1OF5B

Crystal structure of mex67-mtr2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
165
structure length
128
Chain Sequence
NQAQITATFTKKILAHLDDPDSNLAQFVQLFNPNCRIIFNATPFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA EXPORT FACTOR MEX67
publication title Structural similarity in the absence of sequence homology of the messenger RNA export factors Mtr2 and p15.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear transport
total genus 35
structure length 128
sequence length 165
ec nomenclature
pdb deposition date 2003-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1of5B00
3FKAA 2BNGA 2F98A 3OX9A 1OPYA 1JN5A 3STDA 5IEOA 1IDPA 3NM2A 3LZAA 7STDA 4PEJA 4ORLA 1GY6A 3EC9A 1AR0A 2GEXA 2GBXB 1GY7A 1DMQA 4MJDA 5AIGA 3EX9A 2BMRB 1W01A 3OWUA 3F14A 5KP1A 4WYKA 1JB4A 4R9KA 1O7MB 2B24B 3IPTA 1JB2A 3B8LA 1TUHA 1OH0A 4J8TA 5CF1A 3CPOA 1ZO2A 1OGXA 4J9AA 3EN1B 1QMAA 2F86B 4H3UA 5IEPA 2HMMB 3MG3A 3MYTA 3S5CA 1C7HA 2YFJB 2QIYA 1O7WB 4WYKB 4HM3B 3VGNA 3GZBA 3E99A 1ULJB 5IENA 1VZZA 5G2GA 3FH1A 3KZTA 1E97A 3F7SA 4HVNA 3ECFA 4HM5B 3NHXA 3D9RA 1CQSA 1BUQA 2QGUA 3DXOA 1O7PB 4R9LA 1QJGA 4HM7B 1E3VA 1EG9B 2HMLB 2BMOB 3RGRA 3ER7A 4K1UA 3EF8A 3EN8A 3FF2A 1Z1SA 3CNXA 1A2KA 2UX0A 4FCJA 3WMDA 4XBXA 1UUWB 2XSHB 4X2OA 3A76A 3JUMA 4XB5A 3H3HA 3VSYA 3BLZA 1W00A 3EQQB 1HKXA 1JKGA 1GY5A 5D82A 1K41A 4LGQA 3SOAA 1O7NB 4I4KA 1OGZA 2A15A 2PZVA 3KE7A 3SOYA 3DM8A 1O7GB 3Q90A 2GEYA 1OF5B 4WWUC 1U5OA 3JUOA 3JUNA 4L8OA 2RGQA 3JUQA 3NV0A 5KP4A 3BB9A 1Q40B 5CK6A 4U13A 5JPUA 3FZWA 3T8NA 4XDVA 3B4PA 3B7CA 3OV4A 1JKGB 4X2HA 2I9WA 3GWRA 3MG2A 3UNLA 4Q53A 4LEHA 3T8UA 3RGAA 1S5AA 2GXFA 3G16A 1W6YA 1SJWA 3KSPA 1W02A 5AI1A 4HM4B 1WQLB 3HX8A 2HMNB 4XDWA 3NV0B 4K1VA 4CDLA 1ZX2A 1ULIB 3OWSA 3GZYB 2HMJB 5DRVA 5KP3A 2HMOB 3LYGA 1GYBA 3K0ZA 4FCMA 3SEDA 5D81A 1TP6A 3HK4A 3FF0A 2B1XB 4LMIA 2STDA 1STDA 5STDA 1Q42A 4N3VA 2RFRA 1OF5A 3FSDA 3MKIA 4HKVB 5DREA 5JPPA 4L7KA 3NBRA 3EHCA 2OWPA 1OHSA 2YFIB 8CHOA 6STDA 3NXJA 3G8ZA 3EBYA 3KKGA 3MHEA 4HM0B 1Q40A 4HM8B 4OUQA 4R1KA 3DUKA 2XSOB 3GRDA 2BMQB 2Z7AA 3CNMA 4KVHA 3M8CA 2Z76A 1NWWA 1OCVA 1UUVB 3DMCA 3JUPA 3F40A 4STDA 2HMKB 3F8XA 3F7XA 4RZMA 3FLJA 5IG4A 3H51A 2F99A 4HZBB 3G0KA 4GB5A 4IIAA 3GZRA 2XRXB 2CHCA 2W2CA 1JB5A 1E3RA 1GS3A 5AEUB 5IERA 1OHOA 3OWYA 5CXOA 3OXAA 2INXA 3DZLA 3I0YA 1O7HB 3HZPA 2R4IA 3EBTA 5IG5A 4WP5A 1JN5B 1ISKA 3EJVA 4L8PA 2RCDA 5TGNA 4HM1B 4XBTA 2CKFB 1DMNA 3MSOA 3F9SA 4HM2B 3GZXB 4XM4A 5BXQA 5EVHA 2YFLB 4HJLB 1OHPA 4XBYA 2GBWB 3UJMA 4OVMA 3NUVA 3B4OA 5AIFA 1OUNA 3CU3A 3F8HA 5CF2A 1DMMA 5BVBA 3FGYA 1ASKA 2Z77A 2IMJA 2XR8B 5IG3A 3K7CA 3ROBA 5AIIA 5FW5A 3MG1A 1NU3A 5IG0A 5HGRA 4HZ9B 1NDOB 4HM6B 5AIHA 5D83A 5IF6A 5CLKA 2K54A 1EA2A 5AEWB 2JQ5A
chains in the Genus database with same CATH superfamily
1B20A 2XGNA 2BIRA 3FKAA 2BNGA 2HOHA 2F98A 1RKYA 1DVDA 1QAKA 1TU5A 1EKMA 3AGOA 1B3SA 1W4NA 3NBBA 3WHOA 1GMPA 3OX9A 1GMQA 5LC6A 2QEX3 1OPYA 3NQYA 3D3LA 3CCE3 1JN5A 3STDA 1A90A 5IEOA 2JDIH 3DGNA 3ZFZA 1IDPA 3NM2A 1IVWA 5EEOA 3BNEA 1K8A4 3EB8A 4O8SA 4RNYA 1RLSA 3LZAA 7STDA 4PEJA 4CCVA 2CX0A 1NO3A 4ORLA 3GSPA 1GY6A 3EC9A 1AR0A 3BNBA 2GEXA 3PXMA 5IW9A 2QA43 1RMSA 1UDII 2FXTA 3AGNA 4FMCA 1PYLA 2GBXB 1GY7A 1DMQA 1TFOA 6GSPA 4MJDA 3WR2A 3Q3FA 1NB5I 5AYSC 2W56A 5AIGA 4DKIA 3KIIA 4ILFA 2F5WA 1YVBI 1UUGB 1DE3A 1Q7HA 1BNJA 1X1XA 2BMRB 2K3DA 3EX9A 3RDEA 1W01A 1N9JA 3NM7A 2UUGC 1NB3I 2WO0A 4WHAA 1BUJA 1IYYA 3OWUA 1UGHI 2GU1A 4MMYB 3F14A 5M18A 1FGRA 5KP1A 1AVLA 1JB4A 1FYSA 4WYKA 4R9KA 1O7MB 3BU4A 5BIRA 1FGOA 2B24B 4K90B 3IPTA 1JB2A 2XEPA 3RNTA 1FA3A 4IPBA 1RGGA 3B8LA 1TUHA 1ZS7A 1LNIA 1UI7A 1YJN3 1B2XA 1OH0A 3HIGA 4J8TA 1GD4A 5CF1A 4LSOA 1JBSA 2CIUA 3CPOA 2CFKA 1ZO2A 2OTJ3 1OGXA 2W9PA 1FGTA 4J9AA 2OQEC 2H0GA 4LYLB 1GOYA 1BNFA 1FUSA 3EN1B 1BSCA 3DGLA 1QMAA 1W6CA 2F86B 3QK9A 4KFDA 4H3UA 5IEPA 5FGOA 2HMMB 3MG3A 2L4VA 3MYTA 3S5CA 1M1XB 1C7HA 1BOXA 2YFJB 3SX1A 3UB1A 3CCM3 3MPHA 1KQS2 3OW22 2QIYA 3Q1CA 7GSPA 1BRSA 1I0VA 3I553 1GOUA 2Q07A 3EE1A 1O7WB 3UL5A 4WYKB 3CPW2 4HM3B 1T2HA 2O3OA 2KAAA 4EBGA 3VGNA 3GZBA 4BL3A 3E99A 1W6GA 1ULJB 5IENA 1B27A 1PFPA 1VZZA 5G2GA 1FUTA 1BIRA 3FH1A 3KZTA 1VQM3 1X1UA 2BU4A 1Q7Y4 1K9M4 1BU4A 3SLUA 1E97A 3F7SA 3LH4A 4HVNA 3D4AA 7RNTA 1I3FA 1BNGA 3ECFA 4HM5B 2IUKA 3V98A 1Q824 1JBRA 1SPUA 1CEWI 1DETA 3CCQ3 4BU4A 1IU7A 1Y4KA 1CQSA 3D9RA 3NHXA 5G1LA 3DGOA 3X3YA 1BUQA 1RRLA 2BT3A 2QGUA 1I2FA 3DXOA 3N8BA 1O7PB 4R9LA 2V1LA 1HU9A 1QJGA 4HM7B 1SIHA 2KF5A 2LQVA 1E3VA 1EG9B 1I8VA 2CG0A 5JBSA 1EEJA 1UGIA 2BMOB 2HMLB 1VQ43 1BRIA 1LOYA 3RGRA 2IYJA 1AVKA 3G4S3 3ER7A 1RCKA 1T3BA 4K1UA 3EF8A 4BTWA 1GOVA 1UI8A 1VQ83 3T0UA 3K63A 1RGCA 2ML5A 1I3IA 3EN8A 3FF2A 3L0RA 2W04A 1L5GB 2OTL3 1C54A 2ZL8A 4N6TA 1R4YA 2L1SA 1D6ZA 1MGWA 3FG1A 1B2ZA 1Z1SA 1M904 3LTCA 2CWUA 2XGLA 1STFI 2E2VA 3NBJA 1PY3A 1RCLA 3CNXA 5I97A 1A2KA 4MEIA 2UX0A 1Q9EA 1RN1A 4FCJA 3WMDA 1KD14 3CME3 4XBXA 4HOHA 3ZG0A 4N6MA 1MWTA 1UUWB 4NREA 3CCU3 4CJNA 1VQK3 2XSHB 2ZDJA 1RGKA 2KRTA 1RJOA 4X2OA 3A76A 3JUMA 4XB5A 3H3HA 3VSYA 2E2TA 2IUJA 1RRHA 3BLZA 1QVG2 1W00A 3EQQB 2BHMA 5HOHA 2SARA 3AHSA 3CCS3 1N5HA 1HKXA 1JKGA 1N8R4 2CK3H 1GY5A 5D82A 1K41A 1U8CB 2LYXA 4LGQA 1QALA 3SOAA 1CH0A 1NJI4 1N8QA 3G6E3 1O7NB 4I4KA 1V74A 3FG4A 3X40A 2ZHXB 2CWTA 1GSPA 1T5YA 1OGZA 2A15A 2PZVA 3KE7A 3SOYA 3DM8A 1IV7A 1UCKA 1CYUA 1O7GB 3Q90A 4NPBA 2GEYA 1OF5B 2D1WA 1RDSA 4WWUC 1U5OA 4BL2A 3PYJA 3JUOA 3JUNA 3CCJ3 4L8OA 1QAFA 1LOVA 3S27A 4GL6A 2RGQA 1NNVA 1SARA 3BNCA 1VQ73 1YHQ3 1BRKA 3JUQA 1VQN3 1BSAA 3QRDA 3NV0A 3D5GA 5KP4A 3BB9A 1BSEA 3WDGB 1VQ53 3KFQC 3D5IA 1ROAA 1LXEA 1Q40B 3VF1A 2F56A 1KWIA 2WOFA 5CK6A 2Y73A 1F8NA 4U13A 5JPUA 3FZWA 3FCSB 4FR9A 3T8NA 1RNBA 1YGWA 2F4YA 4XDVA 3B4PA 1RGHA 3B7CA 2YX9A 1BSDA 3OV4A 1WTHA 3O8YA 1JKGB 3LT9A 4X2HA 1N5PA 1BRHA 2CFLA 3DGYA 3CXC2 4KFFA 1JBTA 3SXXA 1D6YA 2RBIA 2I9WA 4FMDA 1HZ1A 1TRPA 1YIT3 3LTAA 1US1A 3GWRA 2R41A 3MG2A 2OQEA 1YJW3 2BO9B 2XH9A 3UNLA 4Q53A 4I5QA 4LEHA 1V57A 2OOVC 3T8UA 4HYZA 3AHWA 1MGRA 2C10A 2CFWA 3V99A 1G96A 3RGAA 8RNTA 1JZDA 1MNLA 2K0MA 3PCRA 1S5AA 4BTYA 2GXFA 2H0IA 3G16A 1BNSA 1W6YA 4N6NB 1SJWA 3KSPA 4IT7A 1UCIA 1W02A 4AKYA 5AI1A 4ZM8A 4HM4B 3MWZA 1WQLB 3HX8A 2HMNB 5BU4A 2CWVA 4XDWA 5LC7A 5ELJA 3DY5A 3NV0B 4K1VA 4CDLA 3CCV3 1JJ22 4HAAA 1GMRA 1ZX2A 4LZIA 6RNTA 1ULIB 2Y74A 4N6OB 4N6LA 1N9EA 3TDGA 1FW7A 2RSXA 3OWSA 4FMAA 2W0QA 3S67A 5M19A 1RNTA 2WGOA 3GZYB 2HMJB 3KN4A 1G0TA 1W7CA 5DRVA 9RNTA 5KP3A 2J8XB 1IQXA 3IMAB 2HMOB 3LYGA 1B21A 1GYBA 3HI7A 3K0ZA 4FCMA 3SEDA 2AADA 5D81A 3WOEB 1TP6A 1OACA 3PS8A 1FGQA 2WOHA 3HK4A 2MC8A 3WA3A 5GSPA 3FF0A 2B1XB 4LMIA 2O9UX 1A67A 1W2B2 1MWSA 1HYFA 2P05A 3CD63 1RN7A 1BVIA 2STDA 1SIIA 1STDA 5STDA 1B2MA 3NX0A 1Q42A 1X1YA 2CH9A 2RFRA 1JZOA 4N3VA 3X3ZA 1OF5A 3FSDA 3MKIA 4HKVB 5DREA 5JPPA 1UW1A 4N6V0 4L7KA 3BNDA 3NBRA 3EHCA 2OWPA 1VQ93 3CC73 1OHSA 4QWTA 2YFIB 8CHOA 1R4CA 4J5GA 2P38A 3NXJA 1RHLA 3G8ZA 3AMOB 1IQ8A 3EBYA 4N6UA 6STDA 3DGMA 3KKGA 3MHEA 1ZGXA 3HOHA 4HM0B 3FG3A 4GHOA 1K734 3KCHA 3N9HA 1LOWA 1Q40A 2IA7A 1I2EA 1YGEA 3HIIA 4HM8B 1VQO3 4OUQA 1BRGA 4R1KA 3DUKA 2XSOB 3LXUX 3PGBA 3GRDA 2XFSA 4AEQA 2XF3A 2PNCA 4JRFA 1BNRA 2BMQB 2Z7AA 3CNMA 3DH2A 4KVHA 4O02B 1J2BA 3ALAA 3M8CA 3CC43 1T2IA 2MF7A 2Z76A 4K61A 4J5KA 4R80A 1NWWA 1FUWA 1OCVA 4EXRA 1UUVB 3DMCA 1VQP3 1Q814 1EQKA 1FGMA 3F40A 3JUPA 1M9GA 4CPKA 2AAEA 1YIJ3 4FMBA 5AYRB 2CW9A 2C11A 4STDA 1RGFA 1KSIA 2HMKB 1B2SA 3F8XA 2SBLA 4RNTA 1JV2B 2WGQA 3F7XA 3LT8A 4RZMA 2IY2A 4RBNA 1K28A 1RGAA 1MWRA 2OCTA 3FLJA 5IG4A 3LTBA 1LNHA 1S723 1X1WA 1WNHA 4JF8A 3H51A 2F99A 3K5TA 2KXGA 2CX1A 4HZBB 1SQWA 3G0KA 1IVUA 4GB5A 3KSED 4IIAA 2P0MA 1YVSA 1IT7A 3GZRA 1EUIC 1RTUA 1BSBA 2XRXB 3X42A 2KF4A 4AKZA 2CHCA 1B2UA 3Q2PA 2CC3A 1JB5A 1E3RA 2KCDA 2W2CA 3WOFB 5G1KA 1GS3A 5AEUB 5IERA 1OHOA 1I0XA 3OWYA 3V92A 4RNZA 5CXOA 2KF6A 2INXA 3DZLA 3OXAA 4KFEA 2E2UA 3I0YA 1O7HB 1YJ93 1IQYA 3HZPA 1KC84 3IJEB 2R4IA 1TJDA 2GSPA 1LQGC 2Z6BA 3EBTA 4WP5A 5IG5A 5RNTA 4G1MB 3UL6A 1YNVX 3URPA 1IT8A 1PU4A 3CMA3 1D6UA 4O2HA 1JN5B 1TIJA 4EW5A 2XFTA 2W03A 1ISKA 3EJVA 3ZG5A 1FZUA 1UCJA 3K9MC 4L8PA 4O3VA 4EC6A 3A5EA 2RCDA 5A0OB 5EQLA 4KZ1A 1RN4A 4TX4A 1RGEA 3JVCA 4EV5A 5TGNA 3S28A 5ELUA 4HM1B 1LQMB 3S29A 4XBTA 1BRNL 2OOVA 2CKFB 1DMNA 1DYUA 1JNQA 1AV4A 3AMOA 2W56B 3MSOA 1IK3A 3F9SA 4HM2B 3LMLA 3WODG 1V58A 3PCSA 3U97A 1IVXA 1AY7A 2CFGA 4FCZA 4BIRA 3GZXB 4XM4A 5BXQA 3LTDA 5EVHA 1IVVA 1W2ZA 2YFLB 4HJLB 4NHFA 1OHPA 3WA2X 1BNIA 1RSNA 2C4BA 1BANA 1MOLA 2GBWB 4XBYA 3G713 1M1K4 1A2PA 3UJMA 4OVMA 2H0HA 1RGLA 1TFKA 3NUVA 3B4OA 5AIFA 4BTXA 1OUNA 3CU3A 1Q864 1TRQA 2F5MA 1I70A 1BAOA 1JRQA 1WMOA 3CCL3 1DVCA 3F8HA 2GU3A 1G02A 5CF2A 4EV2A 4H61A 4R4KA 1CYVA 3GAXA 2ZA4A 4HBRA 2ML6A 2P09A 1A2VA 1DMMA 1W5ZA 1I2GA 5BVBA 3FGYA 1ASKA 2Z77A 2D42A 1TTOA 2IMJA 2XR8B 3BIRA 1GD3A 2FGTA 2FNQA 5IG3A 1YI23 2CFDA 1LRAA 1IV9A 2KF3A 3K7CA 2UGIA 4OK0A 3ROBA 4GSPA 4EYCA 1BGSA 5AIIA 4WFOA 3J7Yd 1LVNA 1AQZA 3CCR3 1WMPA 1VQQA 5FW5A 2P0XA 3MG1A 1WMNA 1NU3A 4KT3B 3X3XA 3PZWA 5M1AA 5IG0A 1BNEA 3LOYA 1UCLA 3SVAA 4MMXB 5HGRA 4HZ9B 1QVF2 3U1WA 2CG1A 1NDOB 2W9QA 3N54B 1VQ63 4HM6B 1BRJA 5AIHA 5D83A 3SYUA 2RNTA 5IF6A 5CLKA 1MWUA 3NQZA 2K54A 1ROVA 3D79A 4MMZB 1EA2A 3I563 1VQL3 2M7OA 3X41A 5AEWB 1LOXA 2W6JH 3CC23 2JQ5A
chains in the Genus database with same CATH topology
2XGNA 3FKAA 2BNGA 2F98A 1RKYA 1DVDA 1QAKA 1TU5A 1EKMA 1W4NA 3NBBA 3OX9A 5LC6A 2QEX3 1OPYA 3NQYA 3D3LA 3CCE3 1JN5A 3STDA 1A90A 5IEOA 2JDIH 3DGNA 1IDPA 3NM2A 1IVWA 5EEOA 3BNEA 1K8A4 3EB8A 4O8SA 4RNYA 3LZAA 7STDA 4PEJA 4CCVA 1NO3A 4ORLA 1GY6A 3EC9A 1AR0A 3BNBA 2GEXA 3PXMA 5IW9A 2QA43 2FXTA 4FMCA 2GBXB 1GY7A 1DMQA 1TFOA 4MJDA 1NB5I 5AYSC 2W56A 5AIGA 3KIIA 1YVBI 3EX9A 2BMRB 3RDEA 1W01A 1N9JA 3NM7A 1NB3I 2WO0A 4WHAA 3OWUA 4MMYB 2GU1A 3F14A 1FGRA 5KP1A 1AVLA 1JB4A 4WYKA 4R9KA 1O7MB 1FGOA 2B24B 4K90B 3IPTA 1JB2A 2XEPA 1FA3A 4IPBA 3B8LA 1TUHA 1UI7A 1YJN3 1OH0A 3HIGA 4J8TA 1GD4A 5CF1A 4LSOA 2CIUA 3CPOA 2CFKA 1ZO2A 2OTJ3 1OGXA 2W9PA 1FGTA 4J9AA 2OQEC 3EN1B 3DGLA 1QMAA 1W6CA 2F86B 3QK9A 4KFDA 4H3UA 5IEPA 5FGOA 2HMMB 3MG3A 2L4VA 3MYTA 3S5CA 1M1XB 1C7HA 2YFJB 3CCM3 3SX1A 3UB1A 3MPHA 1KQS2 3OW22 2QIYA 3Q1CA 3I553 2Q07A 3EE1A 1O7WB 3UL5A 4WYKB 3CPW2 4HM3B 2O3OA 4EBGA 3VGNA 3GZBA 3E99A 1W6GA 1ULJB 5IENA 1PFPA 1VZZA 5G2GA 3FH1A 3KZTA 1Q7Y4 1VQM3 1K9M4 3SLUA 1E97A 3F7SA 3LH4A 4HVNA 3ECFA 4HM5B 2IUKA 3V98A 1Q824 1SPUA 1CEWI 3CCQ3 1IU7A 1Y4KA 1CQSA 3D9RA 3NHXA 3X3YA 3DGOA 1BUQA 1RRLA 2BT3A 2QGUA 3DXOA 3N8BA 1O7PB 4R9LA 2V1LA 1HU9A 1QJGA 4HM7B 1SIHA 2LQVA 1E3VA 1EG9B 2CG0A 5JBSA 2HMLB 2BMOB 1VQ43 3RGRA 1AVKA 3G4S3 3ER7A 4K1UA 3EF8A 4BTWA 1VQ83 1UI8A 3T0UA 3K63A 2ML5A 1L5GB 3EN8A 3FF2A 3L0RA 2W04A 2OTL3 2ZL8A 4N6TA 1D6ZA 3FG1A 1Z1SA 1M904 3LTCA 2CWUA 2XGLA 1STFI 2E2VA 3NBJA 3CNXA 5I97A 1A2KA 4MEIA 2UX0A 1KD14 4FCJA 3WMDA 3CME3 4XBXA 4N6MA 1UUWB 4NREA 3CCU3 1VQK3 2XSHB 2ZDJA 2KRTA 1RJOA 4X2OA 3A76A 3JUMA 4XB5A 3H3HA 3VSYA 2E2TA 2IUJA 1RRHA 3BLZA 1QVG2 1W00A 3EQQB 2BHMA 3CCS3 1N5HA 1HKXA 1JKGA 1N8R4 2CK3H 1GY5A 5D82A 1K41A 1U8CB 2LYXA 4LGQA 1QALA 3SOAA 1NJI4 1N8QA 3G6E3 1O7NB 4I4KA 1V74A 3FG4A 3X40A 2CWTA 1T5YA 1OGZA 2A15A 2PZVA 3KE7A 3SOYA 3DM8A 1IV7A 1CYUA 1O7GB 3Q90A 2GEYA 1OF5B 2D1WA 4WWUC 1U5OA 3PYJA 3JUOA 3JUNA 3CCJ3 4L8OA 1QAFA 3S27A 4GL6A 2RGQA 3BNCA 1VQ73 1YHQ3 3JUQA 1VQN3 3QRDA 3NV0A 5KP4A 3BB9A 3WDGB 1VQ53 3KFQC 1ROAA 1LXEA 1Q40B 3VF1A 2WOFA 1KWIA 5CK6A 2Y73A 1F8NA 4U13A 5JPUA 3FZWA 3FCSB 4FR9A 3T8NA 4XDVA 3B4PA 3B7CA 2YX9A 3OV4A 1WTHA 3O8YA 1JKGB 3LT9A 4X2HA 1N5PA 3CXC2 2CFLA 4KFFA 3SXXA 1D6YA 4FMDA 2I9WA 1YIT3 3LTAA 1US1A 3GWRA 3MG2A 2OQEA 1YJW3 2BO9B 2XH9A 3UNLA 4Q53A 4LEHA 2OOVC 3T8UA 4HYZA 2C10A 2CFWA 3V99A 1G96A 3RGAA 1MNLA 2K0MA 3PCRA 1S5AA 4BTYA 2GXFA 3G16A 4N6NB 1W6YA 1SJWA 3KSPA 4IT7A 1W02A 4AKYA 5AI1A 4ZM8A 4HM4B 3MWZA 1WQLB 3HX8A 2HMNB 2CWVA 4XDWA 5LC7A 5ELJA 3DY5A 3NV0B 4K1VA 4CDLA 3CCV3 1JJ22 1ZX2A 4LZIA 1ULIB 2Y74A 4N6OB 4N6LA 1N9EA 3TDGA 2RSXA 3OWSA 4FMAA 2W0QA 3S67A 2WGOA 3GZYB 2HMJB 3KN4A 5DRVA 1W7CA 5KP3A 1IQXA 3IMAB 2HMOB 3LYGA 1GYBA 3K0ZA 3HI7A 4FCMA 3SEDA 5D81A 3WOEB 1TP6A 1OACA 3PS8A 1FGQA 2WOHA 3HK4A 2MC8A 3WA3A 3FF0A 2B1XB 4LMIA 2O9UX 1A67A 1W2B2 3CD63 2P05A 1RN7A 2STDA 1SIIA 1STDA 5STDA 3NX0A 1Q42A 2CH9A 4N3VA 2RFRA 3X3ZA 1OF5A 3FSDA 3MKIA 4HKVB 5DREA 5JPPA 1UW1A 4N6V0 4L7KA 3BNDA 3NBRA 3EHCA 2OWPA 1VQ93 3CC73 1OHSA 4QWTA 2YFIB 8CHOA 1R4CA 2P38A 3NXJA 3G8ZA 6STDA 3AMOB 1IQ8A 3EBYA 4N6UA 3DGMA 3KKGA 3MHEA 4HM0B 3FG3A 1K734 3N9HA 1Q40A 2IA7A 1YGEA 3HIIA 4HM8B 1VQO3 4OUQA 4R1KA 3DUKA 2XSOB 3LXUX 3PGBA 3GRDA 2XFSA 4AEQA 2XF3A 2PNCA 4JRFA 2BMQB 2Z7AA 3CNMA 4KVHA 4O02B 1J2BA 3ALAA 3M8CA 3CC43 2MF7A 2Z76A 4K61A 4R80A 1NWWA 1FUWA 1OCVA 4EXRA 1UUVB 3DMCA 1VQP3 1Q814 1FGMA 3F40A 3JUPA 1M9GA 1YIJ3 4FMBA 5AYRB 2CW9A 2C11A 4STDA 1KSIA 2HMKB 3F8XA 2SBLA 1JV2B 2WGQA 3F7XA 3LT8A 4RZMA 4RBNA 1K28A 2OCTA 3FLJA 5IG4A 3LTBA 1LNHA 1S723 1WNHA 4JF8A 3H51A 2F99A 3K5TA 2KXGA 4HZBB 1SQWA 3G0KA 1IVUA 4GB5A 3KSED 4IIAA 2P0MA 3X42A 1IT7A 3GZRA 2XRXB 4AKZA 2CHCA 3Q2PA 2CC3A 1JB5A 1E3RA 2KCDA 2W2CA 3WOFB 1GS3A 5AEUB 5IERA 1OHOA 3OWYA 3V92A 4RNZA 5CXOA 3OXAA 2INXA 3DZLA 4KFEA 2E2UA 3I0YA 1O7HB 1YJ93 1IQYA 3HZPA 1KC84 3IJEB 2R4IA 2Z6BA 3EBTA 5IG5A 4WP5A 4G1MB 3UL6A 1PU4A 3CMA3 1IT8A 1D6UA 4O2HA 1JN5B 1TIJA 2XFTA 2W03A 1ISKA 3EJVA 3K9MC 4L8PA 4O3VA 4EC6A 2RCDA 5A0OB 5EQLA 4KZ1A 4TX4A 3JVCA 4EV5A 5TGNA 3S28A 5ELUA 4HM1B 3S29A 4XBTA 2OOVA 2CKFB 1DMNA 1DYUA 1JNQA 1AV4A 3AMOA 2W56B 3MSOA 1IK3A 3F9SA 4HM2B 3LMLA 3WODG 3PCSA 3U97A 1IVXA 1EQKA 2CFGA 4FCZA 3GZXB 4XM4A 5BXQA 3LTDA 5EVHA 1IVVA 1W2ZA 2YFLB 4HJLB 4NHFA 1OHPA 3WA2X 4XBYA 1MOLA 2GBWB 3G713 1M1K4 3UJMA 4OVMA 1TFKA 3NUVA 3B4OA 5AIFA 4BTXA 1OUNA 3CU3A 1Q864 1JRQA 1WMOA 3CCL3 1DVCA 3F8HA 2GU3A 5CF2A 4EV2A 4H61A 4R4KA 1CYVA 3GAXA 4HBRA 2ML6A 2P09A 1A2VA 1DMMA 1W5ZA 5BVBA 3FGYA 1ASKA 2Z77A 2D42A 2IMJA 2XR8B 5IG3A 1GD3A 2FGTA 2FNQA 1YI23 2CFDA 1IV9A 3K7CA 4OK0A 3ROBA 4EYCA 5AIIA 4WFOA 3J7Yd 1LVNA 3CCR3 1WMPA 5FW5A 2P0XA 3MG1A 1WMNA 1NU3A 3X3XA 3PZWA 5IG0A 3SVAA 3LOYA 4MMXB 5HGRA 4HZ9B 1QVF2 3U1WA 2CG1A 1NDOB 2W9QA 3N54B 1VQ63 4HM6B 5AIHA 5D83A 5IF6A 5CLKA 3NQZA 2K54A 1ROVA 4MMZB 1EA2A 3I563 1VQL3 2M7OA 3X41A 5AEWB 1LOXA 2W6JH 3CC23 2JQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKA A;  2BNG A;  2F98 A;  3OX9 A;  1OPY A;  1JN5 A;  3STD A;  5IEO A;  1IDP A;  3NM2 A;  3LZA A;  7STD A;  4PEJ A;  4ORL A;  1GY6 A;  3EC9 A;  1AR0 A;  2GEX A;  2GBX B;  1GY7 A;  1DMQ A;  4MJD A;  5AIG A;  3EX9 A;  2BMR B;  1W01 A;  3OWU A;  3F14 A;  5KP1 A;  4WYK A;  1JB4 A;  4R9K A;  1O7M B;  2B24 B;  3IPT A;  1JB2 A;  3B8L A;  1TUH A;  1OH0 A;  4J8T A;  5CF1 A;  3CPO A;  1ZO2 A;  1OGX A;  4J9A A;  3EN1 B;  1QMA A;  2F86 B;  4H3U A;  5IEP A;  2HMM B;  3MG3 A;  3MYT A;  3S5C A;  1C7H A;  2YFJ B;  2QIY A;  1O7W B;  4WYK B;  4HM3 B;  3VGN A;  3GZB A;  3E99 A;  1ULJ B;  5IEN A;  1VZZ A;  5G2G A;  3FH1 A;  3KZT A;  1E97 A;  3F7S A;  4HVN A;  3ECF A;  4HM5 B;  3NHX A;  3D9R A;  1CQS A;  1BUQ A;  2QGU A;  3DXO A;  1O7P B;  4R9L A;  1QJG A;  4HM7 B;  1E3V A;  1EG9 B;  2HML B;  2BMO B;  3RGR A;  3ER7 A;  4K1U A;  3EF8 A;  3EN8 A;  3FF2 A;  1Z1S A;  3CNX A;  1A2K A;  2UX0 A;  4FCJ A;  3WMD A;  4XBX A;  1UUW B;  2XSH B;  4X2O A;  3A76 A;  3JUM A;  4XB5 A;  3H3H A;  3VSY A;  3BLZ A;  1W00 A;  3EQQ B;  1HKX A;  1JKG A;  1GY5 A;  5D82 A;  1K41 A;  4LGQ A;  3SOA A;  1O7N B;  4I4K A;  1OGZ A;  2A15 A;  2PZV A;  3KE7 A;  3SOY A;  3DM8 A;  1O7G B;  3Q90 A;  2GEY A;  1OF5 B;  4WWU C;  1U5O A;  3JUO A;  3JUN A;  4L8O A;  2RGQ A;  3JUQ A;  3NV0 A;  5KP4 A;  3BB9 A;  1Q40 B;  5CK6 A;  4U13 A;  5JPU A;  3FZW A;  3T8N A;  4XDV A;  3B4P A;  3B7C A;  3OV4 A;  1JKG B;  4X2H A;  2I9W A;  3GWR A;  3MG2 A;  3UNL A;  4Q53 A;  4LEH A;  3T8U A;  3RGA A;  1S5A A;  2GXF A;  3G16 A;  1W6Y A;  1SJW A;  3KSP A;  1W02 A;  5AI1 A;  4HM4 B;  1WQL B;  3HX8 A;  2HMN B;  4XDW A;  3NV0 B;  4K1V A;  4CDL A;  1ZX2 A;  1ULI B;  3OWS A;  3GZY B;  2HMJ B;  5DRV A;  5KP3 A;  2HMO B;  3LYG A;  1GYB A;  3K0Z A;  4FCM A;  3SED A;  5D81 A;  1TP6 A;  3HK4 A;  3FF0 A;  2B1X B;  4LMI A;  2STD A;  1STD A;  5STD A;  1Q42 A;  4N3V A;  2RFR A;  1OF5 A;  3FSD A;  3MKI A;  4HKV B;  5DRE A;  5JPP A;  4L7K A;  3NBR A;  3EHC A;  2OWP A;  1OHS A;  2YFI B;  8CHO A;  6STD A;  3NXJ A;  3G8Z A;  3EBY A;  3KKG A;  3MHE A;  4HM0 B;  1Q40 A;  4HM8 B;  4OUQ A;  4R1K A;  3DUK A;  2XSO B;  3GRD A;  2BMQ B;  2Z7A A;  3CNM A;  4KVH A;  3M8C A;  2Z76 A;  1NWW A;  1OCV A;  1UUV B;  3DMC A;  3JUP A;  3F40 A;  4STD A;  2HMK B;  3F8X A;  3F7X A;  4RZM A;  3FLJ A;  5IG4 A;  3H51 A;  2F99 A;  4HZB B;  3G0K A;  4GB5 A;  4IIA A;  3GZR A;  2XRX B;  2CHC A;  2W2C A;  1JB5 A;  1E3R A;  1GS3 A;  5AEU B;  5IER A;  1OHO A;  3OWY A;  5CXO A;  3OXA A;  2INX A;  3DZL A;  3I0Y A;  1O7H B;  3HZP A;  2R4I A;  3EBT A;  5IG5 A;  4WP5 A;  1JN5 B;  1ISK A;  3EJV A;  4L8P A;  2RCD A;  5TGN A;  4HM1 B;  4XBT A;  2CKF B;  1DMN A;  3MSO A;  3F9S A;  4HM2 B;  3GZX B;  4XM4 A;  5BXQ A;  5EVH A;  2YFL B;  4HJL B;  1OHP A;  4XBY A;  2GBW B;  3UJM A;  4OVM A;  3NUV A;  3B4O A;  5AIF A;  1OUN A;  3CU3 A;  3F8H A;  5CF2 A;  1DMM A;  5BVB A;  3FGY A;  1ASK A;  2Z77 A;  2IMJ A;  2XR8 B;  5IG3 A;  3K7C A;  3ROB A;  5AII A;  5FW5 A;  3MG1 A;  1NU3 A;  5IG0 A;  5HGR A;  4HZ9 B;  1NDO B;  4HM6 B;  5AIH A;  5D83 A;  5IF6 A;  5CLK A;  2K54 A;  1EA2 A;  5AEW B;  2JQ5 A; 
#chains in the Genus database with same CATH topology
 1B20 A;  2XGN A;  2BIR A;  3FKA A;  2BNG A;  2HOH A;  2F98 A;  1RKY A;  1DVD A;  1QAK A;  1TU5 A;  1EKM A;  3AGO A;  1B3S A;  1W4N A;  3NBB A;  3WHO A;  1GMP A;  3OX9 A;  1GMQ A;  5LC6 A;  2QEX 3;  1OPY A;  3NQY A;  3D3L A;  3CCE 3;  1JN5 A;  3STD A;  1A90 A;  5IEO A;  2JDI H;  3DGN A;  3ZFZ A;  1IDP A;  3NM2 A;  1IVW A;  5EEO A;  3BNE A;  1K8A 4;  3EB8 A;  4O8S A;  4RNY A;  1RLS A;  3LZA A;  7STD A;  4PEJ A;  4CCV A;  2CX0 A;  1NO3 A;  4ORL A;  3GSP A;  1GY6 A;  3EC9 A;  1AR0 A;  3BNB A;  2GEX A;  3PXM A;  5IW9 A;  2QA4 3;  1RMS A;  1UDI I;  2FXT A;  3AGN A;  4FMC A;  1PYL A;  2GBX B;  1GY7 A;  1DMQ A;  1TFO A;  6GSP A;  4MJD A;  3WR2 A;  3Q3F A;  1NB5 I;  5AYS C;  2W56 A;  5AIG A;  4DKI A;  3KII A;  4ILF A;  2F5W A;  1YVB I;  1UUG B;  1DE3 A;  1Q7H A;  1BNJ A;  1X1X A;  2BMR B;  2K3D A;  3EX9 A;  3RDE A;  1W01 A;  1N9J A;  3NM7 A;  2UUG C;  1NB3 I;  2WO0 A;  4WHA A;  1BUJ A;  1IYY A;  3OWU A;  1UGH I;  2GU1 A;  4MMY B;  3F14 A;  5M18 A;  1FGR A;  5KP1 A;  1AVL A;  1JB4 A;  1FYS A;  4WYK A;  4R9K A;  1O7M B;  3BU4 A;  5BIR A;  1FGO A;  2B24 B;  4K90 B;  3IPT A;  1JB2 A;  2XEP A;  3RNT A;  1FA3 A;  4IPB A;  1RGG A;  3B8L A;  1TUH A;  1ZS7 A;  1LNI A;  1UI7 A;  1YJN 3;  1B2X A;  1OH0 A;  3HIG A;  4J8T A;  1GD4 A;  5CF1 A;  4LSO A;  1JBS A;  2CIU A;  3CPO A;  2CFK A;  1ZO2 A;  2OTJ 3;  1OGX A;  2W9P A;  1FGT A;  4J9A A;  2OQE C;  2H0G A;  4LYL B;  1GOY A;  1BNF A;  1FUS A;  3EN1 B;  1BSC A;  3DGL A;  1QMA A;  1W6C A;  2F86 B;  3QK9 A;  4KFD A;  4H3U A;  5IEP A;  5FGO A;  2HMM B;  3MG3 A;  2L4V A;  3MYT A;  3S5C A;  1M1X B;  1C7H A;  1BOX A;  2YFJ B;  3SX1 A;  3UB1 A;  3CCM 3;  3MPH A;  1KQS 2;  3OW2 2;  2QIY A;  3Q1C A;  7GSP A;  1BRS A;  1I0V A;  3I55 3;  1GOU A;  2Q07 A;  3EE1 A;  1O7W B;  3UL5 A;  4WYK B;  3CPW 2;  4HM3 B;  1T2H A;  2O3O A;  2KAA A;  4EBG A;  3VGN A;  3GZB A;  4BL3 A;  3E99 A;  1W6G A;  1ULJ B;  5IEN A;  1B27 A;  1PFP A;  1VZZ A;  5G2G A;  1FUT A;  1BIR A;  3FH1 A;  3KZT A;  1VQM 3;  1X1U A;  2BU4 A;  1Q7Y 4;  1K9M 4;  1BU4 A;  3SLU A;  1E97 A;  3F7S A;  3LH4 A;  4HVN A;  3D4A A;  7RNT A;  1I3F A;  1BNG A;  3ECF A;  4HM5 B;  2IUK A;  3V98 A;  1Q82 4;  1JBR A;  1SPU A;  1CEW I;  1DET A;  3CCQ 3;  4BU4 A;  1IU7 A;  1Y4K A;  1CQS A;  3D9R A;  3NHX A;  5G1L A;  3DGO A;  3X3Y A;  1BUQ A;  1RRL A;  2BT3 A;  2QGU A;  1I2F A;  3DXO A;  3N8B A;  1O7P B;  4R9L A;  2V1L A;  1HU9 A;  1QJG A;  4HM7 B;  1SIH A;  2KF5 A;  2LQV A;  1E3V A;  1EG9 B;  1I8V A;  2CG0 A;  5JBS A;  1EEJ A;  1UGI A;  2BMO B;  2HML B;  1VQ4 3;  1BRI A;  1LOY A;  3RGR A;  2IYJ A;  1AVK A;  3G4S 3;  3ER7 A;  1RCK A;  1T3B A;  4K1U A;  3EF8 A;  4BTW A;  1GOV A;  1UI8 A;  1VQ8 3;  3T0U A;  3K63 A;  1RGC A;  2ML5 A;  1I3I A;  3EN8 A;  3FF2 A;  3L0R A;  2W04 A;  1L5G B;  2OTL 3;  1C54 A;  2ZL8 A;  4N6T A;  1R4Y A;  2L1S A;  1D6Z A;  1MGW A;  3FG1 A;  1B2Z A;  1Z1S A;  1M90 4;  3LTC A;  2CWU A;  2XGL A;  1STF I;  2E2V A;  3NBJ A;  1PY3 A;  1RCL A;  3CNX A;  5I97 A;  1A2K A;  4MEI A;  2UX0 A;  1Q9E A;  1RN1 A;  4FCJ A;  3WMD A;  1KD1 4;  3CME 3;  4XBX A;  4HOH A;  3ZG0 A;  4N6M A;  1MWT A;  1UUW B;  4NRE A;  3CCU 3;  4CJN A;  1VQK 3;  2XSH B;  2ZDJ A;  1RGK A;  2KRT A;  1RJO A;  4X2O A;  3A76 A;  3JUM A;  4XB5 A;  3H3H A;  3VSY A;  2E2T A;  2IUJ A;  1RRH A;  3BLZ A;  1QVG 2;  1W00 A;  3EQQ B;  2BHM A;  5HOH A;  2SAR A;  3AHS A;  3CCS 3;  1N5H A;  1HKX A;  1JKG A;  1N8R 4;  2CK3 H;  1GY5 A;  5D82 A;  1K41 A;  1U8C B;  2LYX A;  4LGQ A;  1QAL A;  3SOA A;  1CH0 A;  1NJI 4;  1N8Q A;  3G6E 3;  1O7N B;  4I4K A;  1V74 A;  3FG4 A;  3X40 A;  2ZHX B;  2CWT A;  1GSP A;  1T5Y A;  1OGZ A;  2A15 A;  2PZV A;  3KE7 A;  3SOY A;  3DM8 A;  1IV7 A;  1UCK A;  1CYU A;  1O7G B;  3Q90 A;  4NPB A;  2GEY A;  1OF5 B;  2D1W A;  1RDS A;  4WWU C;  1U5O A;  4BL2 A;  3PYJ A;  3JUO A;  3JUN A;  3CCJ 3;  4L8O A;  1QAF A;  1LOV A;  3S27 A;  4GL6 A;  2RGQ A;  1NNV A;  1SAR A;  3BNC A;  1VQ7 3;  1YHQ 3;  1BRK A;  3JUQ A;  1VQN 3;  1BSA A;  3QRD A;  3NV0 A;  3D5G A;  5KP4 A;  3BB9 A;  1BSE A;  3WDG B;  1VQ5 3;  3KFQ C;  3D5I A;  1ROA A;  1LXE A;  1Q40 B;  3VF1 A;  2F56 A;  1KWI A;  2WOF A;  5CK6 A;  2Y73 A;  1F8N A;  4U13 A;  5JPU A;  3FZW A;  3FCS B;  4FR9 A;  3T8N A;  1RNB A;  1YGW A;  2F4Y A;  4XDV A;  3B4P A;  1RGH A;  3B7C A;  2YX9 A;  1BSD A;  3OV4 A;  1WTH A;  3O8Y A;  1JKG B;  3LT9 A;  4X2H A;  1N5P A;  1BRH A;  2CFL A;  3DGY A;  3CXC 2;  4KFF A;  1JBT A;  3SXX A;  1D6Y A;  2RBI A;  2I9W A;  4FMD A;  1HZ1 A;  1TRP A;  1YIT 3;  3LTA A;  1US1 A;  3GWR A;  2R41 A;  3MG2 A;  2OQE A;  1YJW 3;  2BO9 B;  2XH9 A;  3UNL A;  4Q53 A;  4I5Q A;  4LEH A;  1V57 A;  2OOV C;  3T8U A;  4HYZ A;  3AHW A;  1MGR A;  2C10 A;  2CFW A;  3V99 A;  1G96 A;  3RGA A;  8RNT A;  1JZD A;  1MNL A;  2K0M A;  3PCR A;  1S5A A;  4BTY A;  2GXF A;  2H0I A;  3G16 A;  1BNS A;  1W6Y A;  4N6N B;  1SJW A;  3KSP A;  4IT7 A;  1UCI A;  1W02 A;  4AKY A;  5AI1 A;  4ZM8 A;  4HM4 B;  3MWZ A;  1WQL B;  3HX8 A;  2HMN B;  5BU4 A;  2CWV A;  4XDW A;  5LC7 A;  5ELJ A;  3DY5 A;  3NV0 B;  4K1V A;  4CDL A;  3CCV 3;  1JJ2 2;  4HAA A;  1GMR A;  1ZX2 A;  4LZI A;  6RNT A;  1ULI B;  2Y74 A;  4N6O B;  4N6L A;  1N9E A;  3TDG A;  1FW7 A;  2RSX A;  3OWS A;  4FMA A;  2W0Q A;  3S67 A;  5M19 A;  1RNT A;  2WGO A;  3GZY B;  2HMJ B;  3KN4 A;  1G0T A;  1W7C A;  5DRV A;  9RNT A;  5KP3 A;  2J8X B;  1IQX A;  3IMA B;  2HMO B;  3LYG A;  1B21 A;  1GYB A;  3HI7 A;  3K0Z A;  4FCM A;  3SED A;  2AAD A;  5D81 A;  3WOE B;  1TP6 A;  1OAC A;  3PS8 A;  1FGQ A;  2WOH A;  3HK4 A;  2MC8 A;  3WA3 A;  5GSP A;  3FF0 A;  2B1X B;  4LMI A;  2O9U X;  1A67 A;  1W2B 2;  1MWS A;  1HYF A;  2P05 A;  3CD6 3;  1RN7 A;  1BVI A;  2STD A;  1SII A;  1STD A;  5STD A;  1B2M A;  3NX0 A;  1Q42 A;  1X1Y A;  2CH9 A;  2RFR A;  1JZO A;  4N3V A;  3X3Z A;  1OF5 A;  3FSD A;  3MKI A;  4HKV B;  5DRE A;  5JPP A;  1UW1 A;  4N6V 0;  4L7K A;  3BND A;  3NBR A;  3EHC A;  2OWP A;  1VQ9 3;  3CC7 3;  1OHS A;  4QWT A;  2YFI B;  8CHO A;  1R4C A;  4J5G A;  2P38 A;  3NXJ A;  1RHL A;  3G8Z A;  3AMO B;  1IQ8 A;  3EBY A;  4N6U A;  6STD A;  3DGM A;  3KKG A;  3MHE A;  1ZGX A;  3HOH A;  4HM0 B;  3FG3 A;  4GHO A;  1K73 4;  3KCH A;  3N9H A;  1LOW A;  1Q40 A;  2IA7 A;  1I2E A;  1YGE A;  3HII A;  4HM8 B;  1VQO 3;  4OUQ A;  1BRG A;  4R1K A;  3DUK A;  2XSO B;  3LXU X;  3PGB A;  3GRD A;  2XFS A;  4AEQ A;  2XF3 A;  2PNC A;  4JRF A;  1BNR A;  2BMQ B;  2Z7A A;  3CNM A;  3DH2 A;  4KVH A;  4O02 B;  1J2B A;  3ALA A;  3M8C A;  3CC4 3;  1T2I A;  2MF7 A;  2Z76 A;  4K61 A;  4J5K A;  4R80 A;  1NWW A;  1FUW A;  1OCV A;  4EXR A;  1UUV B;  3DMC A;  1VQP 3;  1Q81 4;  1EQK A;  1FGM A;  3F40 A;  3JUP A;  1M9G A;  4CPK A;  2AAE A;  1YIJ 3;  4FMB A;  5AYR B;  2CW9 A;  2C11 A;  4STD A;  1RGF A;  1KSI A;  2HMK B;  1B2S A;  3F8X A;  2SBL A;  4RNT A;  1JV2 B;  2WGQ A;  3F7X A;  3LT8 A;  4RZM A;  2IY2 A;  4RBN A;  1K28 A;  1RGA A;  1MWR A;  2OCT A;  3FLJ A;  5IG4 A;  3LTB A;  1LNH A;  1S72 3;  1X1W A;  1WNH A;  4JF8 A;  3H51 A;  2F99 A;  3K5T A;  2KXG A;  2CX1 A;  4HZB B;  1SQW A;  3G0K A;  1IVU A;  4GB5 A;  3KSE D;  4IIA A;  2P0M A;  1YVS A;  1IT7 A;  3GZR A;  1EUI C;  1RTU A;  1BSB A;  2XRX B;  3X42 A;  2KF4 A;  4AKZ A;  2CHC A;  1B2U A;  3Q2P A;  2CC3 A;  1JB5 A;  1E3R A;  2KCD A;  2W2C A;  3WOF B;  5G1K A;  1GS3 A;  5AEU B;  5IER A;  1OHO A;  1I0X A;  3OWY A;  3V92 A;  4RNZ A;  5CXO A;  2KF6 A;  2INX A;  3DZL A;  3OXA A;  4KFE A;  2E2U A;  3I0Y A;  1O7H B;  1YJ9 3;  1IQY A;  3HZP A;  1KC8 4;  3IJE B;  2R4I A;  1TJD A;  2GSP A;  1LQG C;  2Z6B A;  3EBT A;  4WP5 A;  5IG5 A;  5RNT A;  4G1M B;  3UL6 A;  1YNV X;  3URP A;  1IT8 A;  1PU4 A;  3CMA 3;  1D6U A;  4O2H A;  1JN5 B;  1TIJ A;  4EW5 A;  2XFT A;  2W03 A;  1ISK A;  3EJV A;  3ZG5 A;  1FZU A;  1UCJ A;  3K9M C;  4L8P A;  4O3V A;  4EC6 A;  3A5E A;  2RCD A;  5A0O B;  5EQL A;  4KZ1 A;  1RN4 A;  4TX4 A;  1RGE A;  3JVC A;  4EV5 A;  5TGN A;  3S28 A;  5ELU A;  4HM1 B;  1LQM B;  3S29 A;  4XBT A;  1BRN L;  2OOV A;  2CKF B;  1DMN A;  1DYU A;  1JNQ A;  1AV4 A;  3AMO A;  2W56 B;  3MSO A;  1IK3 A;  3F9S A;  4HM2 B;  3LML A;  3WOD G;  1V58 A;  3PCS A;  3U97 A;  1IVX A;  1AY7 A;  2CFG A;  4FCZ A;  4BIR A;  3GZX B;  4XM4 A;  5BXQ A;  3LTD A;  5EVH A;  1IVV A;  1W2Z A;  2YFL B;  4HJL B;  4NHF A;  1OHP A;  3WA2 X;  1BNI A;  1RSN A;  2C4B A;  1BAN A;  1MOL A;  2GBW B;  4XBY A;  3G71 3;  1M1K 4;  1A2P A;  3UJM A;  4OVM A;  2H0H A;  1RGL A;  1TFK A;  3NUV A;  3B4O A;  5AIF A;  4BTX A;  1OUN A;  3CU3 A;  1Q86 4;  1TRQ A;  2F5M A;  1I70 A;  1BAO A;  1JRQ A;  1WMO A;  3CCL 3;  1DVC A;  3F8H A;  2GU3 A;  1G02 A;  5CF2 A;  4EV2 A;  4H61 A;  4R4K A;  1CYV A;  3GAX A;  2ZA4 A;  4HBR A;  2ML6 A;  2P09 A;  1A2V A;  1DMM A;  1W5Z A;  1I2G A;  5BVB A;  3FGY A;  1ASK A;  2Z77 A;  2D42 A;  1TTO A;  2IMJ A;  2XR8 B;  3BIR A;  1GD3 A;  2FGT A;  2FNQ A;  5IG3 A;  1YI2 3;  2CFD A;  1LRA A;  1IV9 A;  2KF3 A;  3K7C A;  2UGI A;  4OK0 A;  3ROB A;  4GSP A;  4EYC A;  1BGS A;  5AII A;  4WFO A;  3J7Y d;  1LVN A;  1AQZ A;  3CCR 3;  1WMP A;  1VQQ A;  5FW5 A;  2P0X A;  3MG1 A;  1WMN A;  1NU3 A;  4KT3 B;  3X3X A;  3PZW A;  5M1A A;  5IG0 A;  1BNE A;  3LOY A;  1UCL A;  3SVA A;  4MMX B;  5HGR A;  4HZ9 B;  1QVF 2;  3U1W A;  2CG1 A;  1NDO B;  2W9Q A;  3N54 B;  1VQ6 3;  4HM6 B;  1BRJ A;  5AIH A;  5D83 A;  3SYU A;  2RNT A;  5IF6 A;  5CLK A;  1MWU A;  3NQZ A;  2K54 A;  1ROV A;  3D79 A;  4MMZ B;  1EA2 A;  3I56 3;  1VQL 3;  2M7O A;  3X41 A;  5AEW B;  1LOX A;  2W6J H;  3CC2 3;  2JQ5 A; 
#chains in the Genus database with same CATH homology
 2XGN A;  3FKA A;  2BNG A;  2F98 A;  1RKY A;  1DVD A;  1QAK A;  1TU5 A;  1EKM A;  1W4N A;  3NBB A;  3OX9 A;  5LC6 A;  2QEX 3;  1OPY A;  3NQY A;  3D3L A;  3CCE 3;  1JN5 A;  3STD A;  1A90 A;  5IEO A;  2JDI H;  3DGN A;  1IDP A;  3NM2 A;  1IVW A;  5EEO A;  3BNE A;  1K8A 4;  3EB8 A;  4O8S A;  4RNY A;  3LZA A;  7STD A;  4PEJ A;  4CCV A;  1NO3 A;  4ORL A;  1GY6 A;  3EC9 A;  1AR0 A;  3BNB A;  2GEX A;  3PXM A;  5IW9 A;  2QA4 3;  2FXT A;  4FMC A;  2GBX B;  1GY7 A;  1DMQ A;  1TFO A;  4MJD A;  1NB5 I;  5AYS C;  2W56 A;  5AIG A;  3KII A;  1YVB I;  3EX9 A;  2BMR B;  3RDE A;  1W01 A;  1N9J A;  3NM7 A;  1NB3 I;  2WO0 A;  4WHA A;  3OWU A;  4MMY B;  2GU1 A;  3F14 A;  1FGR A;  5KP1 A;  1AVL A;  1JB4 A;  4WYK A;  4R9K A;  1O7M B;  1FGO A;  2B24 B;  4K90 B;  3IPT A;  1JB2 A;  2XEP A;  1FA3 A;  4IPB A;  3B8L A;  1TUH A;  1UI7 A;  1YJN 3;  1OH0 A;  3HIG A;  4J8T A;  1GD4 A;  5CF1 A;  4LSO A;  2CIU A;  3CPO A;  2CFK A;  1ZO2 A;  2OTJ 3;  1OGX A;  2W9P A;  1FGT A;  4J9A A;  2OQE C;  3EN1 B;  3DGL A;  1QMA A;  1W6C A;  2F86 B;  3QK9 A;  4KFD A;  4H3U A;  5IEP A;  5FGO A;  2HMM B;  3MG3 A;  2L4V A;  3MYT A;  3S5C A;  1M1X B;  1C7H A;  2YFJ B;  3CCM 3;  3SX1 A;  3UB1 A;  3MPH A;  1KQS 2;  3OW2 2;  2QIY A;  3Q1C A;  3I55 3;  2Q07 A;  3EE1 A;  1O7W B;  3UL5 A;  4WYK B;  3CPW 2;  4HM3 B;  2O3O A;  4EBG A;  3VGN A;  3GZB A;  3E99 A;  1W6G A;  1ULJ B;  5IEN A;  1PFP A;  1VZZ A;  5G2G A;  3FH1 A;  3KZT A;  1Q7Y 4;  1VQM 3;  1K9M 4;  3SLU A;  1E97 A;  3F7S A;  3LH4 A;  4HVN A;  3ECF A;  4HM5 B;  2IUK A;  3V98 A;  1Q82 4;  1SPU A;  1CEW I;  3CCQ 3;  1IU7 A;  1Y4K A;  1CQS A;  3D9R A;  3NHX A;  3X3Y A;  3DGO A;  1BUQ A;  1RRL A;  2BT3 A;  2QGU A;  3DXO A;  3N8B A;  1O7P B;  4R9L A;  2V1L A;  1HU9 A;  1QJG A;  4HM7 B;  1SIH A;  2LQV A;  1E3V A;  1EG9 B;  2CG0 A;  5JBS A;  2HML B;  2BMO B;  1VQ4 3;  3RGR A;  1AVK A;  3G4S 3;  3ER7 A;  4K1U A;  3EF8 A;  4BTW A;  1VQ8 3;  1UI8 A;  3T0U A;  3K63 A;  2ML5 A;  1L5G B;  3EN8 A;  3FF2 A;  3L0R A;  2W04 A;  2OTL 3;  2ZL8 A;  4N6T A;  1D6Z A;  3FG1 A;  1Z1S A;  1M90 4;  3LTC A;  2CWU A;  2XGL A;  1STF I;  2E2V A;  3NBJ A;  3CNX A;  5I97 A;  1A2K A;  4MEI A;  2UX0 A;  1KD1 4;  4FCJ A;  3WMD A;  3CME 3;  4XBX A;  4N6M A;  1UUW B;  4NRE A;  3CCU 3;  1VQK 3;  2XSH B;  2ZDJ A;  2KRT A;  1RJO A;  4X2O A;  3A76 A;  3JUM A;  4XB5 A;  3H3H A;  3VSY A;  2E2T A;  2IUJ A;  1RRH A;  3BLZ A;  1QVG 2;  1W00 A;  3EQQ B;  2BHM A;  3CCS 3;  1N5H A;  1HKX A;  1JKG A;  1N8R 4;  2CK3 H;  1GY5 A;  5D82 A;  1K41 A;  1U8C B;  2LYX A;  4LGQ A;  1QAL A;  3SOA A;  1NJI 4;  1N8Q A;  3G6E 3;  1O7N B;  4I4K A;  1V74 A;  3FG4 A;  3X40 A;  2CWT A;  1T5Y A;  1OGZ A;  2A15 A;  2PZV A;  3KE7 A;  3SOY A;  3DM8 A;  1IV7 A;  1CYU A;  1O7G B;  3Q90 A;  2GEY A;  1OF5 B;  2D1W A;  4WWU C;  1U5O A;  3PYJ A;  3JUO A;  3JUN A;  3CCJ 3;  4L8O A;  1QAF A;  3S27 A;  4GL6 A;  2RGQ A;  3BNC A;  1VQ7 3;  1YHQ 3;  3JUQ A;  1VQN 3;  3QRD A;  3NV0 A;  5KP4 A;  3BB9 A;  3WDG B;  1VQ5 3;  3KFQ C;  1ROA A;  1LXE A;  1Q40 B;  3VF1 A;  2WOF A;  1KWI A;  5CK6 A;  2Y73 A;  1F8N A;  4U13 A;  5JPU A;  3FZW A;  3FCS B;  4FR9 A;  3T8N A;  4XDV A;  3B4P A;  3B7C A;  2YX9 A;  3OV4 A;  1WTH A;  3O8Y A;  1JKG B;  3LT9 A;  4X2H A;  1N5P A;  3CXC 2;  2CFL A;  4KFF A;  3SXX A;  1D6Y A;  4FMD A;  2I9W A;  1YIT 3;  3LTA A;  1US1 A;  3GWR A;  3MG2 A;  2OQE A;  1YJW 3;  2BO9 B;  2XH9 A;  3UNL A;  4Q53 A;  4LEH A;  2OOV C;  3T8U A;  4HYZ A;  2C10 A;  2CFW A;  3V99 A;  1G96 A;  3RGA A;  1MNL A;  2K0M A;  3PCR A;  1S5A A;  4BTY A;  2GXF A;  3G16 A;  4N6N B;  1W6Y A;  1SJW A;  3KSP A;  4IT7 A;  1W02 A;  4AKY A;  5AI1 A;  4ZM8 A;  4HM4 B;  3MWZ A;  1WQL B;  3HX8 A;  2HMN B;  2CWV A;  4XDW A;  5LC7 A;  5ELJ A;  3DY5 A;  3NV0 B;  4K1V A;  4CDL A;  3CCV 3;  1JJ2 2;  1ZX2 A;  4LZI A;  1ULI B;  2Y74 A;  4N6O B;  4N6L A;  1N9E A;  3TDG A;  2RSX A;  3OWS A;  4FMA A;  2W0Q A;  3S67 A;  2WGO A;  3GZY B;  2HMJ B;  3KN4 A;  5DRV A;  1W7C A;  5KP3 A;  1IQX A;  3IMA B;  2HMO B;  3LYG A;  1GYB A;  3K0Z A;  3HI7 A;  4FCM A;  3SED A;  5D81 A;  3WOE B;  1TP6 A;  1OAC A;  3PS8 A;  1FGQ A;  2WOH A;  3HK4 A;  2MC8 A;  3WA3 A;  3FF0 A;  2B1X B;  4LMI A;  2O9U X;  1A67 A;  1W2B 2;  3CD6 3;  2P05 A;  1RN7 A;  2STD A;  1SII A;  1STD A;  5STD A;  3NX0 A;  1Q42 A;  2CH9 A;  4N3V A;  2RFR A;  3X3Z A;  1OF5 A;  3FSD A;  3MKI A;  4HKV B;  5DRE A;  5JPP A;  1UW1 A;  4N6V 0;  4L7K A;  3BND A;  3NBR A;  3EHC A;  2OWP A;  1VQ9 3;  3CC7 3;  1OHS A;  4QWT A;  2YFI B;  8CHO A;  1R4C A;  2P38 A;  3NXJ A;  3G8Z A;  6STD A;  3AMO B;  1IQ8 A;  3EBY A;  4N6U A;  3DGM A;  3KKG A;  3MHE A;  4HM0 B;  3FG3 A;  1K73 4;  3N9H A;  1Q40 A;  2IA7 A;  1YGE A;  3HII A;  4HM8 B;  1VQO 3;  4OUQ A;  4R1K A;  3DUK A;  2XSO B;  3LXU X;  3PGB A;  3GRD A;  2XFS A;  4AEQ A;  2XF3 A;  2PNC A;  4JRF A;  2BMQ B;  2Z7A A;  3CNM A;  4KVH A;  4O02 B;  1J2B A;  3ALA A;  3M8C A;  3CC4 3;  2MF7 A;  2Z76 A;  4K61 A;  4R80 A;  1NWW A;  1FUW A;  1OCV A;  4EXR A;  1UUV B;  3DMC A;  1VQP 3;  1Q81 4;  1FGM A;  3F40 A;  3JUP A;  1M9G A;  1YIJ 3;  4FMB A;  5AYR B;  2CW9 A;  2C11 A;  4STD A;  1KSI A;  2HMK B;  3F8X A;  2SBL A;  1JV2 B;  2WGQ A;  3F7X A;  3LT8 A;  4RZM A;  4RBN A;  1K28 A;  2OCT A;  3FLJ A;  5IG4 A;  3LTB A;  1LNH A;  1S72 3;  1WNH A;  4JF8 A;  3H51 A;  2F99 A;  3K5T A;  2KXG A;  4HZB B;  1SQW A;  3G0K A;  1IVU A;  4GB5 A;  3KSE D;  4IIA A;  2P0M A;  3X42 A;  1IT7 A;  3GZR A;  2XRX B;  4AKZ A;  2CHC A;  3Q2P A;  2CC3 A;  1JB5 A;  1E3R A;  2KCD A;  2W2C A;  3WOF B;  1GS3 A;  5AEU B;  5IER A;  1OHO A;  3OWY A;  3V92 A;  4RNZ A;  5CXO A;  3OXA A;  2INX A;  3DZL A;  4KFE A;  2E2U A;  3I0Y A;  1O7H B;  1YJ9 3;  1IQY A;  3HZP A;  1KC8 4;  3IJE B;  2R4I A;  2Z6B A;  3EBT A;  5IG5 A;  4WP5 A;  4G1M B;  3UL6 A;  1PU4 A;  3CMA 3;  1IT8 A;  1D6U A;  4O2H A;  1JN5 B;  1TIJ A;  2XFT A;  2W03 A;  1ISK A;  3EJV A;  3K9M C;  4L8P A;  4O3V A;  4EC6 A;  2RCD A;  5A0O B;  5EQL A;  4KZ1 A;  4TX4 A;  3JVC A;  4EV5 A;  5TGN A;  3S28 A;  5ELU A;  4HM1 B;  3S29 A;  4XBT A;  2OOV A;  2CKF B;  1DMN A;  1DYU A;  1JNQ A;  1AV4 A;  3AMO A;  2W56 B;  3MSO A;  1IK3 A;  3F9S A;  4HM2 B;  3LML A;  3WOD G;  3PCS A;  3U97 A;  1IVX A;  1EQK A;  2CFG A;  4FCZ A;  3GZX B;  4XM4 A;  5BXQ A;  3LTD A;  5EVH A;  1IVV A;  1W2Z A;  2YFL B;  4HJL B;  4NHF A;  1OHP A;  3WA2 X;  4XBY A;  1MOL A;  2GBW B;  3G71 3;  1M1K 4;  3UJM A;  4OVM A;  1TFK A;  3NUV A;  3B4O A;  5AIF A;  4BTX A;  1OUN A;  3CU3 A;  1Q86 4;  1JRQ A;  1WMO A;  3CCL 3;  1DVC A;  3F8H A;  2GU3 A;  5CF2 A;  4EV2 A;  4H61 A;  4R4K A;  1CYV A;  3GAX A;  4HBR A;  2ML6 A;  2P09 A;  1A2V A;  1DMM A;  1W5Z A;  5BVB A;  3FGY A;  1ASK A;  2Z77 A;  2D42 A;  2IMJ A;  2XR8 B;  5IG3 A;  1GD3 A;  2FGT A;  2FNQ A;  1YI2 3;  2CFD A;  1IV9 A;  3K7C A;  4OK0 A;  3ROB A;  4EYC A;  5AII A;  4WFO A;  3J7Y d;  1LVN A;  3CCR 3;  1WMP A;  5FW5 A;  2P0X A;  3MG1 A;  1WMN A;  1NU3 A;  3X3X A;  3PZW A;  5IG0 A;  3SVA A;  3LOY A;  4MMX B;  5HGR A;  4HZ9 B;  1QVF 2;  3U1W A;  2CG1 A;  1NDO B;  2W9Q A;  3N54 B;  1VQ6 3;  4HM6 B;  5AIH A;  5D83 A;  5IF6 A;  5CLK A;  3NQZ A;  2K54 A;  1ROV A;  4MMZ B;  1EA2 A;  3I56 3;  1VQL 3;  2M7O A;  3X41 A;  5AEW B;  1LOX A;  2W6J H;  3CC2 3;  2JQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...