1OF5B

Crystal structure of mex67-mtr2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
165
structure length
128
Chain Sequence
NQAQITATFTKKILAHLDDPDSNLAQFVQLFNPNCRIIFNATPFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear transport
molecule keywords MRNA EXPORT FACTOR MEX67
publication title Structural similarity in the absence of sequence homology of the messenger RNA export factors Mtr2 and p15.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 35
structure length 128
sequence length 165
ec nomenclature
pdb deposition date 2003-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1of5B00
1NWWA 3KE7A 3DM8A 1OF5A 1O7GB 3FGYA 3GZBA 3T8NA 1ZO2A 2BMOB 1C7HA 3CU3A 2K54A 2F86B 2OWPA 1OH0A 2B24B 3OXAA 2HMOB 3UJMA 1TUHA 3JUOA 4HZBB 4I4KA 5KP4A 1OHOA 3H3HA 4LEHA 3GZXB 1UUVB 3JUNA 3OX9A 3GZRA 1E97A 2STDA 4J8TA 3NV0A 2W2CA 3SOYA 1GY7A 2GBXB 4XDWA 1E3RA 3HZPA 2GEYA 3EX9A 2B1XB 2YFIB 5IG4A 4XDVA 5AIGA 1VZZA 2YFJB 1EG9B 1ULJB 4R9KA 3I0YA 1WQLB 1S5AA 3F8HA 2Z76A 3MSOA 3FZWA 3GRDA 4XBTA 3KSPA 1SJWA 2BMQB 2GXFA 3FF2A 3ECFA 3RGRA 2CHCA 1JB5A 2QGUA 1GYBA 5IENA 5CF1A 1W00A 3Q90A 4HM2B 3VGNA 3NXJA 4WYKA 1GY5A 2GBWB 4R9LA 3F40A 1TP6A 3MHEA 4OUQA 3EQQB 3K0ZA 2IMJA 3KZTA 2HMMB 1GY6A 1ASKA 4PEJA 3B4OA 3M8CA 3F7SA 2GEXA 1NU3A 4HM8B 3MG3A 5KP3A 3RGAA 1BUQA 1QJGA 3A76A 4WYKB 2QIYA 1O7PB 1W6YA 4HM3B 2BMRB 3T8UA 4WP5A 1GS3A 3ER7A 2Z7AA 5EVHA 2INXA 2XR8B 3DUKA 1DMMA 5D82A 3EN8A 3DZLA 3MYTA 1W01A 2HMKB 1HKXA 3F7XA 3WMDA 4HJLB 4X2OA 2JQ5A 3UNLA 3EF8A 2CKFB 5BVBA 3EBTA 1DMQA 3MG2A 4LGQA 3FH1A 5IG0A 2I9WA 5DREA 7STDA 5AI1A 2XRXB 1AR0A 5IG5A 3F9SA 3VSYA 3E99A 5AEWB 3EC9A 5IF6A 5CXOA 4HVNA 4K1VA 2HMLB 2BNGA 3SOAA 6STDA 3CNXA 3F8XA 2F98A 3B8LA 3B7CA 3JUMA 4HZ9B 4HM6B 1STDA 4FCMA 3OWUA 4RZMA 1CQSA 1OGXA 3FF0A 1A2KA 3CNMA 3MG1A 4H3UA 4L8OA 4STDA 1OCVA 3BB9A 5IEPA 1DMNA 5AIIA 3DMCA 5TGNA 8CHOA 3GZYB 4ORLA 1ULIB 2PZVA 4L8PA 3FKAA 1Q40A 4MJDA 3FSDA 5HGRA 3EHCA 3EJVA 5CK6A 2Z77A 3GWRA 5STDA 3STDA 3F14A 1ISKA 5FW5A 5JPPA 2RCDA 1O7NB 1UUWB 3DXOA 4CDLA 3HK4A 1U5OA 4HM1B 1JN5B 3BLZA 4XM4A 3KKGA 1JB4A 3NM2A 3OWSA 3S5CA 4HM7B 1JB2A 4XB5A 4FCJA 4HM4B 1OHPA 3LZAA 4L7KA 3EBYA 3G8ZA 5CF2A 2YFLB 3D9RA 1OUNA 1ZX2A 1OHSA 2R4IA 2XSHB 3G0KA 3HX8A 3JUQA 4HM5B 5DRVA 1O7MB 3NHXA 4GB5A 2RGQA 4XBXA 1OGZA 1K41A 1W02A 1Q42A 1O7WB 5KP1A 3NUVA 4K1UA 1OF5B 2RFRA 4OVMA 4Q53A 5AIHA 1JKGA 3OWYA 1Q40B 1NDOB 3SEDA 2HMNB 2XSOB 4HM0B 5G2GA 4LMIA 5IERA 4U13A 4KVHA 3NBRA 5AIFA 3G16A 5AEUB 4XBYA 2HMJB 3EN1B 4J9AA 3ROBA 5IG3A 1E3VA 5D81A 2A15A 4N3VA 5JPUA 3IPTA 3CPOA 3FLJA 3B4PA 1JN5A 4R1KA 3OV4A 1OPYA 1Z1SA 3LYGA 5BXQA 2F99A 4X2HA 5D83A 4HKVB 3NV0B 5CLKA 1QMAA 3K7CA 2UX0A 1O7HB 4WWUC 1EA2A 1IDPA 1JKGB 3JUPA 3H51A 3MKIA 5IEOA 4IIAA
chains in the Genus database with same CATH superfamily
1NWWA 3PYJA 3KE7A 2Y73A 1Q7HA 3DM8A 4J5KA 1ISKA 1KWIA 3J7Yd 1OF5A 2CIUA 1O7GB 1K8A4 2PNCA 3FGYA 3GZBA 2CW9A 3BNEA 2MF7A 1UGHI 1YNVX 2FGTA 3T8NA 1BRSA 1LVNA 1ZO2A 3WOEB 2BMOB 1C7HA 3RNTA 3CU3A 2K54A 1UI8A 1RRLA 2F86B 2OWPA 1OH0A 1X1WA 5EEOA 2CG0A 1V74A 3AMOA 2B24B 3OXAA 1S723 1AVLA 4AKYA 2HMOB 3LTDA 2IYJA 3D4AA 4KFDA 1B20A 2CFGA 3KSED 3UJMA 2CWUA 1DVDA 1TUHA 6GSPA 1JZDA 1Q814 5JBSA 1MOLA 2UUGC 3JUOA 4HZBB 4I4KA 4KT3B 5KP4A 2D42A 2KXGA 2W0QA 3K9MC 1BSDA 1YIT3 4FR9A 3ZG0A 2W9QA 1OHOA 4R80A 1HYFA 4O8SA 3GSPA 1RJOA 3WA3A 2ZHXB 1EEJA 3PZWA 2IUJA 2P0XA 2GSPA 2W04A 3LMLA 3WHOA 3ALAA 2BT3A 3N8BA 5AYRB 3H3HA 4BL2A 1NJI4 4LEHA 5LC7A 3GZXB 4BU4A 3NBBA 1Q9EA 1UUVB 1W6CA 1YGWA 1FYSA 3JUNA 1X1YA 5G1LA 3OX9A 1VQ83 2OQEC 3GZRA 1E97A 3SX1A 2STDA 2LQVA 4J8TA 4O2HA 2W56B 1L5GB 3NV0A 4BTXA 2W2CA 3HI7A 3SOYA 1FGMA 1LNIA 1I2EA 1LQMB 3S28A 3IMAB 3G713 1CEWI 2V1LA 3LTBA 1B21A 1IVUA 2GU1A 2OCTA 1BRHA 4FMDA 4IPBA 1VQ63 4K61A 1A90A 1BRGA 1AY7A 1GY7A 2GBXB 1NNVA 1DE3A 2CFWA 3LH4A 1STFI 1EUIC 4XDWA 4NPBA 1E3RA 2OQEA 2F4YA 3HZPA 3TDGA 2GEYA 1GMPA 1MWTA 2B1XB 2YFIB 3EX9A 1I0VA 3EE1A 4HYZA 5IG4A 2CWTA 4XDVA 5AIGA 1VZZA 2YFJB 3Q2PA 1EG9B 3FG4A 1ULJB 4R9KA 4RBNA 1B2ZA 2KF3A 4N6UA 3I0YA 1T2HA 1WQLB 3AMOB 1RHLA 5G1KA 1T2IA 4IIAA 1S5AA 3KCHA 4MEIA 3DGYA 3F8HA 4WFOA 1BU4A 2OTJ3 1I3IA 1J2BA 2Z76A 3MSOA 2E2UA 3X42A 1IQ8A 1W2ZA 3FZWA 1V57A 3GRDA 4XBTA 3DGMA 1B27A 1Q7Y4 2CK3H 3KSPA 1SJWA 3LT9A 1RMSA 1RCKA 5LC6A 4H61A 1LOWA 2BMQB 3VF1A 2GXFA 3FF2A 1RN4A 3ECFA 3RGRA 2CHCA 1JB5A 3WOFB 1TU5A 1TJDA 1BSEA 2QGUA 1GYBA 1WMPA 3CD63 2RNTA 5IENA 3CC43 5FGOA 1X1XA 2XFTA 2O9UX 3GAXA 6RNTA 2IY2A 2SARA 1YJ93 5CF1A 1BRIA 1W00A 1IVWA 1ROAA 1K9M4 1VQN3 1FA3A 1FUTA 1B2XA 3Q90A 4HM2B 3VGNA 3PGBA 3CME3 3Q3FA 5A0OB 3NXJA 1X1UA 2ZDJA 3U1WA 1IV7A 1IQYA 2HOHA 4WYKA 2UGIA 3SVAA 1B2MA 1RGGA 1IYYA 1GY5A 3A5EA 3DGLA 5M18A 1IU7A 4WHAA 2FXTA 1G0TA 2W6JH 2GBWB 2XEPA 1FGOA 4R9LA 3CCV3 1RGHA 1U8CB 1UGIA 3LOYA 2QEX3 1QVF2 4CPKA 3F40A 4N6LA 4J5GA 2KCDA 3NBJA 1OACA 4CJNA 4HAAA 2F5MA 1TP6A 1JRQA 4IT7A 3G4S3 1TTOA 1A2PA 3MHEA 4OUQA 2SBLA 3D5IA 3EQQB 2MC8A 2JDIH 1GD3A 3K0ZA 2FNQA 2IMJA 1RSNA 5IW9A 1QVG2 1Y4KA 4HBRA 1RDSA 3UL6A 4TX4A 2K3DA 3KZTA 1M904 3O8YA 1BSCA 2HMMB 2R41A 4MMZB 1GY6A 1SIHA 1ASKA 4KFEA 4PEJA 3T0UA 3B4OA 3K5TA 2W9PA 2H0GA 1FGQA 3M8CA 1W7CA 2OOVA 1ZS7A 3BNBA 2WGOA 1UCKA 2XH9A 2E2VA 3NX0A 3F7SA 1QALA 1BSAA 1TRQA 1LQGC 3N9HA 3V98A 3CCJ3 1FW7A 4FMCA 2H0IA 3N54B 2GEXA 3I563 1NU3A 1BIRA 4EC6A 4HM8B 2C10A 1FZUA 3MG3A 1WMNA 1D6YA 5KP3A 3X40A 3RGAA 1IVXA 3D79A 1BUQA 1QJGA 2K0MA 3A76A 1RNBA 1VQ43 1BNFA 1YHQ3 4WYKB 3LXUX 2QIYA 1O7PB 3BIRA 1JZOA 1JNQA 3WR2A 2KF5A 1W6YA 1WNHA 4HM3B 4LSOA 1Q864 1PYLA 2BMRB 1UUGB 3T8UA 1GS3A 4WP5A 3ER7A 2Z7AA 1N5HA 5EVHA 2XFSA 2INXA 2CX1A 3V99A 1SPUA 2XR8B 3DUKA 4KZ1A 3CCM3 1QAKA 3ZFZA 3DY5A 2BHMA 4O3VA 2AAEA 5ELUA 1DMMA 2KF4A 4RNTA 5BU4A 1BNSA 1WMOA 3HIIA 5D82A 4AKZA 3EN8A 3OW22 2Z6BA 3DZLA 3SXXA 3CMA3 1BSBA 3G6E3 3MWZA 3MYTA 1W01A 4N6MA 4FCZA 2HMKB 3Q1CA 1I2GA 4HOHA 3LT8A 1HKXA 3F7XA 4RNYA 4KFFA 3WMDA 4HJLB 1BNJA 4X2OA 2JQ5A 1UCLA 2M7OA 4QWTA 3UNLA 3EF8A 2CKFB 3PCRA 2ML5A 4N6V0 3AGOA 3WODG 5BVBA 3EBTA 1N9EA 1EKMA 1DMQA 3FG1A 3D3LA 1BVIA 1FUWA 2XGNA 3MG2A 4LGQA 1VQM3 3FH1A 3S27A 4GSPA 1YVBI 2O3OA 2RBIA 7GSPA 1BUJA 1UCIA 5IG0A 2I9WA 5DREA 7STDA 1UCJA 2W03A 5AI1A 3ZG5A 2XRXB 2D1WA 1AR0A 3X3YA 5IG5A 3F9SA 5EQLA 2L4VA 3VSYA 3E99A 5AEWB 1VQL3 1UI7A 1N9JA 1RN7A 2XF3A 1KC84 1VQQA 3EC9A 4R4KA 2E2TA 3UL5A 1BNRA 5IF6A 2OTL3 3PXMA 3MPHA 1JJ22 1GOYA 1T3BA 1JBSA 5CXOA 1B2SA 4HVNA 2P38A 1VQP3 2RSXA 2HMLB 4K1VA 2P0MA 2BNGA 5HOHA 3SOAA 6STDA 3CNXA 1IVVA 3F8XA 3D5GA 2F98A 3B8LA 1TRPA 1BGSA 2BO9B 3B7CA 3SLUA 1R4CA 1TIJA 3AHSA 3JUMA 4EXRA 1Q824 4HZ9B 4JF8A 1DVCA 2KAAA 2P05A 3HIGA 3QRDA 4HM6B 1IK3A 3I553 2ML6A 1G96A 3CPW2 1STDA 4FCMA 1CYUA 3OWUA 1FUSA 3RDEA 1RGEA 4RZMA 1CQSA 1OGXA 3CCR3 8RNTA 3FF0A 1A2KA 1K734 3CNMA 3CCL3 4LZIA 3MG1A 4H3UA 1ROVA 3JVCA 1GOUA 2KF6A 4FMBA 4EBGA 1MWUA 4JRFA 3BNDA 4L8OA 1AVKA 2OOVC 1LRAA 1NB5I 3AHWA 4I5QA 1A2VA 1ZGXA 1MWRA 4STDA 3IJEB 1OCVA 1KSIA 4BTWA 1FGTA 4N6NB 1RGLA 1GSPA 2Q07A 2ZL8A 1VQK3 3L0RA 1YJN3 3BB9A 1V58A 5IEPA 2WOFA 3URPA 1DMNA 1AQZA 2WOHA 4O02B 1BNIA 1SARA 5AIIA 1PY3A 1EQKA 2ZA4A 3DMCA 5TGNA 1LXEA 4MMYB 4EW5A 2CG1A 8CHOA 3NM7A 1D6UA 3GZYB 5ELJA 1JBTA 4ORLA 1N8QA 3CCU3 3CCS3 1ULIB 3U97A 2PZVA 4L8PA 3S67A 4CCVA 3FKAA 3WA2X 2BIRA 1BOXA 1Q40A 4MJDA 3FSDA 1I70A 3KIIA 3EHCA 5HGRA 3EJVA 1RCLA 3DH2A 5CK6A 2Z77A 3PS8A 3GWRA 5STDA 1VQ53 3STDA 1MGWA 3F14A 2C11A 4MMXB 1BAOA 5FW5A 1I2FA 1NB3I 5JPPA 2RCDA 1W4NA 3UB1A 1I8VA 1O7NB 1UUWB 4OK0A 2AADA 1F8NA 2BU4A 1MWSA 1US1A 1BRNL 1T5YA 1HZ1A 1K28A 1M1XB 3DXOA 4CDLA 3HK4A 3HOHA 1KD14 1JBRA 1U5OA 1BNGA 4K90B 5AYSC 4DKIA 4FMAA 1JN5B 4HM1B 3BLZA 4XM4A 1CH0A 1YVSA 1RGKA 1YJW3 3KKGA 1RGCA 2WGQA 4ZM8A 1LOVA 1I3FA 1B3SA 1BANA 1JB4A 1TFKA 1N8R4 3NM2A 1LOYA 3OWSA 2F56A 4N6TA 3S5CA 1RNTA 4HM7B 2IA7A 1JB2A 4XB5A 4FCJA 2CX0A 4HM4B 1OHPA 1DETA 1IQXA 1TFOA 3BNCA 1BRJA 3S29A 4AEQA 3KN4A 3QK9A 3LZAA 4L7KA 4BTYA 3EBYA 3G8ZA 5CF2A 1A67A 2YFLB 3D9RA 3EB8A 1OUNA 1YGEA 1OHSA 1ZX2A 2CFDA 2R4IA 2YX9A 3K63A 4BL3A 1VQ93 1UDII 1GOVA 2XSHB 3G0KA 3HX8A 3JUQA 4HM5B 5DRVA 1O7MB 3NHXA 3CC73 1BNEA 4GB5A 2CH9A 2CFLA 4GHOA 2RGQA 3FG3A 4XBXA 1OGZA 4N6OB 1K41A 1NO3A 1W02A 2CC3A 1Q42A 1O7WB 3FCSB 1D6ZA 3NUVA 4K1UA 5KP1A 1OF5B 2RFRA 4OVMA 1AV4A 3KFQC 4Q53A 5AIHA 3CXC2 1JKGA 3V92A 2J8XB 3OWYA 2QA43 5M1AA 1Q40B 3WDGB 1NDOB 2F5WA 2HMNB 3NQZA 3SEDA 2XSOB 4NREA 1GMRA 2XGLA 1LOXA 4RNZA 1PFPA 1I0XA 2L1SA 9RNTA 4HM0B 5G2GA 4LMIA 5IERA 4U13A 1GD4A 1LNHA 1YIJ3 3DGOA 1R4YA 3NBRA 4KVHA 1C54A 1KQS2 1SQWA 5AIFA 1VQ73 1RGAA 1SIIA 1IT7A 1CYVA 1IT8A 1B2UA 1MGRA 3LTAA 3G16A 3NQYA 5AEUB 3CCE3 4XBYA 1WTHA 2H0HA 2GU3A 2HMJB 3EN1B 1RLSA 2Y74A 4J9AA 3ROBA 1M9GA 4BIRA 5IG3A 1E3VA 2C4BA 5D81A 1MNLA 2A15A 4N3VA 5JPUA 2CWVA 3CCQ3 5M19A 1VQO3 1UW1A 3IPTA 5I97A 1QAFA 3CPOA 1JV2B 3FLJA 1RKYA 3DGNA 3B4PA 1RTUA 4ILFA 4LYLB 1JN5A 4R1KA 3X3ZA 3OV4A 5GSPA 1FGRA 4NHFA 1OPYA 3BU4A 1Z1SA 7RNTA 3AGNA 3LTCA 3LYGA 3CC23 1GMQA 3SYUA 1RRHA 5BXQA 1HU9A 1M1K4 2IUKA 1BRKA 2F99A 2P09A 2CFKA 2KRTA 1IV9A 1RN1A 1DYUA 1W6GA 4X2HA 5D83A 3X41A 5BIRA 4G1MB 4HKVB 1G02A 3NV0B 1QMAA 5CLKA 4EV5A 3K7CA 1W2B2 2UX0A 4GL6A 4EYCA 1PU4A 1O7HB 1W5ZA 4WWUC 4EV2A 1EA2A 3X3XA 1N5PA 3PCSA 1RGFA 1YI23 1IDPA 5RNTA 1JKGB 2WO0A 3H51A 3JUPA 3MKIA 2W56A 5IEOA 2LYXA
chains in the Genus database with same CATH topology
1NWWA 3PYJA 3KE7A 2Y73A 3DM8A 1KWIA 3J7Yd 1OF5A 2CIUA 1O7GB 1K8A4 2PNCA 3FGYA 3GZBA 2CW9A 3BNEA 2MF7A 2FGTA 3T8NA 1LVNA 1ZO2A 3WOEB 2BMOB 1C7HA 3CU3A 2K54A 1UI8A 1RRLA 2F86B 2OWPA 1OH0A 5EEOA 2CG0A 1V74A 3AMOA 2B24B 3OXAA 1S723 1AVLA 4AKYA 2HMOB 3LTDA 4KFDA 2CFGA 3KSED 3UJMA 2CWUA 1DVDA 1TUHA 1Q814 5JBSA 1MOLA 3JUOA 4HZBB 4I4KA 5KP4A 2D42A 2KXGA 2W0QA 3K9MC 1YIT3 4FR9A 2W9QA 1OHOA 4R80A 4O8SA 3WA3A 1RJOA 3PZWA 2IUJA 2P0XA 2W04A 3LMLA 3ALAA 2BT3A 3N8BA 5AYRB 3H3HA 1NJI4 4LEHA 5LC7A 3GZXB 3NBBA 1UUVB 1W6CA 3JUNA 3OX9A 1VQ83 2OQEC 3GZRA 1E97A 3SX1A 2STDA 2LQVA 4J8TA 4O2HA 2W56B 1L5GB 3NV0A 4BTXA 2W2CA 3HI7A 3SOYA 1FGMA 3S28A 3IMAB 3G713 1CEWI 2V1LA 3LTBA 1VQ63 1IVUA 2GU1A 2OCTA 4FMDA 4IPBA 4K61A 1A90A 1GY7A 2GBXB 2CFWA 3LH4A 1STFI 4XDWA 1E3RA 2OQEA 3HZPA 3TDGA 2GEYA 3EX9A 2B1XB 2YFIB 3EE1A 4HYZA 5IG4A 2CWTA 4XDVA 5AIGA 1VZZA 2YFJB 3Q2PA 1EG9B 3FG4A 1ULJB 4R9KA 4RBNA 4N6UA 3I0YA 1WQLB 3AMOB 4IIAA 1S5AA 4WFOA 4MEIA 3F8HA 2OTJ3 1J2BA 2Z76A 3MSOA 2E2UA 3X42A 1IQ8A 1W2ZA 3FZWA 3GRDA 4XBTA 3DGMA 1Q7Y4 2CK3H 3KSPA 1SJWA 3LT9A 5LC6A 4H61A 2BMQB 3VF1A 2GXFA 3FF2A 3ECFA 3RGRA 2CHCA 1JB5A 3WOFB 1TU5A 2QGUA 1GYBA 1WMPA 3CD63 5IENA 3CC43 5FGOA 2XFTA 2O9UX 3GAXA 1YJ93 5CF1A 1W00A 1IVWA 1ROAA 1K9M4 1VQN3 3Q90A 4HM2B 3VGNA 3PGBA 3CME3 5A0OB 3NXJA 2ZDJA 3U1WA 1IV7A 1IQYA 4WYKA 3SVAA 1GY5A 3DGLA 1IU7A 4WHAA 2FXTA 2W6JH 2GBWB 2XEPA 1FGOA 4R9LA 3CCV3 1U8CB 3LOYA 2QEX3 1QVF2 3F40A 4N6LA 2KCDA 3NBJA 1OACA 1TP6A 1JRQA 4IT7A 3G4S3 3MHEA 4OUQA 2SBLA 3EQQB 2MC8A 2JDIH 1GD3A 3K0ZA 2FNQA 2IMJA 5IW9A 1QVG2 1Y4KA 4HBRA 3UL6A 4TX4A 3KZTA 1M904 3O8YA 2HMMB 4MMZB 1GY6A 1SIHA 1ASKA 4KFEA 4PEJA 3T0UA 3B4OA 3K5TA 2W9PA 1FGQA 3M8CA 1W7CA 2OOVA 3BNBA 2WGOA 2XH9A 2E2VA 3NX0A 3F7SA 1QALA 3N9HA 3V98A 3CCJ3 4FMCA 3N54B 2GEXA 3I563 1NU3A 4EC6A 4HM8B 2C10A 3MG3A 1WMNA 1D6YA 5KP3A 3X40A 3RGAA 1IVXA 1BUQA 1QJGA 2K0MA 3A76A 1VQ43 1YHQ3 4WYKB 3LXUX 2QIYA 1O7PB 1JNQA 1W6YA 1WNHA 4HM3B 4LSOA 1Q864 2BMRB 3T8UA 1GS3A 4WP5A 3ER7A 2Z7AA 1N5HA 5EVHA 2XFSA 2INXA 3V99A 1SPUA 2XR8B 3DUKA 4KZ1A 3CCM3 1QAKA 3DY5A 2BHMA 4O3VA 5ELUA 1DMMA 1WMOA 3HIIA 5D82A 4AKZA 3EN8A 3OW22 2Z6BA 3DZLA 3SXXA 3CMA3 3G6E3 3MWZA 3MYTA 1W01A 4N6MA 4FCZA 2HMKB 3Q1CA 3LT8A 1HKXA 3F7XA 4RNYA 4KFFA 3WMDA 4HJLB 4X2OA 2JQ5A 4QWTA 2M7OA 3UNLA 3EF8A 2CKFB 3PCRA 2ML5A 4N6V0 3WODG 5BVBA 3EBTA 1N9EA 1EKMA 1DMQA 3FG1A 3D3LA 1FUWA 2XGNA 3MG2A 4LGQA 1VQM3 3FH1A 3S27A 1YVBI 2O3OA 5IG0A 2I9WA 5DREA 7STDA 2W03A 5AI1A 2XRXB 2D1WA 1AR0A 3X3YA 5IG5A 3F9SA 5EQLA 2L4VA 3VSYA 3E99A 5AEWB 1VQL3 1UI7A 1N9JA 1RN7A 2XF3A 3EC9A 4R4KA 2E2TA 3UL5A 5IF6A 2OTL3 3PXMA 3MPHA 1JJ22 5CXOA 4HVNA 2P38A 1VQP3 2RSXA 2HMLB 4K1VA 2P0MA 2BNGA 3SOAA 6STDA 3CNXA 1IVVA 3F8XA 2F98A 3B8LA 2BO9B 3B7CA 3SLUA 1R4CA 1TIJA 3JUMA 4EXRA 1Q824 4HZ9B 4JF8A 1DVCA 3HIGA 2P05A 3QRDA 1IK3A 4HM6B 3I553 2ML6A 1G96A 3CPW2 1STDA 4FCMA 1CYUA 3OWUA 3RDEA 4RZMA 1CQSA 1OGXA 3CCR3 3FF0A 1A2KA 1K734 3CNMA 3CCL3 4LZIA 3MG1A 4H3UA 1ROVA 3JVCA 4EBGA 4FMBA 4JRFA 3BNDA 4L8OA 1AVKA 2OOVC 1NB5I 1A2VA 4STDA 3IJEB 1OCVA 1KSIA 4BTWA 1FGTA 4N6NB 2Q07A 2ZL8A 1VQK3 3L0RA 1YJN3 3BB9A 5IEPA 2WOFA 1DMNA 2WOHA 4O02B 5AIIA 1EQKA 3DMCA 5TGNA 1LXEA 4MMYB 2CG1A 8CHOA 3NM7A 1D6UA 3GZYB 5ELJA 4ORLA 1N8QA 3CCU3 3CCS3 1ULIB 3U97A 2PZVA 4L8PA 3S67A 4CCVA 3FKAA 3WA2X 1Q40A 4MJDA 3FSDA 3KIIA 3EHCA 5HGRA 3EJVA 5CK6A 2Z77A 3PS8A 3GWRA 5STDA 1VQ53 3STDA 3F14A 4MMXB 2C11A 5FW5A 5JPPA 1KC84 1NB3I 1ISKA 2RCDA 1W4NA 3UB1A 1O7NB 1UUWB 4OK0A 1F8NA 1US1A 1T5YA 1K28A 1M1XB 3DXOA 4CDLA 3HK4A 1KD14 1U5OA 4K90B 5AYSC 4FMAA 1JN5B 4HM1B 3BLZA 4XM4A 1YJW3 3KKGA 2WGQA 4ZM8A 1JB4A 1TFKA 1N8R4 3NM2A 3OWSA 4N6TA 3S5CA 4HM7B 2IA7A 1JB2A 4XB5A 4FCJA 4HM4B 1OHPA 1IQXA 1TFOA 3BNCA 3S29A 4AEQA 3KN4A 3QK9A 3LZAA 4L7KA 4BTYA 3EBYA 3G8ZA 5CF2A 1A67A 2YFLB 3D9RA 3EB8A 1OUNA 1YGEA 1OHSA 1ZX2A 2CFDA 2R4IA 2YX9A 3K63A 1VQ93 2XSHB 3G0KA 3HX8A 3JUQA 4HM5B 5DRVA 3CC73 1O7MB 3NHXA 4GB5A 2CH9A 2CFLA 2RGQA 3FG3A 4XBXA 1OGZA 4N6OB 1K41A 1NO3A 1W02A 2CC3A 1Q42A 1O7WB 3FCSB 1D6ZA 3NUVA 4K1UA 5KP1A 1OF5B 2RFRA 4OVMA 1AV4A 3KFQC 4Q53A 5AIHA 3CXC2 1JKGA 3V92A 3OWYA 2QA43 1Q40B 3WDGB 1NDOB 3SEDA 2HMNB 3NQZA 2XSOB 4NREA 2XGLA 1LOXA 4RNZA 1PFPA 4HM0B 5G2GA 4LMIA 5IERA 4U13A 1GD4A 1LNHA 1YIJ3 3DGOA 4KVHA 3NBRA 1FA3A 1KQS2 1SQWA 5AIFA 1VQ73 1IT7A 1CYVA 1IT8A 1SIIA 3LTAA 3G16A 3NQYA 5AEUB 3CCE3 4XBYA 1WTHA 2HMJB 2GU3A 3EN1B 2Y74A 4J9AA 3ROBA 1M9GA 5IG3A 1E3VA 5D81A 1MNLA 2A15A 4N3VA 5JPUA 2CWVA 3CCQ3 1VQO3 1UW1A 3IPTA 5I97A 1QAFA 3CPOA 1JV2B 3FLJA 1RKYA 3DGNA 3B4PA 3X3ZA 1JN5A 4R1KA 3OV4A 1FGRA 4NHFA 1OPYA 1Z1SA 3LTCA 3LYGA 3CC23 1RRHA 5BXQA 1HU9A 1M1K4 2IUKA 2F99A 2P09A 2CFKA 2KRTA 1IV9A 1W6GA 1DYUA 4X2HA 5D83A 3X41A 4G1MB 4HKVB 3NV0B 5CLKA 1QMAA 4EV5A 1W2B2 3K7CA 2UX0A 4GL6A 4EYCA 1PU4A 1O7HB 1W5ZA 4WWUC 4EV2A 1EA2A 3X3XA 1N5PA 3PCSA 1YI23 1IDPA 1JKGB 2WO0A 3H51A 3JUPA 3MKIA 2W56A 5IEOA 2LYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWW A;  3KE7 A;  3DM8 A;  1OF5 A;  1O7G B;  3FGY A;  3GZB A;  3T8N A;  1ZO2 A;  2BMO B;  1C7H A;  3CU3 A;  2K54 A;  2F86 B;  2OWP A;  1OH0 A;  2B24 B;  3OXA A;  2HMO B;  3UJM A;  1TUH A;  3JUO A;  4HZB B;  4I4K A;  5KP4 A;  1OHO A;  3H3H A;  4LEH A;  3GZX B;  1UUV B;  3JUN A;  3OX9 A;  3GZR A;  1E97 A;  2STD A;  4J8T A;  3NV0 A;  2W2C A;  3SOY A;  1GY7 A;  2GBX B;  4XDW A;  1E3R A;  3HZP A;  2GEY A;  3EX9 A;  2B1X B;  2YFI B;  5IG4 A;  4XDV A;  5AIG A;  1VZZ A;  2YFJ B;  1EG9 B;  1ULJ B;  4R9K A;  3I0Y A;  1WQL B;  1S5A A;  3F8H A;  2Z76 A;  3MSO A;  3FZW A;  3GRD A;  4XBT A;  3KSP A;  1SJW A;  2BMQ B;  2GXF A;  3FF2 A;  3ECF A;  3RGR A;  2CHC A;  1JB5 A;  2QGU A;  1GYB A;  5IEN A;  5CF1 A;  1W00 A;  3Q90 A;  4HM2 B;  3VGN A;  3NXJ A;  4WYK A;  1GY5 A;  2GBW B;  4R9L A;  3F40 A;  1TP6 A;  3MHE A;  4OUQ A;  3EQQ B;  3K0Z A;  2IMJ A;  3KZT A;  2HMM B;  1GY6 A;  1ASK A;  4PEJ A;  3B4O A;  3M8C A;  3F7S A;  2GEX A;  1NU3 A;  4HM8 B;  3MG3 A;  5KP3 A;  3RGA A;  1BUQ A;  1QJG A;  3A76 A;  4WYK B;  2QIY A;  1O7P B;  1W6Y A;  4HM3 B;  2BMR B;  3T8U A;  4WP5 A;  1GS3 A;  3ER7 A;  2Z7A A;  5EVH A;  2INX A;  2XR8 B;  3DUK A;  1DMM A;  5D82 A;  3EN8 A;  3DZL A;  3MYT A;  1W01 A;  2HMK B;  1HKX A;  3F7X A;  3WMD A;  4HJL B;  4X2O A;  2JQ5 A;  3UNL A;  3EF8 A;  2CKF B;  5BVB A;  3EBT A;  1DMQ A;  3MG2 A;  4LGQ A;  3FH1 A;  5IG0 A;  2I9W A;  5DRE A;  7STD A;  5AI1 A;  2XRX B;  1AR0 A;  5IG5 A;  3F9S A;  3VSY A;  3E99 A;  5AEW B;  3EC9 A;  5IF6 A;  5CXO A;  4HVN A;  4K1V A;  2HML B;  2BNG A;  3SOA A;  6STD A;  3CNX A;  3F8X A;  2F98 A;  3B8L A;  3B7C A;  3JUM A;  4HZ9 B;  4HM6 B;  1STD A;  4FCM A;  3OWU A;  4RZM A;  1CQS A;  1OGX A;  3FF0 A;  1A2K A;  3CNM A;  3MG1 A;  4H3U A;  4L8O A;  4STD A;  1OCV A;  3BB9 A;  5IEP A;  1DMN A;  5AII A;  3DMC A;  5TGN A;  8CHO A;  3GZY B;  4ORL A;  1ULI B;  2PZV A;  4L8P A;  3FKA A;  1Q40 A;  4MJD A;  3FSD A;  5HGR A;  3EHC A;  3EJV A;  5CK6 A;  2Z77 A;  3GWR A;  5STD A;  3STD A;  3F14 A;  1ISK A;  5FW5 A;  5JPP A;  2RCD A;  1O7N B;  1UUW B;  3DXO A;  4CDL A;  3HK4 A;  1U5O A;  4HM1 B;  1JN5 B;  3BLZ A;  4XM4 A;  3KKG A;  1JB4 A;  3NM2 A;  3OWS A;  3S5C A;  4HM7 B;  1JB2 A;  4XB5 A;  4FCJ A;  4HM4 B;  1OHP A;  3LZA A;  4L7K A;  3EBY A;  3G8Z A;  5CF2 A;  2YFL B;  3D9R A;  1OUN A;  1ZX2 A;  1OHS A;  2R4I A;  2XSH B;  3G0K A;  3HX8 A;  3JUQ A;  4HM5 B;  5DRV A;  1O7M B;  3NHX A;  4GB5 A;  2RGQ A;  4XBX A;  1OGZ A;  1K41 A;  1W02 A;  1Q42 A;  1O7W B;  5KP1 A;  3NUV A;  4K1U A;  1OF5 B;  2RFR A;  4OVM A;  4Q53 A;  5AIH A;  1JKG A;  3OWY A;  1Q40 B;  1NDO B;  3SED A;  2HMN B;  2XSO B;  4HM0 B;  5G2G A;  4LMI A;  5IER A;  4U13 A;  4KVH A;  3NBR A;  5AIF A;  3G16 A;  5AEU B;  4XBY A;  2HMJ B;  3EN1 B;  4J9A A;  3ROB A;  5IG3 A;  1E3V A;  5D81 A;  2A15 A;  4N3V A;  5JPU A;  3IPT A;  3CPO A;  3FLJ A;  3B4P A;  1JN5 A;  4R1K A;  3OV4 A;  1OPY A;  1Z1S A;  3LYG A;  5BXQ A;  2F99 A;  4X2H A;  5D83 A;  4HKV B;  3NV0 B;  5CLK A;  1QMA A;  3K7C A;  2UX0 A;  1O7H B;  4WWU C;  1EA2 A;  1IDP A;  1JKG B;  3JUP A;  3H51 A;  3MKI A;  5IEO A;  4IIA A; 
#chains in the Genus database with same CATH topology
 1NWW A;  3PYJ A;  3KE7 A;  2Y73 A;  1Q7H A;  3DM8 A;  4J5K A;  1ISK A;  1KWI A;  3J7Y d;  1OF5 A;  2CIU A;  1O7G B;  1K8A 4;  2PNC A;  3FGY A;  3GZB A;  2CW9 A;  3BNE A;  2MF7 A;  1UGH I;  1YNV X;  2FGT A;  3T8N A;  1BRS A;  1LVN A;  1ZO2 A;  3WOE B;  2BMO B;  1C7H A;  3RNT A;  3CU3 A;  2K54 A;  1UI8 A;  1RRL A;  2F86 B;  2OWP A;  1OH0 A;  1X1W A;  5EEO A;  2CG0 A;  1V74 A;  3AMO A;  2B24 B;  3OXA A;  1S72 3;  1AVL A;  4AKY A;  2HMO B;  3LTD A;  2IYJ A;  3D4A A;  4KFD A;  1B20 A;  2CFG A;  3KSE D;  3UJM A;  2CWU A;  1DVD A;  1TUH A;  6GSP A;  1JZD A;  1Q81 4;  5JBS A;  1MOL A;  2UUG C;  3JUO A;  4HZB B;  4I4K A;  4KT3 B;  5KP4 A;  2D42 A;  2KXG A;  2W0Q A;  3K9M C;  1BSD A;  1YIT 3;  4FR9 A;  3ZG0 A;  2W9Q A;  1OHO A;  4R80 A;  1HYF A;  4O8S A;  3GSP A;  1RJO A;  3WA3 A;  2ZHX B;  1EEJ A;  3PZW A;  2IUJ A;  2P0X A;  2GSP A;  2W04 A;  3LML A;  3WHO A;  3ALA A;  2BT3 A;  3N8B A;  5AYR B;  3H3H A;  4BL2 A;  1NJI 4;  4LEH A;  5LC7 A;  3GZX B;  4BU4 A;  3NBB A;  1Q9E A;  1UUV B;  1W6C A;  1YGW A;  1FYS A;  3JUN A;  1X1Y A;  5G1L A;  3OX9 A;  1VQ8 3;  2OQE C;  3GZR A;  1E97 A;  3SX1 A;  2STD A;  2LQV A;  4J8T A;  4O2H A;  2W56 B;  1L5G B;  3NV0 A;  4BTX A;  2W2C A;  3HI7 A;  3SOY A;  1FGM A;  1LNI A;  1I2E A;  1LQM B;  3S28 A;  3IMA B;  3G71 3;  1CEW I;  2V1L A;  3LTB A;  1B21 A;  1IVU A;  2GU1 A;  2OCT A;  1BRH A;  4FMD A;  4IPB A;  1VQ6 3;  4K61 A;  1A90 A;  1BRG A;  1AY7 A;  1GY7 A;  2GBX B;  1NNV A;  1DE3 A;  2CFW A;  3LH4 A;  1STF I;  1EUI C;  4XDW A;  4NPB A;  1E3R A;  2OQE A;  2F4Y A;  3HZP A;  3TDG A;  2GEY A;  1GMP A;  1MWT A;  2B1X B;  2YFI B;  3EX9 A;  1I0V A;  3EE1 A;  4HYZ A;  5IG4 A;  2CWT A;  4XDV A;  5AIG A;  1VZZ A;  2YFJ B;  3Q2P A;  1EG9 B;  3FG4 A;  1ULJ B;  4R9K A;  4RBN A;  1B2Z A;  2KF3 A;  4N6U A;  3I0Y A;  1T2H A;  1WQL B;  3AMO B;  1RHL A;  5G1K A;  1T2I A;  4IIA A;  1S5A A;  3KCH A;  4MEI A;  3DGY A;  3F8H A;  4WFO A;  1BU4 A;  2OTJ 3;  1I3I A;  1J2B A;  2Z76 A;  3MSO A;  2E2U A;  3X42 A;  1IQ8 A;  1W2Z A;  3FZW A;  1V57 A;  3GRD A;  4XBT A;  3DGM A;  1B27 A;  1Q7Y 4;  2CK3 H;  3KSP A;  1SJW A;  3LT9 A;  1RMS A;  1RCK A;  5LC6 A;  4H61 A;  1LOW A;  2BMQ B;  3VF1 A;  2GXF A;  3FF2 A;  1RN4 A;  3ECF A;  3RGR A;  2CHC A;  1JB5 A;  3WOF B;  1TU5 A;  1TJD A;  1BSE A;  2QGU A;  1GYB A;  1WMP A;  3CD6 3;  2RNT A;  5IEN A;  3CC4 3;  5FGO A;  1X1X A;  2XFT A;  2O9U X;  3GAX A;  6RNT A;  2IY2 A;  2SAR A;  1YJ9 3;  5CF1 A;  1BRI A;  1W00 A;  1IVW A;  1ROA A;  1K9M 4;  1VQN 3;  1FA3 A;  1FUT A;  1B2X A;  3Q90 A;  4HM2 B;  3VGN A;  3PGB A;  3CME 3;  3Q3F A;  5A0O B;  3NXJ A;  1X1U A;  2ZDJ A;  3U1W A;  1IV7 A;  1IQY A;  2HOH A;  4WYK A;  2UGI A;  3SVA A;  1B2M A;  1RGG A;  1IYY A;  1GY5 A;  3A5E A;  3DGL A;  5M18 A;  1IU7 A;  4WHA A;  2FXT A;  1G0T A;  2W6J H;  2GBW B;  2XEP A;  1FGO A;  4R9L A;  3CCV 3;  1RGH A;  1U8C B;  1UGI A;  3LOY A;  2QEX 3;  1QVF 2;  4CPK A;  3F40 A;  4N6L A;  4J5G A;  2KCD A;  3NBJ A;  1OAC A;  4CJN A;  4HAA A;  2F5M A;  1TP6 A;  1JRQ A;  4IT7 A;  3G4S 3;  1TTO A;  1A2P A;  3MHE A;  4OUQ A;  2SBL A;  3D5I A;  3EQQ B;  2MC8 A;  2JDI H;  1GD3 A;  3K0Z A;  2FNQ A;  2IMJ A;  1RSN A;  5IW9 A;  1QVG 2;  1Y4K A;  4HBR A;  1RDS A;  3UL6 A;  4TX4 A;  2K3D A;  3KZT A;  1M90 4;  3O8Y A;  1BSC A;  2HMM B;  2R41 A;  4MMZ B;  1GY6 A;  1SIH A;  1ASK A;  4KFE A;  4PEJ A;  3T0U A;  3B4O A;  3K5T A;  2W9P A;  2H0G A;  1FGQ A;  3M8C A;  1W7C A;  2OOV A;  1ZS7 A;  3BNB A;  2WGO A;  1UCK A;  2XH9 A;  2E2V A;  3NX0 A;  3F7S A;  1QAL A;  1BSA A;  1TRQ A;  1LQG C;  3N9H A;  3V98 A;  3CCJ 3;  1FW7 A;  4FMC A;  2H0I A;  3N54 B;  2GEX A;  3I56 3;  1NU3 A;  1BIR A;  4EC6 A;  4HM8 B;  2C10 A;  1FZU A;  3MG3 A;  1WMN A;  1D6Y A;  5KP3 A;  3X40 A;  3RGA A;  1IVX A;  3D79 A;  1BUQ A;  1QJG A;  2K0M A;  3A76 A;  1RNB A;  1VQ4 3;  1BNF A;  1YHQ 3;  4WYK B;  3LXU X;  2QIY A;  1O7P B;  3BIR A;  1JZO A;  1JNQ A;  3WR2 A;  2KF5 A;  1W6Y A;  1WNH A;  4HM3 B;  4LSO A;  1Q86 4;  1PYL A;  2BMR B;  1UUG B;  3T8U A;  1GS3 A;  4WP5 A;  3ER7 A;  2Z7A A;  1N5H A;  5EVH A;  2XFS A;  2INX A;  2CX1 A;  3V99 A;  1SPU A;  2XR8 B;  3DUK A;  4KZ1 A;  3CCM 3;  1QAK A;  3ZFZ A;  3DY5 A;  2BHM A;  4O3V A;  2AAE A;  5ELU A;  1DMM A;  2KF4 A;  4RNT A;  5BU4 A;  1BNS A;  1WMO A;  3HII A;  5D82 A;  4AKZ A;  3EN8 A;  3OW2 2;  2Z6B A;  3DZL A;  3SXX A;  3CMA 3;  1BSB A;  3G6E 3;  3MWZ A;  3MYT A;  1W01 A;  4N6M A;  4FCZ A;  2HMK B;  3Q1C A;  1I2G A;  4HOH A;  3LT8 A;  1HKX A;  3F7X A;  4RNY A;  4KFF A;  3WMD A;  4HJL B;  1BNJ A;  4X2O A;  2JQ5 A;  1UCL A;  2M7O A;  4QWT A;  3UNL A;  3EF8 A;  2CKF B;  3PCR A;  2ML5 A;  4N6V 0;  3AGO A;  3WOD G;  5BVB A;  3EBT A;  1N9E A;  1EKM A;  1DMQ A;  3FG1 A;  3D3L A;  1BVI A;  1FUW A;  2XGN A;  3MG2 A;  4LGQ A;  1VQM 3;  3FH1 A;  3S27 A;  4GSP A;  1YVB I;  2O3O A;  2RBI A;  7GSP A;  1BUJ A;  1UCI A;  5IG0 A;  2I9W A;  5DRE A;  7STD A;  1UCJ A;  2W03 A;  5AI1 A;  3ZG5 A;  2XRX B;  2D1W A;  1AR0 A;  3X3Y A;  5IG5 A;  3F9S A;  5EQL A;  2L4V A;  3VSY A;  3E99 A;  5AEW B;  1VQL 3;  1UI7 A;  1N9J A;  1RN7 A;  2XF3 A;  1KC8 4;  1VQQ A;  3EC9 A;  4R4K A;  2E2T A;  3UL5 A;  1BNR A;  5IF6 A;  2OTL 3;  3PXM A;  3MPH A;  1JJ2 2;  1GOY A;  1T3B A;  1JBS A;  5CXO A;  1B2S A;  4HVN A;  2P38 A;  1VQP 3;  2RSX A;  2HML B;  4K1V A;  2P0M A;  2BNG A;  5HOH A;  3SOA A;  6STD A;  3CNX A;  1IVV A;  3F8X A;  3D5G A;  2F98 A;  3B8L A;  1TRP A;  1BGS A;  2BO9 B;  3B7C A;  3SLU A;  1R4C A;  1TIJ A;  3AHS A;  3JUM A;  4EXR A;  1Q82 4;  4HZ9 B;  4JF8 A;  1DVC A;  2KAA A;  2P05 A;  3HIG A;  3QRD A;  4HM6 B;  1IK3 A;  3I55 3;  2ML6 A;  1G96 A;  3CPW 2;  1STD A;  4FCM A;  1CYU A;  3OWU A;  1FUS A;  3RDE A;  1RGE A;  4RZM A;  1CQS A;  1OGX A;  3CCR 3;  8RNT A;  3FF0 A;  1A2K A;  1K73 4;  3CNM A;  3CCL 3;  4LZI A;  3MG1 A;  4H3U A;  1ROV A;  3JVC A;  1GOU A;  2KF6 A;  4FMB A;  4EBG A;  1MWU A;  4JRF A;  3BND A;  4L8O A;  1AVK A;  2OOV C;  1LRA A;  1NB5 I;  3AHW A;  4I5Q A;  1A2V A;  1ZGX A;  1MWR A;  4STD A;  3IJE B;  1OCV A;  1KSI A;  4BTW A;  1FGT A;  4N6N B;  1RGL A;  1GSP A;  2Q07 A;  2ZL8 A;  1VQK 3;  3L0R A;  1YJN 3;  3BB9 A;  1V58 A;  5IEP A;  2WOF A;  3URP A;  1DMN A;  1AQZ A;  2WOH A;  4O02 B;  1BNI A;  1SAR A;  5AII A;  1PY3 A;  1EQK A;  2ZA4 A;  3DMC A;  5TGN A;  1LXE A;  4MMY B;  4EW5 A;  2CG1 A;  8CHO A;  3NM7 A;  1D6U A;  3GZY B;  5ELJ A;  1JBT A;  4ORL A;  1N8Q A;  3CCU 3;  3CCS 3;  1ULI B;  3U97 A;  2PZV A;  4L8P A;  3S67 A;  4CCV A;  3FKA A;  3WA2 X;  2BIR A;  1BOX A;  1Q40 A;  4MJD A;  3FSD A;  1I70 A;  3KII A;  3EHC A;  5HGR A;  3EJV A;  1RCL A;  3DH2 A;  5CK6 A;  2Z77 A;  3PS8 A;  3GWR A;  5STD A;  1VQ5 3;  3STD A;  1MGW A;  3F14 A;  2C11 A;  4MMX B;  1BAO A;  5FW5 A;  1I2F A;  1NB3 I;  5JPP A;  2RCD A;  1W4N A;  3UB1 A;  1I8V A;  1O7N B;  1UUW B;  4OK0 A;  2AAD A;  1F8N A;  2BU4 A;  1MWS A;  1US1 A;  1BRN L;  1T5Y A;  1HZ1 A;  1K28 A;  1M1X B;  3DXO A;  4CDL A;  3HK4 A;  3HOH A;  1KD1 4;  1JBR A;  1U5O A;  1BNG A;  4K90 B;  5AYS C;  4DKI A;  4FMA A;  1JN5 B;  4HM1 B;  3BLZ A;  4XM4 A;  1CH0 A;  1YVS A;  1RGK A;  1YJW 3;  3KKG A;  1RGC A;  2WGQ A;  4ZM8 A;  1LOV A;  1I3F A;  1B3S A;  1BAN A;  1JB4 A;  1TFK A;  1N8R 4;  3NM2 A;  1LOY A;  3OWS A;  2F56 A;  4N6T A;  3S5C A;  1RNT A;  4HM7 B;  2IA7 A;  1JB2 A;  4XB5 A;  4FCJ A;  2CX0 A;  4HM4 B;  1OHP A;  1DET A;  1IQX A;  1TFO A;  3BNC A;  1BRJ A;  3S29 A;  4AEQ A;  3KN4 A;  3QK9 A;  3LZA A;  4L7K A;  4BTY A;  3EBY A;  3G8Z A;  5CF2 A;  1A67 A;  2YFL B;  3D9R A;  3EB8 A;  1OUN A;  1YGE A;  1OHS A;  1ZX2 A;  2CFD A;  2R4I A;  2YX9 A;  3K63 A;  4BL3 A;  1VQ9 3;  1UDI I;  1GOV A;  2XSH B;  3G0K A;  3HX8 A;  3JUQ A;  4HM5 B;  5DRV A;  1O7M B;  3NHX A;  3CC7 3;  1BNE A;  4GB5 A;  2CH9 A;  2CFL A;  4GHO A;  2RGQ A;  3FG3 A;  4XBX A;  1OGZ A;  4N6O B;  1K41 A;  1NO3 A;  1W02 A;  2CC3 A;  1Q42 A;  1O7W B;  3FCS B;  1D6Z A;  3NUV A;  4K1U A;  5KP1 A;  1OF5 B;  2RFR A;  4OVM A;  1AV4 A;  3KFQ C;  4Q53 A;  5AIH A;  3CXC 2;  1JKG A;  3V92 A;  2J8X B;  3OWY A;  2QA4 3;  5M1A A;  1Q40 B;  3WDG B;  1NDO B;  2F5W A;  2HMN B;  3NQZ A;  3SED A;  2XSO B;  4NRE A;  1GMR A;  2XGL A;  1LOX A;  4RNZ A;  1PFP A;  1I0X A;  2L1S A;  9RNT A;  4HM0 B;  5G2G A;  4LMI A;  5IER A;  4U13 A;  1GD4 A;  1LNH A;  1YIJ 3;  3DGO A;  1R4Y A;  3NBR A;  4KVH A;  1C54 A;  1KQS 2;  1SQW A;  5AIF A;  1VQ7 3;  1RGA A;  1SII A;  1IT7 A;  1CYV A;  1IT8 A;  1B2U A;  1MGR A;  3LTA A;  3G16 A;  3NQY A;  5AEU B;  3CCE 3;  4XBY A;  1WTH A;  2H0H A;  2GU3 A;  2HMJ B;  3EN1 B;  1RLS A;  2Y74 A;  4J9A A;  3ROB A;  1M9G A;  4BIR A;  5IG3 A;  1E3V A;  2C4B A;  5D81 A;  1MNL A;  2A15 A;  4N3V A;  5JPU A;  2CWV A;  3CCQ 3;  5M19 A;  1VQO 3;  1UW1 A;  3IPT A;  5I97 A;  1QAF A;  3CPO A;  1JV2 B;  3FLJ A;  1RKY A;  3DGN A;  3B4P A;  1RTU A;  4ILF A;  4LYL B;  1JN5 A;  4R1K A;  3X3Z A;  3OV4 A;  5GSP A;  1FGR A;  4NHF A;  1OPY A;  3BU4 A;  1Z1S A;  7RNT A;  3AGN A;  3LTC A;  3LYG A;  3CC2 3;  1GMQ A;  3SYU A;  1RRH A;  5BXQ A;  1HU9 A;  1M1K 4;  2IUK A;  1BRK A;  2F99 A;  2P09 A;  2CFK A;  2KRT A;  1IV9 A;  1RN1 A;  1DYU A;  1W6G A;  4X2H A;  5D83 A;  3X41 A;  5BIR A;  4G1M B;  4HKV B;  1G02 A;  3NV0 B;  1QMA A;  5CLK A;  4EV5 A;  3K7C A;  1W2B 2;  2UX0 A;  4GL6 A;  4EYC A;  1PU4 A;  1O7H B;  1W5Z A;  4WWU C;  4EV2 A;  1EA2 A;  3X3X A;  1N5P A;  3PCS A;  1RGF A;  1YI2 3;  1IDP A;  5RNT A;  1JKG B;  2WO0 A;  3H51 A;  3JUP A;  3MKI A;  2W56 A;  5IEO A;  2LYX A; 
#chains in the Genus database with same CATH homology
 1NWW A;  3PYJ A;  3KE7 A;  2Y73 A;  3DM8 A;  1KWI A;  3J7Y d;  1OF5 A;  2CIU A;  1O7G B;  1K8A 4;  2PNC A;  3FGY A;  3GZB A;  2CW9 A;  3BNE A;  2MF7 A;  2FGT A;  3T8N A;  1LVN A;  1ZO2 A;  3WOE B;  2BMO B;  1C7H A;  3CU3 A;  2K54 A;  1UI8 A;  1RRL A;  2F86 B;  2OWP A;  1OH0 A;  5EEO A;  2CG0 A;  1V74 A;  3AMO A;  2B24 B;  3OXA A;  1S72 3;  1AVL A;  4AKY A;  2HMO B;  3LTD A;  4KFD A;  2CFG A;  3KSE D;  3UJM A;  2CWU A;  1DVD A;  1TUH A;  1Q81 4;  5JBS A;  1MOL A;  3JUO A;  4HZB B;  4I4K A;  5KP4 A;  2D42 A;  2KXG A;  2W0Q A;  3K9M C;  1YIT 3;  4FR9 A;  2W9Q A;  1OHO A;  4R80 A;  4O8S A;  3WA3 A;  1RJO A;  3PZW A;  2IUJ A;  2P0X A;  2W04 A;  3LML A;  3ALA A;  2BT3 A;  3N8B A;  5AYR B;  3H3H A;  1NJI 4;  4LEH A;  5LC7 A;  3GZX B;  3NBB A;  1UUV B;  1W6C A;  3JUN A;  3OX9 A;  1VQ8 3;  2OQE C;  3GZR A;  1E97 A;  3SX1 A;  2STD A;  2LQV A;  4J8T A;  4O2H A;  2W56 B;  1L5G B;  3NV0 A;  4BTX A;  2W2C A;  3HI7 A;  3SOY A;  1FGM A;  3S28 A;  3IMA B;  3G71 3;  1CEW I;  2V1L A;  3LTB A;  1VQ6 3;  1IVU A;  2GU1 A;  2OCT A;  4FMD A;  4IPB A;  4K61 A;  1A90 A;  1GY7 A;  2GBX B;  2CFW A;  3LH4 A;  1STF I;  4XDW A;  1E3R A;  2OQE A;  3HZP A;  3TDG A;  2GEY A;  3EX9 A;  2B1X B;  2YFI B;  3EE1 A;  4HYZ A;  5IG4 A;  2CWT A;  4XDV A;  5AIG A;  1VZZ A;  2YFJ B;  3Q2P A;  1EG9 B;  3FG4 A;  1ULJ B;  4R9K A;  4RBN A;  4N6U A;  3I0Y A;  1WQL B;  3AMO B;  4IIA A;  1S5A A;  4WFO A;  4MEI A;  3F8H A;  2OTJ 3;  1J2B A;  2Z76 A;  3MSO A;  2E2U A;  3X42 A;  1IQ8 A;  1W2Z A;  3FZW A;  3GRD A;  4XBT A;  3DGM A;  1Q7Y 4;  2CK3 H;  3KSP A;  1SJW A;  3LT9 A;  5LC6 A;  4H61 A;  2BMQ B;  3VF1 A;  2GXF A;  3FF2 A;  3ECF A;  3RGR A;  2CHC A;  1JB5 A;  3WOF B;  1TU5 A;  2QGU A;  1GYB A;  1WMP A;  3CD6 3;  5IEN A;  3CC4 3;  5FGO A;  2XFT A;  2O9U X;  3GAX A;  1YJ9 3;  5CF1 A;  1W00 A;  1IVW A;  1ROA A;  1K9M 4;  1VQN 3;  3Q90 A;  4HM2 B;  3VGN A;  3PGB A;  3CME 3;  5A0O B;  3NXJ A;  2ZDJ A;  3U1W A;  1IV7 A;  1IQY A;  4WYK A;  3SVA A;  1GY5 A;  3DGL A;  1IU7 A;  4WHA A;  2FXT A;  2W6J H;  2GBW B;  2XEP A;  1FGO A;  4R9L A;  3CCV 3;  1U8C B;  3LOY A;  2QEX 3;  1QVF 2;  3F40 A;  4N6L A;  2KCD A;  3NBJ A;  1OAC A;  1TP6 A;  1JRQ A;  4IT7 A;  3G4S 3;  3MHE A;  4OUQ A;  2SBL A;  3EQQ B;  2MC8 A;  2JDI H;  1GD3 A;  3K0Z A;  2FNQ A;  2IMJ A;  5IW9 A;  1QVG 2;  1Y4K A;  4HBR A;  3UL6 A;  4TX4 A;  3KZT A;  1M90 4;  3O8Y A;  2HMM B;  4MMZ B;  1GY6 A;  1SIH A;  1ASK A;  4KFE A;  4PEJ A;  3T0U A;  3B4O A;  3K5T A;  2W9P A;  1FGQ A;  3M8C A;  1W7C A;  2OOV A;  3BNB A;  2WGO A;  2XH9 A;  2E2V A;  3NX0 A;  3F7S A;  1QAL A;  3N9H A;  3V98 A;  3CCJ 3;  4FMC A;  3N54 B;  2GEX A;  3I56 3;  1NU3 A;  4EC6 A;  4HM8 B;  2C10 A;  3MG3 A;  1WMN A;  1D6Y A;  5KP3 A;  3X40 A;  3RGA A;  1IVX A;  1BUQ A;  1QJG A;  2K0M A;  3A76 A;  1VQ4 3;  1YHQ 3;  4WYK B;  3LXU X;  2QIY A;  1O7P B;  1JNQ A;  1W6Y A;  1WNH A;  4HM3 B;  4LSO A;  1Q86 4;  2BMR B;  3T8U A;  1GS3 A;  4WP5 A;  3ER7 A;  2Z7A A;  1N5H A;  5EVH A;  2XFS A;  2INX A;  3V99 A;  1SPU A;  2XR8 B;  3DUK A;  4KZ1 A;  3CCM 3;  1QAK A;  3DY5 A;  2BHM A;  4O3V A;  5ELU A;  1DMM A;  1WMO A;  3HII A;  5D82 A;  4AKZ A;  3EN8 A;  3OW2 2;  2Z6B A;  3DZL A;  3SXX A;  3CMA 3;  3G6E 3;  3MWZ A;  3MYT A;  1W01 A;  4N6M A;  4FCZ A;  2HMK B;  3Q1C A;  3LT8 A;  1HKX A;  3F7X A;  4RNY A;  4KFF A;  3WMD A;  4HJL B;  4X2O A;  2JQ5 A;  4QWT A;  2M7O A;  3UNL A;  3EF8 A;  2CKF B;  3PCR A;  2ML5 A;  4N6V 0;  3WOD G;  5BVB A;  3EBT A;  1N9E A;  1EKM A;  1DMQ A;  3FG1 A;  3D3L A;  1FUW A;  2XGN A;  3MG2 A;  4LGQ A;  1VQM 3;  3FH1 A;  3S27 A;  1YVB I;  2O3O A;  5IG0 A;  2I9W A;  5DRE A;  7STD A;  2W03 A;  5AI1 A;  2XRX B;  2D1W A;  1AR0 A;  3X3Y A;  5IG5 A;  3F9S A;  5EQL A;  2L4V A;  3VSY A;  3E99 A;  5AEW B;  1VQL 3;  1UI7 A;  1N9J A;  1RN7 A;  2XF3 A;  3EC9 A;  4R4K A;  2E2T A;  3UL5 A;  5IF6 A;  2OTL 3;  3PXM A;  3MPH A;  1JJ2 2;  5CXO A;  4HVN A;  2P38 A;  1VQP 3;  2RSX A;  2HML B;  4K1V A;  2P0M A;  2BNG A;  3SOA A;  6STD A;  3CNX A;  1IVV A;  3F8X A;  2F98 A;  3B8L A;  2BO9 B;  3B7C A;  3SLU A;  1R4C A;  1TIJ A;  3JUM A;  4EXR A;  1Q82 4;  4HZ9 B;  4JF8 A;  1DVC A;  3HIG A;  2P05 A;  3QRD A;  1IK3 A;  4HM6 B;  3I55 3;  2ML6 A;  1G96 A;  3CPW 2;  1STD A;  4FCM A;  1CYU A;  3OWU A;  3RDE A;  4RZM A;  1CQS A;  1OGX A;  3CCR 3;  3FF0 A;  1A2K A;  1K73 4;  3CNM A;  3CCL 3;  4LZI A;  3MG1 A;  4H3U A;  1ROV A;  3JVC A;  4EBG A;  4FMB A;  4JRF A;  3BND A;  4L8O A;  1AVK A;  2OOV C;  1NB5 I;  1A2V A;  4STD A;  3IJE B;  1OCV A;  1KSI A;  4BTW A;  1FGT A;  4N6N B;  2Q07 A;  2ZL8 A;  1VQK 3;  3L0R A;  1YJN 3;  3BB9 A;  5IEP A;  2WOF A;  1DMN A;  2WOH A;  4O02 B;  5AII A;  1EQK A;  3DMC A;  5TGN A;  1LXE A;  4MMY B;  2CG1 A;  8CHO A;  3NM7 A;  1D6U A;  3GZY B;  5ELJ A;  4ORL A;  1N8Q A;  3CCU 3;  3CCS 3;  1ULI B;  3U97 A;  2PZV A;  4L8P A;  3S67 A;  4CCV A;  3FKA A;  3WA2 X;  1Q40 A;  4MJD A;  3FSD A;  3KII A;  3EHC A;  5HGR A;  3EJV A;  5CK6 A;  2Z77 A;  3PS8 A;  3GWR A;  5STD A;  1VQ5 3;  3STD A;  3F14 A;  4MMX B;  2C11 A;  5FW5 A;  5JPP A;  1KC8 4;  1NB3 I;  1ISK A;  2RCD A;  1W4N A;  3UB1 A;  1O7N B;  1UUW B;  4OK0 A;  1F8N A;  1US1 A;  1T5Y A;  1K28 A;  1M1X B;  3DXO A;  4CDL A;  3HK4 A;  1KD1 4;  1U5O A;  4K90 B;  5AYS C;  4FMA A;  1JN5 B;  4HM1 B;  3BLZ A;  4XM4 A;  1YJW 3;  3KKG A;  2WGQ A;  4ZM8 A;  1JB4 A;  1TFK A;  1N8R 4;  3NM2 A;  3OWS A;  4N6T A;  3S5C A;  4HM7 B;  2IA7 A;  1JB2 A;  4XB5 A;  4FCJ A;  4HM4 B;  1OHP A;  1IQX A;  1TFO A;  3BNC A;  3S29 A;  4AEQ A;  3KN4 A;  3QK9 A;  3LZA A;  4L7K A;  4BTY A;  3EBY A;  3G8Z A;  5CF2 A;  1A67 A;  2YFL B;  3D9R A;  3EB8 A;  1OUN A;  1YGE A;  1OHS A;  1ZX2 A;  2CFD A;  2R4I A;  2YX9 A;  3K63 A;  1VQ9 3;  2XSH B;  3G0K A;  3HX8 A;  3JUQ A;  4HM5 B;  5DRV A;  3CC7 3;  1O7M B;  3NHX A;  4GB5 A;  2CH9 A;  2CFL A;  2RGQ A;  3FG3 A;  4XBX A;  1OGZ A;  4N6O B;  1K41 A;  1NO3 A;  1W02 A;  2CC3 A;  1Q42 A;  1O7W B;  3FCS B;  1D6Z A;  3NUV A;  4K1U A;  5KP1 A;  1OF5 B;  2RFR A;  4OVM A;  1AV4 A;  3KFQ C;  4Q53 A;  5AIH A;  3CXC 2;  1JKG A;  3V92 A;  3OWY A;  2QA4 3;  1Q40 B;  3WDG B;  1NDO B;  3SED A;  2HMN B;  3NQZ A;  2XSO B;  4NRE A;  2XGL A;  1LOX A;  4RNZ A;  1PFP A;  4HM0 B;  5G2G A;  4LMI A;  5IER A;  4U13 A;  1GD4 A;  1LNH A;  1YIJ 3;  3DGO A;  4KVH A;  3NBR A;  1FA3 A;  1KQS 2;  1SQW A;  5AIF A;  1VQ7 3;  1IT7 A;  1CYV A;  1IT8 A;  1SII A;  3LTA A;  3G16 A;  3NQY A;  5AEU B;  3CCE 3;  4XBY A;  1WTH A;  2HMJ B;  2GU3 A;  3EN1 B;  2Y74 A;  4J9A A;  3ROB A;  1M9G A;  5IG3 A;  1E3V A;  5D81 A;  1MNL A;  2A15 A;  4N3V A;  5JPU A;  2CWV A;  3CCQ 3;  1VQO 3;  1UW1 A;  3IPT A;  5I97 A;  1QAF A;  3CPO A;  1JV2 B;  3FLJ A;  1RKY A;  3DGN A;  3B4P A;  3X3Z A;  1JN5 A;  4R1K A;  3OV4 A;  1FGR A;  4NHF A;  1OPY A;  1Z1S A;  3LTC A;  3LYG A;  3CC2 3;  1RRH A;  5BXQ A;  1HU9 A;  1M1K 4;  2IUK A;  2F99 A;  2P09 A;  2CFK A;  2KRT A;  1IV9 A;  1W6G A;  1DYU A;  4X2H A;  5D83 A;  3X41 A;  4G1M B;  4HKV B;  3NV0 B;  5CLK A;  1QMA A;  4EV5 A;  1W2B 2;  3K7C A;  2UX0 A;  4GL6 A;  4EYC A;  1PU4 A;  1O7H B;  1W5Z A;  4WWU C;  4EV2 A;  1EA2 A;  3X3X A;  1N5P A;  3PCS A;  1YI2 3;  1IDP A;  1JKG B;  2WO0 A;  3H51 A;  3JUP A;  3MKI A;  2W56 A;  5IEO A;  2LYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...