1OGXA

High resolution crystal structure of ketosteroid isomerase mutant d40n(d38n, ti numbering) from pseudomonas putida complexed with equilenin at 2.0 a resolution.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title Detection of Large Pka Perturbation of an Inhibitor and a Catalytic Group at an Enzyme Active Site, a Mechanistic Basis for Catalytic Power of Many Enzymes
pubmed doi rcsb
source organism Pseudomonas putida
total genus 30
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ogxA00
2B1XB 1JB5A 2F86B 4U13A 4WYKA 1EG9B 1OUNA 1OH0A 2I9WA 3WMDA 2BMOB 5AIHA 5DRVA 3F7XA 2HMJB 3FF0A 4R1KA 3A76A 3Q90A 4HJLB 4OVMA 4LMIA 5G2GA 3H3HA 3DZLA 1EA2A 1O7MB 2RCDA 4XBTA 5KP1A 4L8OA 3G16A 2STDA 2QGUA 1O7NB 6STDA 3MSOA 3K0ZA 2XSHB 3T8UA 3B4OA 4WWUC 4XBYA 2GXFA 3FZWA 5BVBA 2HMNB 1ULJB 2JQ5A 4MJDA 1QMAA 3FF2A 5AEWB 2YFIB 2R4IA 5AIIA 1UUWB 2Z76A 3G8ZA 1WQLB 1O7WB 3BB9A 3MKIA 1VZZA 5STDA 1K41A 1O7PB 4WP5A 5IG3A 3RGRA 4N3VA 2RGQA 1O7HB 2QIYA 3HZPA 1S5AA 3EF8A 1NWWA 3OWYA 3EBTA 1STDA 4I4KA 3F8HA 3HX8A 1W01A 2UX0A 3OWUA 1UUVB 3CU3A 4HZ9B 5DREA 4HM2B 3EC9A 5TGNA 3IPTA 4HVNA 1JKGB 3GZXB 3JUMA 3KKGA 1QJGA 2GBWB 4GB5A 5IG5A 5CF2A 3VGNA 4XB5A 3EHCA 4HM1B 3UNLA 1GY5A 3LYGA 2YFJB 3K7CA 3OXAA 1JB4A 4ORLA 3SOYA 2XSOB 4R9LA 1BUQA 3DMCA 3RGAA 3KE7A 3NV0B 5KP4A 4Q53A 3ER7A 1C7HA 5D83A 5KP3A 3F8XA 3LZAA 5BXQA 1GY6A 1ULIB 2HMKB 3UJMA 2F98A 5D82A 3SOAA 4OUQA 3JUNA 3S5CA 4X2HA 2GBXB 3JUPA 5IG4A 3CNXA 2CHCA 3GZYB 2A15A 3FSDA 3FLJA 3STDA 4XBXA 2PZVA 5AIFA 2Z7AA 2OWPA 4H3UA 2Z77A 5HGRA 4J9AA 3F9SA 3MYTA 3B8LA 4HM0B 3GRDA 1NU3A 1Q40B 1U5OA 8CHOA 4L8PA 3CNMA 2GEYA 3FH1A 3GWRA 4HM6B 3FGYA 2HMOB 4HM4B 1ZO2A 3EN1B 1OF5B 3B4PA 4X2OA 5JPUA 3NM2A 2XRXB 1TP6A 1W00A 4HZBB 1JN5B 2XR8B 4J8TA 4HM8B 3NBRA 4KVHA 5IG0A 3MG3A 2BMQB 1OGXA 5FW5A 2YFLB 4L7KA 1SJWA 3MHEA 4K1UA 1JKGA 2F99A 1GS3A 3JUQA 3EQQB 2HMLB 1OPYA 1O7GB 4STDA 4XM4A 5IEPA 2CKFB 2B24B 1CQSA 3EX9A 2GEXA 5AIGA 5CXOA 5IEOA 3B7CA 5CK6A 4K1VA 3F40A 3BLZA 3I0YA 4IIAA 1OHSA 5EVHA 1OCVA 4LEHA 4WYKB 1ASKA 4LGQA 5JPPA 3SEDA 3NV0A 3HK4A 2W2CA 3E99A 1E97A 2BMRB 2RFRA 2HMMB 1AR0A 1Z1SA 4HM3B 7STDA 1A2KA 5IENA 1NDOB 4HM5B 1Q42A 1OHPA 5D81A 3GZRA 5AEUB 1DMQA 1JB2A 1W6YA 1DMMA 3CPOA 3EBYA 3DXOA 3OWSA 3H51A 1W02A 4CDLA 1Q40A 2IMJA 3OV4A 4XDVA 4RZMA 3OX9A 3JUOA 1E3RA 4PEJA 3NXJA 1OF5A 5IERA 2K54A 3MG1A 3F7SA 3VSYA 1JN5A 1DMNA 4HKVB 1TUHA 3ROBA 3DUKA 3GZBA 3KSPA 1OHOA 5IF6A 1ZX2A 3KZTA 3G0KA 1IDPA 1ISKA 3ECFA 3NUVA 1HKXA 5AI1A 3DM8A 3EJVA 4HM7B 3F14A 1GY7A 1E3VA 3FKAA 3M8CA 5CLKA 4XDWA 2BNGA 3T8NA 5CF1A 3D9RA 4FCMA 3EN8A 1OGZA 1GYBA 4FCJA 3NHXA 3MG2A 4R9KA 2INXA
chains in the Genus database with same CATH superfamily
5EQLA 2CWTA 2B1XB 1JB5A 2F86B 1QAKA 4U13A 4WYKA 1KQS2 1EG9B 1YNVX 4N6OB 1OUNA 2IUJA 1GMQA 1OH0A 1TFOA 2I9WA 1JBSA 3WMDA 1WMOA 1RJOA 2BMOB 2OOVC 2XGNA 5AIHA 1GMPA 1X1WA 5DRVA 3F7XA 1EQKA 3K9MC 1GD4A 1W6CA 4WHAA 1N8QA 1BRNL 1D6ZA 2RNTA 1BAOA 1W6GA 2GU3A 2E2TA 1JZOA 1YJN3 2HMJB 3S67A 3CC73 3FF0A 4R1KA 5I97A 1YIJ3 3AGNA 1YGEA 1C54A 3CCL3 3A76A 3Q90A 4HJLB 1A2VA 1MNLA 1VQM3 1BSCA 1SIHA 3PCSA 3SLUA 4OVMA 1IVXA 2Y73A 1SQWA 1NO3A 1UCIA 3ALAA 3BNDA 8RNTA 4AKZA 4GL6A 4MEIA 1VQQA 4HAAA 4LMIA 5G2GA 3URPA 1SIIA 2R41A 3H3HA 3DZLA 3KSED 1EA2A 1O7MB 2W9QA 2RCDA 4XBTA 2CX1A 2Q07A 2CK3H 4KFDA 5KP1A 4L8OA 4RNZA 3G16A 1RNTA 1B2UA 1YJW3 2STDA 1BRJA 1O7NB 2CFKA 2QGUA 6STDA 1HZ1A 2F5WA 2ZA4A 4EV5A 3V99A 2PNCA 3K0ZA 3MSOA 2GU1A 2XSHB 3T8UA 3CCM3 3B4OA 3FG1A 4WWUC 4N6UA 4XBYA 2GXFA 3FZWA 3DGMA 5BVBA 2HMNB 1JJ22 3PS8A 1GD3A 1IQXA 1K8A4 1JV2B 1ULJB 2JQ5A 4MJDA 1QMAA 1Y4KA 3FF2A 5AEWB 2FXTA 1SPUA 2YFIB 2R4IA 2QA43 1G96A 1V58A 1VQO3 3U1WA 1BNJA 1CYUA 1FYSA 5AIIA 1BIRA 1M9GA 4BTYA 4EXRA 2KCDA 1UUWB 2XH9A 2Z76A 1W2B2 3G8ZA 1EKMA 1WQLB 4FMDA 1QVF2 2OQEA 2C10A 1O7WB 1TIJA 2XFSA 2K0MA 3BB9A 3MKIA 3UL5A 1BVIA 1T2HA 1VZZA 5STDA 3T0UA 1K41A 1BRSA 3V92A 1KWIA 4FMAA 4LYLB 2P05A 3UL6A 1PY3A 1O7PB 3AMOB 1JBTA 4WP5A 1UGHI 5IG3A 3RGRA 4N3VA 2RGQA 1IQ8A 1O7HB 1ROVA 2P09A 1A67A 2QIYA 2WGQA 3LTCA 3MPHA 4EV2A 2LYXA 1RKYA 1NNVA 3HZPA 2F4YA 1IVVA 2AAEA 3ZG5A 1RGCA 1RN7A 1S5AA 2CX0A 3EF8A 1NWWA 3LTDA 3RNTA 3OWYA 3EBTA 1STDA 4I4KA 4JRFA 1AQZA 3F8HA 3HX8A 3Q2PA 1W01A 2ML6A 1IT7A 2UX0A 3OWUA 1NJI4 2C4BA 1I3IA 3NQZA 3QRDA 1UUVB 3CU3A 4HZ9B 3PXMA 1BGSA 3K5TA 3AGOA 3QK9A 5DREA 4HM2B 1R4CA 1F8NA 1BRKA 3Q1CA 3EC9A 2F56A 2CG0A 1RNBA 3HIGA 5TGNA 1UCJA 3IPTA 1RGGA 2ZHXB 2L4VA 2O9UX 4HVNA 1ZS7A 2WO0A 3AHSA 3DH2A 2BU4A 5M1AA 3SYUA 7RNTA 1JKGB 2RSXA 2YX9A 5FGOA 3X42A 1DETA 3GZXB 3JUMA 3KKGA 3DGOA 3BU4A 1QJGA 2GBWB 4GB5A 5IG5A 2CWVA 1W7CA 5CF2A 1MWTA 1BRHA 1RRLA 1M1K4 3VGNA 2CG1A 3NBBA 1U8CB 1IV9A 4XB5A 3EHCA 1LOVA 2RBIA 1TFKA 4HM1B 1FUWA 1PFPA 1IQYA 1I2FA 1T3BA 2W56A 4KFFA 1GY5A 3UNLA 4N6MA 3CCJ3 1S723 3LYGA 1GMRA 1G0TA 2BIRA 5LC7A 1DVDA 1TTOA 2YFJB 3K7CA 3G6E3 1QAFA 3OXAA 1HYFA 1JB4A 4ORLA 1BSBA 3D4AA 1I0XA 4H61A 2D1WA 2MF7A 2CW9A 3SOYA 1R4YA 1GOUA 2XSOB 4R9LA 3N8BA 1BUQA 3DMCA 1M1XB 1VQP3 4N6NB 3RGAA 1WNHA 2C11A 3PZWA 4J5KA 1UCLA 5A0OB 3KE7A 3KCHA 4BL3A 1HU9A 1B2ZA 3CPW2 2GSPA 1VQN3 1KSIA 3ZG0A 3NBJA 1J2BA 2OTJ3 3V98A 3KN4A 1QVG2 3J7Yd 1BU4A 3SXXA 1T5YA 3NV0B 3CCE3 4BU4A 3CMA3 2KRTA 4LSOA 4JF8A 2BT3A 3EE1A 5KP4A 1LNIA 2H0HA 4Q53A 3ER7A 2CFGA 1BSAA 2FGTA 1C7HA 5D83A 4GHOA 5KP3A 1VQ93 1N9JA 3LMLA 3F8XA 3MWZA 2XFTA 3LZAA 4R4KA 4N6TA 3IJEB 4ZM8A 5BXQA 4K61A 1GY6A 1LVNA 1ULIB 3ZFZA 2HMKB 3UJMA 1V74A 2F98A 2L1SA 4OUQA 5D82A 3SOAA 1Q7Y4 4OK0A 2IUKA 3EB8A 3JUNA 2KF4A 2AADA 3LXUX 1NB5I 3S29A 3X3YA 2KAAA 1ZGXA 3NQYA 4AKYA 1VQ53 3D5GA 3S5CA 4NREA 1CEWI 1TU5A 1RGKA 4X2HA 3PCRA 2GBXB 5BU4A 3JUPA 5IG4A 3CNXA 2CHCA 1V57A 2WOHA 3N9HA 1MOLA 2W04A 3GZYB 4BTWA 1PYLA 4BTXA 2A15A 5BIRA 3I563 3FSDA 1UI8A 3A5EA 3OW22 1W4NA 4EYCA 1YJ93 4RBNA 3DGLA 3FLJA 3HI7A 4CJNA 3STDA 4XBXA 5ELUA 2INXA 1Q7HA 1AVLA 2PZVA 5AIFA 2Z7AA 2OWPA 4O3VA 4H3UA 3CCR3 4K90B 1RN4A 1BRGA 1IVWA 1LOXA 2KF3A 2Z77A 5HGRA 5LC6A 1BNSA 4J9AA 1I70A 5G1KA 2OCTA 3O8YA 1IK3A 3F9SA 3MYTA 3B8LA 4HM0B 3GRDA 1B21A 1NU3A 1Q40B 3CC23 1U5OA 2IYJA 2WGOA 8CHOA 3AHWA 4L8PA 3CNMA 2OTL3 2GEYA 3FH1A 3GWRA 4HM6B 3FGYA 2HMOB 1VQ63 4HM4B 6GSPA 1DVCA 1VQ83 1G02A 3AMOA 3HOHA 4IT7A 1N9EA 3CD63 2OOVA 1RMSA 1UI7A 1ZO2A 1K28A 1UCKA 3EN1B 1OF5B 3D5IA 4FMCA 4N6V0 3B4PA 4X2OA 1I2GA 5JPUA 3DGYA 3NM2A 2XRXB 4I5QA 1DYUA 1TP6A 4FMBA 4NHFA 1K9M4 1W00A 2SARA 1GOYA 1PU4A 4HZBB 1AY7A 1VQL3 1JN5B 1M904 4RNTA 2XR8B 1IT8A 1RLSA 1WMNA 2CIUA 4EW5A 5JBSA 1LOYA 4J8TA 1LQMB 4HM8B 3BNEA 3NBRA 3PYJA 2H0GA 2W03A 4KVHA 5IG0A 3MG3A 5RNTA 2BMQB 3X40A 1KD14 4FR9A 3BNCA 3CC43 1OGXA 1Q814 1A2PA 3WOFB 2W9PA 1L5GB 1BSDA 5FW5A 1AVKA 1B20A 1FGMA 3VF1A 4KT3B 2IY2A 2YFLB 4L7KA 3CCV3 1Q9EA 2E2VA 1SJWA 3MHEA 4K1UA 1YVSA 4MMZB 2LQVA 1JKGA 2F99A 3G4S3 1UGIA 3CXC2 1GS3A 1VQ73 3JUQA 3EQQB 2HMLB 1OPYA 1RSNA 1IU7A 2O3OA 1O7GB 4STDA 2HOHA 2BO9B 2W0QA 1JZDA 4XM4A 5IEPA 1LOWA 2B24B 1RDSA 2CKFB 1BNFA 2UGIA 3WODG 1W2ZA 1B2SA 1CQSA 3EX9A 1MWUA 2GEXA 4NPBA 2CFWA 3GAXA 1IYYA 1I8VA 5AIGA 5CXOA 1SARA 3BIRA 3B7CA 4R80A 5CK6A 5IEOA 1QALA 3WR2A 4K1VA 3X3ZA 3CCS3 3X41A 1X1XA 2SBLA 2KF5A 4RNYA 2E2UA 1EUIC 1BNRA 3F40A 4DKIA 3DGNA 3CME3 3BLZA 3I0YA 4MMYB 4IIAA 3LTBA 1OHSA 1I3FA 3PGBA 3BNBA 5EVHA 2WOFA 1OCVA 1LQGC 2QEX3 3CCQ3 4HOHA 4LEHA 4WYKB 3TDGA 4O8SA 1ASKA 3DY5A 3FCSB 4LGQA 3KFQC 1LXEA 3SEDA 5JPPA 2H0IA 3NV0A 3HK4A 2F5MA 1LRAA 2BHMA 2JDIH 3U97A 1FUSA 2W2CA 1E97A 3E99A 2BMRB 1RN1A 2RFRA 4ILFA 2FNQA 1AR0A 2HMMB 3JVCA 2XGLA 1US1A 1Z1SA 4HM3B 3WA2X 1BNEA 4EC6A 1CYVA 7STDA 3WDGB 3HIIA 3NM7A 1BUJA 3LOYA 2KXGA 1FW7A 1A2KA 2XEPA 3X3XA 2CFLA 5IENA 1RCLA 5M19A 1I2EA 3WA3A 3IMAB 1NDOB 1Q42A 2J8XB 4HM5B 1OHPA 1UDII 1MGWA 1RGLA 1LNHA 1KC84 1GSPA 4WFOA 5D81A 1FUTA 3GZRA 5AEUB 2W6JH 2IA7A 4LZIA 3CCU3 1RTUA 3L0RA 1DMQA 3D79A 1Q864 1FGRA 2KF6A 1UUGB 4TX4A 3I553 1JB2A 4HBRA 2MC8A 2K3DA 1W6YA 3S28A 1TJDA 4GSPA 1DMMA 4BL2A 3CPOA 3K63A 3EBYA 3DXOA 3OWSA 4HYZA 6RNTA 3H51A 3RDEA 4CPKA 1D6YA 1CH0A 1W02A 4CDLA 4CCVA 1Q40A 2IMJA 3FG3A 3OV4A 1FGOA 4XDVA 4IPBA 4AEQA 5IW9A 1VQK3 1W5ZA 2ZDJA 4RZMA 4O02B 3OX9A 3Q3FA 3JUOA 1MWSA 1IV7A 1X1UA 1E3RA 2XF3A 4PEJA 1N5HA 3NXJA 1RRHA 4QWTA 3WOEB 1D6UA 1OF5A 5IERA 1K734 1BOXA 1UW1A 3LT9A 4FCZA 1A90A 4N6LA 1YVBI 2K54A 3MG1A 1JRQA 1X1YA 1T2IA 3F7SA 5AYSC 1EEJA 3VSYA 2ML5A 1B2XA 2P0XA 1JN5A 1Q824 1STFI 5EEOA 1AV4A 1DMNA 4HKVB 4MMXB 1TUHA 1JNQA 5ELJA 2CWUA 3DUKA 3FG4A 3GZBA 3KSPA 3ROBA 1IVUA 1OHOA 1RGEA 2D42A 1YIT3 1N8R4 5IF6A 1RGFA 1BRIA 1ZX2A 3KZTA 3SX1A 1WTHA 4KZ1A 5G1LA 1B27A 2P38A 3G0KA 1B3SA 1IDPA 1MGRA 4O2HA 3WHOA 1ISKA 4J5GA 3LTAA 9RNTA 2CFDA 3LH4A 5AYRB 3ECFA 5HOHA 3NX0A 3NUVA 1NB3I 5M18A 1BANA 1HKXA 5AI1A 3DM8A 1FGQA 1RCKA 3D3LA 3EJVA 1RGAA 3F14A 3LT8A 4HM7B 1GY7A 1VQ43 1E3VA 3UB1A 3KIIA 1RHLA 3FKAA 3M8CA 5CLKA 1FA3A 1DE3A 4XDWA 2BNGA 1N5PA 2M7OA 3T8NA 5CF1A 2V1LA 2CC3A 2UUGC 3D9RA 1B2MA 3GSPA 5GSPA 2Z6BA 2W56B 1MWRA 4FCMA 2P0MA 4EBGA 1FZUA 3EN8A 1OGZA 1GYBA 1YHQ3 2CH9A 4BIRA 3SVAA 7GSPA 1JBRA 4FCJA 1RGHA 4KFEA 1YI23 2ZL8A 1ROAA 2OQEC 1BNGA 3NHXA 1TRQA 1OACA 2Y74A 1BSEA 3S27A 3MG2A 3N54B 1WMPA 1BNIA 3G713 4R9KA 1GOVA 1TRPA 1YGWA 1FGTA 4G1MB 1I0VA
chains in the Genus database with same CATH topology
5EQLA 2CWTA 2B1XB 1JB5A 2F86B 1QAKA 4U13A 4WYKA 1KQS2 1EG9B 4N6OB 1OUNA 2IUJA 1OH0A 1TFOA 2I9WA 3WMDA 1WMOA 1RJOA 2BMOB 2OOVC 2XGNA 5AIHA 1EQKA 5DRVA 3F7XA 3K9MC 1GD4A 1W6CA 4WHAA 1N8QA 1D6ZA 1W6GA 2GU3A 2E2TA 1YJN3 2HMJB 3S67A 3CC73 3FF0A 4R1KA 5I97A 1YIJ3 1YGEA 3CCL3 3A76A 3Q90A 4HJLB 1A2VA 1MNLA 1VQM3 1SIHA 3PCSA 3SLUA 4OVMA 1IVXA 2Y73A 1SQWA 1NO3A 3ALAA 3BNDA 4AKZA 4GL6A 4MEIA 4LMIA 5G2GA 1SIIA 3H3HA 3DZLA 3KSED 1EA2A 1O7MB 2W9QA 2RCDA 4XBTA 2Q07A 2CK3H 4KFDA 5KP1A 4L8OA 4RNZA 3G16A 1YJW3 2STDA 2CFKA 1O7NB 2QGUA 6STDA 4EV5A 3V99A 2PNCA 3K0ZA 3MSOA 2GU1A 2XSHB 3T8UA 3CCM3 3B4OA 3FG1A 4WWUC 4N6UA 4XBYA 2GXFA 3FZWA 3DGMA 5BVBA 2HMNB 1JJ22 3PS8A 1GD3A 1IQXA 1K8A4 2JQ5A 1JV2B 1ULJB 4MJDA 1QMAA 1Y4KA 3FF2A 5AEWB 2FXTA 1SPUA 2YFIB 2R4IA 2QA43 1G96A 1VQO3 3U1WA 1CYUA 5AIIA 1M9GA 4BTYA 4EXRA 2KCDA 1UUWB 2XH9A 2Z76A 1W2B2 3G8ZA 1EKMA 1WQLB 4FMDA 1QVF2 2OQEA 2C10A 1O7WB 1TIJA 2XFSA 2K0MA 3BB9A 3MKIA 3UL5A 3T0UA 1VZZA 5STDA 3V92A 1K41A 1KWIA 4FMAA 2P05A 3UL6A 1O7PB 3AMOB 4WP5A 5IG3A 3RGRA 4N3VA 2RGQA 1IQ8A 1O7HB 1ROVA 2P09A 1A67A 2QIYA 2WGQA 3LTCA 3MPHA 4EV2A 2LYXA 1RKYA 3HZPA 1IVVA 1RN7A 1S5AA 3EF8A 1NWWA 3LTDA 3OWYA 3EBTA 1STDA 4I4KA 4JRFA 3F8HA 3HX8A 3Q2PA 1W01A 2ML6A 1IT7A 2UX0A 3OWUA 1NJI4 3NQZA 3QRDA 1UUVB 3CU3A 4HZ9B 3PXMA 3K5TA 3QK9A 5DREA 4HM2B 1R4CA 1F8NA 3Q1CA 3EC9A 2CG0A 3HIGA 5TGNA 3IPTA 2O9UX 2L4VA 4HVNA 2WO0A 1JKGB 2RSXA 2YX9A 5FGOA 3X42A 3GZXB 3JUMA 3KKGA 3DGOA 1QJGA 2GBWB 4GB5A 5IG5A 2CWVA 1W7CA 5CF2A 1RRLA 1M1K4 3VGNA 2CG1A 3NBBA 1U8CB 1IV9A 4XB5A 3EHCA 1TFKA 4HM1B 1FUWA 1PFPA 1IQYA 2W56A 1FGTA 4KFFA 3UNLA 1GY5A 3CCJ3 4N6MA 1S723 3LYGA 5LC7A 1DVDA 2YFJB 3K7CA 3G6E3 1QAFA 3OXAA 1JB4A 4ORLA 4H61A 2D1WA 2MF7A 2CW9A 3SOYA 2XSOB 4R9LA 3N8BA 1BUQA 3DMCA 1M1XB 1VQP3 4N6NB 3RGAA 1WNHA 2C11A 3PZWA 5A0OB 3KE7A 1HU9A 3CPW2 1VQN3 1KSIA 3NBJA 1J2BA 2OTJ3 3V98A 3KN4A 1QVG2 3J7Yd 3SXXA 1T5YA 3NV0B 3CCE3 3CMA3 2KRTA 4LSOA 4JF8A 2BT3A 3EE1A 5KP4A 4Q53A 3ER7A 2CFGA 2FGTA 1C7HA 5D83A 5KP3A 1VQ93 1N9JA 3LMLA 3F8XA 3MWZA 2XFTA 3LZAA 4R4KA 4N6TA 3IJEB 4ZM8A 5BXQA 4K61A 1GY6A 1LVNA 1ULIB 2HMKB 3UJMA 1V74A 2F98A 5D82A 4OUQA 3SOAA 1Q7Y4 4OK0A 2IUKA 3EB8A 3JUNA 3LXUX 1NB5I 3S29A 3X3YA 3NQYA 4AKYA 1VQ53 3S5CA 4NREA 1CEWI 1TU5A 4X2HA 3PCRA 2GBXB 3JUPA 5IG4A 3CNXA 2CHCA 2WOHA 3N9HA 1MOLA 2W04A 3GZYB 4BTWA 3I563 4BTXA 2A15A 3FSDA 1UI8A 3OW22 1W4NA 4EYCA 1YJ93 4RBNA 3DGLA 3FLJA 3HI7A 3STDA 4XBXA 5ELUA 1AVLA 2PZVA 5AIFA 2Z7AA 2OWPA 4O3VA 4H3UA 3CCR3 4K90B 1IVWA 1LOXA 2Z77A 5LC6A 5HGRA 4J9AA 2OCTA 3O8YA 1IK3A 3F9SA 3MYTA 3B8LA 4HM0B 3GRDA 1NU3A 1Q40B 3CC23 1U5OA 2WGOA 8CHOA 4L8PA 3CNMA 2OTL3 2GEYA 3FH1A 3GWRA 4HM6B 3FGYA 2HMOB 1VQ63 4HM4B 1DVCA 1VQ83 3AMOA 4IT7A 1N9EA 3CD63 2OOVA 1UI7A 1ZO2A 1K28A 3EN1B 1OF5B 4N6V0 4FMCA 3B4PA 4X2OA 5JPUA 3NM2A 2XRXB 4NHFA 1DYUA 1TP6A 4FMBA 1K9M4 1W00A 1PU4A 4HZBB 1VQL3 1JN5B 1M904 2XR8B 1IT8A 1WMNA 2CIUA 5JBSA 4J8TA 4HM8B 3BNEA 3NBRA 3PYJA 2W03A 4KVHA 5IG0A 3MG3A 2BMQB 3X40A 1KD14 4FR9A 3BNCA 3CC43 1OGXA 1Q814 3WOFB 2W9PA 1L5GB 5FW5A 1AVKA 1FGMA 3VF1A 2YFLB 4L7KA 3CCV3 2E2VA 1SJWA 3MHEA 4K1UA 4MMZB 2LQVA 1JKGA 2F99A 3G4S3 3CXC2 1GS3A 1VQ73 3JUQA 3EQQB 2HMLB 1OPYA 1IU7A 2O3OA 1O7GB 4STDA 2BO9B 2W0QA 4XM4A 5IEPA 2CKFB 2B24B 3WODG 1W2ZA 1CQSA 3EX9A 2GEXA 2CFWA 3GAXA 5AIGA 5CXOA 5IEOA 4R80A 3B7CA 3CCS3 5CK6A 1QALA 4K1VA 3X3ZA 3X41A 2SBLA 4RNYA 2E2UA 3F40A 3CME3 3DGNA 3BLZA 3I0YA 4MMYB 4IIAA 3LTBA 1OHSA 3PGBA 3BNBA 5EVHA 2WOFA 1OCVA 2QEX3 3CCQ3 4LEHA 4WYKB 3TDGA 4O8SA 1ASKA 3DY5A 3FCSB 4LGQA 3KFQC 1LXEA 3SEDA 5JPPA 3NV0A 3HK4A 2BHMA 2JDIH 3U97A 2W2CA 3E99A 1E97A 2BMRB 2RFRA 2FNQA 1AR0A 2HMMB 3JVCA 2XGLA 1US1A 1Z1SA 4HM3B 3WA2X 4EC6A 1CYVA 7STDA 3WDGB 3HIIA 3NM7A 3LOYA 2KXGA 1A2KA 2XEPA 3X3XA 2CFLA 5IENA 3WA3A 3IMAB 1NDOB 1Q42A 4HM5B 1OHPA 1LNHA 1KC84 4WFOA 5D81A 3GZRA 5AEUB 3CCU3 2W6JH 2IA7A 4LZIA 3L0RA 1DMQA 1Q864 1FGRA 4TX4A 3I553 1JB2A 4HBRA 2MC8A 1W6YA 3S28A 1DMMA 3CPOA 3K63A 3EBYA 3DXOA 3OWSA 4HYZA 3H51A 3RDEA 1D6YA 1W02A 4CDLA 4CCVA 1Q40A 2IMJA 3FG3A 3OV4A 1FGOA 4XDVA 4IPBA 4AEQA 5IW9A 1VQK3 1W5ZA 2ZDJA 4RZMA 4O02B 3OX9A 3JUOA 1IV7A 1E3RA 2XF3A 4PEJA 1N5HA 3NXJA 1RRHA 4QWTA 3WOEB 1D6UA 1OF5A 5IERA 1K734 1UW1A 3LT9A 4FCZA 1A90A 4N6LA 1YVBI 2K54A 3MG1A 1JRQA 3F7SA 5AYSC 3VSYA 2ML5A 2P0XA 1JN5A 1Q824 1STFI 5EEOA 1AV4A 1DMNA 4HKVB 4MMXB 1TUHA 1JNQA 5ELJA 2CWUA 3DUKA 3FG4A 3GZBA 3KSPA 3ROBA 1IVUA 1OHOA 2D42A 1YIT3 1N8R4 5IF6A 1ZX2A 3KZTA 3SX1A 1WTHA 4KZ1A 2P38A 3G0KA 1IDPA 4O2HA 1ISKA 3LTAA 2CFDA 3LH4A 5AYRB 3ECFA 3NX0A 3NUVA 1NB3I 1HKXA 5AI1A 3DM8A 1FGQA 3D3LA 3EJVA 4HM7B 3F14A 3LT8A 1GY7A 1VQ43 1E3VA 3UB1A 3KIIA 3FKAA 3M8CA 5CLKA 1FA3A 4XDWA 2BNGA 1N5PA 2M7OA 3T8NA 5CF1A 2V1LA 2CC3A 3D9RA 2Z6BA 2W56B 4FCMA 2P0MA 4EBGA 3EN8A 1OGZA 1GYBA 1YHQ3 2CH9A 3SVAA 4FCJA 4KFEA 1YI23 2ZL8A 1ROAA 2OQEC 3NHXA 1OACA 2Y74A 3S27A 3MG2A 3N54B 1WMPA 3G713 4R9KA 4G1MB 2INXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1X B;  1JB5 A;  2F86 B;  4U13 A;  4WYK A;  1EG9 B;  1OUN A;  1OH0 A;  2I9W A;  3WMD A;  2BMO B;  5AIH A;  5DRV A;  3F7X A;  2HMJ B;  3FF0 A;  4R1K A;  3A76 A;  3Q90 A;  4HJL B;  4OVM A;  4LMI A;  5G2G A;  3H3H A;  3DZL A;  1EA2 A;  1O7M B;  2RCD A;  4XBT A;  5KP1 A;  4L8O A;  3G16 A;  2STD A;  2QGU A;  1O7N B;  6STD A;  3MSO A;  3K0Z A;  2XSH B;  3T8U A;  3B4O A;  4WWU C;  4XBY A;  2GXF A;  3FZW A;  5BVB A;  2HMN B;  1ULJ B;  2JQ5 A;  4MJD A;  1QMA A;  3FF2 A;  5AEW B;  2YFI B;  2R4I A;  5AII A;  1UUW B;  2Z76 A;  3G8Z A;  1WQL B;  1O7W B;  3BB9 A;  3MKI A;  1VZZ A;  5STD A;  1K41 A;  1O7P B;  4WP5 A;  5IG3 A;  3RGR A;  4N3V A;  2RGQ A;  1O7H B;  2QIY A;  3HZP A;  1S5A A;  3EF8 A;  1NWW A;  3OWY A;  3EBT A;  1STD A;  4I4K A;  3F8H A;  3HX8 A;  1W01 A;  2UX0 A;  3OWU A;  1UUV B;  3CU3 A;  4HZ9 B;  5DRE A;  4HM2 B;  3EC9 A;  5TGN A;  3IPT A;  4HVN A;  1JKG B;  3GZX B;  3JUM A;  3KKG A;  1QJG A;  2GBW B;  4GB5 A;  5IG5 A;  5CF2 A;  3VGN A;  4XB5 A;  3EHC A;  4HM1 B;  3UNL A;  1GY5 A;  3LYG A;  2YFJ B;  3K7C A;  3OXA A;  1JB4 A;  4ORL A;  3SOY A;  2XSO B;  4R9L A;  1BUQ A;  3DMC A;  3RGA A;  3KE7 A;  3NV0 B;  5KP4 A;  4Q53 A;  3ER7 A;  1C7H A;  5D83 A;  5KP3 A;  3F8X A;  3LZA A;  5BXQ A;  1GY6 A;  1ULI B;  2HMK B;  3UJM A;  2F98 A;  5D82 A;  3SOA A;  4OUQ A;  3JUN A;  3S5C A;  4X2H A;  2GBX B;  3JUP A;  5IG4 A;  3CNX A;  2CHC A;  3GZY B;  2A15 A;  3FSD A;  3FLJ A;  3STD A;  4XBX A;  2PZV A;  5AIF A;  2Z7A A;  2OWP A;  4H3U A;  2Z77 A;  5HGR A;  4J9A A;  3F9S A;  3MYT A;  3B8L A;  4HM0 B;  3GRD A;  1NU3 A;  1Q40 B;  1U5O A;  8CHO A;  4L8P A;  3CNM A;  2GEY A;  3FH1 A;  3GWR A;  4HM6 B;  3FGY A;  2HMO B;  4HM4 B;  1ZO2 A;  3EN1 B;  1OF5 B;  3B4P A;  4X2O A;  5JPU A;  3NM2 A;  2XRX B;  1TP6 A;  1W00 A;  4HZB B;  1JN5 B;  2XR8 B;  4J8T A;  4HM8 B;  3NBR A;  4KVH A;  5IG0 A;  3MG3 A;  2BMQ B;  1OGX A;  5FW5 A;  2YFL B;  4L7K A;  1SJW A;  3MHE A;  4K1U A;  1JKG A;  2F99 A;  1GS3 A;  3JUQ A;  3EQQ B;  2HML B;  1OPY A;  1O7G B;  4STD A;  4XM4 A;  5IEP A;  2CKF B;  2B24 B;  1CQS A;  3EX9 A;  2GEX A;  5AIG A;  5CXO A;  5IEO A;  3B7C A;  5CK6 A;  4K1V A;  3F40 A;  3BLZ A;  3I0Y A;  4IIA A;  1OHS A;  5EVH A;  1OCV A;  4LEH A;  4WYK B;  1ASK A;  4LGQ A;  5JPP A;  3SED A;  3NV0 A;  3HK4 A;  2W2C A;  3E99 A;  1E97 A;  2BMR B;  2RFR A;  2HMM B;  1AR0 A;  1Z1S A;  4HM3 B;  7STD A;  1A2K A;  5IEN A;  1NDO B;  4HM5 B;  1Q42 A;  1OHP A;  5D81 A;  3GZR A;  5AEU B;  1DMQ A;  1JB2 A;  1W6Y A;  1DMM A;  3CPO A;  3EBY A;  3DXO A;  3OWS A;  3H51 A;  1W02 A;  4CDL A;  1Q40 A;  2IMJ A;  3OV4 A;  4XDV A;  4RZM A;  3OX9 A;  3JUO A;  1E3R A;  4PEJ A;  3NXJ A;  1OF5 A;  5IER A;  2K54 A;  3MG1 A;  3F7S A;  3VSY A;  1JN5 A;  1DMN A;  4HKV B;  1TUH A;  3ROB A;  3DUK A;  3GZB A;  3KSP A;  1OHO A;  5IF6 A;  1ZX2 A;  3KZT A;  3G0K A;  1IDP A;  1ISK A;  3ECF A;  3NUV A;  1HKX A;  5AI1 A;  3DM8 A;  3EJV A;  4HM7 B;  3F14 A;  1GY7 A;  1E3V A;  3FKA A;  3M8C A;  5CLK A;  4XDW A;  2BNG A;  3T8N A;  5CF1 A;  3D9R A;  4FCM A;  3EN8 A;  1OGZ A;  1GYB A;  4FCJ A;  3NHX A;  3MG2 A;  4R9K A;  2INX A; 
#chains in the Genus database with same CATH topology
 5EQL A;  2CWT A;  2B1X B;  1JB5 A;  2F86 B;  1QAK A;  4U13 A;  4WYK A;  1KQS 2;  1EG9 B;  1YNV X;  4N6O B;  1OUN A;  2IUJ A;  1GMQ A;  1OH0 A;  1TFO A;  2I9W A;  1JBS A;  3WMD A;  1WMO A;  1RJO A;  2BMO B;  2OOV C;  2XGN A;  5AIH A;  1GMP A;  1X1W A;  5DRV A;  3F7X A;  1EQK A;  3K9M C;  1GD4 A;  1W6C A;  4WHA A;  1N8Q A;  1BRN L;  1D6Z A;  2RNT A;  1BAO A;  1W6G A;  2GU3 A;  2E2T A;  1JZO A;  1YJN 3;  2HMJ B;  3S67 A;  3CC7 3;  3FF0 A;  4R1K A;  5I97 A;  1YIJ 3;  3AGN A;  1YGE A;  1C54 A;  3CCL 3;  3A76 A;  3Q90 A;  4HJL B;  1A2V A;  1MNL A;  1VQM 3;  1BSC A;  1SIH A;  3PCS A;  3SLU A;  4OVM A;  1IVX A;  2Y73 A;  1SQW A;  1NO3 A;  1UCI A;  3ALA A;  3BND A;  8RNT A;  4AKZ A;  4GL6 A;  4MEI A;  1VQQ A;  4HAA A;  4LMI A;  5G2G A;  3URP A;  1SII A;  2R41 A;  3H3H A;  3DZL A;  3KSE D;  1EA2 A;  1O7M B;  2W9Q A;  2RCD A;  4XBT A;  2CX1 A;  2Q07 A;  2CK3 H;  4KFD A;  5KP1 A;  4L8O A;  4RNZ A;  3G16 A;  1RNT A;  1B2U A;  1YJW 3;  2STD A;  1BRJ A;  1O7N B;  2CFK A;  2QGU A;  6STD A;  1HZ1 A;  2F5W A;  2ZA4 A;  4EV5 A;  3V99 A;  2PNC A;  3K0Z A;  3MSO A;  2GU1 A;  2XSH B;  3T8U A;  3CCM 3;  3B4O A;  3FG1 A;  4WWU C;  4N6U A;  4XBY A;  2GXF A;  3FZW A;  3DGM A;  5BVB A;  2HMN B;  1JJ2 2;  3PS8 A;  1GD3 A;  1IQX A;  1K8A 4;  1JV2 B;  1ULJ B;  2JQ5 A;  4MJD A;  1QMA A;  1Y4K A;  3FF2 A;  5AEW B;  2FXT A;  1SPU A;  2YFI B;  2R4I A;  2QA4 3;  1G96 A;  1V58 A;  1VQO 3;  3U1W A;  1BNJ A;  1CYU A;  1FYS A;  5AII A;  1BIR A;  1M9G A;  4BTY A;  4EXR A;  2KCD A;  1UUW B;  2XH9 A;  2Z76 A;  1W2B 2;  3G8Z A;  1EKM A;  1WQL B;  4FMD A;  1QVF 2;  2OQE A;  2C10 A;  1O7W B;  1TIJ A;  2XFS A;  2K0M A;  3BB9 A;  3MKI A;  3UL5 A;  1BVI A;  1T2H A;  1VZZ A;  5STD A;  3T0U A;  1K41 A;  1BRS A;  3V92 A;  1KWI A;  4FMA A;  4LYL B;  2P05 A;  3UL6 A;  1PY3 A;  1O7P B;  3AMO B;  1JBT A;  4WP5 A;  1UGH I;  5IG3 A;  3RGR A;  4N3V A;  2RGQ A;  1IQ8 A;  1O7H B;  1ROV A;  2P09 A;  1A67 A;  2QIY A;  2WGQ A;  3LTC A;  3MPH A;  4EV2 A;  2LYX A;  1RKY A;  1NNV A;  3HZP A;  2F4Y A;  1IVV A;  2AAE A;  3ZG5 A;  1RGC A;  1RN7 A;  1S5A A;  2CX0 A;  3EF8 A;  1NWW A;  3LTD A;  3RNT A;  3OWY A;  3EBT A;  1STD A;  4I4K A;  4JRF A;  1AQZ A;  3F8H A;  3HX8 A;  3Q2P A;  1W01 A;  2ML6 A;  1IT7 A;  2UX0 A;  3OWU A;  1NJI 4;  2C4B A;  1I3I A;  3NQZ A;  3QRD A;  1UUV B;  3CU3 A;  4HZ9 B;  3PXM A;  1BGS A;  3K5T A;  3AGO A;  3QK9 A;  5DRE A;  4HM2 B;  1R4C A;  1F8N A;  1BRK A;  3Q1C A;  3EC9 A;  2F56 A;  2CG0 A;  1RNB A;  3HIG A;  5TGN A;  1UCJ A;  3IPT A;  1RGG A;  2ZHX B;  2L4V A;  2O9U X;  4HVN A;  1ZS7 A;  2WO0 A;  3AHS A;  3DH2 A;  2BU4 A;  5M1A A;  3SYU A;  7RNT A;  1JKG B;  2RSX A;  2YX9 A;  5FGO A;  3X42 A;  1DET A;  3GZX B;  3JUM A;  3KKG A;  3DGO A;  3BU4 A;  1QJG A;  2GBW B;  4GB5 A;  5IG5 A;  2CWV A;  1W7C A;  5CF2 A;  1MWT A;  1BRH A;  1RRL A;  1M1K 4;  3VGN A;  2CG1 A;  3NBB A;  1U8C B;  1IV9 A;  4XB5 A;  3EHC A;  1LOV A;  2RBI A;  1TFK A;  4HM1 B;  1FUW A;  1PFP A;  1IQY A;  1I2F A;  1T3B A;  2W56 A;  4KFF A;  1GY5 A;  3UNL A;  4N6M A;  3CCJ 3;  1S72 3;  3LYG A;  1GMR A;  1G0T A;  2BIR A;  5LC7 A;  1DVD A;  1TTO A;  2YFJ B;  3K7C A;  3G6E 3;  1QAF A;  3OXA A;  1HYF A;  1JB4 A;  4ORL A;  1BSB A;  3D4A A;  1I0X A;  4H61 A;  2D1W A;  2MF7 A;  2CW9 A;  3SOY A;  1R4Y A;  1GOU A;  2XSO B;  4R9L A;  3N8B A;  1BUQ A;  3DMC A;  1M1X B;  1VQP 3;  4N6N B;  3RGA A;  1WNH A;  2C11 A;  3PZW A;  4J5K A;  1UCL A;  5A0O B;  3KE7 A;  3KCH A;  4BL3 A;  1HU9 A;  1B2Z A;  3CPW 2;  2GSP A;  1VQN 3;  1KSI A;  3ZG0 A;  3NBJ A;  1J2B A;  2OTJ 3;  3V98 A;  3KN4 A;  1QVG 2;  3J7Y d;  1BU4 A;  3SXX A;  1T5Y A;  3NV0 B;  3CCE 3;  4BU4 A;  3CMA 3;  2KRT A;  4LSO A;  4JF8 A;  2BT3 A;  3EE1 A;  5KP4 A;  1LNI A;  2H0H A;  4Q53 A;  3ER7 A;  2CFG A;  1BSA A;  2FGT A;  1C7H A;  5D83 A;  4GHO A;  5KP3 A;  1VQ9 3;  1N9J A;  3LML A;  3F8X A;  3MWZ A;  2XFT A;  3LZA A;  4R4K A;  4N6T A;  3IJE B;  4ZM8 A;  5BXQ A;  4K61 A;  1GY6 A;  1LVN A;  1ULI B;  3ZFZ A;  2HMK B;  3UJM A;  1V74 A;  2F98 A;  2L1S A;  4OUQ A;  5D82 A;  3SOA A;  1Q7Y 4;  4OK0 A;  2IUK A;  3EB8 A;  3JUN A;  2KF4 A;  2AAD A;  3LXU X;  1NB5 I;  3S29 A;  3X3Y A;  2KAA A;  1ZGX A;  3NQY A;  4AKY A;  1VQ5 3;  3D5G A;  3S5C A;  4NRE A;  1CEW I;  1TU5 A;  1RGK A;  4X2H A;  3PCR A;  2GBX B;  5BU4 A;  3JUP A;  5IG4 A;  3CNX A;  2CHC A;  1V57 A;  2WOH A;  3N9H A;  1MOL A;  2W04 A;  3GZY B;  4BTW A;  1PYL A;  4BTX A;  2A15 A;  5BIR A;  3I56 3;  3FSD A;  1UI8 A;  3A5E A;  3OW2 2;  1W4N A;  4EYC A;  1YJ9 3;  4RBN A;  3DGL A;  3FLJ A;  3HI7 A;  4CJN A;  3STD A;  4XBX A;  5ELU A;  2INX A;  1Q7H A;  1AVL A;  2PZV A;  5AIF A;  2Z7A A;  2OWP A;  4O3V A;  4H3U A;  3CCR 3;  4K90 B;  1RN4 A;  1BRG A;  1IVW A;  1LOX A;  2KF3 A;  2Z77 A;  5HGR A;  5LC6 A;  1BNS A;  4J9A A;  1I70 A;  5G1K A;  2OCT A;  3O8Y A;  1IK3 A;  3F9S A;  3MYT A;  3B8L A;  4HM0 B;  3GRD A;  1B21 A;  1NU3 A;  1Q40 B;  3CC2 3;  1U5O A;  2IYJ A;  2WGO A;  8CHO A;  3AHW A;  4L8P A;  3CNM A;  2OTL 3;  2GEY A;  3FH1 A;  3GWR A;  4HM6 B;  3FGY A;  2HMO B;  1VQ6 3;  4HM4 B;  6GSP A;  1DVC A;  1VQ8 3;  1G02 A;  3AMO A;  3HOH A;  4IT7 A;  1N9E A;  3CD6 3;  2OOV A;  1RMS A;  1UI7 A;  1ZO2 A;  1K28 A;  1UCK A;  3EN1 B;  1OF5 B;  3D5I A;  4FMC A;  4N6V 0;  3B4P A;  4X2O A;  1I2G A;  5JPU A;  3DGY A;  3NM2 A;  2XRX B;  4I5Q A;  1DYU A;  1TP6 A;  4FMB A;  4NHF A;  1K9M 4;  1W00 A;  2SAR A;  1GOY A;  1PU4 A;  4HZB B;  1AY7 A;  1VQL 3;  1JN5 B;  1M90 4;  4RNT A;  2XR8 B;  1IT8 A;  1RLS A;  1WMN A;  2CIU A;  4EW5 A;  5JBS A;  1LOY A;  4J8T A;  1LQM B;  4HM8 B;  3BNE A;  3NBR A;  3PYJ A;  2H0G A;  2W03 A;  4KVH A;  5IG0 A;  3MG3 A;  5RNT A;  2BMQ B;  3X40 A;  1KD1 4;  4FR9 A;  3BNC A;  3CC4 3;  1OGX A;  1Q81 4;  1A2P A;  3WOF B;  2W9P A;  1L5G B;  1BSD A;  5FW5 A;  1AVK A;  1B20 A;  1FGM A;  3VF1 A;  4KT3 B;  2IY2 A;  2YFL B;  4L7K A;  3CCV 3;  1Q9E A;  2E2V A;  1SJW A;  3MHE A;  4K1U A;  1YVS A;  4MMZ B;  2LQV A;  1JKG A;  2F99 A;  3G4S 3;  1UGI A;  3CXC 2;  1GS3 A;  1VQ7 3;  3JUQ A;  3EQQ B;  2HML B;  1OPY A;  1RSN A;  1IU7 A;  2O3O A;  1O7G B;  4STD A;  2HOH A;  2BO9 B;  2W0Q A;  1JZD A;  4XM4 A;  5IEP A;  1LOW A;  2B24 B;  1RDS A;  2CKF B;  1BNF A;  2UGI A;  3WOD G;  1W2Z A;  1B2S A;  1CQS A;  3EX9 A;  1MWU A;  2GEX A;  4NPB A;  2CFW A;  3GAX A;  1IYY A;  1I8V A;  5AIG A;  5CXO A;  1SAR A;  3BIR A;  3B7C A;  4R80 A;  5CK6 A;  5IEO A;  1QAL A;  3WR2 A;  4K1V A;  3X3Z A;  3CCS 3;  3X41 A;  1X1X A;  2SBL A;  2KF5 A;  4RNY A;  2E2U A;  1EUI C;  1BNR A;  3F40 A;  4DKI A;  3DGN A;  3CME 3;  3BLZ A;  3I0Y A;  4MMY B;  4IIA A;  3LTB A;  1OHS A;  1I3F A;  3PGB A;  3BNB A;  5EVH A;  2WOF A;  1OCV A;  1LQG C;  2QEX 3;  3CCQ 3;  4HOH A;  4LEH A;  4WYK B;  3TDG A;  4O8S A;  1ASK A;  3DY5 A;  3FCS B;  4LGQ A;  3KFQ C;  1LXE A;  3SED A;  5JPP A;  2H0I A;  3NV0 A;  3HK4 A;  2F5M A;  1LRA A;  2BHM A;  2JDI H;  3U97 A;  1FUS A;  2W2C A;  1E97 A;  3E99 A;  2BMR B;  1RN1 A;  2RFR A;  4ILF A;  2FNQ A;  1AR0 A;  2HMM B;  3JVC A;  2XGL A;  1US1 A;  1Z1S A;  4HM3 B;  3WA2 X;  1BNE A;  4EC6 A;  1CYV A;  7STD A;  3WDG B;  3HII A;  3NM7 A;  1BUJ A;  3LOY A;  2KXG A;  1FW7 A;  1A2K A;  2XEP A;  3X3X A;  2CFL A;  5IEN A;  1RCL A;  5M19 A;  1I2E A;  3WA3 A;  3IMA B;  1NDO B;  1Q42 A;  2J8X B;  4HM5 B;  1OHP A;  1UDI I;  1MGW A;  1RGL A;  1LNH A;  1KC8 4;  1GSP A;  4WFO A;  5D81 A;  1FUT A;  3GZR A;  5AEU B;  2W6J H;  2IA7 A;  4LZI A;  3CCU 3;  1RTU A;  3L0R A;  1DMQ A;  3D79 A;  1Q86 4;  1FGR A;  2KF6 A;  1UUG B;  4TX4 A;  3I55 3;  1JB2 A;  4HBR A;  2MC8 A;  2K3D A;  1W6Y A;  3S28 A;  1TJD A;  4GSP A;  1DMM A;  4BL2 A;  3CPO A;  3K63 A;  3EBY A;  3DXO A;  3OWS A;  4HYZ A;  6RNT A;  3H51 A;  3RDE A;  4CPK A;  1D6Y A;  1CH0 A;  1W02 A;  4CDL A;  4CCV A;  1Q40 A;  2IMJ A;  3FG3 A;  3OV4 A;  1FGO A;  4XDV A;  4IPB A;  4AEQ A;  5IW9 A;  1VQK 3;  1W5Z A;  2ZDJ A;  4RZM A;  4O02 B;  3OX9 A;  3Q3F A;  3JUO A;  1MWS A;  1IV7 A;  1X1U A;  1E3R A;  2XF3 A;  4PEJ A;  1N5H A;  3NXJ A;  1RRH A;  4QWT A;  3WOE B;  1D6U A;  1OF5 A;  5IER A;  1K73 4;  1BOX A;  1UW1 A;  3LT9 A;  4FCZ A;  1A90 A;  4N6L A;  1YVB I;  2K54 A;  3MG1 A;  1JRQ A;  1X1Y A;  1T2I A;  3F7S A;  5AYS C;  1EEJ A;  3VSY A;  2ML5 A;  1B2X A;  2P0X A;  1JN5 A;  1Q82 4;  1STF I;  5EEO A;  1AV4 A;  1DMN A;  4HKV B;  4MMX B;  1TUH A;  1JNQ A;  5ELJ A;  2CWU A;  3DUK A;  3FG4 A;  3GZB A;  3KSP A;  3ROB A;  1IVU A;  1OHO A;  1RGE A;  2D42 A;  1YIT 3;  1N8R 4;  5IF6 A;  1RGF A;  1BRI A;  1ZX2 A;  3KZT A;  3SX1 A;  1WTH A;  4KZ1 A;  5G1L A;  1B27 A;  2P38 A;  3G0K A;  1B3S A;  1IDP A;  1MGR A;  4O2H A;  3WHO A;  1ISK A;  4J5G A;  3LTA A;  9RNT A;  2CFD A;  3LH4 A;  5AYR B;  3ECF A;  5HOH A;  3NX0 A;  3NUV A;  1NB3 I;  5M18 A;  1BAN A;  1HKX A;  5AI1 A;  3DM8 A;  1FGQ A;  1RCK A;  3D3L A;  3EJV A;  1RGA A;  3F14 A;  3LT8 A;  4HM7 B;  1GY7 A;  1VQ4 3;  1E3V A;  3UB1 A;  3KII A;  1RHL A;  3FKA A;  3M8C A;  5CLK A;  1FA3 A;  1DE3 A;  4XDW A;  2BNG A;  1N5P A;  2M7O A;  3T8N A;  5CF1 A;  2V1L A;  2CC3 A;  2UUG C;  3D9R A;  1B2M A;  3GSP A;  5GSP A;  2Z6B A;  2W56 B;  1MWR A;  4FCM A;  2P0M A;  4EBG A;  1FZU A;  3EN8 A;  1OGZ A;  1GYB A;  1YHQ 3;  2CH9 A;  4BIR A;  3SVA A;  7GSP A;  1JBR A;  4FCJ A;  1RGH A;  4KFE A;  1YI2 3;  2ZL8 A;  1ROA A;  2OQE C;  1BNG A;  3NHX A;  1TRQ A;  1OAC A;  2Y74 A;  1BSE A;  3S27 A;  3MG2 A;  3N54 B;  1WMP A;  1BNI A;  3G71 3;  4R9K A;  1GOV A;  1TRP A;  1YGW A;  1FGT A;  4G1M B;  1I0V A; 
#chains in the Genus database with same CATH homology
 5EQL A;  2CWT A;  2B1X B;  1JB5 A;  2F86 B;  1QAK A;  4U13 A;  4WYK A;  1KQS 2;  1EG9 B;  4N6O B;  1OUN A;  2IUJ A;  1OH0 A;  1TFO A;  2I9W A;  3WMD A;  1WMO A;  1RJO A;  2BMO B;  2OOV C;  2XGN A;  5AIH A;  1EQK A;  5DRV A;  3F7X A;  3K9M C;  1GD4 A;  1W6C A;  4WHA A;  1N8Q A;  1D6Z A;  1W6G A;  2GU3 A;  2E2T A;  1YJN 3;  2HMJ B;  3S67 A;  3CC7 3;  3FF0 A;  4R1K A;  5I97 A;  1YIJ 3;  1YGE A;  3CCL 3;  3A76 A;  3Q90 A;  4HJL B;  1A2V A;  1MNL A;  1VQM 3;  1SIH A;  3PCS A;  3SLU A;  4OVM A;  1IVX A;  2Y73 A;  1SQW A;  1NO3 A;  3ALA A;  3BND A;  4AKZ A;  4GL6 A;  4MEI A;  4LMI A;  5G2G A;  1SII A;  3H3H A;  3DZL A;  3KSE D;  1EA2 A;  1O7M B;  2W9Q A;  2RCD A;  4XBT A;  2Q07 A;  2CK3 H;  4KFD A;  5KP1 A;  4L8O A;  4RNZ A;  3G16 A;  1YJW 3;  2STD A;  2CFK A;  1O7N B;  2QGU A;  6STD A;  4EV5 A;  3V99 A;  2PNC A;  3K0Z A;  3MSO A;  2GU1 A;  2XSH B;  3T8U A;  3CCM 3;  3B4O A;  3FG1 A;  4WWU C;  4N6U A;  4XBY A;  2GXF A;  3FZW A;  3DGM A;  5BVB A;  2HMN B;  1JJ2 2;  3PS8 A;  1GD3 A;  1IQX A;  1K8A 4;  2JQ5 A;  1JV2 B;  1ULJ B;  4MJD A;  1QMA A;  1Y4K A;  3FF2 A;  5AEW B;  2FXT A;  1SPU A;  2YFI B;  2R4I A;  2QA4 3;  1G96 A;  1VQO 3;  3U1W A;  1CYU A;  5AII A;  1M9G A;  4BTY A;  4EXR A;  2KCD A;  1UUW B;  2XH9 A;  2Z76 A;  1W2B 2;  3G8Z A;  1EKM A;  1WQL B;  4FMD A;  1QVF 2;  2OQE A;  2C10 A;  1O7W B;  1TIJ A;  2XFS A;  2K0M A;  3BB9 A;  3MKI A;  3UL5 A;  3T0U A;  1VZZ A;  5STD A;  3V92 A;  1K41 A;  1KWI A;  4FMA A;  2P05 A;  3UL6 A;  1O7P B;  3AMO B;  4WP5 A;  5IG3 A;  3RGR A;  4N3V A;  2RGQ A;  1IQ8 A;  1O7H B;  1ROV A;  2P09 A;  1A67 A;  2QIY A;  2WGQ A;  3LTC A;  3MPH A;  4EV2 A;  2LYX A;  1RKY A;  3HZP A;  1IVV A;  1RN7 A;  1S5A A;  3EF8 A;  1NWW A;  3LTD A;  3OWY A;  3EBT A;  1STD A;  4I4K A;  4JRF A;  3F8H A;  3HX8 A;  3Q2P A;  1W01 A;  2ML6 A;  1IT7 A;  2UX0 A;  3OWU A;  1NJI 4;  3NQZ A;  3QRD A;  1UUV B;  3CU3 A;  4HZ9 B;  3PXM A;  3K5T A;  3QK9 A;  5DRE A;  4HM2 B;  1R4C A;  1F8N A;  3Q1C A;  3EC9 A;  2CG0 A;  3HIG A;  5TGN A;  3IPT A;  2O9U X;  2L4V A;  4HVN A;  2WO0 A;  1JKG B;  2RSX A;  2YX9 A;  5FGO A;  3X42 A;  3GZX B;  3JUM A;  3KKG A;  3DGO A;  1QJG A;  2GBW B;  4GB5 A;  5IG5 A;  2CWV A;  1W7C A;  5CF2 A;  1RRL A;  1M1K 4;  3VGN A;  2CG1 A;  3NBB A;  1U8C B;  1IV9 A;  4XB5 A;  3EHC A;  1TFK A;  4HM1 B;  1FUW A;  1PFP A;  1IQY A;  2W56 A;  1FGT A;  4KFF A;  3UNL A;  1GY5 A;  3CCJ 3;  4N6M A;  1S72 3;  3LYG A;  5LC7 A;  1DVD A;  2YFJ B;  3K7C A;  3G6E 3;  1QAF A;  3OXA A;  1JB4 A;  4ORL A;  4H61 A;  2D1W A;  2MF7 A;  2CW9 A;  3SOY A;  2XSO B;  4R9L A;  3N8B A;  1BUQ A;  3DMC A;  1M1X B;  1VQP 3;  4N6N B;  3RGA A;  1WNH A;  2C11 A;  3PZW A;  5A0O B;  3KE7 A;  1HU9 A;  3CPW 2;  1VQN 3;  1KSI A;  3NBJ A;  1J2B A;  2OTJ 3;  3V98 A;  3KN4 A;  1QVG 2;  3J7Y d;  3SXX A;  1T5Y A;  3NV0 B;  3CCE 3;  3CMA 3;  2KRT A;  4LSO A;  4JF8 A;  2BT3 A;  3EE1 A;  5KP4 A;  4Q53 A;  3ER7 A;  2CFG A;  2FGT A;  1C7H A;  5D83 A;  5KP3 A;  1VQ9 3;  1N9J A;  3LML A;  3F8X A;  3MWZ A;  2XFT A;  3LZA A;  4R4K A;  4N6T A;  3IJE B;  4ZM8 A;  5BXQ A;  4K61 A;  1GY6 A;  1LVN A;  1ULI B;  2HMK B;  3UJM A;  1V74 A;  2F98 A;  5D82 A;  4OUQ A;  3SOA A;  1Q7Y 4;  4OK0 A;  2IUK A;  3EB8 A;  3JUN A;  3LXU X;  1NB5 I;  3S29 A;  3X3Y A;  3NQY A;  4AKY A;  1VQ5 3;  3S5C A;  4NRE A;  1CEW I;  1TU5 A;  4X2H A;  3PCR A;  2GBX B;  3JUP A;  5IG4 A;  3CNX A;  2CHC A;  2WOH A;  3N9H A;  1MOL A;  2W04 A;  3GZY B;  4BTW A;  3I56 3;  4BTX A;  2A15 A;  3FSD A;  1UI8 A;  3OW2 2;  1W4N A;  4EYC A;  1YJ9 3;  4RBN A;  3DGL A;  3FLJ A;  3HI7 A;  3STD A;  4XBX A;  5ELU A;  1AVL A;  2PZV A;  5AIF A;  2Z7A A;  2OWP A;  4O3V A;  4H3U A;  3CCR 3;  4K90 B;  1IVW A;  1LOX A;  2Z77 A;  5LC6 A;  5HGR A;  4J9A A;  2OCT A;  3O8Y A;  1IK3 A;  3F9S A;  3MYT A;  3B8L A;  4HM0 B;  3GRD A;  1NU3 A;  1Q40 B;  3CC2 3;  1U5O A;  2WGO A;  8CHO A;  4L8P A;  3CNM A;  2OTL 3;  2GEY A;  3FH1 A;  3GWR A;  4HM6 B;  3FGY A;  2HMO B;  1VQ6 3;  4HM4 B;  1DVC A;  1VQ8 3;  3AMO A;  4IT7 A;  1N9E A;  3CD6 3;  2OOV A;  1UI7 A;  1ZO2 A;  1K28 A;  3EN1 B;  1OF5 B;  4N6V 0;  4FMC A;  3B4P A;  4X2O A;  5JPU A;  3NM2 A;  2XRX B;  4NHF A;  1DYU A;  1TP6 A;  4FMB A;  1K9M 4;  1W00 A;  1PU4 A;  4HZB B;  1VQL 3;  1JN5 B;  1M90 4;  2XR8 B;  1IT8 A;  1WMN A;  2CIU A;  5JBS A;  4J8T A;  4HM8 B;  3BNE A;  3NBR A;  3PYJ A;  2W03 A;  4KVH A;  5IG0 A;  3MG3 A;  2BMQ B;  3X40 A;  1KD1 4;  4FR9 A;  3BNC A;  3CC4 3;  1OGX A;  1Q81 4;  3WOF B;  2W9P A;  1L5G B;  5FW5 A;  1AVK A;  1FGM A;  3VF1 A;  2YFL B;  4L7K A;  3CCV 3;  2E2V A;  1SJW A;  3MHE A;  4K1U A;  4MMZ B;  2LQV A;  1JKG A;  2F99 A;  3G4S 3;  3CXC 2;  1GS3 A;  1VQ7 3;  3JUQ A;  3EQQ B;  2HML B;  1OPY A;  1IU7 A;  2O3O A;  1O7G B;  4STD A;  2BO9 B;  2W0Q A;  4XM4 A;  5IEP A;  2CKF B;  2B24 B;  3WOD G;  1W2Z A;  1CQS A;  3EX9 A;  2GEX A;  2CFW A;  3GAX A;  5AIG A;  5CXO A;  5IEO A;  4R80 A;  3B7C A;  3CCS 3;  5CK6 A;  1QAL A;  4K1V A;  3X3Z A;  3X41 A;  2SBL A;  4RNY A;  2E2U A;  3F40 A;  3CME 3;  3DGN A;  3BLZ A;  3I0Y A;  4MMY B;  4IIA A;  3LTB A;  1OHS A;  3PGB A;  3BNB A;  5EVH A;  2WOF A;  1OCV A;  2QEX 3;  3CCQ 3;  4LEH A;  4WYK B;  3TDG A;  4O8S A;  1ASK A;  3DY5 A;  3FCS B;  4LGQ A;  3KFQ C;  1LXE A;  3SED A;  5JPP A;  3NV0 A;  3HK4 A;  2BHM A;  2JDI H;  3U97 A;  2W2C A;  3E99 A;  1E97 A;  2BMR B;  2RFR A;  2FNQ A;  1AR0 A;  2HMM B;  3JVC A;  2XGL A;  1US1 A;  1Z1S A;  4HM3 B;  3WA2 X;  4EC6 A;  1CYV A;  7STD A;  3WDG B;  3HII A;  3NM7 A;  3LOY A;  2KXG A;  1A2K A;  2XEP A;  3X3X A;  2CFL A;  5IEN A;  3WA3 A;  3IMA B;  1NDO B;  1Q42 A;  4HM5 B;  1OHP A;  1LNH A;  1KC8 4;  4WFO A;  5D81 A;  3GZR A;  5AEU B;  3CCU 3;  2W6J H;  2IA7 A;  4LZI A;  3L0R A;  1DMQ A;  1Q86 4;  1FGR A;  4TX4 A;  3I55 3;  1JB2 A;  4HBR A;  2MC8 A;  1W6Y A;  3S28 A;  1DMM A;  3CPO A;  3K63 A;  3EBY A;  3DXO A;  3OWS A;  4HYZ A;  3H51 A;  3RDE A;  1D6Y A;  1W02 A;  4CDL A;  4CCV A;  1Q40 A;  2IMJ A;  3FG3 A;  3OV4 A;  1FGO A;  4XDV A;  4IPB A;  4AEQ A;  5IW9 A;  1VQK 3;  1W5Z A;  2ZDJ A;  4RZM A;  4O02 B;  3OX9 A;  3JUO A;  1IV7 A;  1E3R A;  2XF3 A;  4PEJ A;  1N5H A;  3NXJ A;  1RRH A;  4QWT A;  3WOE B;  1D6U A;  1OF5 A;  5IER A;  1K73 4;  1UW1 A;  3LT9 A;  4FCZ A;  1A90 A;  4N6L A;  1YVB I;  2K54 A;  3MG1 A;  1JRQ A;  3F7S A;  5AYS C;  3VSY A;  2ML5 A;  2P0X A;  1JN5 A;  1Q82 4;  1STF I;  5EEO A;  1AV4 A;  1DMN A;  4HKV B;  4MMX B;  1TUH A;  1JNQ A;  5ELJ A;  2CWU A;  3DUK A;  3FG4 A;  3GZB A;  3KSP A;  3ROB A;  1IVU A;  1OHO A;  2D42 A;  1YIT 3;  1N8R 4;  5IF6 A;  1ZX2 A;  3KZT A;  3SX1 A;  1WTH A;  4KZ1 A;  2P38 A;  3G0K A;  1IDP A;  4O2H A;  1ISK A;  3LTA A;  2CFD A;  3LH4 A;  5AYR B;  3ECF A;  3NX0 A;  3NUV A;  1NB3 I;  1HKX A;  5AI1 A;  3DM8 A;  1FGQ A;  3D3L A;  3EJV A;  4HM7 B;  3F14 A;  3LT8 A;  1GY7 A;  1VQ4 3;  1E3V A;  3UB1 A;  3KII A;  3FKA A;  3M8C A;  5CLK A;  1FA3 A;  4XDW A;  2BNG A;  1N5P A;  2M7O A;  3T8N A;  5CF1 A;  2V1L A;  2CC3 A;  3D9R A;  2Z6B A;  2W56 B;  4FCM A;  2P0M A;  4EBG A;  3EN8 A;  1OGZ A;  1GYB A;  1YHQ 3;  2CH9 A;  3SVA A;  4FCJ A;  4KFE A;  1YI2 3;  2ZL8 A;  1ROA A;  2OQE C;  3NHX A;  1OAC A;  2Y74 A;  3S27 A;  3MG2 A;  3N54 B;  1WMP A;  3G71 3;  4R9K A;  4G1M B;  2INX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...