1OF5B

Crystal structure of mex67-mtr2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
165
structure length
128
Chain Sequence
NQAQITATFTKKILAHLDDPDSNLAQFVQLFNPNCRIIFNATPFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA EXPORT FACTOR MEX67
publication title Structural similarity in the absence of sequence homology of the messenger RNA export factors Mtr2 and p15.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear transport
total genus 35
structure length 128
sequence length 165
ec nomenclature
pdb deposition date 2003-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1of5B00
1JB2A 4J8TA 3FZWA 3FH1A 3LYGA 3F9SA 5CF1A 5BVBA 3GZYB 5DRVA 3S5CA 3T8NA 4HZ9B 2RGQA 1DMNA 2BMOB 3VSYA 3KKGA 3EJVA 3EBTA 1OPYA 4X2HA 1Q40B 3K0ZA 4HM6B 4ORLA 5DREA 3MG2A 1EG9B 4LEHA 1UUWB 1GYBA 4X2OA 1GY7A 5D81A 4LMIA 5G2GA 4XBXA 1OHOA 3F7XA 1A2KA 3GZXB 2F98A 3FLJA 4HM4B 4U13A 4WYKA 1JN5B 3GZBA 4HM5B 2HMOB 2XRXB 5IEPA 1QJGA 1O7NB 5IG0A 1TUHA 3NBRA 3DM8A 3SOYA 3NHXA 1W01A 3FSDA 4STDA 2INXA 1CQSA 3EHCA 3B8LA 3RGAA 2HMLB 1OF5A 2HMKB 4LGQA 2W2CA 1TP6A 1O7HB 5IERA 3CU3A 2B1XB 3MSOA 4XB5A 2BMQB 5CF2A 3FGYA 3NV0B 5JPPA 3CNXA 3GRDA 1S5AA 5CLKA 3KE7A 1SJWA 2HMNB 4HM8B 2RFRA 1ULIB 2BMRB 4FCJA 4J9AA 2GEXA 3MYTA 2YFJB 4HJLB 4MJDA 2Z77A 4K1UA 2OWPA 4RZMA 3ECFA 2K54A 1E3VA 3OWYA 5IENA 4HKVB 3NUVA 1OCVA 4IIAA 3H3HA 2UX0A 4XM4A 3ROBA 8CHOA 5FW5A 2F99A 1ISKA 2JQ5A 2HMMB 1BUQA 3OWUA 4I4KA 3I0YA 2Z76A 5TGNA 3G8ZA 5KP3A 3F8XA 3DXOA 4XBTA 3F8HA 1E3RA 3MG3A 3JUOA 2QIYA 1HKXA 3BLZA 1W6YA 1DMQA 4HM0B 3HX8A 1JKGB 3NV0A 3G0KA 1OH0A 5CK6A 1E97A 1W02A 3JUMA 4HM2B 4L8PA 4L8OA 2B24B 5AEWB 5KP1A 5AIGA 3WMDA 3D9RA 5AIIA 1QMAA 1OGZA 5HGRA 3VGNA 5D82A 1WQLB 3EN1B 5IG3A 3G16A 3NXJA 3OV4A 4KVHA 2RCDA 4K1VA 3MG1A 1K41A 1O7GB 1Q40A 5IG5A 1U5OA 4GB5A 2XSOB 5BXQA 1O7PB 1Z1SA 1UUVB 3UNLA 3JUPA 2STDA 3EC9A 2I9WA 1ZO2A 3STDA 1OUNA 1EA2A 3EX9A 3ER7A 3B7CA 3EBYA 3E99A 4HM3B 1Q42A 1NWWA 4R1KA 3DUKA 4OVMA 5AIHA 2XSHB 3H51A 4L7KA 3GZRA 1JN5A 2YFIB 4XDWA 2BNGA 2PZVA 4WYKB 4XBYA 5IG4A 4HM1B 3FF2A 3F40A 1AR0A 1STDA 5JPUA 4XDVA 5IF6A 5AI1A 1DMMA 1OHPA 2GEYA 2CKFB 2QGUA 1OGXA 5KP4A 5EVHA 3B4OA 3OXAA 2CHCA 3EF8A 3CPOA 5D83A 3GWRA 4HM7B 3T8UA 3Q90A 6STDA 1JB5A 2GXFA 2IMJA 3EQQB 1OF5B 4R9LA 2A15A 3OX9A 3IPTA 1JB4A 3NM2A 3BB9A 2HMJB 3CNMA 4WP5A 3FKAA 3HZPA 3B4PA 3HK4A 2YFLB 2R4IA 4HZBB 1GY5A 7STDA 4OUQA 3KZTA 3FF0A 1IDPA 5CXOA 3EN8A 4H3UA 5AEUB 1GS3A 1ULJB 3M8CA 5AIFA 1NDOB 3SEDA 1GY6A 3MHEA 4WWUC 1O7MB 1OHSA 3RGRA 2F86B 4FCMA 5IEOA 4PEJA 2GBXB 1VZZA 4CDLA 3LZAA 3K7CA 4HVNA 3SOAA 1ASKA 3A76A 2GBWB 3MKIA 1O7WB 1NU3A 3UJMA 5STDA 2Z7AA 3JUQA 4R9KA 3OWSA 3KSPA 1C7HA 1W00A 2XR8B 1JKGA 3F7SA 1ZX2A 4Q53A 3DZLA 3JUNA 4N3VA 3F14A 3DMCA
chains in the Genus database with same CATH superfamily
4HOHA 3D3LA 1JB2A 1MNLA 1N8QA 3WHOA 4J8TA 2WOHA 1IV9A 2CIUA 3FZWA 2BIRA 3FH1A 2IA7A 2ZL8A 3F9SA 3LYGA 3WOFB 5CF1A 2CX1A 4N6TA 5BVBA 1BNIA 3GZYB 5DRVA 2CFGA 4O3VA 1ZGXA 3S5CA 1RGFA 1BRSA 3T8NA 1N9EA 4O02B 1LOXA 4O2HA 5A0OB 1MOLA 4HZ9B 2RGQA 1DMNA 1WTHA 1K28A 2W56A 2BMOB 3GSPA 1LVNA 3VSYA 3KKGA 1GMRA 2O9UX 3EJVA 3BIRA 2KF4A 1OPYA 1VQQA 3EBTA 4X2HA 2H0IA 2CWVA 1Q40B 3FG4A 3K0ZA 3RNTA 4BTYA 4HM6B 1T5YA 2RBIA 3Q3FA 4JRFA 2OQEC 1RN7A 1A90A 1YIT3 3CPW2 3S28A 1VQL3 3Q1CA 4ORLA 5DREA 4BTWA 1J2BA 4G1MB 3MG2A 4AEQA 1EG9B 3BU4A 4LEHA 1VQ93 1UUWB 4TX4A 1V57A 3PZWA 1FUSA 4N6UA 4GHOA 1GYBA 1B27A 4X2OA 1GY7A 5D81A 4LMIA 3S29A 1LNIA 2CG1A 3N8BA 1X1WA 2H0HA 3SX1A 1IV7A 1YI23 1B2XA 1LOWA 5GSPA 5G2GA 5BIRA 1V74A 2MF7A 4N6V0 1HZ1A 4XBXA 3X42A 3N9HA 1FGMA 1WMNA 3CXC2 1I0VA 1QAFA 4RBNA 1OHOA 4FCZA 2OTJ3 3F7XA 1A2KA 4EC6A 3GZXB 2F98A 3L0RA 4ILFA 1B21A 3FLJA 4HM4B 1RN4A 2CX0A 3CC73 1IT7A 1UCLA 2KF5A 4U13A 3AMOA 4FMBA 1IVVA 4WYKA 3RDEA 1YGEA 3KFQC 1JN5B 1VQO3 2P05A 3PS8A 5FGOA 4NPBA 3WA2X 1BRGA 4LSOA 1LQMB 3GZBA 4AKZA 1UCIA 3HIGA 4HM5B 1B20A 1BIRA 2HMOB 4LZIA 1W6CA 1X1XA 2KRTA 1B2ZA 2XRXB 5M1AA 5IEPA 1Q7Y4 2OOVA 3T0UA 1FW7A 2ZA4A 4OK0A 1D6ZA 1PFPA 1QJGA 2V1LA 1BNRA 2ML6A 2WO0A 1JNQA 3LMLA 1O7NB 1A2VA 5IG0A 3WR2A 1TUHA 3NBRA 2XF3A 1WNHA 3D5IA 4EYCA 3DM8A 1MGWA 3LTAA 2CG0A 1CEWI 5I97A 3SOYA 1JZOA 1MWSA 3NHXA 3CD63 1BSAA 1W01A 3X3ZA 3BNEA 3FSDA 1RCKA 1V58A 1TU5A 2F5WA 4STDA 1Q814 5RNTA 2INXA 3DGLA 1CQSA 1BSBA 3K63A 3EHCA 3B8LA 4LYLB 1LXEA 1W7CA 3AGOA 2F5MA 3EE1A 2HMLB 3LTBA 4K61A 4N6OB 1RTUA 3RGAA 4BU4A 1VQ53 2PNCA 1OF5A 1LOYA 2CWTA 2ML5A 3AHSA 1N9JA 1LOVA 1G0TA 2IYJA 3UB1A 3N54B 4J5GA 1BRNL 2HMKB 1TJDA 2W2CA 1D6YA 3KSED 4LGQA 1TP6A 1O7HB 3X40A 4HAAA 3CME3 5IERA 1N8R4 3CU3A 2B1XB 3MSOA 4XB5A 2BMQB 5CF2A 3FGYA 1AVKA 4BL2A 1SIIA 3BNBA 4R4KA 3WODG 3NV0B 5JPPA 3CNXA 3GRDA 1PYLA 1S5AA 3LH4A 2P38A 3KE7A 1SJWA 2HMNB 4HM8B 2LYXA 2RFRA 1IK3A 1TTOA 1ZS7A 1D6UA 1ULIB 4NREA 1BSEA 2BMRB 4FCJA 4J9AA 3U97A 2H0GA 1AQZA 2GEXA 3MYTA 1TFOA 2YFJB 4HJLB 4ZM8A 1PY3A 4MJDA 2W0QA 1RGEA 4HBRA 1BNFA 1QALA 2L4VA 2Z77A 1DETA 4K1UA 2AAEA 3DMCA 3WOEB 2OWPA 3DGOA 3I563 1R4CA 4RZMA 1Q864 1EUIC 3ECFA 2K54A 1E3VA 3OWYA 1Q824 1QAKA 1C54A 5IENA 5ELUA 5G1KA 3IMAB 1WMPA 2D42A 4HKVB 1FYSA 3FG3A 1Q9EA 3VF1A 2ZDJA 3S67A 3NUVA 5EQLA 1W6GA 1BVIA 1MWRA 2BHMA 4EV2A 1VQN3 2RNTA 3ZFZA 3X3YA 1RNTA 1QVG2 1OCVA 1JRQA 4IIAA 3H3HA 2UX0A 4XM4A 1NB3I 3ROBA 2WGOA 3URPA 1W4NA 5FW5A 8CHOA 2IUKA 2JDIH 1STFI 4H61A 2F99A 1ISKA 2JQ5A 3RGRA 1G02A 3PYJA 2HMMB 5AYSC 1GSPA 1MGRA 1BUQA 1W2ZA 2OTL3 1SARA 1IT8A 3HOHA 3G6E3 3OWUA 2C4BA 3K9MC 4I4KA 3I0YA 2Z76A 5AYRB 3CCU3 5TGNA 1BOXA 3G8ZA 5KP3A 2P0MA 3QK9A 1I3IA 3SVAA 3F8XA 3DXOA 4XBTA 1I8VA 3AHWA 3F8HA 5M18A 1NNVA 3WA3A 1I2FA 1RGGA 1E3RA 3JVCA 1VQM3 1YNVX 1LQGC 3MG3A 4CCVA 3JUOA 1GD3A 1JBRA 1FUTA 2QIYA 1HKXA 1US1A 2QEX3 2Y73A 4RNZA 1OACA 1W6YA 3BLZA 2K0MA 1UDII 2CFWA 4HYZA 2E2TA 4EW5A 1PU4A 1DMQA 3MWZA 1BNSA 1BRJA 1RDSA 1U8CB 2CK3H 3IJEB 3ZG0A 1M1XB 4HM0B 3HX8A 1JKGB 3NV0A 2MC8A 3G0KA 1OH0A 5CK6A 3CCQ3 2R41A 1A67A 1E97A 1I2GA 1W02A 3JUMA 1BAOA 4HM2B 4L8PA 3DGNA 2IUJA 4GL6A 2B24B 2WOFA 3LOYA 4L8OA 5AEWB 5EEOA 3WDGB 5KP1A 4AKYA 4JF8A 1YVSA 2O3OA 5AIGA 3WMDA 2W6JH 4O8SA 1YGWA 1X1YA 2XEPA 3UL5A 3D9RA 2CFKA 3CCV3 1UCKA 1NO3A 2XH9A 3ALAA 2W03A 5AIIA 1QMAA 3GAXA 1GOYA 1FUWA 1I3FA 3V92A 1OGZA 3DGMA 5HGRA 1EKMA 2KF6A 1W2B2 3VGNA 5D82A 5IW9A 3MPHA 1WQLB 2Y74A 1JBSA 3LT8A 1HU9A 1YVBI 3EN1B 5IG3A 4CPKA 1RMSA 1EEJA 3CC23 1IQYA 1RGCA 1RJOA 3G16A 1FGOA 4KFEA 3NXJA 3OV4A 2C10A 4KVHA 3LT9A 2J8XB 2RCDA 1AY7A 3PCRA 5BU4A 4K1VA 3MG1A 2CC3A 1K41A 1O7GB 2BO9B 1KWIA 1Q40A 5IG5A 1FA3A 1IU7A 1IVWA 1BSDA 2KXGA 3DGYA 1YJN3 1U5OA 1NJI4 2W04A 4GB5A 2XSOB 4WFOA 5BXQA 1IYYA 1T3BA 1O7PB 1VQ73 1Z1SA 1UUVB 2XFTA 5M19A 3UNLA 2M7OA 1GOUA 2IY2A 1F8NA 3JUPA 4BIRA 2STDA 1RGLA 3EC9A 1B2UA 2XGNA 2I9WA 1ZO2A 1N5HA 3ZG5A 3CCL3 2Z6BA 3STDA 1A2PA 1OUNA 1YJW3 1EA2A 3EX9A 1LRAA 2GU1A 1RKYA 4N6MA 1IVXA 3ER7A 1DVDA 1BGSA 2KAAA 3B7CA 3V99A 1UGIA 2OOVC 3CCJ3 3EBYA 1T2IA 3E99A 1RNBA 1CH0A 9RNTA 3LTDA 4HM3B 1Q42A 1NWWA 1L5GB 2D1WA 2FGTA 4MEIA 1KQS2 1TRPA 4R1KA 1B3SA 1RGAA 3DUKA 4OVMA 5AIHA 3CCM3 2XSHB 3H51A 4L7KA 3GZRA 1JBTA 3NQZA 7GSPA 2XFSA 4IPBA 1FGRA 2OQEA 1RRHA 2BT3A 1BRHA 1JN5A 2YFIB 3NQYA 4FMDA 4XDWA 2BNGA 2PZVA 3AMOB 4WYKB 3NBBA 4XBYA 4J5KA 3KN4A 2F4YA 3U1WA 1EQKA 5IG4A 1BNGA 1RRLA 2CFDA 4HM1B 3FG1A 3PXMA 2W9PA 3FF2A 3BNCA 4NHFA 5LC6A 1VQ83 3F40A 1AR0A 1ROAA 4N6LA 2RSXA 5CLKA 1STDA 1X1UA 3HIIA 5JPUA 1T2HA 1YIJ3 3AGNA 4XDVA 5IF6A 1RCLA 5AI1A 3KCHA 1YJ93 1DMMA 1OHPA 2GEYA 1QVF2 2KF3A 2UUGC 4KZ1A 3I553 2CKFB 2QGUA 3D5GA 3FCSB 1OGXA 1N5PA 5KP4A 1UI7A 3B4OA 5EVHA 3OXAA 1I0XA 2SARA 1BU4A 4DKIA 1I2EA 1WMOA 1IVUA 2CHCA 1UUGB 4KFFA 3EF8A 3CPOA 5D83A 4QWTA 3GWRA 1K8A4 2W9QA 4HM7B 1IQ8A 3T8UA 3Q90A 6STDA 1JB5A 2GXFA 5HOHA 1UCJA 2IMJA 3PGBA 3EQQB 5G1LA 3NBJA 1OF5B 2AADA 4I5QA 4R9LA 4KFDA 1Y4KA 2A15A 3SXXA 2BU4A 3OX9A 2CFLA 1B2MA 2ZHXB 3IPTA 1VQP3 1SPUA 2K3DA 1JB4A 2GSPA 4FMCA 3NM2A 4EBGA 1VQK3 1UGHI 1JV2B 2HMJB 3BB9A 4BL3A 1ROVA 4RNTA 3CNMA 4WP5A 4WHAA 3FKAA 1CYVA 3HZPA 1G96A 3B4PA 2QA43 3HK4A 3NX0A 3QRDA 4MMZB 2YFLB 2R4IA 4HZBB 1RN1A 1GD4A 3SYUA 2F56A 3O8YA 4R80A 3CCE3 1K734 1GY5A 7STDA 1KC84 1NB5I 4OUQA 2YX9A 3KZTA 3FF0A 2E2VA 1IDPA 1SQWA 3CC43 1RLSA 3EN8A 5CXOA 1UI8A 3G713 4H3UA 2Q07A 1FGTA 5AEUB 1GS3A 3TDGA 4BTXA 1ULJB 2C11A 3M8CA 5AIFA 1NDOB 3DY5A 3OW22 3CMA3 1AVLA 3X41A 1W5ZA 1VQ63 3HI7A 3D79A 1HYFA 7RNTA 1S723 1YHQ3 3SEDA 3G4S3 3CCS3 1CYUA 2CH9A 2CWUA 1GY6A 3MHEA 3CCR3 1I70A 3BNDA 4WWUC 1FGQA 1AV4A 4EXRA 2W56B 1SIHA 1FZUA 1O7MB 2XGLA 1OHSA 1BUJA 1TIJA 1BANA 1GOVA 1RGHA 2F86B 2HOHA 1BRKA 1UW1A 3LTCA 4FCMA 3S27A 4GSPA 5IEOA 1KD14 1JJ22 4RNYA 1M904 4PEJA 6GSPA 4FR9A 1TFKA 1M9GA 1R4YA 3SLUA 1VQ43 2LQVA 2GBXB 3KIIA 1MWTA 2CW9A 1VZZA 2L1SA 4CDLA 1DVCA 1K9M4 3X3XA 8RNTA 3LZAA 3K7CA 1DE3A 1IQXA 4HVNA 1B2SA 1RGKA 3SOAA 4K90B 1ASKA 3A76A 1BRIA 2GBWB 1JZDA 3MKIA 5ELJA 3J7Yd 1LNHA 5JBSA 2E2UA 3Q2PA 3PCSA 1DYUA 3UL6A 1O7WB 1NU3A 1BNJA 2UGIA 3UJMA 5STDA 4N6NB 1RSNA 1MWUA 2GU3A 2Z7AA 4EV5A 2WGQA 2KCDA 1M1K4 1TRQA 3DH2A 3D4AA 3JUQA 4R9KA 4FMAA 5LC7A 3OWSA 4IT7A 2FXTA 3KSPA 4MMXB 1C7HA 1GMPA 1W00A 4CJNA 1BNEA 1KSIA 2SBLA 3A5EA 2FNQA 3NM7A 1RHLA 2P0XA 2XR8B 1JKGA 2OCTA 3F7SA 2P09A 3LXUX 1ZX2A 4Q53A 3EB8A 3V98A 4KT3B 3DZLA 3K5TA 4MMYB 1Q7HA 3JUNA 4N3VA 6RNTA 1BSCA 3F14A 1GMQA
chains in the Genus database with same CATH topology
3D3LA 1JB2A 1MNLA 1N8QA 4J8TA 2WOHA 1IV9A 2CIUA 3FZWA 3FH1A 2IA7A 2ZL8A 3F9SA 3LYGA 3WOFB 5CF1A 4N6TA 5BVBA 3GZYB 5DRVA 2CFGA 4O3VA 3S5CA 3T8NA 1N9EA 4O02B 1LOXA 4O2HA 5A0OB 1MOLA 4HZ9B 2RGQA 1DMNA 1WTHA 1K28A 2W56A 2BMOB 1LVNA 3VSYA 3KKGA 2O9UX 3EJVA 3EBTA 1OPYA 4X2HA 2CWVA 1Q40B 3FG4A 3K0ZA 4BTYA 4HM6B 1T5YA 4JRFA 2OQEC 1RN7A 1A90A 1YIT3 3CPW2 3S28A 1VQL3 3Q1CA 4ORLA 5DREA 4BTWA 1J2BA 4G1MB 3MG2A 4AEQA 1EG9B 4LEHA 1VQ93 1UUWB 4TX4A 3PZWA 4N6UA 1GYBA 4X2OA 1GY7A 5D81A 4LMIA 3S29A 2CG1A 3N8BA 3SX1A 1IV7A 1YI23 5G2GA 1V74A 2MF7A 4N6V0 4XBXA 3X42A 3N9HA 1FGMA 1WMNA 3CXC2 1QAFA 4RBNA 1OHOA 4FCZA 2OTJ3 3F7XA 1A2KA 4EC6A 3GZXB 2F98A 3L0RA 3FLJA 4HM4B 3CC73 1IT7A 4U13A 3AMOA 4FMBA 1IVVA 4WYKA 3RDEA 1YGEA 3KFQC 1JN5B 1VQO3 2P05A 3PS8A 5FGOA 3WA2X 4LSOA 3GZBA 4AKZA 3HIGA 4HM5B 2HMOB 4LZIA 1W6CA 2KRTA 2XRXB 5IEPA 1Q7Y4 2OOVA 3T0UA 4OK0A 1D6ZA 1PFPA 1QJGA 2V1LA 2ML6A 2WO0A 1JNQA 3LMLA 1O7NB 1A2VA 5IG0A 1TUHA 3NBRA 2XF3A 1WNHA 4EYCA 3DM8A 3LTAA 2CG0A 1CEWI 5I97A 3SOYA 3NHXA 3CD63 1W01A 3X3ZA 3BNEA 3FSDA 1TU5A 4STDA 1Q814 2INXA 3DGLA 1CQSA 3K63A 3EHCA 3B8LA 1LXEA 1W7CA 3EE1A 4N6OB 2HMLB 3LTBA 4K61A 3RGAA 1VQ53 2PNCA 1OF5A 2CWTA 2ML5A 1N9JA 3UB1A 3N54B 2HMKB 3KSED 2W2CA 1D6YA 4LGQA 1TP6A 1O7HB 3X40A 3CME3 5IERA 1N8R4 3CU3A 2B1XB 3MSOA 4XB5A 2BMQB 5CF2A 3FGYA 1AVKA 1SIIA 3BNBA 4R4KA 3WODG 3NV0B 5JPPA 3CNXA 3GRDA 1S5AA 3LH4A 5CLKA 2P38A 3KE7A 1SJWA 2HMNB 4HM8B 2LYXA 2RFRA 1IK3A 1D6UA 1ULIB 4NREA 2BMRB 4FCJA 4J9AA 3U97A 2GEXA 3MYTA 1TFOA 2YFJB 4HJLB 4ZM8A 4MJDA 2W0QA 4HBRA 1QALA 2L4VA 2Z77A 4K1UA 3WOEB 2OWPA 3DGOA 3I563 1R4CA 4RZMA 1Q864 3ECFA 2K54A 1E3VA 3OWYA 1Q824 1QAKA 5IENA 5ELUA 3IMAB 1WMPA 2D42A 4HKVB 3FG3A 3VF1A 2ZDJA 3S67A 3NUVA 5EQLA 1W6GA 4EV2A 2BHMA 1VQN3 3X3YA 1QVG2 1OCVA 1JRQA 4IIAA 3H3HA 2UX0A 4XM4A 1NB3I 3ROBA 2WGOA 1W4NA 5FW5A 8CHOA 2IUKA 2JDIH 1STFI 4H61A 2F99A 1ISKA 2JQ5A 3PYJA 2HMMB 5AYSC 1BUQA 1W2ZA 2OTL3 1IT8A 3G6E3 3OWUA 4I4KA 3K9MC 3I0YA 2Z76A 5AYRB 3CCU3 5TGNA 3G8ZA 5KP3A 2P0MA 3QK9A 3SVAA 3F8XA 3DXOA 4XBTA 3F8HA 3WA3A 1E3RA 3JVCA 1VQM3 4CCVA 3MG3A 3JUOA 1GD3A 2QIYA 1HKXA 1US1A 2QEX3 2Y73A 4RNZA 1OACA 1W6YA 3BLZA 2K0MA 2CFWA 4HYZA 2E2TA 1PU4A 1DMQA 3MWZA 2CK3H 1U8CB 3IJEB 1M1XB 4HM0B 3HX8A 1JKGB 3NV0A 2MC8A 3G0KA 1OH0A 5CK6A 3CCQ3 1A67A 1E97A 1W02A 3JUMA 4HM2B 4L8PA 3DGNA 2IUJA 4GL6A 2WOFA 2B24B 3LOYA 4L8OA 5AEWB 5EEOA 3WDGB 5KP1A 4AKYA 4JF8A 2O3OA 5AIGA 3WMDA 2W6JH 4O8SA 2XEPA 3UL5A 3D9RA 2CFKA 3CCV3 1NO3A 2XH9A 3ALAA 2W03A 5AIIA 1QMAA 3GAXA 1FUWA 3V92A 1OGZA 3DGMA 5HGRA 1EKMA 1W2B2 3VGNA 5D82A 5IW9A 3MPHA 1WQLB 2Y74A 3LT8A 1HU9A 1YVBI 3EN1B 5IG3A 3CC23 1IQYA 1RJOA 3G16A 1FGOA 4KFEA 3NXJA 3OV4A 2C10A 4KVHA 3LT9A 2RCDA 3PCRA 4K1VA 3MG1A 2CC3A 1K41A 1O7GB 2BO9B 1KWIA 1Q40A 5IG5A 1FA3A 1IU7A 1IVWA 2KXGA 1YJN3 1U5OA 1NJI4 2W04A 4GB5A 2XSOB 4WFOA 5BXQA 1O7PB 1VQ73 1Z1SA 1UUVB 2XFTA 3UNLA 2M7OA 3JUPA 1F8NA 2STDA 3EC9A 2XGNA 2I9WA 1ZO2A 1N5HA 3CCL3 2Z6BA 3STDA 1OUNA 1YJW3 1EA2A 3EX9A 2GU1A 1RKYA 4N6MA 1IVXA 3ER7A 1DVDA 3B7CA 3CCJ3 3V99A 2OOVC 3EBYA 3E99A 3LTDA 4HM3B 1Q42A 1NWWA 1L5GB 2D1WA 2FGTA 4MEIA 1KQS2 4R1KA 3CCM3 3DUKA 4OVMA 5AIHA 2XSHB 3H51A 4L7KA 3GZRA 3NQZA 2XFSA 4IPBA 1FGRA 2OQEA 1RRHA 2BT3A 1JN5A 2YFIB 3NQYA 4FMDA 4XDWA 2BNGA 2PZVA 3AMOB 4WYKB 3NBBA 4XBYA 3KN4A 3U1WA 1EQKA 5IG4A 1RRLA 2CFDA 4HM1B 3FG1A 3PXMA 2W9PA 3FF2A 3BNCA 4NHFA 5LC6A 1VQ83 3F40A 1AR0A 1ROAA 4N6LA 2RSXA 1STDA 3HIIA 5JPUA 1YIJ3 4XDVA 5IF6A 5AI1A 1YJ93 1DMMA 1OHPA 2GEYA 1QVF2 4KZ1A 3I553 2CKFB 2QGUA 3FCSB 1OGXA 1N5PA 5KP4A 1UI7A 3B4OA 5EVHA 3OXAA 1WMOA 1IVUA 2CHCA 4KFFA 3EF8A 3CPOA 5D83A 4QWTA 3GWRA 1K8A4 2W9QA 4HM7B 1IQ8A 3T8UA 3Q90A 6STDA 1JB5A 2GXFA 2IMJA 3PGBA 3EQQB 3NBJA 1OF5B 4R9LA 4KFDA 1Y4KA 2A15A 3SXXA 3OX9A 2CFLA 3IPTA 1VQP3 1SPUA 1JB4A 4FMCA 3NM2A 4EBGA 1VQK3 1JV2B 2HMJB 3BB9A 1ROVA 3CNMA 4WP5A 4WHAA 3FKAA 1CYVA 3HZPA 1G96A 3B4PA 2QA43 3HK4A 3NX0A 3QRDA 4MMZB 2YFLB 2R4IA 4HZBB 1GD4A 1K734 3O8YA 4R80A 3CCE3 1GY5A 7STDA 1KC84 1NB5I 4OUQA 2YX9A 3KZTA 3FF0A 2E2VA 1IDPA 1SQWA 3CC43 5CXOA 3EN8A 1UI8A 3G713 4H3UA 2Q07A 1FGTA 5AEUB 1GS3A 3TDGA 4BTXA 1ULJB 2C11A 3M8CA 5AIFA 1NDOB 3DY5A 3OW22 3CMA3 1AVLA 3X41A 1W5ZA 1VQ63 3HI7A 1S723 1YHQ3 3SEDA 3G4S3 3CCS3 1CYUA 2CH9A 2CWUA 1GY6A 3MHEA 3CCR3 3BNDA 4WWUC 1FGQA 1AV4A 4EXRA 2W56B 1SIHA 1O7MB 2XGLA 1OHSA 1TIJA 3RGRA 2F86B 3LTCA 4FCMA 3S27A 1UW1A 1JJ22 5IEOA 1KD14 4RNYA 1M904 4PEJA 4FR9A 1TFKA 1M9GA 3SLUA 1VQ43 2LQVA 2GBXB 3KIIA 2CW9A 1VZZA 4CDLA 1K9M4 1DVCA 3X3XA 3LZAA 3K7CA 1IQXA 4HVNA 3SOAA 4K90B 1ASKA 3A76A 2GBWB 3MKIA 5ELJA 3J7Yd 1LNHA 5JBSA 2E2UA 3Q2PA 3PCSA 1DYUA 3UL6A 1O7WB 1NU3A 3UJMA 5STDA 4N6NB 2GU3A 2Z7AA 4EV5A 1M1K4 2WGQA 2KCDA 3JUQA 4R9KA 4FMAA 5LC7A 3OWSA 4IT7A 2FXTA 3KSPA 4MMXB 1C7HA 1W00A 1KSIA 2SBLA 2FNQA 3NM7A 2P0XA 2XR8B 1JKGA 2OCTA 3F7SA 2P09A 3LXUX 1ZX2A 4Q53A 3EB8A 3V98A 3DZLA 3K5TA 4MMYB 3JUNA 4N3VA 3F14A 3DMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB2 A;  4J8T A;  3FZW A;  3FH1 A;  3LYG A;  3F9S A;  5CF1 A;  5BVB A;  3GZY B;  5DRV A;  3S5C A;  3T8N A;  4HZ9 B;  2RGQ A;  1DMN A;  2BMO B;  3VSY A;  3KKG A;  3EJV A;  3EBT A;  1OPY A;  4X2H A;  1Q40 B;  3K0Z A;  4HM6 B;  4ORL A;  5DRE A;  3MG2 A;  1EG9 B;  4LEH A;  1UUW B;  1GYB A;  4X2O A;  1GY7 A;  5D81 A;  4LMI A;  5G2G A;  4XBX A;  1OHO A;  3F7X A;  1A2K A;  3GZX B;  2F98 A;  3FLJ A;  4HM4 B;  4U13 A;  4WYK A;  1JN5 B;  3GZB A;  4HM5 B;  2HMO B;  2XRX B;  5IEP A;  1QJG A;  1O7N B;  5IG0 A;  1TUH A;  3NBR A;  3DM8 A;  3SOY A;  3NHX A;  1W01 A;  3FSD A;  4STD A;  2INX A;  1CQS A;  3EHC A;  3B8L A;  3RGA A;  2HML B;  1OF5 A;  2HMK B;  4LGQ A;  2W2C A;  1TP6 A;  1O7H B;  5IER A;  3CU3 A;  2B1X B;  3MSO A;  4XB5 A;  2BMQ B;  5CF2 A;  3FGY A;  3NV0 B;  5JPP A;  3CNX A;  3GRD A;  1S5A A;  5CLK A;  3KE7 A;  1SJW A;  2HMN B;  4HM8 B;  2RFR A;  1ULI B;  2BMR B;  4FCJ A;  4J9A A;  2GEX A;  3MYT A;  2YFJ B;  4HJL B;  4MJD A;  2Z77 A;  4K1U A;  2OWP A;  4RZM A;  3ECF A;  2K54 A;  1E3V A;  3OWY A;  5IEN A;  4HKV B;  3NUV A;  1OCV A;  4IIA A;  3H3H A;  2UX0 A;  4XM4 A;  3ROB A;  8CHO A;  5FW5 A;  2F99 A;  1ISK A;  2JQ5 A;  2HMM B;  1BUQ A;  3OWU A;  4I4K A;  3I0Y A;  2Z76 A;  5TGN A;  3G8Z A;  5KP3 A;  3F8X A;  3DXO A;  4XBT A;  3F8H A;  1E3R A;  3MG3 A;  3JUO A;  2QIY A;  1HKX A;  3BLZ A;  1W6Y A;  1DMQ A;  4HM0 B;  3HX8 A;  1JKG B;  3NV0 A;  3G0K A;  1OH0 A;  5CK6 A;  1E97 A;  1W02 A;  3JUM A;  4HM2 B;  4L8P A;  4L8O A;  2B24 B;  5AEW B;  5KP1 A;  5AIG A;  3WMD A;  3D9R A;  5AII A;  1QMA A;  1OGZ A;  5HGR A;  3VGN A;  5D82 A;  1WQL B;  3EN1 B;  5IG3 A;  3G16 A;  3NXJ A;  3OV4 A;  4KVH A;  2RCD A;  4K1V A;  3MG1 A;  1K41 A;  1O7G B;  1Q40 A;  5IG5 A;  1U5O A;  4GB5 A;  2XSO B;  5BXQ A;  1O7P B;  1Z1S A;  1UUV B;  3UNL A;  3JUP A;  2STD A;  3EC9 A;  2I9W A;  1ZO2 A;  3STD A;  1OUN A;  1EA2 A;  3EX9 A;  3ER7 A;  3B7C A;  3EBY A;  3E99 A;  4HM3 B;  1Q42 A;  1NWW A;  4R1K A;  3DUK A;  4OVM A;  5AIH A;  2XSH B;  3H51 A;  4L7K A;  3GZR A;  1JN5 A;  2YFI B;  4XDW A;  2BNG A;  2PZV A;  4WYK B;  4XBY A;  5IG4 A;  4HM1 B;  3FF2 A;  3F40 A;  1AR0 A;  1STD A;  5JPU A;  4XDV A;  5IF6 A;  5AI1 A;  1DMM A;  1OHP A;  2GEY A;  2CKF B;  2QGU A;  1OGX A;  5KP4 A;  5EVH A;  3B4O A;  3OXA A;  2CHC A;  3EF8 A;  3CPO A;  5D83 A;  3GWR A;  4HM7 B;  3T8U A;  3Q90 A;  6STD A;  1JB5 A;  2GXF A;  2IMJ A;  3EQQ B;  1OF5 B;  4R9L A;  2A15 A;  3OX9 A;  3IPT A;  1JB4 A;  3NM2 A;  3BB9 A;  2HMJ B;  3CNM A;  4WP5 A;  3FKA A;  3HZP A;  3B4P A;  3HK4 A;  2YFL B;  2R4I A;  4HZB B;  1GY5 A;  7STD A;  4OUQ A;  3KZT A;  3FF0 A;  1IDP A;  5CXO A;  3EN8 A;  4H3U A;  5AEU B;  1GS3 A;  1ULJ B;  3M8C A;  5AIF A;  1NDO B;  3SED A;  1GY6 A;  3MHE A;  4WWU C;  1O7M B;  1OHS A;  3RGR A;  2F86 B;  4FCM A;  5IEO A;  4PEJ A;  2GBX B;  1VZZ A;  4CDL A;  3LZA A;  3K7C A;  4HVN A;  3SOA A;  1ASK A;  3A76 A;  2GBW B;  3MKI A;  1O7W B;  1NU3 A;  3UJM A;  5STD A;  2Z7A A;  3JUQ A;  4R9K A;  3OWS A;  3KSP A;  1C7H A;  1W00 A;  2XR8 B;  1JKG A;  3F7S A;  1ZX2 A;  4Q53 A;  3DZL A;  3JUN A;  4N3V A;  3F14 A;  3DMC A; 
#chains in the Genus database with same CATH topology
 4HOH A;  3D3L A;  1JB2 A;  1MNL A;  1N8Q A;  3WHO A;  4J8T A;  2WOH A;  1IV9 A;  2CIU A;  3FZW A;  2BIR A;  3FH1 A;  2IA7 A;  2ZL8 A;  3F9S A;  3LYG A;  3WOF B;  5CF1 A;  2CX1 A;  4N6T A;  5BVB A;  1BNI A;  3GZY B;  5DRV A;  2CFG A;  4O3V A;  1ZGX A;  3S5C A;  1RGF A;  1BRS A;  3T8N A;  1N9E A;  4O02 B;  1LOX A;  4O2H A;  5A0O B;  1MOL A;  4HZ9 B;  2RGQ A;  1DMN A;  1WTH A;  1K28 A;  2W56 A;  2BMO B;  3GSP A;  1LVN A;  3VSY A;  3KKG A;  1GMR A;  2O9U X;  3EJV A;  3BIR A;  2KF4 A;  1OPY A;  1VQQ A;  3EBT A;  4X2H A;  2H0I A;  2CWV A;  1Q40 B;  3FG4 A;  3K0Z A;  3RNT A;  4BTY A;  4HM6 B;  1T5Y A;  2RBI A;  3Q3F A;  4JRF A;  2OQE C;  1RN7 A;  1A90 A;  1YIT 3;  3CPW 2;  3S28 A;  1VQL 3;  3Q1C A;  4ORL A;  5DRE A;  4BTW A;  1J2B A;  4G1M B;  3MG2 A;  4AEQ A;  1EG9 B;  3BU4 A;  4LEH A;  1VQ9 3;  1UUW B;  4TX4 A;  1V57 A;  3PZW A;  1FUS A;  4N6U A;  4GHO A;  1GYB A;  1B27 A;  4X2O A;  1GY7 A;  5D81 A;  4LMI A;  3S29 A;  1LNI A;  2CG1 A;  3N8B A;  1X1W A;  2H0H A;  3SX1 A;  1IV7 A;  1YI2 3;  1B2X A;  1LOW A;  5GSP A;  5G2G A;  5BIR A;  1V74 A;  2MF7 A;  4N6V 0;  1HZ1 A;  4XBX A;  3X42 A;  3N9H A;  1FGM A;  1WMN A;  3CXC 2;  1I0V A;  1QAF A;  4RBN A;  1OHO A;  4FCZ A;  2OTJ 3;  3F7X A;  1A2K A;  4EC6 A;  3GZX B;  2F98 A;  3L0R A;  4ILF A;  1B21 A;  3FLJ A;  4HM4 B;  1RN4 A;  2CX0 A;  3CC7 3;  1IT7 A;  1UCL A;  2KF5 A;  4U13 A;  3AMO A;  4FMB A;  1IVV A;  4WYK A;  3RDE A;  1YGE A;  3KFQ C;  1JN5 B;  1VQO 3;  2P05 A;  3PS8 A;  5FGO A;  4NPB A;  3WA2 X;  1BRG A;  4LSO A;  1LQM B;  3GZB A;  4AKZ A;  1UCI A;  3HIG A;  4HM5 B;  1B20 A;  1BIR A;  2HMO B;  4LZI A;  1W6C A;  1X1X A;  2KRT A;  1B2Z A;  2XRX B;  5M1A A;  5IEP A;  1Q7Y 4;  2OOV A;  3T0U A;  1FW7 A;  2ZA4 A;  4OK0 A;  1D6Z A;  1PFP A;  1QJG A;  2V1L A;  1BNR A;  2ML6 A;  2WO0 A;  1JNQ A;  3LML A;  1O7N B;  1A2V A;  5IG0 A;  3WR2 A;  1TUH A;  3NBR A;  2XF3 A;  1WNH A;  3D5I A;  4EYC A;  3DM8 A;  1MGW A;  3LTA A;  2CG0 A;  1CEW I;  5I97 A;  3SOY A;  1JZO A;  1MWS A;  3NHX A;  3CD6 3;  1BSA A;  1W01 A;  3X3Z A;  3BNE A;  3FSD A;  1RCK A;  1V58 A;  1TU5 A;  2F5W A;  4STD A;  1Q81 4;  5RNT A;  2INX A;  3DGL A;  1CQS A;  1BSB A;  3K63 A;  3EHC A;  3B8L A;  4LYL B;  1LXE A;  1W7C A;  3AGO A;  2F5M A;  3EE1 A;  2HML B;  3LTB A;  4K61 A;  4N6O B;  1RTU A;  3RGA A;  4BU4 A;  1VQ5 3;  2PNC A;  1OF5 A;  1LOY A;  2CWT A;  2ML5 A;  3AHS A;  1N9J A;  1LOV A;  1G0T A;  2IYJ A;  3UB1 A;  3N54 B;  4J5G A;  1BRN L;  2HMK B;  1TJD A;  2W2C A;  1D6Y A;  3KSE D;  4LGQ A;  1TP6 A;  1O7H B;  3X40 A;  4HAA A;  3CME 3;  5IER A;  1N8R 4;  3CU3 A;  2B1X B;  3MSO A;  4XB5 A;  2BMQ B;  5CF2 A;  3FGY A;  1AVK A;  4BL2 A;  1SII A;  3BNB A;  4R4K A;  3WOD G;  3NV0 B;  5JPP A;  3CNX A;  3GRD A;  1PYL A;  1S5A A;  3LH4 A;  2P38 A;  3KE7 A;  1SJW A;  2HMN B;  4HM8 B;  2LYX A;  2RFR A;  1IK3 A;  1TTO A;  1ZS7 A;  1D6U A;  1ULI B;  4NRE A;  1BSE A;  2BMR B;  4FCJ A;  4J9A A;  3U97 A;  2H0G A;  1AQZ A;  2GEX A;  3MYT A;  1TFO A;  2YFJ B;  4HJL B;  4ZM8 A;  1PY3 A;  4MJD A;  2W0Q A;  1RGE A;  4HBR A;  1BNF A;  1QAL A;  2L4V A;  2Z77 A;  1DET A;  4K1U A;  2AAE A;  3DMC A;  3WOE B;  2OWP A;  3DGO A;  3I56 3;  1R4C A;  4RZM A;  1Q86 4;  1EUI C;  3ECF A;  2K54 A;  1E3V A;  3OWY A;  1Q82 4;  1QAK A;  1C54 A;  5IEN A;  5ELU A;  5G1K A;  3IMA B;  1WMP A;  2D42 A;  4HKV B;  1FYS A;  3FG3 A;  1Q9E A;  3VF1 A;  2ZDJ A;  3S67 A;  3NUV A;  5EQL A;  1W6G A;  1BVI A;  1MWR A;  2BHM A;  4EV2 A;  1VQN 3;  2RNT A;  3ZFZ A;  3X3Y A;  1RNT A;  1QVG 2;  1OCV A;  1JRQ A;  4IIA A;  3H3H A;  2UX0 A;  4XM4 A;  1NB3 I;  3ROB A;  2WGO A;  3URP A;  1W4N A;  5FW5 A;  8CHO A;  2IUK A;  2JDI H;  1STF I;  4H61 A;  2F99 A;  1ISK A;  2JQ5 A;  3RGR A;  1G02 A;  3PYJ A;  2HMM B;  5AYS C;  1GSP A;  1MGR A;  1BUQ A;  1W2Z A;  2OTL 3;  1SAR A;  1IT8 A;  3HOH A;  3G6E 3;  3OWU A;  2C4B A;  3K9M C;  4I4K A;  3I0Y A;  2Z76 A;  5AYR B;  3CCU 3;  5TGN A;  1BOX A;  3G8Z A;  5KP3 A;  2P0M A;  3QK9 A;  1I3I A;  3SVA A;  3F8X A;  3DXO A;  4XBT A;  1I8V A;  3AHW A;  3F8H A;  5M18 A;  1NNV A;  3WA3 A;  1I2F A;  1RGG A;  1E3R A;  3JVC A;  1VQM 3;  1YNV X;  1LQG C;  3MG3 A;  4CCV A;  3JUO A;  1GD3 A;  1JBR A;  1FUT A;  2QIY A;  1HKX A;  1US1 A;  2QEX 3;  2Y73 A;  4RNZ A;  1OAC A;  1W6Y A;  3BLZ A;  2K0M A;  1UDI I;  2CFW A;  4HYZ A;  2E2T A;  4EW5 A;  1PU4 A;  1DMQ A;  3MWZ A;  1BNS A;  1BRJ A;  1RDS A;  1U8C B;  2CK3 H;  3IJE B;  3ZG0 A;  1M1X B;  4HM0 B;  3HX8 A;  1JKG B;  3NV0 A;  2MC8 A;  3G0K A;  1OH0 A;  5CK6 A;  3CCQ 3;  2R41 A;  1A67 A;  1E97 A;  1I2G A;  1W02 A;  3JUM A;  1BAO A;  4HM2 B;  4L8P A;  3DGN A;  2IUJ A;  4GL6 A;  2B24 B;  2WOF A;  3LOY A;  4L8O A;  5AEW B;  5EEO A;  3WDG B;  5KP1 A;  4AKY A;  4JF8 A;  1YVS A;  2O3O A;  5AIG A;  3WMD A;  2W6J H;  4O8S A;  1YGW A;  1X1Y A;  2XEP A;  3UL5 A;  3D9R A;  2CFK A;  3CCV 3;  1UCK A;  1NO3 A;  2XH9 A;  3ALA A;  2W03 A;  5AII A;  1QMA A;  3GAX A;  1GOY A;  1FUW A;  1I3F A;  3V92 A;  1OGZ A;  3DGM A;  5HGR A;  1EKM A;  2KF6 A;  1W2B 2;  3VGN A;  5D82 A;  5IW9 A;  3MPH A;  1WQL B;  2Y74 A;  1JBS A;  3LT8 A;  1HU9 A;  1YVB I;  3EN1 B;  5IG3 A;  4CPK A;  1RMS A;  1EEJ A;  3CC2 3;  1IQY A;  1RGC A;  1RJO A;  3G16 A;  1FGO A;  4KFE A;  3NXJ A;  3OV4 A;  2C10 A;  4KVH A;  3LT9 A;  2J8X B;  2RCD A;  1AY7 A;  3PCR A;  5BU4 A;  4K1V A;  3MG1 A;  2CC3 A;  1K41 A;  1O7G B;  2BO9 B;  1KWI A;  1Q40 A;  5IG5 A;  1FA3 A;  1IU7 A;  1IVW A;  1BSD A;  2KXG A;  3DGY A;  1YJN 3;  1U5O A;  1NJI 4;  2W04 A;  4GB5 A;  2XSO B;  4WFO A;  5BXQ A;  1IYY A;  1T3B A;  1O7P B;  1VQ7 3;  1Z1S A;  1UUV B;  2XFT A;  5M19 A;  3UNL A;  2M7O A;  1GOU A;  2IY2 A;  1F8N A;  3JUP A;  4BIR A;  2STD A;  1RGL A;  3EC9 A;  1B2U A;  2XGN A;  2I9W A;  1ZO2 A;  1N5H A;  3ZG5 A;  3CCL 3;  2Z6B A;  3STD A;  1A2P A;  1OUN A;  1YJW 3;  1EA2 A;  3EX9 A;  1LRA A;  2GU1 A;  1RKY A;  4N6M A;  1IVX A;  3ER7 A;  1DVD A;  1BGS A;  2KAA A;  3B7C A;  3V99 A;  1UGI A;  2OOV C;  3CCJ 3;  3EBY A;  1T2I A;  3E99 A;  1RNB A;  1CH0 A;  9RNT A;  3LTD A;  4HM3 B;  1Q42 A;  1NWW A;  1L5G B;  2D1W A;  2FGT A;  4MEI A;  1KQS 2;  1TRP A;  4R1K A;  1B3S A;  1RGA A;  3DUK A;  4OVM A;  5AIH A;  3CCM 3;  2XSH B;  3H51 A;  4L7K A;  3GZR A;  1JBT A;  3NQZ A;  7GSP A;  2XFS A;  4IPB A;  1FGR A;  2OQE A;  1RRH A;  2BT3 A;  1BRH A;  1JN5 A;  2YFI B;  3NQY A;  4FMD A;  4XDW A;  2BNG A;  2PZV A;  3AMO B;  4WYK B;  3NBB A;  4XBY A;  4J5K A;  3KN4 A;  2F4Y A;  3U1W A;  1EQK A;  5IG4 A;  1BNG A;  1RRL A;  2CFD A;  4HM1 B;  3FG1 A;  3PXM A;  2W9P A;  3FF2 A;  3BNC A;  4NHF A;  5LC6 A;  1VQ8 3;  3F40 A;  1AR0 A;  1ROA A;  4N6L A;  2RSX A;  5CLK A;  1STD A;  1X1U A;  3HII A;  5JPU A;  1T2H A;  1YIJ 3;  3AGN A;  4XDV A;  5IF6 A;  1RCL A;  5AI1 A;  3KCH A;  1YJ9 3;  1DMM A;  1OHP A;  2GEY A;  1QVF 2;  2KF3 A;  2UUG C;  4KZ1 A;  3I55 3;  2CKF B;  2QGU A;  3D5G A;  3FCS B;  1OGX A;  1N5P A;  5KP4 A;  1UI7 A;  3B4O A;  5EVH A;  3OXA A;  1I0X A;  2SAR A;  1BU4 A;  4DKI A;  1I2E A;  1WMO A;  1IVU A;  2CHC A;  1UUG B;  4KFF A;  3EF8 A;  3CPO A;  5D83 A;  4QWT A;  3GWR A;  1K8A 4;  2W9Q A;  4HM7 B;  1IQ8 A;  3T8U A;  3Q90 A;  6STD A;  1JB5 A;  2GXF A;  5HOH A;  1UCJ A;  2IMJ A;  3PGB A;  3EQQ B;  5G1L A;  3NBJ A;  1OF5 B;  2AAD A;  4I5Q A;  4R9L A;  4KFD A;  1Y4K A;  2A15 A;  3SXX A;  2BU4 A;  3OX9 A;  2CFL A;  1B2M A;  2ZHX B;  3IPT A;  1VQP 3;  1SPU A;  2K3D A;  1JB4 A;  2GSP A;  4FMC A;  3NM2 A;  4EBG A;  1VQK 3;  1UGH I;  1JV2 B;  2HMJ B;  3BB9 A;  4BL3 A;  1ROV A;  4RNT A;  3CNM A;  4WP5 A;  4WHA A;  3FKA A;  1CYV A;  3HZP A;  1G96 A;  3B4P A;  2QA4 3;  3HK4 A;  3NX0 A;  3QRD A;  4MMZ B;  2YFL B;  2R4I A;  4HZB B;  1RN1 A;  1GD4 A;  3SYU A;  2F56 A;  3O8Y A;  4R80 A;  3CCE 3;  1K73 4;  1GY5 A;  7STD A;  1KC8 4;  1NB5 I;  4OUQ A;  2YX9 A;  3KZT A;  3FF0 A;  2E2V A;  1IDP A;  1SQW A;  3CC4 3;  1RLS A;  3EN8 A;  5CXO A;  1UI8 A;  3G71 3;  4H3U A;  2Q07 A;  1FGT A;  5AEU B;  1GS3 A;  3TDG A;  4BTX A;  1ULJ B;  2C11 A;  3M8C A;  5AIF A;  1NDO B;  3DY5 A;  3OW2 2;  3CMA 3;  1AVL A;  3X41 A;  1W5Z A;  1VQ6 3;  3HI7 A;  3D79 A;  1HYF A;  7RNT A;  1S72 3;  1YHQ 3;  3SED A;  3G4S 3;  3CCS 3;  1CYU A;  2CH9 A;  2CWU A;  1GY6 A;  3MHE A;  3CCR 3;  1I70 A;  3BND A;  4WWU C;  1FGQ A;  1AV4 A;  4EXR A;  2W56 B;  1SIH A;  1FZU A;  1O7M B;  2XGL A;  1OHS A;  1BUJ A;  1TIJ A;  1BAN A;  1GOV A;  1RGH A;  2F86 B;  2HOH A;  1BRK A;  1UW1 A;  3LTC A;  4FCM A;  3S27 A;  4GSP A;  5IEO A;  1KD1 4;  1JJ2 2;  4RNY A;  1M90 4;  4PEJ A;  6GSP A;  4FR9 A;  1TFK A;  1M9G A;  1R4Y A;  3SLU A;  1VQ4 3;  2LQV A;  2GBX B;  3KII A;  1MWT A;  2CW9 A;  1VZZ A;  2L1S A;  4CDL A;  1DVC A;  1K9M 4;  3X3X A;  8RNT A;  3LZA A;  3K7C A;  1DE3 A;  1IQX A;  4HVN A;  1B2S A;  1RGK A;  3SOA A;  4K90 B;  1ASK A;  3A76 A;  1BRI A;  2GBW B;  1JZD A;  3MKI A;  5ELJ A;  3J7Y d;  1LNH A;  5JBS A;  2E2U A;  3Q2P A;  3PCS A;  1DYU A;  3UL6 A;  1O7W B;  1NU3 A;  1BNJ A;  2UGI A;  3UJM A;  5STD A;  4N6N B;  1RSN A;  1MWU A;  2GU3 A;  2Z7A A;  4EV5 A;  2WGQ A;  2KCD A;  1M1K 4;  1TRQ A;  3DH2 A;  3D4A A;  3JUQ A;  4R9K A;  4FMA A;  5LC7 A;  3OWS A;  4IT7 A;  2FXT A;  3KSP A;  4MMX B;  1C7H A;  1GMP A;  1W00 A;  4CJN A;  1BNE A;  1KSI A;  2SBL A;  3A5E A;  2FNQ A;  3NM7 A;  1RHL A;  2P0X A;  2XR8 B;  1JKG A;  2OCT A;  3F7S A;  2P09 A;  3LXU X;  1ZX2 A;  4Q53 A;  3EB8 A;  3V98 A;  4KT3 B;  3DZL A;  3K5T A;  4MMY B;  1Q7H A;  3JUN A;  4N3V A;  6RNT A;  1BSC A;  3F14 A;  1GMQ A; 
#chains in the Genus database with same CATH homology
 3D3L A;  1JB2 A;  1MNL A;  1N8Q A;  4J8T A;  2WOH A;  1IV9 A;  2CIU A;  3FZW A;  3FH1 A;  2IA7 A;  2ZL8 A;  3F9S A;  3LYG A;  3WOF B;  5CF1 A;  4N6T A;  5BVB A;  3GZY B;  5DRV A;  2CFG A;  4O3V A;  3S5C A;  3T8N A;  1N9E A;  4O02 B;  1LOX A;  4O2H A;  5A0O B;  1MOL A;  4HZ9 B;  2RGQ A;  1DMN A;  1WTH A;  1K28 A;  2W56 A;  2BMO B;  1LVN A;  3VSY A;  3KKG A;  2O9U X;  3EJV A;  3EBT A;  1OPY A;  4X2H A;  2CWV A;  1Q40 B;  3FG4 A;  3K0Z A;  4BTY A;  4HM6 B;  1T5Y A;  4JRF A;  2OQE C;  1RN7 A;  1A90 A;  1YIT 3;  3CPW 2;  3S28 A;  1VQL 3;  3Q1C A;  4ORL A;  5DRE A;  4BTW A;  1J2B A;  4G1M B;  3MG2 A;  4AEQ A;  1EG9 B;  4LEH A;  1VQ9 3;  1UUW B;  4TX4 A;  3PZW A;  4N6U A;  1GYB A;  4X2O A;  1GY7 A;  5D81 A;  4LMI A;  3S29 A;  2CG1 A;  3N8B A;  3SX1 A;  1IV7 A;  1YI2 3;  5G2G A;  1V74 A;  2MF7 A;  4N6V 0;  4XBX A;  3X42 A;  3N9H A;  1FGM A;  1WMN A;  3CXC 2;  1QAF A;  4RBN A;  1OHO A;  4FCZ A;  2OTJ 3;  3F7X A;  1A2K A;  4EC6 A;  3GZX B;  2F98 A;  3L0R A;  3FLJ A;  4HM4 B;  3CC7 3;  1IT7 A;  4U13 A;  3AMO A;  4FMB A;  1IVV A;  4WYK A;  3RDE A;  1YGE A;  3KFQ C;  1JN5 B;  1VQO 3;  2P05 A;  3PS8 A;  5FGO A;  3WA2 X;  4LSO A;  3GZB A;  4AKZ A;  3HIG A;  4HM5 B;  2HMO B;  4LZI A;  1W6C A;  2KRT A;  2XRX B;  5IEP A;  1Q7Y 4;  2OOV A;  3T0U A;  4OK0 A;  1D6Z A;  1PFP A;  1QJG A;  2V1L A;  2ML6 A;  2WO0 A;  1JNQ A;  3LML A;  1O7N B;  1A2V A;  5IG0 A;  1TUH A;  3NBR A;  2XF3 A;  1WNH A;  4EYC A;  3DM8 A;  3LTA A;  2CG0 A;  1CEW I;  5I97 A;  3SOY A;  3NHX A;  3CD6 3;  1W01 A;  3X3Z A;  3BNE A;  3FSD A;  1TU5 A;  4STD A;  1Q81 4;  2INX A;  3DGL A;  1CQS A;  3K63 A;  3EHC A;  3B8L A;  1LXE A;  1W7C A;  3EE1 A;  4N6O B;  2HML B;  3LTB A;  4K61 A;  3RGA A;  1VQ5 3;  2PNC A;  1OF5 A;  2CWT A;  2ML5 A;  1N9J A;  3UB1 A;  3N54 B;  2HMK B;  3KSE D;  2W2C A;  1D6Y A;  4LGQ A;  1TP6 A;  1O7H B;  3X40 A;  3CME 3;  5IER A;  1N8R 4;  3CU3 A;  2B1X B;  3MSO A;  4XB5 A;  2BMQ B;  5CF2 A;  3FGY A;  1AVK A;  1SII A;  3BNB A;  4R4K A;  3WOD G;  3NV0 B;  5JPP A;  3CNX A;  3GRD A;  1S5A A;  3LH4 A;  5CLK A;  2P38 A;  3KE7 A;  1SJW A;  2HMN B;  4HM8 B;  2LYX A;  2RFR A;  1IK3 A;  1D6U A;  1ULI B;  4NRE A;  2BMR B;  4FCJ A;  4J9A A;  3U97 A;  2GEX A;  3MYT A;  1TFO A;  2YFJ B;  4HJL B;  4ZM8 A;  4MJD A;  2W0Q A;  4HBR A;  1QAL A;  2L4V A;  2Z77 A;  4K1U A;  3WOE B;  2OWP A;  3DGO A;  3I56 3;  1R4C A;  4RZM A;  1Q86 4;  3ECF A;  2K54 A;  1E3V A;  3OWY A;  1Q82 4;  1QAK A;  5IEN A;  5ELU A;  3IMA B;  1WMP A;  2D42 A;  4HKV B;  3FG3 A;  3VF1 A;  2ZDJ A;  3S67 A;  3NUV A;  5EQL A;  1W6G A;  4EV2 A;  2BHM A;  1VQN 3;  3X3Y A;  1QVG 2;  1OCV A;  1JRQ A;  4IIA A;  3H3H A;  2UX0 A;  4XM4 A;  1NB3 I;  3ROB A;  2WGO A;  1W4N A;  5FW5 A;  8CHO A;  2IUK A;  2JDI H;  1STF I;  4H61 A;  2F99 A;  1ISK A;  2JQ5 A;  3PYJ A;  2HMM B;  5AYS C;  1BUQ A;  1W2Z A;  2OTL 3;  1IT8 A;  3G6E 3;  3OWU A;  4I4K A;  3K9M C;  3I0Y A;  2Z76 A;  5AYR B;  3CCU 3;  5TGN A;  3G8Z A;  5KP3 A;  2P0M A;  3QK9 A;  3SVA A;  3F8X A;  3DXO A;  4XBT A;  3F8H A;  3WA3 A;  1E3R A;  3JVC A;  1VQM 3;  4CCV A;  3MG3 A;  3JUO A;  1GD3 A;  2QIY A;  1HKX A;  1US1 A;  2QEX 3;  2Y73 A;  4RNZ A;  1OAC A;  1W6Y A;  3BLZ A;  2K0M A;  2CFW A;  4HYZ A;  2E2T A;  1PU4 A;  1DMQ A;  3MWZ A;  2CK3 H;  1U8C B;  3IJE B;  1M1X B;  4HM0 B;  3HX8 A;  1JKG B;  3NV0 A;  2MC8 A;  3G0K A;  1OH0 A;  5CK6 A;  3CCQ 3;  1A67 A;  1E97 A;  1W02 A;  3JUM A;  4HM2 B;  4L8P A;  3DGN A;  2IUJ A;  4GL6 A;  2WOF A;  2B24 B;  3LOY A;  4L8O A;  5AEW B;  5EEO A;  3WDG B;  5KP1 A;  4AKY A;  4JF8 A;  2O3O A;  5AIG A;  3WMD A;  2W6J H;  4O8S A;  2XEP A;  3UL5 A;  3D9R A;  2CFK A;  3CCV 3;  1NO3 A;  2XH9 A;  3ALA A;  2W03 A;  5AII A;  1QMA A;  3GAX A;  1FUW A;  3V92 A;  1OGZ A;  3DGM A;  5HGR A;  1EKM A;  1W2B 2;  3VGN A;  5D82 A;  5IW9 A;  3MPH A;  1WQL B;  2Y74 A;  3LT8 A;  1HU9 A;  1YVB I;  3EN1 B;  5IG3 A;  3CC2 3;  1IQY A;  1RJO A;  3G16 A;  1FGO A;  4KFE A;  3NXJ A;  3OV4 A;  2C10 A;  4KVH A;  3LT9 A;  2RCD A;  3PCR A;  4K1V A;  3MG1 A;  2CC3 A;  1K41 A;  1O7G B;  2BO9 B;  1KWI A;  1Q40 A;  5IG5 A;  1FA3 A;  1IU7 A;  1IVW A;  2KXG A;  1YJN 3;  1U5O A;  1NJI 4;  2W04 A;  4GB5 A;  2XSO B;  4WFO A;  5BXQ A;  1O7P B;  1VQ7 3;  1Z1S A;  1UUV B;  2XFT A;  3UNL A;  2M7O A;  3JUP A;  1F8N A;  2STD A;  3EC9 A;  2XGN A;  2I9W A;  1ZO2 A;  1N5H A;  3CCL 3;  2Z6B A;  3STD A;  1OUN A;  1YJW 3;  1EA2 A;  3EX9 A;  2GU1 A;  1RKY A;  4N6M A;  1IVX A;  3ER7 A;  1DVD A;  3B7C A;  3CCJ 3;  3V99 A;  2OOV C;  3EBY A;  3E99 A;  3LTD A;  4HM3 B;  1Q42 A;  1NWW A;  1L5G B;  2D1W A;  2FGT A;  4MEI A;  1KQS 2;  4R1K A;  3CCM 3;  3DUK A;  4OVM A;  5AIH A;  2XSH B;  3H51 A;  4L7K A;  3GZR A;  3NQZ A;  2XFS A;  4IPB A;  1FGR A;  2OQE A;  1RRH A;  2BT3 A;  1JN5 A;  2YFI B;  3NQY A;  4FMD A;  4XDW A;  2BNG A;  2PZV A;  3AMO B;  4WYK B;  3NBB A;  4XBY A;  3KN4 A;  3U1W A;  1EQK A;  5IG4 A;  1RRL A;  2CFD A;  4HM1 B;  3FG1 A;  3PXM A;  2W9P A;  3FF2 A;  3BNC A;  4NHF A;  5LC6 A;  1VQ8 3;  3F40 A;  1AR0 A;  1ROA A;  4N6L A;  2RSX A;  1STD A;  3HII A;  5JPU A;  1YIJ 3;  4XDV A;  5IF6 A;  5AI1 A;  1YJ9 3;  1DMM A;  1OHP A;  2GEY A;  1QVF 2;  4KZ1 A;  3I55 3;  2CKF B;  2QGU A;  3FCS B;  1OGX A;  1N5P A;  5KP4 A;  1UI7 A;  3B4O A;  5EVH A;  3OXA A;  1WMO A;  1IVU A;  2CHC A;  4KFF A;  3EF8 A;  3CPO A;  5D83 A;  4QWT A;  3GWR A;  1K8A 4;  2W9Q A;  4HM7 B;  1IQ8 A;  3T8U A;  3Q90 A;  6STD A;  1JB5 A;  2GXF A;  2IMJ A;  3PGB A;  3EQQ B;  3NBJ A;  1OF5 B;  4R9L A;  4KFD A;  1Y4K A;  2A15 A;  3SXX A;  3OX9 A;  2CFL A;  3IPT A;  1VQP 3;  1SPU A;  1JB4 A;  4FMC A;  3NM2 A;  4EBG A;  1VQK 3;  1JV2 B;  2HMJ B;  3BB9 A;  1ROV A;  3CNM A;  4WP5 A;  4WHA A;  3FKA A;  1CYV A;  3HZP A;  1G96 A;  3B4P A;  2QA4 3;  3HK4 A;  3NX0 A;  3QRD A;  4MMZ B;  2YFL B;  2R4I A;  4HZB B;  1GD4 A;  1K73 4;  3O8Y A;  4R80 A;  3CCE 3;  1GY5 A;  7STD A;  1KC8 4;  1NB5 I;  4OUQ A;  2YX9 A;  3KZT A;  3FF0 A;  2E2V A;  1IDP A;  1SQW A;  3CC4 3;  5CXO A;  3EN8 A;  1UI8 A;  3G71 3;  4H3U A;  2Q07 A;  1FGT A;  5AEU B;  1GS3 A;  3TDG A;  4BTX A;  1ULJ B;  2C11 A;  3M8C A;  5AIF A;  1NDO B;  3DY5 A;  3OW2 2;  3CMA 3;  1AVL A;  3X41 A;  1W5Z A;  1VQ6 3;  3HI7 A;  1S72 3;  1YHQ 3;  3SED A;  3G4S 3;  3CCS 3;  1CYU A;  2CH9 A;  2CWU A;  1GY6 A;  3MHE A;  3CCR 3;  3BND A;  4WWU C;  1FGQ A;  1AV4 A;  4EXR A;  2W56 B;  1SIH A;  1O7M B;  2XGL A;  1OHS A;  1TIJ A;  3RGR A;  2F86 B;  3LTC A;  4FCM A;  3S27 A;  1UW1 A;  1JJ2 2;  5IEO A;  1KD1 4;  4RNY A;  1M90 4;  4PEJ A;  4FR9 A;  1TFK A;  1M9G A;  3SLU A;  1VQ4 3;  2LQV A;  2GBX B;  3KII A;  2CW9 A;  1VZZ A;  4CDL A;  1K9M 4;  1DVC A;  3X3X A;  3LZA A;  3K7C A;  1IQX A;  4HVN A;  3SOA A;  4K90 B;  1ASK A;  3A76 A;  2GBW B;  3MKI A;  5ELJ A;  3J7Y d;  1LNH A;  5JBS A;  2E2U A;  3Q2P A;  3PCS A;  1DYU A;  3UL6 A;  1O7W B;  1NU3 A;  3UJM A;  5STD A;  4N6N B;  2GU3 A;  2Z7A A;  4EV5 A;  1M1K 4;  2WGQ A;  2KCD A;  3JUQ A;  4R9K A;  4FMA A;  5LC7 A;  3OWS A;  4IT7 A;  2FXT A;  3KSP A;  4MMX B;  1C7H A;  1W00 A;  1KSI A;  2SBL A;  2FNQ A;  3NM7 A;  2P0X A;  2XR8 B;  1JKG A;  2OCT A;  3F7S A;  2P09 A;  3LXU X;  1ZX2 A;  4Q53 A;  3EB8 A;  3V98 A;  3DZL A;  3K5T A;  4MMY B;  3JUN A;  4N3V A;  3F14 A;  3DMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...