1OGXA

High resolution crystal structure of ketosteroid isomerase mutant d40n(d38n, ti numbering) from pseudomonas putida complexed with equilenin at 2.0 a resolution.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Detection of Large Pka Perturbation of an Inhibitor and a Catalytic Group at an Enzyme Active Site, a Mechanistic Basis for Catalytic Power of Many Enzymes
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ogxA00
1ULJB 5KP1A 1WQLB 3FKAA 3HK4A 1O7WB 3OWSA 4X2OA 3RGRA 3NXJA 4HM3B 4R9LA 4L8PA 2XRXB 2OWPA 3GZYB 2INXA 4X2HA 4XB5A 2W2CA 3JUOA 3FSDA 2F99A 4HM1B 5D81A 1JB2A 3STDA 3HZPA 1EA2A 1ASKA 2R4IA 3FF2A 5G2GA 1OHOA 7STDA 3MG2A 3SEDA 2HMMB 5TGNA 5D82A 4IIAA 1GY6A 3MKIA 3NM2A 4HM7B 3CNXA 1STDA 1OF5A 4RZMA 1OCVA 1NDOB 5IEPA 1JB5A 3BB9A 1ZX2A 3EX9A 3OX9A 2B24B 4XBYA 3F14A 3MYTA 3EQQB 1SJWA 5AEWB 4STDA 3EJVA 5AIFA 3CPOA 3Q90A 3K0ZA 1NU3A 1EG9B 3NHXA 4XDWA 3OWUA 5AI1A 2CHCA 4OUQA 1JKGA 3GZBA 4CDLA 3CNMA 2F86B 3F7XA 1W6YA 2RFRA 1OF5B 5EVHA 2Z77A 1AR0A 1ULIB 2YFLB 2GEXA 3GZXB 1Z1SA 2YFJB 3JUPA 5KP3A 5BXQA 2HMLB 3KE7A 2HMJB 1OHSA 5IERA 2XR8B 3A76A 3EF8A 4XBXA 2JQ5A 3NBRA 2GBWB 1DMMA 4R1KA 3KKGA 3B4OA 1OGZA 4HKVB 2GXFA 2STDA 2PZVA 2XSOB 3DXOA 1W01A 5DREA 4MJDA 1C7HA 2BNGA 1O7MB 1JN5A 3EBYA 3JUNA 4ORLA 4WYKA 1OH0A 5AIIA 4H3UA 5AEUB 1E3VA 4GB5A 2BMQB 1U5OA 4HZBB 3F8XA 1CQSA 5JPUA 3SOYA 3EC9A 1DMQA 1E97A 3FZWA 3KSPA 3DMCA 1JB4A 3ROBA 3D9RA 3E99A 4LEHA 5AIGA 3EN8A 5CK6A 4U13A 4K1UA 2RGQA 5HGRA 6STDA 4J9AA 1S5AA 1O7HB 4XBTA 3MG1A 3F40A 1QJGA 5IEOA 5IG0A 2Z76A 1GS3A 3ECFA 5JPPA 4J8TA 4LMIA 4WYKB 4WWUC 1UUVB 3EN1B 1HKXA 3K7CA 3DM8A 4I4KA 1UUWB 3B8LA 4HM8B 2UX0A 2HMOB 5STDA 5IG4A 4K1VA 4FCMA 1GY5A 3KZTA 3VGNA 3M8CA 1Q40A 5DRVA 3MHEA 3G16A 1GYBA 1OHPA 4XM4A 1GY7A 1O7NB 2F98A 3BLZA 2IMJA 5IG5A 4L7KA 1W02A 5IF6A 3IPTA 1NWWA 2HMKB 3CU3A 2GEYA 1TP6A 3FF0A 4WP5A 2BMOB 3LYGA 1ZO2A 3F8HA 3UJMA 3ER7A 4N3VA 1BUQA 3FGYA 2QGUA 5FW5A 3JUMA 4PEJA 1JKGB 3JUQA 1IDPA 5IENA 4XDVA 2GBXB 5CLKA 4HM2B 3H3HA 5CXOA 3FLJA 5KP4A 2QIYA 3LZAA 3HX8A 3UNLA 3S5CA 2BMRB 1Q40B 4HM0B 4HJLB 5IG3A 2B1XB 5CF1A 3I0YA 1O7PB 3G8ZA 3G0KA 1OPYA 1OGXA 5BVBA 4HZ9B 3DUKA 3NV0A 1DMNA 1O7GB 5CF2A 3FH1A 3VSYA 3H51A 2HMNB 2XSHB 4L8OA 3OWYA 3F9SA 3WMDA 5D83A 1JN5B 2YFIB 4HM4B 3OV4A 5AIHA 1K41A 4LGQA 4OVMA 2K54A 4R9KA 2RCDA 1E3RA 1A2KA 1ISKA 4Q53A 3T8UA 3EHCA 1W00A 4KVHA 4FCJA 3GWRA 3NUVA 3T8NA 3DZLA 1OUNA 4HM5B 3OXAA 3EBTA 1VZZA 3GRDA 3RGAA 1TUHA 2Z7AA 8CHOA 3B4PA 1QMAA 2CKFB 3NV0B 2I9WA 3F7SA 3MSOA 2A15A 3GZRA 4HM6B 1Q42A 3SOAA 4HVNA 3B7CA 3MG3A
chains in the Genus database with same CATH superfamily
1ULJB 3PZWA 5KP1A 1SIHA 1WQLB 3FKAA 4EV2A 3GAXA 3BNEA 3HK4A 1Q7HA 2FNQA 1O7WB 4JRFA 8RNTA 1ZGXA 1BRSA 3WA2X 2MC8A 4BIRA 2AADA 2WOFA 3U97A 3OWSA 4X2OA 3RGRA 1BNJA 1GMRA 3NXJA 1V57A 2ZHXB 1V58A 1EEJA 4HM3B 4R9LA 4L8PA 2XRXB 4HAAA 1B2SA 1Q814 2OWPA 3AHSA 3GZYB 3S27A 2INXA 4X2HA 3V92A 1Q7Y4 4XB5A 3I563 1GD4A 4AKZA 1GOVA 1W2ZA 1LRAA 2CFDA 1BRIA 1SPUA 1RGHA 2PNCA 2W2CA 3JUOA 3FSDA 2F99A 4HM1B 5D81A 1JB2A 3STDA 2E2UA 2XF3A 2ZA4A 1I2GA 3HZPA 1IV7A 1IQYA 1V74A 1EA2A 3CXC2 3CCJ3 1VQ83 2QA43 4NHFA 2IYJA 3I553 3S29A 1ASKA 2BO9B 2R4IA 5A0OB 3FF2A 3URPA 3FCSB 1YJN3 2F5WA 5G2GA 1OHOA 4OK0A 1I8VA 3ZFZA 3PS8A 7STDA 3LTAA 3MG2A 3QRDA 3SEDA 1UCIA 1BSCA 2HMMB 5TGNA 2WO0A 5D82A 4IIAA 3HIGA 1GY6A 1IVWA 4K90B 3MKIA 1IK3A 1Q9EA 3IMAB 3LTDA 3NM2A 1BIRA 4HM7B 3ZG5A 1OACA 5ELUA 3CNXA 1AVLA 6RNTA 1FA3A 4N6V0 1STDA 1OF5A 3WOEB 3N9HA 1FYSA 5RNTA 1I3IA 2C4BA 1LQMB 4IT7A 5M18A 1M9GA 4RZMA 1RSNA 4LYLB 1OCVA 2GU1A 1LVNA 4N6NB 1NDOB 2KF3A 5IEPA 1KQS2 1D6YA 1JB5A 3BB9A 2P0MA 4EW5A 1B27A 1BSBA 2E2VA 3LTCA 1YJ93 1BNSA 1ZX2A 3EX9A 3OX9A 1EUIC 2RBIA 5LC7A 3MPHA 2B24B 1N8QA 1X1WA 1RKYA 2OQEA 6GSPA 4XBYA 3L0RA 1IQ8A 3F14A 3D3LA 3MYTA 4MMXB 4KT3B 2R41A 1LQGC 3EQQB 1SJWA 2KF6A 1JJ22 3AGNA 5AEWB 1AQZA 4STDA 4RNTA 3EJVA 3PYJA 3KIIA 5AIFA 1UGIA 3CPOA 3Q90A 1NB3I 3K0ZA 3S67A 1JBSA 4TX4A 1VQ93 1NU3A 4O02B 1YHQ3 3J7Yd 1EG9B 3NHXA 1Q824 1SQWA 3KCHA 2ML6A 2OCTA 1BRGA 3DGLA 4XDWA 1WMPA 1VQ73 3OWUA 5AI1A 3AMOB 2CHCA 2CWVA 1N8R4 3CMA3 4ILFA 2OTJ3 5D83A 3T0UA 1UUGB 1TJDA 2CW9A 1JKGA 4OUQA 1A90A 3GZBA 4CDLA 3CCR3 1W7CA 1VQO3 4HYZA 3CNMA 2F86B 3K63A 1MGWA 3F7XA 1JBTA 1W6YA 2H0HA 1RGLA 2RFRA 1OF5B 3CC43 2ZDJA 3BU4A 1DVDA 1FGMA 4HBRA 5EVHA 4DKIA 1BSAA 2Z77A 1AR0A 1RGAA 1I3FA 1ULIB 2YFLB 5AYRB 1T2IA 2HOHA 2GEXA 5BIRA 2BHMA 3GZXB 1Z1SA 2W9PA 2YFJB 3EB8A 1B2UA 3JUPA 5KP3A 2WGQA 2CG0A 3NX0A 4BL3A 1AY7A 1WNHA 5BXQA 3DY5A 1YI23 2HMLB 2SBLA 3B7CA 4N6OB 1QVF2 2P09A 3KE7A 1CH0A 2CX1A 1ROVA 2HMJB 1VQN3 4O8SA 3KFQC 1D6ZA 3LT9A 1UI7A 1OHSA 2F4YA 5IERA 1PU4A 2XR8B 1RCKA 3A76A 3EF8A 3HIIA 3SXXA 4CCVA 4XBXA 2JQ5A 3NBRA 2GBWB 3CCS3 1M1K4 2ZL8A 1DMMA 2D42A 3BIRA 4R1KA 3KKGA 3D5GA 2OOVA 1B20A 3B4OA 1T5YA 1OGZA 2BU4A 1FGTA 2C11A 3BNBA 3NBBA 2OQEC 1LNHA 3OW22 2K3DA 1B21A 4HKVB 2GXFA 3CC23 1YVSA 1JZOA 3PCSA 1BOXA 2Y74A 4IPBA 2STDA 1VQ53 1BRNL 2PZVA 1IV9A 2XSOB 3DXOA 1UCJA 3TDGA 2F56A 1W01A 5LC6A 2H0IA 2K0MA 3CCV3 1HYFA 5DREA 4MJDA 1C7HA 4I5QA 2BNGA 4H61A 1BRKA 1O7MB 1R4CA 3DH2A 3CCL3 1JN5A 1F8NA 1RRLA 3EBYA 3JUNA 4ORLA 1GOUA 4O2HA 4WYKA 1OH0A 2Q07A 3BNCA 3UB1A 5AIIA 4H3UA 5AEUB 1BNGA 1R4YA 3D5IA 2RSXA 1IT7A 4K61A 4KZ1A 1UCLA 2W56A 1GMPA 4CPKA 1G96A 1RGFA 3AGOA 1KD14 4LZIA 4CJNA 1E3VA 4GB5A 2D1WA 2XFTA 1TRPA 5JBSA 4FMDA 2JDIH 5G1KA 1RNBA 3LT8A 2BMQB 1U5OA 4HZBB 2Z6BA 3F8XA 4LSOA 1CQSA 5JPUA 1KC84 3SOYA 3EC9A 1QALA 1DMQA 4BTYA 1DE3A 1E97A 1BU4A 1I2FA 1UCKA 3FZWA 3KSPA 1PY3A 2CK3H 1BAOA 3DMCA 3LOYA 1JB4A 1RN4A 3ROBA 3D9RA 3E99A 3X3ZA 4LEHA 2KCDA 5AIGA 2WGOA 2L1SA 4NREA 3Q1CA 1VQK3 1LOWA 1TRQA 4EBGA 3EN8A 1STFI 3G6E3 1FGRA 4MMZB 5CK6A 4U13A 2CH9A 4K1UA 1AV4A 1GMQA 1T3BA 2RGQA 4WHAA 5HGRA 6STDA 2QEX3 1TFKA 1FZUA 1IT8A 1S5AA 4J9AA 5BU4A 3WA3A 1MWTA 1O7HB 1FW7A 2P38A 3FG3A 3MG1A 4XBTA 3KN4A 3F40A 1QJGA 1B2ZA 1X1XA 1EQKA 1US1A 5IEOA 4KFFA 2CG1A 2OOVC 2ML5A 3RNTA 3V98A 4QWTA 5IG0A 2Z76A 1GS3A 3ECFA 3NM7A 3PGBA 5JPPA 1JRQA 4J8TA 1IQXA 1K8A4 1X1YA 4LMIA 1RGEA 4WYKB 2IY2A 4WWUC 1I0VA 1DVCA 1UUVB 3LMLA 3X3YA 2KXGA 3EN1B 1HKXA 3K7CA 4N6UA 2GU3A 2M7OA 1BSEA 3DM8A 1QVG2 4I4KA 5ELJA 3QK9A 5GSPA 1UUWB 1YVBI 2C10A 1KSIA 2KAAA 3B8LA 4HM8B 2UX0A 3UL6A 1NB5I 1MGRA 5IW9A 5AYSC 1RDSA 3CC73 2HMOB 1LOVA 5STDA 3IJEB 4GL6A 1RTUA 1MNLA 3BNDA 5IG4A 1T2HA 3KSED 1BGSA 3A5EA 4FCMA 4K1VA 1GY5A 3KZTA 1FGOA 1ZS7A 1RCLA 3VGNA 3M8CA 3SVAA 1Q40A 5DRVA 1MWSA 3MHEA 4N6MA 1BNFA 1BRHA 3G16A 1GYBA 3SYUA 3NBJA 1OHPA 1RMSA 4XM4A 3PCRA 1GD3A 1BSDA 2V1LA 2W6JH 2CFLA 1GY7A 1O7NB 2F98A 1L5GB 3BLZA 2FXTA 1RRHA 4N6TA 1VQ63 2IMJA 7RNTA 5IG5A 4L7KA 3V99A 3G4S3 1W02A 5IF6A 1TTOA 2XGLA 7GSPA 3IPTA 1NWWA 3G713 1NJI4 2HMKB 2O9UX 3CME3 5FGOA 4GHOA 1K734 1BANA 3CU3A 2GEYA 1TP6A 3FF0A 3N8BA 4WP5A 1WTHA 2W9QA 3UL5A 2BMOB 3LYGA 1N5PA 1ZO2A 2LYXA 3F8HA 1X1UA 3K5TA 3CCE3 3K9MC 4R80A 1LNIA 1JBRA 3UJMA 1SIIA 3ER7A 2W0QA 3CD63 4N3VA 2RNTA 3Q2PA 5EEOA 4ZM8A 1VQP3 1BUQA 3FGYA 2QGUA 5FW5A 4WFOA 3LH4A 5HOHA 3JUMA 1B2XA 2GSPA 3LTBA 4PEJA 1WMOA 1JKGB 3JUQA 5M1AA 2XEPA 3WHOA 2CC3A 1IDPA 2W03A 1B3SA 3MWZA 1RLSA 3D4AA 1BRJA 4XDVA 5IENA 1CEWI 1G0TA 2GBXB 1LXEA 2W04A 1BNEA 1ROAA 1I0XA 1RGGA 1QAFA 5CLKA 4HM2B 1EKMA 2CFKA 2L4VA 3H3HA 4N6LA 5CXOA 3FLJA 1JV2B 3ZG0A 4EC6A 5KP4A 2QIYA 3LZAA 3HX8A 4J5KA 2IA7A 1BNIA 4RNYA 3UNLA 3S5CA 2BMRB 1Q40B 1W5ZA 2MF7A 2P0XA 4HM0B 1W2B2 1UGHI 1CYVA 3WOFB 4HJLB 5IG3A 1HU9A 2B1XB 2IUKA 1RNTA 3X3XA 2IUJA 3PXMA 5CF1A 1YJW3 4EXRA 3GSPA 3RDEA 3X42A 1VQQA 3I0YA 5I97A 3AMOA 1O7PB 3G8ZA 3X40A 3DGMA 3G0KA 1FGQA 1G02A 2YX9A 5G1LA 1B2MA 1VQL3 1OPYA 1FUWA 1N5HA 1MWRA 4FMCA 1K9M4 1IU7A 1OGXA 1NO3A 5BVBA 4BU4A 2O3OA 4GSPA 4HZ9B 4AKYA 2H0GA 3DUKA 4RBNA 2UGIA 3NV0A 3CCU3 4BL2A 1WMNA 1DMNA 1O7GB 3WODG 2LQVA 5CF2A 2CWTA 1BUJA 2KF5A 1RN1A 2CFGA 9RNTA 3FG1A 3X41A 3FH1A 3Q3FA 4R4KA 3VF1A 3VSYA 3H51A 3JVCA 1A67A 2OTL3 2CWUA 2HMNB 2XSHB 4L8OA 3OWYA 3CCM3 1MOLA 3F9SA 4KFDA 3WDGB 5EQLA 3WMDA 1VQM3 1DYUA 1IVUA 1JN5B 2YFIB 1QAKA 3D79A 1RGCA 2KF4A 4HM4B 2F5MA 4J5GA 3OV4A 4EYCA 1YIJ3 5AIHA 1KWIA 1FUSA 1PFPA 4EV5A 1K41A 1GOYA 1RJOA 2E2TA 3EE1A 1NNVA 1YGWA 1TU5A 3SX1A 2W56B 1C54A 2BT3A 2UUGC 1TFOA 2KRTA 3AHWA 4FR9A 4LGQA 2CIUA 4OVMA 1YIT3 2XH9A 4HOHA 2K54A 4R9KA 2RCDA 1E3RA 3ALAA 1UDII 1A2KA 2XFSA 4FMBA 1BNRA 3HOHA 3CPW2 1D6UA 1ISKA 1LOXA 4Q53A 3T8UA 1I70A 3EHCA 3SLUA 1W00A 1GSPA 1RN7A 4KVHA 4FCJA 1Q864 1RHLA 1TIJA 4JF8A 3DGOA 2Y73A 2AAEA 3GWRA 1N9EA 3LXUX 3NUVA 1AVKA 3S28A 3WR2A 3T8NA 4BTXA 3N54B 1A2VA 3DZLA 1RGKA 1OUNA 3O8YA 4HM5B 3CCQ3 1Y4KA 2FGTA 1DETA 3EBTA 1VZZA 3OXAA 5M19A 1HZ1A 1YGEA 3GRDA 1BVIA 1PYLA 1UW1A 4BTWA 1MWUA 1W6CA 1I2EA 4FMAA 1W4NA 2XGNA 4AEQA 2CFWA 2WOHA 1M1XB 1TUHA 3NQYA 3RGAA 2Z7AA 1A2PA 1UI8A 8CHOA 2SARA 3B4PA 1IVVA 1QMAA 4MMYB 1W6GA 1YNVX 1LOYA 2CKFB 3NV0B 2I9WA 1K28A 4FCZA 2J8XB 3F7SA 3MSOA 2A15A 3FG4A 1CYUA 3DGNA 3GZRA 1M904 1IVXA 3DGYA 1VQ43 4HM6B 4RNZA 2BIRA 3HI7A 1JZDA 1N9JA 4G1MB 2P05A 1JNQA 4NPBA 1SARA 3U1WA 1Q42A 1J2BA 3NQZA 3SOAA 1IYYA 4O3VA 1S723 4HVNA 1FUTA 4KFEA 4MEIA 1U8CB 2CX0A 3MG3A
chains in the Genus database with same CATH topology
1ULJB 3PZWA 5KP1A 1SIHA 1WQLB 3FKAA 4EV2A 3GAXA 3BNEA 3HK4A 2FNQA 4JRFA 1O7WB 3WA2X 2MC8A 2WOFA 3U97A 3OWSA 4X2OA 3RGRA 3NXJA 4HM3B 4R9LA 4L8PA 2XRXB 1Q814 2OWPA 3GZYB 3S27A 1Q7Y4 2INXA 4X2HA 3V92A 4XB5A 3I563 1GD4A 4AKZA 1W2ZA 2CFDA 2PNCA 1SPUA 2W2CA 3JUOA 3FSDA 2F99A 4HM1B 5D81A 1JB2A 3STDA 2E2UA 2XF3A 3HZPA 1IV7A 1IQYA 1V74A 1EA2A 3CXC2 3CCJ3 1VQ83 2QA43 4NHFA 3I553 3S29A 1ASKA 2BO9B 2R4IA 5A0OB 3FF2A 3FCSB 1YJN3 5G2GA 1OHOA 4OK0A 3PS8A 7STDA 3LTAA 3MG2A 3QRDA 3SEDA 2HMMB 5TGNA 2WO0A 5D82A 4IIAA 3HIGA 1GY6A 1IVWA 4K90B 3MKIA 1IK3A 3IMAB 3LTDA 3NM2A 4HM7B 1OACA 5ELUA 3CNXA 1AVLA 1FA3A 4N6V0 1STDA 1OF5A 3WOEB 3N9HA 4IT7A 1M9GA 4RZMA 1OCVA 2GU1A 1LVNA 4N6NB 1NDOB 5IEPA 1KQS2 1D6YA 1JB5A 3BB9A 2P0MA 2E2VA 3LTCA 1YJ93 1ZX2A 3EX9A 3OX9A 5LC7A 3MPHA 2B24B 1N8QA 1RKYA 2OQEA 4XBYA 3L0RA 1IQ8A 3F14A 3D3LA 3MYTA 4MMXB 3EQQB 1SJWA 1JJ22 5AEWB 4STDA 3EJVA 3PYJA 3KIIA 5AIFA 3CPOA 3Q90A 1NB3I 3K0ZA 3S67A 4TX4A 1VQ93 1NU3A 4O02B 1YHQ3 3J7Yd 1EG9B 3NHXA 1Q824 1SQWA 2ML6A 2OCTA 3DGLA 4XDWA 1WMPA 1VQ73 3OWUA 5AI1A 3AMOB 2CHCA 2CWVA 1N8R4 3CMA3 2OTJ3 3T0UA 2CW9A 4OUQA 1JKGA 1A90A 3GZBA 4CDLA 3CCR3 1W7CA 1VQO3 4HYZA 3CNMA 2F86B 3K63A 3F7XA 1W6YA 2RFRA 1OF5B 3CC43 2ZDJA 1DVDA 1FGMA 4HBRA 5EVHA 2Z77A 1AR0A 1ULIB 2YFLB 5AYRB 2GEXA 2BHMA 3GZXB 1Z1SA 2W9PA 2YFJB 3EB8A 3JUPA 5KP3A 2WGQA 2CG0A 3NX0A 5BXQA 1WNHA 1YI23 3DY5A 2HMLB 2SBLA 4N6OB 1QVF2 2P09A 3KE7A 1ROVA 2HMJB 1VQN3 4O8SA 3KFQC 1D6ZA 3LT9A 1UI7A 1OHSA 5IERA 1PU4A 2XR8B 3A76A 3EF8A 3HIIA 3SXXA 4CCVA 4XBXA 2JQ5A 3NBRA 2GBWB 3CCS3 1M1K4 2ZL8A 1DMMA 2D42A 4R1KA 3KKGA 2OOVA 3B4OA 1T5YA 1OGZA 1FGTA 2C11A 3BNBA 3NBBA 2OQEC 1LNHA 3OW22 3CC23 4HKVB 2GXFA 3PCSA 2Y74A 4IPBA 2STDA 1VQ53 2PZVA 1IV9A 2XSOB 3DXOA 3TDGA 5LC6A 1W01A 2K0MA 3CCV3 5DREA 4MJDA 1C7HA 2BNGA 4H61A 1O7MB 1R4CA 3CCL3 1JN5A 1F8NA 1RRLA 3EBYA 3JUNA 4ORLA 4O2HA 4WYKA 3UB1A 1OH0A 2Q07A 3BNCA 5AIIA 4H3UA 5AEUB 2RSXA 1IT7A 4K61A 4KZ1A 2W56A 1G96A 1KD14 4LZIA 1E3VA 4GB5A 2D1WA 2XFTA 5JBSA 4FMDA 2JDIH 3LT8A 2BMQB 1U5OA 4HZBB 2Z6BA 3F8XA 4LSOA 1CQSA 5JPUA 1KC84 3SOYA 3EC9A 1QALA 1DMQA 4BTYA 1E97A 3FZWA 3KSPA 2CK3H 3LOYA 3DMCA 1JB4A 3ROBA 3D9RA 3E99A 3X3ZA 4LEHA 2KCDA 5AIGA 2WGOA 4NREA 3Q1CA 1VQK3 4EBGA 3EN8A 1STFI 3G6E3 1FGRA 4MMZB 5CK6A 4U13A 2CH9A 4K1UA 1AV4A 2RGQA 5HGRA 4WHAA 6STDA 2QEX3 1TFKA 4J9AA 1IT8A 1S5AA 3WA3A 1O7HB 2P38A 3FG3A 3MG1A 4XBTA 3KN4A 3F40A 1QJGA 1EQKA 1US1A 5IEOA 4KFFA 2CG1A 2OOVC 2ML5A 3V98A 4QWTA 5IG0A 2Z76A 1GS3A 3ECFA 3NM7A 3PGBA 5JPPA 1JRQA 4J8TA 1IQXA 1K8A4 4LMIA 4WYKB 4WWUC 3X3YA 1DVCA 1UUVB 3LMLA 2KXGA 3EN1B 1HKXA 3K7CA 4N6UA 2GU3A 2M7OA 3DM8A 1QVG2 4I4KA 5ELJA 3QK9A 1UUWB 1YVBI 2C10A 1KSIA 3B8LA 3UL6A 4HM8B 2UX0A 1NB5I 5IW9A 5AYSC 3CC73 2HMOB 5STDA 3IJEB 4GL6A 1MNLA 3BNDA 5IG4A 3KSED 4K1VA 4FCMA 1GY5A 3KZTA 1FGOA 3VGNA 3M8CA 3SVAA 1Q40A 5DRVA 3MHEA 4N6MA 3G16A 1GYBA 3NBJA 1OHPA 4XM4A 3PCRA 1GD3A 2V1LA 2W6JH 2CFLA 1GY7A 1O7NB 2F98A 1L5GB 3BLZA 2FXTA 1RRHA 4N6TA 1VQ63 2IMJA 5IG5A 4L7KA 3V99A 3G4S3 1W02A 5IF6A 2XGLA 3G713 3IPTA 1NWWA 1NJI4 2HMKB 2O9UX 3CME3 5FGOA 1K734 3CU3A 2GEYA 1TP6A 3FF0A 3N8BA 4WP5A 1WTHA 2W9QA 3UL5A 2BMOB 3LYGA 1N5PA 1ZO2A 2LYXA 3F8HA 3K5TA 3CCE3 3K9MC 4R80A 3UJMA 1SIIA 3ER7A 2W0QA 3CD63 4N3VA 3Q2PA 5EEOA 1VQP3 4ZM8A 1BUQA 3FGYA 2QGUA 5FW5A 4WFOA 3LH4A 3JUMA 3LTBA 4PEJA 1WMOA 1JKGB 3JUQA 2XEPA 2CC3A 1IDPA 2W03A 3MWZA 5IENA 4XDVA 1CEWI 2GBXB 2W04A 1LXEA 1ROAA 5CLKA 1QAFA 4HM2B 1EKMA 2CFKA 2L4VA 3H3HA 4N6LA 5CXOA 3FLJA 1JV2B 4EC6A 5KP4A 2QIYA 3LZAA 3HX8A 2IA7A 4RNYA 3UNLA 3S5CA 2BMRB 1Q40B 1W5ZA 2MF7A 2P0XA 4HM0B 1W2B2 1CYVA 3WOFB 4HJLB 5IG3A 1HU9A 2B1XB 2IUKA 3X3XA 2IUJA 3PXMA 5CF1A 1YJW3 4EXRA 3RDEA 3X42A 3I0YA 5I97A 3AMOA 1O7PB 3G8ZA 3X40A 3DGMA 3G0KA 1FGQA 2YX9A 1VQL3 1OPYA 1FUWA 1N5HA 4FMCA 1K9M4 1IU7A 1OGXA 1NO3A 5BVBA 2O3OA 4HZ9B 4AKYA 3CCU3 3DUKA 4RBNA 3NV0A 1WMNA 1DMNA 1O7GB 3WODG 2LQVA 5CF2A 2CWTA 2CFGA 3FG1A 3X41A 3FH1A 4R4KA 3VF1A 3VSYA 3H51A 3JVCA 1A67A 2OTL3 2CWUA 2HMNB 2XSHB 4L8OA 3OWYA 3CCM3 1MOLA 3F9SA 4KFDA 3WDGB 5EQLA 3WMDA 1VQM3 1DYUA 1IVUA 1JN5B 2YFIB 1QAKA 4HM4B 5D83A 1YIJ3 3OV4A 4EYCA 5AIHA 1KWIA 1PFPA 4EV5A 1K41A 1RJOA 2E2TA 3EE1A 1TU5A 3SX1A 2W56B 2BT3A 4FR9A 1TFOA 2KRTA 4LGQA 2CIUA 4OVMA 1YIT3 2XH9A 2K54A 4R9KA 2RCDA 1E3RA 3ALAA 4FMBA 1A2KA 2XFSA 3CPW2 1D6UA 1ISKA 1LOXA 4Q53A 3T8UA 3EHCA 3SLUA 1W00A 1RN7A 4KVHA 4FCJA 1Q864 4JF8A 1TIJA 3DGOA 2Y73A 3GWRA 1N9EA 3LXUX 3NUVA 1AVKA 3S28A 3T8NA 4BTXA 3N54B 1A2VA 3DZLA 1OUNA 3O8YA 4HM5B 3CCQ3 1Y4KA 2FGTA 3OXAA 3EBTA 1VZZA 1YGEA 3GRDA 1UW1A 4BTWA 1W6CA 4FMAA 1W4NA 2XGNA 4AEQA 2CFWA 2WOHA 1M1XB 1TUHA 3NQYA 3RGAA 2Z7AA 1UI8A 8CHOA 3B4PA 1IVVA 1QMAA 4MMYB 1W6GA 2CKFB 3NV0B 2I9WA 1K28A 4FCZA 3F7SA 3MSOA 2A15A 3FG4A 1CYUA 3DGNA 3GZRA 1M904 1IVXA 1VQ43 4HM6B 4RNZA 3HI7A 1N9JA 4G1MB 2P05A 1JNQA 3U1WA 1Q42A 1J2BA 3NQZA 3SOAA 4O3VA 1S723 4HVNA 4KFEA 4MEIA 1U8CB 3B7CA 3MG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULJ B;  5KP1 A;  1WQL B;  3FKA A;  3HK4 A;  1O7W B;  3OWS A;  4X2O A;  3RGR A;  3NXJ A;  4HM3 B;  4R9L A;  4L8P A;  2XRX B;  2OWP A;  3GZY B;  2INX A;  4X2H A;  4XB5 A;  2W2C A;  3JUO A;  3FSD A;  2F99 A;  4HM1 B;  5D81 A;  1JB2 A;  3STD A;  3HZP A;  1EA2 A;  1ASK A;  2R4I A;  3FF2 A;  5G2G A;  1OHO A;  7STD A;  3MG2 A;  3SED A;  2HMM B;  5TGN A;  5D82 A;  4IIA A;  1GY6 A;  3MKI A;  3NM2 A;  4HM7 B;  3CNX A;  1STD A;  1OF5 A;  4RZM A;  1OCV A;  1NDO B;  5IEP A;  1JB5 A;  3BB9 A;  1ZX2 A;  3EX9 A;  3OX9 A;  2B24 B;  4XBY A;  3F14 A;  3MYT A;  3EQQ B;  1SJW A;  5AEW B;  4STD A;  3EJV A;  5AIF A;  3CPO A;  3Q90 A;  3K0Z A;  1NU3 A;  1EG9 B;  3NHX A;  4XDW A;  3OWU A;  5AI1 A;  2CHC A;  4OUQ A;  1JKG A;  3GZB A;  4CDL A;  3CNM A;  2F86 B;  3F7X A;  1W6Y A;  2RFR A;  1OF5 B;  5EVH A;  2Z77 A;  1AR0 A;  1ULI B;  2YFL B;  2GEX A;  3GZX B;  1Z1S A;  2YFJ B;  3JUP A;  5KP3 A;  5BXQ A;  2HML B;  3KE7 A;  2HMJ B;  1OHS A;  5IER A;  2XR8 B;  3A76 A;  3EF8 A;  4XBX A;  2JQ5 A;  3NBR A;  2GBW B;  1DMM A;  4R1K A;  3KKG A;  3B4O A;  1OGZ A;  4HKV B;  2GXF A;  2STD A;  2PZV A;  2XSO B;  3DXO A;  1W01 A;  5DRE A;  4MJD A;  1C7H A;  2BNG A;  1O7M B;  1JN5 A;  3EBY A;  3JUN A;  4ORL A;  4WYK A;  1OH0 A;  5AII A;  4H3U A;  5AEU B;  1E3V A;  4GB5 A;  2BMQ B;  1U5O A;  4HZB B;  3F8X A;  1CQS A;  5JPU A;  3SOY A;  3EC9 A;  1DMQ A;  1E97 A;  3FZW A;  3KSP A;  3DMC A;  1JB4 A;  3ROB A;  3D9R A;  3E99 A;  4LEH A;  5AIG A;  3EN8 A;  5CK6 A;  4U13 A;  4K1U A;  2RGQ A;  5HGR A;  6STD A;  4J9A A;  1S5A A;  1O7H B;  4XBT A;  3MG1 A;  3F40 A;  1QJG A;  5IEO A;  5IG0 A;  2Z76 A;  1GS3 A;  3ECF A;  5JPP A;  4J8T A;  4LMI A;  4WYK B;  4WWU C;  1UUV B;  3EN1 B;  1HKX A;  3K7C A;  3DM8 A;  4I4K A;  1UUW B;  3B8L A;  4HM8 B;  2UX0 A;  2HMO B;  5STD A;  5IG4 A;  4K1V A;  4FCM A;  1GY5 A;  3KZT A;  3VGN A;  3M8C A;  1Q40 A;  5DRV A;  3MHE A;  3G16 A;  1GYB A;  1OHP A;  4XM4 A;  1GY7 A;  1O7N B;  2F98 A;  3BLZ A;  2IMJ A;  5IG5 A;  4L7K A;  1W02 A;  5IF6 A;  3IPT A;  1NWW A;  2HMK B;  3CU3 A;  2GEY A;  1TP6 A;  3FF0 A;  4WP5 A;  2BMO B;  3LYG A;  1ZO2 A;  3F8H A;  3UJM A;  3ER7 A;  4N3V A;  1BUQ A;  3FGY A;  2QGU A;  5FW5 A;  3JUM A;  4PEJ A;  1JKG B;  3JUQ A;  1IDP A;  5IEN A;  4XDV A;  2GBX B;  5CLK A;  4HM2 B;  3H3H A;  5CXO A;  3FLJ A;  5KP4 A;  2QIY A;  3LZA A;  3HX8 A;  3UNL A;  3S5C A;  2BMR B;  1Q40 B;  4HM0 B;  4HJL B;  5IG3 A;  2B1X B;  5CF1 A;  3I0Y A;  1O7P B;  3G8Z A;  3G0K A;  1OPY A;  1OGX A;  5BVB A;  4HZ9 B;  3DUK A;  3NV0 A;  1DMN A;  1O7G B;  5CF2 A;  3FH1 A;  3VSY A;  3H51 A;  2HMN B;  2XSH B;  4L8O A;  3OWY A;  3F9S A;  3WMD A;  5D83 A;  1JN5 B;  2YFI B;  4HM4 B;  3OV4 A;  5AIH A;  1K41 A;  4LGQ A;  4OVM A;  2K54 A;  4R9K A;  2RCD A;  1E3R A;  1A2K A;  1ISK A;  4Q53 A;  3T8U A;  3EHC A;  1W00 A;  4KVH A;  4FCJ A;  3GWR A;  3NUV A;  3T8N A;  3DZL A;  1OUN A;  4HM5 B;  3OXA A;  3EBT A;  1VZZ A;  3GRD A;  3RGA A;  1TUH A;  2Z7A A;  8CHO A;  3B4P A;  1QMA A;  2CKF B;  3NV0 B;  2I9W A;  3F7S A;  3MSO A;  2A15 A;  3GZR A;  4HM6 B;  1Q42 A;  3SOA A;  4HVN A;  3B7C A;  3MG3 A; 
#chains in the Genus database with same CATH topology
 1ULJ B;  3PZW A;  5KP1 A;  1SIH A;  1WQL B;  3FKA A;  4EV2 A;  3GAX A;  3BNE A;  3HK4 A;  1Q7H A;  2FNQ A;  1O7W B;  4JRF A;  8RNT A;  1ZGX A;  1BRS A;  3WA2 X;  2MC8 A;  4BIR A;  2AAD A;  2WOF A;  3U97 A;  3OWS A;  4X2O A;  3RGR A;  1BNJ A;  1GMR A;  3NXJ A;  1V57 A;  2ZHX B;  1V58 A;  1EEJ A;  4HM3 B;  4R9L A;  4L8P A;  2XRX B;  4HAA A;  1B2S A;  1Q81 4;  2OWP A;  3AHS A;  3GZY B;  3S27 A;  2INX A;  4X2H A;  3V92 A;  1Q7Y 4;  4XB5 A;  3I56 3;  1GD4 A;  4AKZ A;  1GOV A;  1W2Z A;  1LRA A;  2CFD A;  1BRI A;  1SPU A;  1RGH A;  2PNC A;  2W2C A;  3JUO A;  3FSD A;  2F99 A;  4HM1 B;  5D81 A;  1JB2 A;  3STD A;  2E2U A;  2XF3 A;  2ZA4 A;  1I2G A;  3HZP A;  1IV7 A;  1IQY A;  1V74 A;  1EA2 A;  3CXC 2;  3CCJ 3;  1VQ8 3;  2QA4 3;  4NHF A;  2IYJ A;  3I55 3;  3S29 A;  1ASK A;  2BO9 B;  2R4I A;  5A0O B;  3FF2 A;  3URP A;  3FCS B;  1YJN 3;  2F5W A;  5G2G A;  1OHO A;  4OK0 A;  1I8V A;  3ZFZ A;  3PS8 A;  7STD A;  3LTA A;  3MG2 A;  3QRD A;  3SED A;  1UCI A;  1BSC A;  2HMM B;  5TGN A;  2WO0 A;  5D82 A;  4IIA A;  3HIG A;  1GY6 A;  1IVW A;  4K90 B;  3MKI A;  1IK3 A;  1Q9E A;  3IMA B;  3LTD A;  3NM2 A;  1BIR A;  4HM7 B;  3ZG5 A;  1OAC A;  5ELU A;  3CNX A;  1AVL A;  6RNT A;  1FA3 A;  4N6V 0;  1STD A;  1OF5 A;  3WOE B;  3N9H A;  1FYS A;  5RNT A;  1I3I A;  2C4B A;  1LQM B;  4IT7 A;  5M18 A;  1M9G A;  4RZM A;  1RSN A;  4LYL B;  1OCV A;  2GU1 A;  1LVN A;  4N6N B;  1NDO B;  2KF3 A;  5IEP A;  1KQS 2;  1D6Y A;  1JB5 A;  3BB9 A;  2P0M A;  4EW5 A;  1B27 A;  1BSB A;  2E2V A;  3LTC A;  1YJ9 3;  1BNS A;  1ZX2 A;  3EX9 A;  3OX9 A;  1EUI C;  2RBI A;  5LC7 A;  3MPH A;  2B24 B;  1N8Q A;  1X1W A;  1RKY A;  2OQE A;  6GSP A;  4XBY A;  3L0R A;  1IQ8 A;  3F14 A;  3D3L A;  3MYT A;  4MMX B;  4KT3 B;  2R41 A;  1LQG C;  3EQQ B;  1SJW A;  2KF6 A;  1JJ2 2;  3AGN A;  5AEW B;  1AQZ A;  4STD A;  4RNT A;  3EJV A;  3PYJ A;  3KII A;  5AIF A;  1UGI A;  3CPO A;  3Q90 A;  1NB3 I;  3K0Z A;  3S67 A;  1JBS A;  4TX4 A;  1VQ9 3;  1NU3 A;  4O02 B;  1YHQ 3;  3J7Y d;  1EG9 B;  3NHX A;  1Q82 4;  1SQW A;  3KCH A;  2ML6 A;  2OCT A;  1BRG A;  3DGL A;  4XDW A;  1WMP A;  1VQ7 3;  3OWU A;  5AI1 A;  3AMO B;  2CHC A;  2CWV A;  1N8R 4;  3CMA 3;  4ILF A;  2OTJ 3;  5D83 A;  3T0U A;  1UUG B;  1TJD A;  2CW9 A;  1JKG A;  4OUQ A;  1A90 A;  3GZB A;  4CDL A;  3CCR 3;  1W7C A;  1VQO 3;  4HYZ A;  3CNM A;  2F86 B;  3K63 A;  1MGW A;  3F7X A;  1JBT A;  1W6Y A;  2H0H A;  1RGL A;  2RFR A;  1OF5 B;  3CC4 3;  2ZDJ A;  3BU4 A;  1DVD A;  1FGM A;  4HBR A;  5EVH A;  4DKI A;  1BSA A;  2Z77 A;  1AR0 A;  1RGA A;  1I3F A;  1ULI B;  2YFL B;  5AYR B;  1T2I A;  2HOH A;  2GEX A;  5BIR A;  2BHM A;  3GZX B;  1Z1S A;  2W9P A;  2YFJ B;  3EB8 A;  1B2U A;  3JUP A;  5KP3 A;  2WGQ A;  2CG0 A;  3NX0 A;  4BL3 A;  1AY7 A;  1WNH A;  5BXQ A;  3DY5 A;  1YI2 3;  2HML B;  2SBL A;  3B7C A;  4N6O B;  1QVF 2;  2P09 A;  3KE7 A;  1CH0 A;  2CX1 A;  1ROV A;  2HMJ B;  1VQN 3;  4O8S A;  3KFQ C;  1D6Z A;  3LT9 A;  1UI7 A;  1OHS A;  2F4Y A;  5IER A;  1PU4 A;  2XR8 B;  1RCK A;  3A76 A;  3EF8 A;  3HII A;  3SXX A;  4CCV A;  4XBX A;  2JQ5 A;  3NBR A;  2GBW B;  3CCS 3;  1M1K 4;  2ZL8 A;  1DMM A;  2D42 A;  3BIR A;  4R1K A;  3KKG A;  3D5G A;  2OOV A;  1B20 A;  3B4O A;  1T5Y A;  1OGZ A;  2BU4 A;  1FGT A;  2C11 A;  3BNB A;  3NBB A;  2OQE C;  1LNH A;  3OW2 2;  2K3D A;  1B21 A;  4HKV B;  2GXF A;  3CC2 3;  1YVS A;  1JZO A;  3PCS A;  1BOX A;  2Y74 A;  4IPB A;  2STD A;  1VQ5 3;  1BRN L;  2PZV A;  1IV9 A;  2XSO B;  3DXO A;  1UCJ A;  3TDG A;  2F56 A;  1W01 A;  5LC6 A;  2H0I A;  2K0M A;  3CCV 3;  1HYF A;  5DRE A;  4MJD A;  1C7H A;  4I5Q A;  2BNG A;  4H61 A;  1BRK A;  1O7M B;  1R4C A;  3DH2 A;  3CCL 3;  1JN5 A;  1F8N A;  1RRL A;  3EBY A;  3JUN A;  4ORL A;  1GOU A;  4O2H A;  4WYK A;  1OH0 A;  2Q07 A;  3BNC A;  3UB1 A;  5AII A;  4H3U A;  5AEU B;  1BNG A;  1R4Y A;  3D5I A;  2RSX A;  1IT7 A;  4K61 A;  4KZ1 A;  1UCL A;  2W56 A;  1GMP A;  4CPK A;  1G96 A;  1RGF A;  3AGO A;  1KD1 4;  4LZI A;  4CJN A;  1E3V A;  4GB5 A;  2D1W A;  2XFT A;  1TRP A;  5JBS A;  4FMD A;  2JDI H;  5G1K A;  1RNB A;  3LT8 A;  2BMQ B;  1U5O A;  4HZB B;  2Z6B A;  3F8X A;  4LSO A;  1CQS A;  5JPU A;  1KC8 4;  3SOY A;  3EC9 A;  1QAL A;  1DMQ A;  4BTY A;  1DE3 A;  1E97 A;  1BU4 A;  1I2F A;  1UCK A;  3FZW A;  3KSP A;  1PY3 A;  2CK3 H;  1BAO A;  3DMC A;  3LOY A;  1JB4 A;  1RN4 A;  3ROB A;  3D9R A;  3E99 A;  3X3Z A;  4LEH A;  2KCD A;  5AIG A;  2WGO A;  2L1S A;  4NRE A;  3Q1C A;  1VQK 3;  1LOW A;  1TRQ A;  4EBG A;  3EN8 A;  1STF I;  3G6E 3;  1FGR A;  4MMZ B;  5CK6 A;  4U13 A;  2CH9 A;  4K1U A;  1AV4 A;  1GMQ A;  1T3B A;  2RGQ A;  4WHA A;  5HGR A;  6STD A;  2QEX 3;  1TFK A;  1FZU A;  1IT8 A;  1S5A A;  4J9A A;  5BU4 A;  3WA3 A;  1MWT A;  1O7H B;  1FW7 A;  2P38 A;  3FG3 A;  3MG1 A;  4XBT A;  3KN4 A;  3F40 A;  1QJG A;  1B2Z A;  1X1X A;  1EQK A;  1US1 A;  5IEO A;  4KFF A;  2CG1 A;  2OOV C;  2ML5 A;  3RNT A;  3V98 A;  4QWT A;  5IG0 A;  2Z76 A;  1GS3 A;  3ECF A;  3NM7 A;  3PGB A;  5JPP A;  1JRQ A;  4J8T A;  1IQX A;  1K8A 4;  1X1Y A;  4LMI A;  1RGE A;  4WYK B;  2IY2 A;  4WWU C;  1I0V A;  1DVC A;  1UUV B;  3LML A;  3X3Y A;  2KXG A;  3EN1 B;  1HKX A;  3K7C A;  4N6U A;  2GU3 A;  2M7O A;  1BSE A;  3DM8 A;  1QVG 2;  4I4K A;  5ELJ A;  3QK9 A;  5GSP A;  1UUW B;  1YVB I;  2C10 A;  1KSI A;  2KAA A;  3B8L A;  4HM8 B;  2UX0 A;  3UL6 A;  1NB5 I;  1MGR A;  5IW9 A;  5AYS C;  1RDS A;  3CC7 3;  2HMO B;  1LOV A;  5STD A;  3IJE B;  4GL6 A;  1RTU A;  1MNL A;  3BND A;  5IG4 A;  1T2H A;  3KSE D;  1BGS A;  3A5E A;  4FCM A;  4K1V A;  1GY5 A;  3KZT A;  1FGO A;  1ZS7 A;  1RCL A;  3VGN A;  3M8C A;  3SVA A;  1Q40 A;  5DRV A;  1MWS A;  3MHE A;  4N6M A;  1BNF A;  1BRH A;  3G16 A;  1GYB A;  3SYU A;  3NBJ A;  1OHP A;  1RMS A;  4XM4 A;  3PCR A;  1GD3 A;  1BSD A;  2V1L A;  2W6J H;  2CFL A;  1GY7 A;  1O7N B;  2F98 A;  1L5G B;  3BLZ A;  2FXT A;  1RRH A;  4N6T A;  1VQ6 3;  2IMJ A;  7RNT A;  5IG5 A;  4L7K A;  3V99 A;  3G4S 3;  1W02 A;  5IF6 A;  1TTO A;  2XGL A;  7GSP A;  3IPT A;  1NWW A;  3G71 3;  1NJI 4;  2HMK B;  2O9U X;  3CME 3;  5FGO A;  4GHO A;  1K73 4;  1BAN A;  3CU3 A;  2GEY A;  1TP6 A;  3FF0 A;  3N8B A;  4WP5 A;  1WTH A;  2W9Q A;  3UL5 A;  2BMO B;  3LYG A;  1N5P A;  1ZO2 A;  2LYX A;  3F8H A;  1X1U A;  3K5T A;  3CCE 3;  3K9M C;  4R80 A;  1LNI A;  1JBR A;  3UJM A;  1SII A;  3ER7 A;  2W0Q A;  3CD6 3;  4N3V A;  2RNT A;  3Q2P A;  5EEO A;  4ZM8 A;  1VQP 3;  1BUQ A;  3FGY A;  2QGU A;  5FW5 A;  4WFO A;  3LH4 A;  5HOH A;  3JUM A;  1B2X A;  2GSP A;  3LTB A;  4PEJ A;  1WMO A;  1JKG B;  3JUQ A;  5M1A A;  2XEP A;  3WHO A;  2CC3 A;  1IDP A;  2W03 A;  1B3S A;  3MWZ A;  1RLS A;  3D4A A;  1BRJ A;  4XDV A;  5IEN A;  1CEW I;  1G0T A;  2GBX B;  1LXE A;  2W04 A;  1BNE A;  1ROA A;  1I0X A;  1RGG A;  1QAF A;  5CLK A;  4HM2 B;  1EKM A;  2CFK A;  2L4V A;  3H3H A;  4N6L A;  5CXO A;  3FLJ A;  1JV2 B;  3ZG0 A;  4EC6 A;  5KP4 A;  2QIY A;  3LZA A;  3HX8 A;  4J5K A;  2IA7 A;  1BNI A;  4RNY A;  3UNL A;  3S5C A;  2BMR B;  1Q40 B;  1W5Z A;  2MF7 A;  2P0X A;  4HM0 B;  1W2B 2;  1UGH I;  1CYV A;  3WOF B;  4HJL B;  5IG3 A;  1HU9 A;  2B1X B;  2IUK A;  1RNT A;  3X3X A;  2IUJ A;  3PXM A;  5CF1 A;  1YJW 3;  4EXR A;  3GSP A;  3RDE A;  3X42 A;  1VQQ A;  3I0Y A;  5I97 A;  3AMO A;  1O7P B;  3G8Z A;  3X40 A;  3DGM A;  3G0K A;  1FGQ A;  1G02 A;  2YX9 A;  5G1L A;  1B2M A;  1VQL 3;  1OPY A;  1FUW A;  1N5H A;  1MWR A;  4FMC A;  1K9M 4;  1IU7 A;  1OGX A;  1NO3 A;  5BVB A;  4BU4 A;  2O3O A;  4GSP A;  4HZ9 B;  4AKY A;  2H0G A;  3DUK A;  4RBN A;  2UGI A;  3NV0 A;  3CCU 3;  4BL2 A;  1WMN A;  1DMN A;  1O7G B;  3WOD G;  2LQV A;  5CF2 A;  2CWT A;  1BUJ A;  2KF5 A;  1RN1 A;  2CFG A;  9RNT A;  3FG1 A;  3X41 A;  3FH1 A;  3Q3F A;  4R4K A;  3VF1 A;  3VSY A;  3H51 A;  3JVC A;  1A67 A;  2OTL 3;  2CWU A;  2HMN B;  2XSH B;  4L8O A;  3OWY A;  3CCM 3;  1MOL A;  3F9S A;  4KFD A;  3WDG B;  5EQL A;  3WMD A;  1VQM 3;  1DYU A;  1IVU A;  1JN5 B;  2YFI B;  1QAK A;  3D79 A;  1RGC A;  2KF4 A;  4HM4 B;  2F5M A;  4J5G A;  3OV4 A;  4EYC A;  1YIJ 3;  5AIH A;  1KWI A;  1FUS A;  1PFP A;  4EV5 A;  1K41 A;  1GOY A;  1RJO A;  2E2T A;  3EE1 A;  1NNV A;  1YGW A;  1TU5 A;  3SX1 A;  2W56 B;  1C54 A;  2BT3 A;  2UUG C;  1TFO A;  2KRT A;  3AHW A;  4FR9 A;  4LGQ A;  2CIU A;  4OVM A;  1YIT 3;  2XH9 A;  4HOH A;  2K54 A;  4R9K A;  2RCD A;  1E3R A;  3ALA A;  1UDI I;  1A2K A;  2XFS A;  4FMB A;  1BNR A;  3HOH A;  3CPW 2;  1D6U A;  1ISK A;  1LOX A;  4Q53 A;  3T8U A;  1I70 A;  3EHC A;  3SLU A;  1W00 A;  1GSP A;  1RN7 A;  4KVH A;  4FCJ A;  1Q86 4;  1RHL A;  1TIJ A;  4JF8 A;  3DGO A;  2Y73 A;  2AAE A;  3GWR A;  1N9E A;  3LXU X;  3NUV A;  1AVK A;  3S28 A;  3WR2 A;  3T8N A;  4BTX A;  3N54 B;  1A2V A;  3DZL A;  1RGK A;  1OUN A;  3O8Y A;  4HM5 B;  3CCQ 3;  1Y4K A;  2FGT A;  1DET A;  3EBT A;  1VZZ A;  3OXA A;  5M19 A;  1HZ1 A;  1YGE A;  3GRD A;  1BVI A;  1PYL A;  1UW1 A;  4BTW A;  1MWU A;  1W6C A;  1I2E A;  4FMA A;  1W4N A;  2XGN A;  4AEQ A;  2CFW A;  2WOH A;  1M1X B;  1TUH A;  3NQY A;  3RGA A;  2Z7A A;  1A2P A;  1UI8 A;  8CHO A;  2SAR A;  3B4P A;  1IVV A;  1QMA A;  4MMY B;  1W6G A;  1YNV X;  1LOY A;  2CKF B;  3NV0 B;  2I9W A;  1K28 A;  4FCZ A;  2J8X B;  3F7S A;  3MSO A;  2A15 A;  3FG4 A;  1CYU A;  3DGN A;  3GZR A;  1M90 4;  1IVX A;  3DGY A;  1VQ4 3;  4HM6 B;  4RNZ A;  2BIR A;  3HI7 A;  1JZD A;  1N9J A;  4G1M B;  2P05 A;  1JNQ A;  4NPB A;  1SAR A;  3U1W A;  1Q42 A;  1J2B A;  3NQZ A;  3SOA A;  1IYY A;  4O3V A;  1S72 3;  4HVN A;  1FUT A;  4KFE A;  4MEI A;  1U8C B;  2CX0 A;  3MG3 A; 
#chains in the Genus database with same CATH homology
 1ULJ B;  3PZW A;  5KP1 A;  1SIH A;  1WQL B;  3FKA A;  4EV2 A;  3GAX A;  3BNE A;  3HK4 A;  2FNQ A;  4JRF A;  1O7W B;  3WA2 X;  2MC8 A;  2WOF A;  3U97 A;  3OWS A;  4X2O A;  3RGR A;  3NXJ A;  4HM3 B;  4R9L A;  4L8P A;  2XRX B;  1Q81 4;  2OWP A;  3GZY B;  3S27 A;  1Q7Y 4;  2INX A;  4X2H A;  3V92 A;  4XB5 A;  3I56 3;  1GD4 A;  4AKZ A;  1W2Z A;  2CFD A;  2PNC A;  1SPU A;  2W2C A;  3JUO A;  3FSD A;  2F99 A;  4HM1 B;  5D81 A;  1JB2 A;  3STD A;  2E2U A;  2XF3 A;  3HZP A;  1IV7 A;  1IQY A;  1V74 A;  1EA2 A;  3CXC 2;  3CCJ 3;  1VQ8 3;  2QA4 3;  4NHF A;  3I55 3;  3S29 A;  1ASK A;  2BO9 B;  2R4I A;  5A0O B;  3FF2 A;  3FCS B;  1YJN 3;  5G2G A;  1OHO A;  4OK0 A;  3PS8 A;  7STD A;  3LTA A;  3MG2 A;  3QRD A;  3SED A;  2HMM B;  5TGN A;  2WO0 A;  5D82 A;  4IIA A;  3HIG A;  1GY6 A;  1IVW A;  4K90 B;  3MKI A;  1IK3 A;  3IMA B;  3LTD A;  3NM2 A;  4HM7 B;  1OAC A;  5ELU A;  3CNX A;  1AVL A;  1FA3 A;  4N6V 0;  1STD A;  1OF5 A;  3WOE B;  3N9H A;  4IT7 A;  1M9G A;  4RZM A;  1OCV A;  2GU1 A;  1LVN A;  4N6N B;  1NDO B;  5IEP A;  1KQS 2;  1D6Y A;  1JB5 A;  3BB9 A;  2P0M A;  2E2V A;  3LTC A;  1YJ9 3;  1ZX2 A;  3EX9 A;  3OX9 A;  5LC7 A;  3MPH A;  2B24 B;  1N8Q A;  1RKY A;  2OQE A;  4XBY A;  3L0R A;  1IQ8 A;  3F14 A;  3D3L A;  3MYT A;  4MMX B;  3EQQ B;  1SJW A;  1JJ2 2;  5AEW B;  4STD A;  3EJV A;  3PYJ A;  3KII A;  5AIF A;  3CPO A;  3Q90 A;  1NB3 I;  3K0Z A;  3S67 A;  4TX4 A;  1VQ9 3;  1NU3 A;  4O02 B;  1YHQ 3;  3J7Y d;  1EG9 B;  3NHX A;  1Q82 4;  1SQW A;  2ML6 A;  2OCT A;  3DGL A;  4XDW A;  1WMP A;  1VQ7 3;  3OWU A;  5AI1 A;  3AMO B;  2CHC A;  2CWV A;  1N8R 4;  3CMA 3;  2OTJ 3;  3T0U A;  2CW9 A;  4OUQ A;  1JKG A;  1A90 A;  3GZB A;  4CDL A;  3CCR 3;  1W7C A;  1VQO 3;  4HYZ A;  3CNM A;  2F86 B;  3K63 A;  3F7X A;  1W6Y A;  2RFR A;  1OF5 B;  3CC4 3;  2ZDJ A;  1DVD A;  1FGM A;  4HBR A;  5EVH A;  2Z77 A;  1AR0 A;  1ULI B;  2YFL B;  5AYR B;  2GEX A;  2BHM A;  3GZX B;  1Z1S A;  2W9P A;  2YFJ B;  3EB8 A;  3JUP A;  5KP3 A;  2WGQ A;  2CG0 A;  3NX0 A;  5BXQ A;  1WNH A;  1YI2 3;  3DY5 A;  2HML B;  2SBL A;  4N6O B;  1QVF 2;  2P09 A;  3KE7 A;  1ROV A;  2HMJ B;  1VQN 3;  4O8S A;  3KFQ C;  1D6Z A;  3LT9 A;  1UI7 A;  1OHS A;  5IER A;  1PU4 A;  2XR8 B;  3A76 A;  3EF8 A;  3HII A;  3SXX A;  4CCV A;  4XBX A;  2JQ5 A;  3NBR A;  2GBW B;  3CCS 3;  1M1K 4;  2ZL8 A;  1DMM A;  2D42 A;  4R1K A;  3KKG A;  2OOV A;  3B4O A;  1T5Y A;  1OGZ A;  1FGT A;  2C11 A;  3BNB A;  3NBB A;  2OQE C;  1LNH A;  3OW2 2;  3CC2 3;  4HKV B;  2GXF A;  3PCS A;  2Y74 A;  4IPB A;  2STD A;  1VQ5 3;  2PZV A;  1IV9 A;  2XSO B;  3DXO A;  3TDG A;  5LC6 A;  1W01 A;  2K0M A;  3CCV 3;  5DRE A;  4MJD A;  1C7H A;  2BNG A;  4H61 A;  1O7M B;  1R4C A;  3CCL 3;  1JN5 A;  1F8N A;  1RRL A;  3EBY A;  3JUN A;  4ORL A;  4O2H A;  4WYK A;  3UB1 A;  1OH0 A;  2Q07 A;  3BNC A;  5AII A;  4H3U A;  5AEU B;  2RSX A;  1IT7 A;  4K61 A;  4KZ1 A;  2W56 A;  1G96 A;  1KD1 4;  4LZI A;  1E3V A;  4GB5 A;  2D1W A;  2XFT A;  5JBS A;  4FMD A;  2JDI H;  3LT8 A;  2BMQ B;  1U5O A;  4HZB B;  2Z6B A;  3F8X A;  4LSO A;  1CQS A;  5JPU A;  1KC8 4;  3SOY A;  3EC9 A;  1QAL A;  1DMQ A;  4BTY A;  1E97 A;  3FZW A;  3KSP A;  2CK3 H;  3LOY A;  3DMC A;  1JB4 A;  3ROB A;  3D9R A;  3E99 A;  3X3Z A;  4LEH A;  2KCD A;  5AIG A;  2WGO A;  4NRE A;  3Q1C A;  1VQK 3;  4EBG A;  3EN8 A;  1STF I;  3G6E 3;  1FGR A;  4MMZ B;  5CK6 A;  4U13 A;  2CH9 A;  4K1U A;  1AV4 A;  2RGQ A;  5HGR A;  4WHA A;  6STD A;  2QEX 3;  1TFK A;  4J9A A;  1IT8 A;  1S5A A;  3WA3 A;  1O7H B;  2P38 A;  3FG3 A;  3MG1 A;  4XBT A;  3KN4 A;  3F40 A;  1QJG A;  1EQK A;  1US1 A;  5IEO A;  4KFF A;  2CG1 A;  2OOV C;  2ML5 A;  3V98 A;  4QWT A;  5IG0 A;  2Z76 A;  1GS3 A;  3ECF A;  3NM7 A;  3PGB A;  5JPP A;  1JRQ A;  4J8T A;  1IQX A;  1K8A 4;  4LMI A;  4WYK B;  4WWU C;  3X3Y A;  1DVC A;  1UUV B;  3LML A;  2KXG A;  3EN1 B;  1HKX A;  3K7C A;  4N6U A;  2GU3 A;  2M7O A;  3DM8 A;  1QVG 2;  4I4K A;  5ELJ A;  3QK9 A;  1UUW B;  1YVB I;  2C10 A;  1KSI A;  3B8L A;  3UL6 A;  4HM8 B;  2UX0 A;  1NB5 I;  5IW9 A;  5AYS C;  3CC7 3;  2HMO B;  5STD A;  3IJE B;  4GL6 A;  1MNL A;  3BND A;  5IG4 A;  3KSE D;  4K1V A;  4FCM A;  1GY5 A;  3KZT A;  1FGO A;  3VGN A;  3M8C A;  3SVA A;  1Q40 A;  5DRV A;  3MHE A;  4N6M A;  3G16 A;  1GYB A;  3NBJ A;  1OHP A;  4XM4 A;  3PCR A;  1GD3 A;  2V1L A;  2W6J H;  2CFL A;  1GY7 A;  1O7N B;  2F98 A;  1L5G B;  3BLZ A;  2FXT A;  1RRH A;  4N6T A;  1VQ6 3;  2IMJ A;  5IG5 A;  4L7K A;  3V99 A;  3G4S 3;  1W02 A;  5IF6 A;  2XGL A;  3G71 3;  3IPT A;  1NWW A;  1NJI 4;  2HMK B;  2O9U X;  3CME 3;  5FGO A;  1K73 4;  3CU3 A;  2GEY A;  1TP6 A;  3FF0 A;  3N8B A;  4WP5 A;  1WTH A;  2W9Q A;  3UL5 A;  2BMO B;  3LYG A;  1N5P A;  1ZO2 A;  2LYX A;  3F8H A;  3K5T A;  3CCE 3;  3K9M C;  4R80 A;  3UJM A;  1SII A;  3ER7 A;  2W0Q A;  3CD6 3;  4N3V A;  3Q2P A;  5EEO A;  1VQP 3;  4ZM8 A;  1BUQ A;  3FGY A;  2QGU A;  5FW5 A;  4WFO A;  3LH4 A;  3JUM A;  3LTB A;  4PEJ A;  1WMO A;  1JKG B;  3JUQ A;  2XEP A;  2CC3 A;  1IDP A;  2W03 A;  3MWZ A;  5IEN A;  4XDV A;  1CEW I;  2GBX B;  2W04 A;  1LXE A;  1ROA A;  5CLK A;  1QAF A;  4HM2 B;  1EKM A;  2CFK A;  2L4V A;  3H3H A;  4N6L A;  5CXO A;  3FLJ A;  1JV2 B;  4EC6 A;  5KP4 A;  2QIY A;  3LZA A;  3HX8 A;  2IA7 A;  4RNY A;  3UNL A;  3S5C A;  2BMR B;  1Q40 B;  1W5Z A;  2MF7 A;  2P0X A;  4HM0 B;  1W2B 2;  1CYV A;  3WOF B;  4HJL B;  5IG3 A;  1HU9 A;  2B1X B;  2IUK A;  3X3X A;  2IUJ A;  3PXM A;  5CF1 A;  1YJW 3;  4EXR A;  3RDE A;  3X42 A;  3I0Y A;  5I97 A;  3AMO A;  1O7P B;  3G8Z A;  3X40 A;  3DGM A;  3G0K A;  1FGQ A;  2YX9 A;  1VQL 3;  1OPY A;  1FUW A;  1N5H A;  4FMC A;  1K9M 4;  1IU7 A;  1OGX A;  1NO3 A;  5BVB A;  2O3O A;  4HZ9 B;  4AKY A;  3CCU 3;  3DUK A;  4RBN A;  3NV0 A;  1WMN A;  1DMN A;  1O7G B;  3WOD G;  2LQV A;  5CF2 A;  2CWT A;  2CFG A;  3FG1 A;  3X41 A;  3FH1 A;  4R4K A;  3VF1 A;  3VSY A;  3H51 A;  3JVC A;  1A67 A;  2OTL 3;  2CWU A;  2HMN B;  2XSH B;  4L8O A;  3OWY A;  3CCM 3;  1MOL A;  3F9S A;  4KFD A;  3WDG B;  5EQL A;  3WMD A;  1VQM 3;  1DYU A;  1IVU A;  1JN5 B;  2YFI B;  1QAK A;  4HM4 B;  5D83 A;  1YIJ 3;  3OV4 A;  4EYC A;  5AIH A;  1KWI A;  1PFP A;  4EV5 A;  1K41 A;  1RJO A;  2E2T A;  3EE1 A;  1TU5 A;  3SX1 A;  2W56 B;  2BT3 A;  4FR9 A;  1TFO A;  2KRT A;  4LGQ A;  2CIU A;  4OVM A;  1YIT 3;  2XH9 A;  2K54 A;  4R9K A;  2RCD A;  1E3R A;  3ALA A;  4FMB A;  1A2K A;  2XFS A;  3CPW 2;  1D6U A;  1ISK A;  1LOX A;  4Q53 A;  3T8U A;  3EHC A;  3SLU A;  1W00 A;  1RN7 A;  4KVH A;  4FCJ A;  1Q86 4;  4JF8 A;  1TIJ A;  3DGO A;  2Y73 A;  3GWR A;  1N9E A;  3LXU X;  3NUV A;  1AVK A;  3S28 A;  3T8N A;  4BTX A;  3N54 B;  1A2V A;  3DZL A;  1OUN A;  3O8Y A;  4HM5 B;  3CCQ 3;  1Y4K A;  2FGT A;  3OXA A;  3EBT A;  1VZZ A;  1YGE A;  3GRD A;  1UW1 A;  4BTW A;  1W6C A;  4FMA A;  1W4N A;  2XGN A;  4AEQ A;  2CFW A;  2WOH A;  1M1X B;  1TUH A;  3NQY A;  3RGA A;  2Z7A A;  1UI8 A;  8CHO A;  3B4P A;  1IVV A;  1QMA A;  4MMY B;  1W6G A;  2CKF B;  3NV0 B;  2I9W A;  1K28 A;  4FCZ A;  3F7S A;  3MSO A;  2A15 A;  3FG4 A;  1CYU A;  3DGN A;  3GZR A;  1M90 4;  1IVX A;  1VQ4 3;  4HM6 B;  4RNZ A;  3HI7 A;  1N9J A;  4G1M B;  2P05 A;  1JNQ A;  3U1W A;  1Q42 A;  1J2B A;  3NQZ A;  3SOA A;  4O3V A;  1S72 3;  4HVN A;  4KFE A;  4MEI A;  1U8C B;  3B7C A;  3MG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...