IEO A;  3U1W A;  3G8Z A;  1O7N B;  1Q9E A;  1RGG A;  1S5A A;  2IYJ A;  3ZG5 A;  4XBT A;  1X1U A;  3QK9 A;  1TUH A;  1UUG B;  2STD A;  1RJO A;  4GSP A;  2P05 A;  2CFG A;  3N8B A;  3S5C A;  1YJN 3;  1BVI A;  2HMM B;  2GU1 A;  2W0Q A;  3GZR A;  3DMC A;  1SII A;  1LOY A;  1W7C A;  2Y74 A;  3AMO B;  1N9J A;  1UW1 A;  5EQL A;  2BU4 A;  1DMM A;  1JB5 A;  1NNV A;  1GYB A;  1N9E A;  3NQZ A;  4KFE A;  5G2G A;  3BB9 A;  1M90 4;  2I9W A;  1RCL A;  2CHC A;  1WTH A;  3F8X A;  2BMR B;  3B7C A;  4STD A;  3BLZ A;  3F9S A;  1FUT A;  3X41 A;  4HYZ A;  1YVS A;  4H3U A;  4BTW A;  2D42 A;  3CCQ 3;  2OTL 3;  2R4I A;  3FF0 A;  3FG1 A;  3IPT A;  2IUK A;  2KXG A;  4O02 B;  4PEJ A;  1CH0 A;  2ZHX B;  1OGX A;  3ROB A;  3S28 A;  1GOV A;  3KSE D;  1S72 3;  3CCS 3;  4KZ1 A;  3CXC 2;  1MWT A;  1WQL B;  1UI8 A;  3D5G A;  3NV0 A;  3LTD A;  1RN1 A;  4CDL A;  3F7S A;  1K73 4;  5AI1 A;  3Q2P A;  2E2U A;  3LTC A;  4LYL B;  1VQQ A;  3WDG B;  1OAC A;  2W04 A;  1A67 A;  2CIU A;  2K3D A;  3K0Z A;  4EV2 A;  1VQL 3;  1FGT A;  1VQ8 3;  2ML5 A;  1TP6 A;  3I0Y A;  4EXR A;  1IVV A;  1Y4K A;  1STD A;  1BNR A;  2GBW B;  2XEP A;  1D6Z A;  4FMD A;  2XFS A;  2W03 A;  3L0R A;  1M1K 4;  3SX1 A;  1TIJ A;  1FYS A;  4RNT A;  5IG0 A;  2MF7 A;  3SED A;  1TU5 A;  1OF5 B;  1VQO 3;  2QIY A;  3GZB A;  3FKA A;  3SYU A;  3CPW 2;  1KSI A;  1O7G B;  4J5G A;  4QWT A;  3UL5 A;  3NUV A;  3NM2 A;  3Q1C A;  3EBT A;  3NBB A;  3X3Y A;  1HU9 A;  1BU4 A;  1FGO A;  1K28 A;  2CFL A;  4ORL A;  2OWP A;  3D9R A;  3LTA A;  1Q7Y 4;  3URP A;  5FW5 A;  1V58 A;  1W6C A;  4K1V A;  3OXA A;  2MC8 A;  3ZFZ A;  1B2S A;  1TFO A;  2LYX A;  1PYL A;  4WP5 A;  1TJD A;  2BIR A;  3UJM A;  1JZD A;  1QJG A;  3T8U A;  3HOH A;  3WR2 A;  1UUW B;  2ZL8 A;  4NPB A;  4ZM8 A;  1A90 A;  3CCM 3;  3V98 A;  3CC2 3;  2IUJ A;  1EG9 B;  1T3B A;  1WMN A;  1U8C B;  2BHM A;  3K9M C;  2GEY A;  1JN5 B;  3DGY A;  5CK6 A;  2CX0 A;  3LTB A;  5IG3 A;  1NDO B;  1GS3 A;  1SPU A;  2Z6B A;  3KII A;  3OWU A;  3X3X A;  1NWW A;  1KC8 4;  2XSH B;  1LQM B;  1DET A;  1GY7 A;  1E3R A;  1I0X A;  3MKI A;  2XR8 B;  1VQ9 3;  4KFD A;  3G16 A;  3GZX B;  4K1U A;  1GOY A;  2HMJ B;  4ILF A;  5D81 A;  5IEP A;  1FUS A;  3HZP A;  2RNT A;  2O9U X;  5D82 A;  1CEW I;  1QMA A;  2L4V A;  1OUN A;  4CCV A;  5IG4 A;  2L1S A;  2CG1 A;  4WYK B;  4WHA A;  2CWT A;  3JUO A;  3LT8 A;  2CG0 A;  2W56 B;  4RZM A;  4XBY A;  3AGN A;  3MYT A;  1DMQ A;  2F5M A;  2C4B A;  2KF4 A;  4WFO A;  3EBY A;  1BRK A;  1NB3 I;  5BXQ A;  1KWI A;  2F86 B;  5CF1 A;  5M19 A;  3N54 B;  3BND A;  2RCD A;  5DRE A;  3RDE A;  1BRI A;  1W6G A;  1MGR A;  1AV4 A;  1BNS A;  4FR9 A;  4HZB B;  4LGQ A;  5AEW B;  6GSP A;  2OTJ 3;  1BOX A;  2UX0 A;  3N9H A;  1I2G A;  1VQ5 3;  3FLJ A;  4I5Q A;  1MOL A;  3FF2 A;  1IV9 A;  1GMQ A;  1NU3 A;  1QAL A;  1SQW A;  4HM8 B;  4J9A A;  3DGN A;  4FCZ A;  2R41 A;  2F56 A;  2KAA A;  3KN4 A;  3E99 A;  1N8R 4;  2IMJ A;  3K7C A;  3CCR 3;  3NHX A;  5IG5 A;  4LEH A;  3FH1 A;  3EN8 A;  7RNT A;  5AEU B;  1EKM A;  1AVL A;  1R4C A;  5G1K A;  5AIH A;  1JKG B;  1E97 A;  1LVN A;  5ELU A;  5KP3 A;  3PYJ A;  4KT3 B;  3PS8 A;  3EX9 A;  1JBS A;  1IT7 A;  2W9Q A;  5AIF A;  3ZG0 A;  1B2X A;  2OOV C;  1EA2 A;  1OF5 A;  1HYF A;  1GD3 A;  4IIA A;  1BSC A;  1SAR A;  2SBL A;  3S27 A;  1M9G A;  1LRA A;  1W4N A;  2F98 A;  1HKX A;  4MEI A;  4HZ9 B;  1MNL A;  1JV2 B;  1IQY A;  3A5E A;  5LC6 A;  4BTY A;  1UCK A;  3G0K A;  1BNE A;  5AIG A;  2OQE C;  3SOY A;  1J2B A;  3D4A A;  4R9K A;  4N3V A;  2ML6 A;  1B2Z A;  1BNJ A;  1GY5 A;  2XF3 A;  1DYU A;  2E2V A;  2P09 A;  3CNM A;  4HM0 B;  3CC4 3;  1JB4 A;  1B3S A;  1O7H B;  1BNI A;  2INX A;  3JVC A;  3LOY A;  4GL6 A;  1AR0 A;  1BAO A;  1JBT A;  4N6U A;  1OHP A;  1PFP A;  2W9P A;  1Q40 B;  3UL6 A;  4EC6 A;  3K5T A;  2GXF A;  2WGO A;  3LYG A;  3VGN A;  3F8H A;  2K0M A;  3WHO A;  3G4S 3;  3GZY B;  1YIJ 3;  1BRG A;  3JUP A;  2CWU A;  1CYV A;  1IDP A;  3WOF B;  4MMZ B;  5IER A;  1DE3 A;  1W02 A;  2M7O A;  3DGM A;  2W2C A;  4K90 B;  1YGW A;  1RNB A;  1OHS A;  4EYC A;  2YX9 A;  2RBI A;  3DM8 A;  4G1M B;  1VQN 3;  3I55 3;  3BNC A;  5EEO A;  3WMD A;  4J8T A;  8RNT A;  7STD A;  3CMA 3;  1BIR A;  3FCS B;  1JRQ A;  1SJW A;  3MG2 A;  3NQY A;  4MMX B;  1I3F A;  1UDI I;  2BMO B;  2LQV A;  4BL2 A;  1MWR A;  3S29 A;  3KE7 A;  3GWR A;  4H61 A;  1ASK A;  1VZZ A;  4HM1 B;  2BNG A;  5DRV A;  5STD A;  1KD1 4;  1LNI A;  4MJD A;  4HOH A;  3MG3 A;  3ALA A;  1W2B 2;  1I2F A;  2ZA4 A;  1HZ1 A;  4XDV A;  1BSA A;  3D79 A;  5AII A;  5KP4 A;  1SIH A;  5BU4 A;  2IA7 A;  3IMA B;  1FGR A;  1STF I;  3T8N A;  3EF8 A;  1I3I A;  1ZS7 A;  2Y73 A;  2PZV A;  3BNB A;  1YI2 3;  1RCK A;  3PZW A;  1LOV A;  2AAE A;  1D6Y A;  3DUK A;  3H3H A;  3MG1 A;  1Q82 4;  3NBR A;  3I56 3;  2AAD A;  5HOH A;  4RBN A;  3PCS A;  3BU4 A;  4L7K A;  4EV5 A;  1I8V A;  2PNC A;  3DXO A;  2BMQ B;  3AHS A;  4EBG A;  2J8X B;  2GSP A;  4N6N B;  3V92 A;  3WA3 A;  2QEX 3;  1NB5 I;  1ZO2 A;  1VQ4 3;  1YVB I;  1BAN A;  1BSE A;  4FMC A;  1QVF 2;  3D3L A;  1RKY A;  3CCV 3;  2GU3 A;  3OWS A;  1E3V A;  3MWZ A;  2GEX A;  3T0U A;  3KSP A;  1JKG A;  1VQM 3;  1M1X B;  1VQ7 3;  4R9L A;  1X1Y A;  1BRH A;  3FZW A;  3M8C A;  1TFK A;  1I70 A;  1IVW A;  2KF3 A;  4HJL B;  1X1X A;  5CXO A;  3K63 A; 
#chains in the Genus database with same CATH homology
 1LQM B;  1UGH I;  2J8X B;  2UGI A;  1EUI C;  1UGI A;  1UUG B;  2ZHX B;  1UDI I;  4LYL B;  2UUG C;  1LQG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...