1OGXA

High resolution crystal structure of ketosteroid isomerase mutant d40n(d38n, ti numbering) from pseudomonas putida complexed with equilenin at 2.0 a resolution.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Detection of Large Pka Perturbation of an Inhibitor and a Catalytic Group at an Enzyme Active Site, a Mechanistic Basis for Catalytic Power of Many Enzymes
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ogxA00
3FKAA 3I0YA 3MG2A 3DUKA 4XM4A 3EN8A 3OWYA 3SOYA 1ULJB 1OHOA 5D83A 1Q40B 4LGQA 1STDA 5BXQA 3OV4A 1O7HB 3HX8A 3SOAA 1OCVA 2BMRB 2Z77A 2QGUA 3CU3A 2XR8B 6STDA 4U13A 2BNGA 3GWRA 3RGAA 3B4PA 3MYTA 2STDA 2YFLB 3BB9A 3VSYA 3F7SA 2CHCA 1C7HA 3B4OA 2F98A 2RGQA 2IMJA 4K1VA 4HZBB 1JB4A 2F99A 2YFIB 5AIHA 4HM5B 3EBTA 2HMOB 3NBRA 5AIIA 4XDWA 2GEXA 3VGNA 3Q90A 3WMDA 3K7CA 1OGZA 4WWUC 5AEWB 5IG5A 2GEYA 5JPUA 1JKGB 3G16A 4XBXA 3JUOA 1E3VA 5DREA 3F9SA 2GBWB 3EBYA 4HM1B 3GZYB 5AI1A 1EA2A 2B1XB 3STDA 4L8OA 1JN5B 3FF0A 4HM6B 1IDPA 1ULIB 4HM0B 1GS3A 3F8HA 4MJDA 1GYBA 3G0KA 4Q53A 1ISKA 5IG3A 3NV0A 3OX9A 4X2HA 5JPPA 4LMIA 3OWSA 4LEHA 2RFRA 1O7MB 3HK4A 1A2KA 1JB5A 3B8LA 3MG3A 5STDA 1GY5A 1ZO2A 2OWPA 4STDA 1OH0A 1OHSA 2W2CA 2B24B 5DRVA 3FSDA 5KP4A 1BUQA 1TP6A 1DMQA 1Z1SA 1E3RA 4OVMA 3DMCA 3LZAA 3S5CA 1EG9B 2HMMB 1NU3A 4R9KA 4HM7B 2HMKB 1ASKA 1JB2A 3FZWA 1U5OA 3ROBA 3DXOA 3F14A 1S5AA 3FF2A 3EHCA 4XBYA 3HZPA 1W02A 3RGRA 3F8XA 5G2GA 4J9AA 1K41A 1O7NB 1Q42A 5TGNA 1O7GB 1DMNA 2R4IA 2XSOB 5IF6A 3OXAA 4GB5A 3FLJA 4K1UA 3BLZA 1NDOB 4R9LA 4CDLA 1OUNA 5IEPA 3K0ZA 3JUNA 4FCJA 5D81A 2F86B 2Z7AA 3UJMA 5D82A 3F7XA 7STDA 2UX0A 3MKIA 5CK6A 4WP5A 2JQ5A 1W01A 2HMJB 3F40A 3KKGA 4HM2B 5IG0A 4KVHA 1OF5A 1OHPA 3NV0B 5AEUB 5CF2A 4XB5A 3T8UA 3NUVA 1WQLB 4HVNA 5HGRA 3M8CA 3GRDA 3A76A 3NM2A 3EX9A 4HM8B 3CNXA 3JUPA 3T8NA 4ORLA 4HM4B 1QJGA 3KSPA 4PEJA 4HZ9B 1DMMA 3OWUA 4IIAA 3MG1A 4WYKA 8CHOA 3DM8A 3IPTA 3MHEA 4FCMA 2PZVA 3EC9A 1GY6A 4L7KA 4XBTA 3D9RA 2HMNB 1UUWB 5FW5A 4L8PA 3H51A 1W6YA 4HJLB 1NWWA 3KZTA 5CF1A 2A15A 4R1KA 5KP3A 1O7PB 4J8TA 2BMQB 3CNMA 1Q40A 3GZBA 3SEDA 3NHXA 4OUQA 3GZXB 3LYGA 5IG4A 2GXFA 1W00A 5IENA 3UNLA 3JUMA 5CXOA 2XSHB 3FH1A 3CPOA 1CQSA 3H3HA 2K54A 1O7WB 2GBXB 2HMLB 3DZLA 2RCDA 4X2OA 3MSOA 3NXJA 2Z76A 1OPYA 1OF5B 5KP1A 3E99A 3EN1B 3G8ZA 5IEOA 2XRXB 1OGXA 2YFJB 5CLKA 2CKFB 1ZX2A 4XDVA 5BVBA 2I9WA 1UUVB 1HKXA 1JKGA 3FGYA 3GZRA 3KE7A 4N3VA 3ECFA 5AIGA 5IERA 1AR0A 4RZMA 1QMAA 1JN5A 2QIYA 3JUQA 2BMOB 5EVHA 5AIFA 4I4KA 3EF8A 4WYKB 3B7CA 1GY7A 3EJVA 3EQQB 1TUHA 2INXA 4HKVB 1VZZA 1SJWA 4HM3B 3ER7A 4H3UA 1E97A
chains in the Genus database with same CATH superfamily
2BHMA 1YVSA 3FKAA 2KF5A 3I0YA 3DUKA 1LRAA 3MG2A 4XM4A 1X1UA 3LT9A 1QVF2 2QA43 1I2GA 3EN8A 4BTWA 3NM7A 3FCSB 3OWYA 1ULJB 1FGTA 1OHOA 3SOYA 3ZFZA 1BVIA 1TFKA 5D83A 5A0OB 1Q40B 1RSNA 2KXGA 4LGQA 2D1WA 1STDA 5BXQA 1RLSA 3OV4A 3CCL3 2MC8A 2KF6A 2KAAA 1O7HB 1DETA 3HX8A 4JRFA 1W2B2 2QEX3 3SOAA 1OCVA 3LTCA 5M18A 2Z6BA 3IJEB 2CFDA 3I553 1YHQ3 3MPHA 3DGLA 2OTJ3 2BMRB 3UB1A 2GU1A 2CG0A 2ML6A 1W2ZA 2Z77A 2H0GA 4FR9A 2QGUA 2GSPA 3CU3A 4WHAA 1STFI 2AADA 2XR8B 6STDA 1DVCA 1UCIA 4U13A 3DH2A 1FW7A 3AGNA 2BNGA 9RNTA 2F5WA 1RGGA 3GWRA 1GOYA 2W0QA 3B4PA 3KSED 1B2SA 3RGAA 2V1LA 2XFSA 3WODG 3ZG0A 3PS8A 2L4VA 1W7CA 2STDA 3MYTA 2YFLB 3SYUA 3BB9A 1BNRA 4N6MA 3VSYA 1WTHA 1NNVA 3F7SA 2SBLA 5BIRA 3CCR3 4HOHA 2CHCA 2KF3A 1C7HA 3IMAB 3B4OA 2E2UA 2F98A 4LSOA 1M1XB 2RGQA 1Q7Y4 1BNSA 3CC23 1RHLA 2IMJA 4K1VA 3X42A 3X40A 1FUTA 4HZBB 1TJDA 1BNFA 1IVVA 1JB4A 1TFOA 3L0RA 1IV7A 1LOXA 4EV5A 1NB5I 2P38A 2SARA 1BSEA 1T2HA 3CCE3 2H0HA 3PCRA 2F99A 2YFIB 1YJ93 3AMOB 5AIHA 1VQK3 4HM5B 3EBTA 3O8YA 1X1WA 1LOVA 2HMOB 3NBRA 3NBBA 4XDWA 5AIIA 3S27A 2PNCA 4BU4A 1BRNL 2W9QA 2GEXA 3VGNA 5BU4A 3Q90A 2XGLA 3D3LA 3WMDA 1VQ43 1CEWI 1UCLA 2P05A 3K7CA 1OGZA 3G4S3 1FA3A 4WWUC 5AEWB 5IG5A 2GEYA 2ZDJA 5JPUA 1JKGB 2BU4A 2F4YA 3G16A 4RNYA 4XBXA 4EBGA 3JUOA 3URPA 5RNTA 1RGKA 4R4KA 1E3VA 5DREA 2WOFA 1BIRA 3F9SA 5LC7A 1B2XA 1JV2B 1RJOA 2GBWB 1JZDA 1SIHA 2IY2A 3RNTA 1RGLA 3EBYA 4HM1B 3GZYB 5I97A 4KFEA 5AI1A 1BOXA 1EA2A 3KCHA 5AYSC 1AVKA 2B1XB 4IPBA 3STDA 4L8OA 1JN5B 3FF0A 3AHWA 1IDPA 3KFQC 4HM6B 1ULIB 2KCDA 1TRPA 3D5GA 4HM0B 1GS3A 3F8HA 4O8SA 3CME3 3VF1A 4BIRA 3CCQ3 1ZS7A 3G713 4MJDA 1GMRA 3NQZA 1HU9A 1I2EA 1GYBA 2XH9A 3G0KA 1RDSA 1NB3I 4Q53A 3BNCA 4ILFA 1ISKA 5IG3A 3NV0A 3OX9A 4X2HA 4CJNA 1KSIA 1US1A 4LMIA 5JPPA 3OWSA 1UCKA 1I2FA 2MF7A 3DGOA 1RMSA 1BNGA 4LEHA 1JBRA 2CW9A 1D6ZA 2RFRA 1BAOA 3K63A 1BNEA 1LQMB 1O7MB 4BTYA 2CFGA 3HK4A 1Y4KA 3CPW2 1YVBI 1YIT3 3I563 1KD14 1A2KA 1BRJA 4RNTA 1Q7HA 1JB5A 1GMQA 3B8LA 4FCZA 3GAXA 1Q814 1OACA 3HOHA 3MG3A 2W56A 1B2ZA 5G1LA 2E2TA 4K61A 5STDA 1AQZA 1RNTA 1GY5A 1ZO2A 2OWPA 4NPBA 4I5QA 4STDA 4EV2A 1OH0A 1OHSA 2W2CA 1CYUA 1RGHA 2B24B 5DRVA 3WHOA 1PFPA 3N8BA 4FMBA 3LTAA 3FSDA 1AVLA 3LTBA 5KP4A 1B27A 1KQS2 1BUQA 1EEJA 1TP6A 1VQO3 4O3VA 1BRSA 2C11A 1RRLA 7RNTA 1FUWA 1BSBA 4KFFA 4KFDA 3X41A 3WA2X 2KF4A 1JBSA 1SQWA 1JJ22 1N8QA 1DMQA 3CCU3 1GD4A 3PXMA 2LQVA 2FGTA 2UUGC 3CCM3 1B3SA 2YX9A 1Z1SA 3CCV3 1YGEA 5ELUA 1AY7A 2HOHA 1LXEA 2XGNA 1Q824 1E3RA 4OVMA 2JDIH 3SVAA 1B2MA 3DMCA 1L5GB 3LZAA 5FGOA 1BRKA 3DGNA 3JVCA 1EG9B 3S5CA 2HMMB 1NU3A 2E2VA 4HM7B 2UGIA 4R9KA 3BNBA 2HMKB 1ASKA 1JB2A 3FZWA 1U5OA 3DXOA 2W6JH 3ROBA 3AHSA 1WMPA 3F14A 1DYUA 1S5AA 2FXTA 2P0XA 3N9HA 1DVDA 3FF2A 2W04A 1YJW3 2LYXA 1BGSA 1W5ZA 5EEOA 3BU4A 3ALAA 1YGWA 3EHCA 3PGBA 4K90B 4OK0A 4EC6A 2CIUA 4H61A 1D6YA 3T0UA 4XBYA 3HZPA 3KN4A 1W02A 3RGRA 3F8XA 2CK3H 1VQL3 1ZGXA 1B20A 5G2GA 4J9AA 1K41A 1D6UA 1O7NB 1PYLA 3SX1A 1Q42A 3Q1CA 5TGNA 1O7GB 1I3IA 1DMNA 2R4IA 1V57A 1SPUA 2XSOB 5IF6A 7GSPA 2O3OA 3OXAA 3DGYA 4RNZA 1UDII 4GB5A 2CFWA 1VQ83 3ZG5A 1BRGA 1X1XA 3K5TA 3WA3A 4BL2A 4FMDA 1CH0A 1R4YA 3UL5A 1BRIA 2M7OA 3FLJA 4K1UA 3BLZA 1UW1A 1NDOB 4R9LA 1PU4A 1VQP3 1GOUA 4CDLA 1OUNA 5IEPA 1WNHA 1MNLA 1N5HA 3K0ZA 3JUNA 1IV9A 4FCJA 1QAKA 5D81A 2GU3A 2F86B 4J5GA 4EXRA 1LNIA 2Z7AA 3UJMA 5D82A 2ML5A 3F7XA 3HIGA 2CWVA 7STDA 2UX0A 1ROAA 3TDGA 3MKIA 1IVXA 5CK6A 2OOVA 2C4BA 4WP5A 2JQ5A 1Q9EA 1W01A 1UI7A 3MWZA 2HMJB 4J5KA 3F40A 4AEQA 3KKGA 1UUGB 3D79A 4HM2B 2OOVC 1RGCA 1MWTA 3Q2PA 4KVHA 3QRDA 1RCKA 5EQLA 1OF5A 5IG0A 4AKZA 1OHPA 3HIIA 1J2BA 3NV0B 1N5PA 3HI7A 1RTUA 5AEUB 1LOYA 1A90A 1RN1A 1RRHA 1MWUA 2IUKA 5CF2A 1G0TA 1EUIC 1TTOA 4XB5A 3T8UA 3LT8A 3EB8A 3WR2A 4ZM8A 1C54A 3NUVA 3LMLA 1WQLB 4HVNA 3SXXA 3QK9A 2K3DA 5HGRA 2CG1A 2IUJA 3M8CA 1T2IA 3GRDA 1G02A 2W56B 4N6UA 4O02B 3FG4A 1A2PA 4EW5A 1TIJA 3LH4A 4EYCA 1VQQA 4N6NB 3CCJ3 1JRQA 1NJI4 5G1KA 2FNQA 3A76A 1MGWA 1QAFA 1WMOA 3V92A 3NM2A 3EX9A 4HM8B 1BSAA 3CNXA 1QALA 2W9PA 3JUPA 3LXUX 3T8NA 1LVNA 3DY5A 4ORLA 4HM4B 1QJGA 3CCS3 3DGMA 3KSPA 4PEJA 2Y74A 1I70A 4HZ9B 5JBSA 1DMMA 2WOHA 1BNJA 1A67A 3OWUA 4IIAA 1VQ73 3GSPA 6GSPA 1M904 4HBRA 3V99A 1LOWA 3MG1A 4WYKA 3UL6A 1VQN3 1G96A 2P09A 1CYVA 1VQM3 1DE3A 4R80A 8CHOA 1N9JA 3DM8A 3IPTA 3MHEA 4GHOA 2K0MA 2BO9B 2RBIA 4FCMA 1K734 2J8XB 2CFLA 1F8NA 1I0VA 2PZVA 2W03A 2WO0A 3EC9A 5AYRB 2O9UX 1GY6A 5HOHA 1JZOA 2XFTA 4L7KA 1K8A4 4IT7A 4XBTA 1GD3A 4FMCA 3D9RA 2HMNB 1UUWB 4CCVA 1I0XA 3CC73 1MWRA 4L8PA 5FW5A 3H51A 4N6OB 1W6YA 4HJLB 4MMXB 1IVWA 1NWWA 1RKYA 3KZTA 3BIRA 4CPKA 1TRQA 1FYSA 1V74A 1V58A 1BNIA 2BIRA 1R4CA 1U8CB 2A15A 2AAEA 4R1KA 1IT8A 5KP3A 4BL3A 5CF1A 4RBNA 1EKMA 2F5MA 2ZHXB 3X3XA 3OW22 1O7PB 1VQ63 4J8TA 2BMQB 3FG1A 1VQ53 3CNMA 1Q40A 3GZBA 5GSPA 3S67A 6RNTA 3SEDA 3NHXA 4OUQA 3RDEA 1GMPA 4N6V0 1M9GA 1IQYA 1ROVA 3GZXB 1RN4A 1WMNA 1KC84 2CWUA 3LYGA 1YNVX 4QWTA 5IG4A 2GXFA 3PCSA 1PY3A 2CX0A 5ELJA 1FUSA 2WGOA 4LZIA 3PYJA 4KT3B 1W00A 5IENA 1S723 1M1K4 2CWTA 1K9M4 2OTL3 3K9MC 1W4NA 2P0MA 3UNLA 4O2HA 1FGMA 3X3ZA 3JUMA 1EQKA 1RCLA 5CXOA 1IQ8A 3NX0A 2XSHB 4G1MB 1MGRA 2XEPA 3FH1A 3CPOA 1IVUA 3CMA3 4LYLB 4GL6A 4AKYA 2BT3A 1CQSA 2D42A 3H3HA 2H0IA 1IYYA 2K54A 4MEIA 1KWIA 1UGIA 1O7WB 2GBXB 2HMLB 3J7Yd 2ZL8A 3DZLA 1UI8A 1T5YA 1MOLA 4KZ1A 2RNTA 3D4AA 3CXC2 5LC6A 1RGAA 2RCDA 3FG3A 2C10A 4X2OA 3MSOA 1YI23 3CC43 3NXJA 2R41A 1TU5A 1BUJA 1B2UA 1BSDA 4HYZA 2Z76A 1OPYA 1OF5B 2Q07A 3AGOA 3NQYA 3AMOA 3E99A 1BU4A 5KP1A 5IW9A 4BTXA 5M19A 3EN1B 3WDGB 3G8ZA 3LOYA 3NBJA 4TX4A 5IEOA 1W6GA 1GSPA 3U97A 3WOEB 2XRXB 2CC3A 2XF3A 1RNBA 1OGXA 2YFJB 4NREA 5CLKA 1IQXA 1SARA 1HYFA 2CKFB 1IU7A 1ZX2A 3V98A 4XDVA 3U1WA 4HAAA 5BVBA 2I9WA 1UUVB 1HKXA 1JKGA 1BSCA 1QVG2 2CH9A 1LNHA 1JNQA 2ZA4A 3FGYA 8RNTA 3KIIA 3GZRA 4NHFA 1RGEA 3KE7A 4N3VA 1X1YA 3G6E3 4MMYB 5M1AA 3ECFA 1VQ93 5AIGA 1RN7A 5IERA 1T3BA 1AR0A 1UGHI 2F56A 2IA7A 1FGRA 1K28A 1QMAA 4RZMA 1BANA 1UCJA 2IYJA 2CX1A 3SLUA 1JN5A 2KRTA 4N6TA 1HZ1A 2QIYA 3JUQA 1YIJ3 4FMAA 1LQGC 2BMOB 1FGOA 3PZWA 4N6LA 3Q3FA 1AV4A 1W6CA 2L1SA 2CFKA 5EVHA 5AIFA 3S29A 4I4KA 1A2VA 3EF8A 4WYKB 1Q864 3B7CA 2RSXA 1JBTA 1GOVA 1GY7A 4MMZB 3A5EA 3EJVA 4WFOA 2OQEA 3EQQB 3X3YA 4GSPA 1SIIA 3BNEA 3WOFB 1TUHA 1YJN3 4DKIA 1RGFA 1FZUA 1MWSA 3D5IA 3CD63 3S28A 3LTDA 2INXA 2OQEC 1NO3A 1IK3A 3BNDA 3EE1A 4HKVB 1N9EA 1VZZA 2Y73A 1I3FA 2OCTA 2WGQA 1IT7A 1B21A 1SJWA 3N54B 4HM3B 1N8R4 3ER7A 1BRHA 1FGQA 1I8VA 4H3UA 4JF8A 1E97A
chains in the Genus database with same CATH topology
2BHMA 3FKAA 3I0YA 3MG2A 3DUKA 4XM4A 3LT9A 1QVF2 2QA43 3EN8A 4BTWA 3NM7A 3FCSB 3OWYA 1ULJB 1FGTA 1OHOA 3SOYA 1TFKA 5D83A 5A0OB 1Q40B 2KXGA 4LGQA 2D1WA 1STDA 5BXQA 3OV4A 3CCL3 2MC8A 1O7HB 3HX8A 4JRFA 1W2B2 2QEX3 3SOAA 1OCVA 3LTCA 2Z6BA 3IJEB 2CFDA 3I553 1YHQ3 3MPHA 3DGLA 2OTJ3 2BMRB 3UB1A 2GU1A 2CG0A 2ML6A 1W2ZA 2Z77A 4FR9A 2QGUA 4WHAA 3CU3A 1STFI 2XR8B 6STDA 1DVCA 4U13A 2BNGA 3GWRA 2W0QA 3B4PA 3RGAA 3KSED 3WODG 2V1LA 2XFSA 3PS8A 2L4VA 1W7CA 2STDA 3MYTA 2YFLB 3BB9A 4N6MA 3VSYA 1WTHA 3F7SA 3CCR3 2SBLA 2CHCA 1C7HA 3IMAB 3B4OA 2E2UA 2F98A 4LSOA 1M1XB 2RGQA 1Q7Y4 3CC23 2IMJA 4K1VA 3X42A 3X40A 4HZBB 1IVVA 1JB4A 1TFOA 3L0RA 1IV7A 1LOXA 4EV5A 1NB5I 2P38A 3CCE3 3PCRA 2F99A 2YFIB 1YJ93 3AMOB 5AIHA 1VQK3 4HM5B 3EBTA 3O8YA 2HMOB 3NBBA 3NBRA 5AIIA 4XDWA 3S27A 2PNCA 2W9QA 2GEXA 3VGNA 3Q90A 2XGLA 3D3LA 3WMDA 1VQ43 1CEWI 2P05A 3K7CA 1OGZA 3G4S3 1FA3A 4WWUC 5AEWB 5IG5A 2GEYA 2ZDJA 5JPUA 1JKGB 3G16A 4RNYA 4XBXA 4EBGA 3JUOA 4R4KA 1E3VA 5DREA 2WOFA 3F9SA 5LC7A 1JV2B 1RJOA 2GBWB 1SIHA 3EBYA 4HM1B 3GZYB 5I97A 4KFEA 5AI1A 1EA2A 5AYSC 1AVKA 2B1XB 4IPBA 3STDA 4L8OA 1JN5B 3FF0A 4HM6B 1IDPA 3KFQC 1ULIB 2KCDA 4HM0B 1GS3A 3F8HA 4O8SA 3CME3 3VF1A 3CCQ3 3G713 4MJDA 3NQZA 1HU9A 1GYBA 2XH9A 3G0KA 1NB3I 4Q53A 3BNCA 1ISKA 5IG3A 3NV0A 3OX9A 4X2HA 1KSIA 1US1A 4LMIA 5JPPA 3OWSA 2MF7A 3DGOA 4LEHA 2CW9A 1D6ZA 2RFRA 3K63A 4BTYA 3CPW2 1O7MB 2CFGA 3HK4A 1Y4KA 1YVBI 1YIT3 3I563 1KD14 1A2KA 1JB5A 4FCZA 3B8LA 1Q814 3GAXA 1OACA 3MG3A 2W56A 2E2TA 4K61A 5STDA 1GY5A 1ZO2A 2OWPA 4STDA 4EV2A 1OH0A 1OHSA 2W2CA 1CYUA 2B24B 5DRVA 1PFPA 3N8BA 4FMBA 3LTAA 3FSDA 1AVLA 3LTBA 5KP4A 1KQS2 1BUQA 1TP6A 1VQO3 4O3VA 2C11A 1RRLA 1FUWA 4KFFA 4KFDA 3X41A 3WA2X 1SQWA 1JJ22 1N8QA 1DMQA 3CCU3 1GD4A 3PXMA 2LQVA 2FGTA 3CCM3 2YX9A 1Z1SA 3CCV3 1YGEA 5ELUA 1LXEA 2XGNA 1Q824 1E3RA 4OVMA 2JDIH 3SVAA 3DMCA 1L5GB 3LZAA 5FGOA 3JVCA 3DGNA 3S5CA 1EG9B 2HMMB 1NU3A 2E2VA 4HM7B 4R9KA 3BNBA 2HMKB 1ASKA 1JB2A 3FZWA 1U5OA 3DXOA 2W6JH 3ROBA 3F14A 1WMPA 1DYUA 1S5AA 2FXTA 2P0XA 3N9HA 1DVDA 3FF2A 2W04A 1YJW3 2LYXA 1W5ZA 5EEOA 3ALAA 3PGBA 3EHCA 4K90B 4OK0A 4EC6A 2CIUA 4H61A 1D6YA 3T0UA 4XBYA 3HZPA 3KN4A 1W02A 3RGRA 3F8XA 2CK3H 1VQL3 5G2GA 4J9AA 1K41A 1D6UA 1O7NB 3SX1A 1Q42A 3Q1CA 5TGNA 1O7GB 1DMNA 2R4IA 1SPUA 2XSOB 5IF6A 2O3OA 3OXAA 4RNZA 4GB5A 2CFWA 1VQ83 3K5TA 3WA3A 4FMDA 3UL5A 2M7OA 3FLJA 4K1UA 3BLZA 1UW1A 1NDOB 4R9LA 1PU4A 4CDLA 1OUNA 5IEPA 1WNHA 1MNLA 1N5HA 3K0ZA 3JUNA 1IV9A 4FCJA 1QAKA 5D81A 2GU3A 2F86B 4EXRA 2Z7AA 3UJMA 5D82A 2ML5A 3F7XA 3HIGA 2CWVA 7STDA 2UX0A 1ROAA 3TDGA 3MKIA 1IVXA 5CK6A 2OOVA 4WP5A 2JQ5A 1W01A 1UI7A 3MWZA 2HMJB 4AEQA 3F40A 3KKGA 4HM2B 2OOVC 5IG0A 3Q2PA 4KVHA 5EQLA 3QRDA 1J2BA 1OF5A 4AKZA 1OHPA 3HIIA 3NV0B 1N5PA 3HI7A 5AEUB 1A90A 1RRHA 2IUKA 5CF2A 4XB5A 3T8UA 3LT8A 3EB8A 4ZM8A 3NUVA 3LMLA 1WQLB 4HVNA 3SXXA 3QK9A 5HGRA 2CG1A 2IUJA 3M8CA 3GRDA 2W56B 4N6UA 4O02B 3FG4A 1TIJA 3LH4A 4EYCA 4N6NB 3CCJ3 1JRQA 1NJI4 2FNQA 3A76A 1QAFA 1WMOA 3V92A 3NM2A 3EX9A 4HM8B 3CNXA 3LXUX 1QALA 2W9PA 3JUPA 3T8NA 1LVNA 3DY5A 4ORLA 4HM4B 1QJGA 3CCS3 3DGMA 3KSPA 4PEJA 2Y74A 4HZ9B 5JBSA 1DMMA 2WOHA 1A67A 3OWUA 4IIAA 1VQ73 1M904 4HBRA 3V99A 3UL6A 3MG1A 4WYKA 1VQN3 1G96A 2P09A 1CYVA 1VQM3 4R80A 8CHOA 1N9JA 3DM8A 3IPTA 3MHEA 2K0MA 2BO9B 4FCMA 1K734 2CFLA 1F8NA 2PZVA 2W03A 2WO0A 3EC9A 5AYRB 2O9UX 1GY6A 1K8A4 2XFTA 4L7KA 4IT7A 4XBTA 1GD3A 4FMCA 3D9RA 2HMNB 1UUWB 4CCVA 3CC73 4L8PA 5FW5A 3H51A 4N6OB 1W6YA 4HJLB 4MMXB 1IVWA 1NWWA 1RKYA 3KZTA 1V74A 1R4CA 1U8CB 2A15A 4R1KA 5KP3A 1IT8A 5CF1A 4RBNA 1EKMA 3X3XA 3OW22 1O7PB 1VQ63 4J8TA 2BMQB 3FG1A 1VQ53 3CNMA 1Q40A 3GZBA 3S67A 3SEDA 3NHXA 4OUQA 3RDEA 4N6V0 1M9GA 1IQYA 1ROVA 3GZXB 1WMNA 1KC84 2CWUA 3LYGA 4QWTA 5IG4A 2GXFA 3PCSA 5ELJA 2WGOA 4LZIA 3PYJA 1S723 1W00A 5IENA 1M1K4 2CWTA 1K9M4 2OTL3 3K9MC 1W4NA 2P0MA 3UNLA 4O2HA 1FGMA 3X3ZA 3JUMA 1EQKA 5CXOA 1IQ8A 3NX0A 2XSHB 4G1MB 2XEPA 3FH1A 3CPOA 1IVUA 3CMA3 4GL6A 4AKYA 2BT3A 1CQSA 2D42A 3H3HA 2K54A 4MEIA 1KWIA 1O7WB 2GBXB 2HMLB 3J7Yd 2ZL8A 3DZLA 1UI8A 1T5YA 1MOLA 4KZ1A 3CXC2 5LC6A 2RCDA 3FG3A 2C10A 4X2OA 3MSOA 1YI23 3CC43 3NXJA 1TU5A 4HYZA 2Z76A 1OPYA 1OF5B 2Q07A 3NQYA 5KP1A 3AMOA 3E99A 1VQP3 5IW9A 4BTXA 3EN1B 3WDGB 3G8ZA 3LOYA 3NBJA 4TX4A 5IEOA 1W6GA 3U97A 3WOEB 2XRXB 2CC3A 2XF3A 1OGXA 2YFJB 4NREA 5CLKA 1IQXA 2CKFB 1IU7A 1ZX2A 3V98A 4XDVA 3U1WA 5BVBA 2I9WA 1UUVB 1HKXA 1JKGA 1QVG2 2CH9A 1LNHA 1JNQA 3FGYA 3KIIA 3GZRA 4NHFA 3KE7A 4N3VA 3G6E3 4MMYB 3ECFA 1VQ93 5AIGA 1RN7A 5IERA 2IA7A 1AR0A 1FGRA 1K28A 1QMAA 4RZMA 3SLUA 1JN5A 2KRTA 4N6TA 2QIYA 3JUQA 1YIJ3 4FMAA 2BMOB 1FGOA 3PZWA 4N6LA 1AV4A 1W6CA 2CFKA 5EVHA 5AIFA 3S29A 4I4KA 1A2VA 3EF8A 4WYKB 1Q864 3B7CA 2RSXA 1GY7A 4MMZB 3EJVA 2OQEA 4WFOA 3X3YA 3EQQB 1SIIA 3BNEA 3WOFB 1TUHA 1YJN3 3CD63 3S28A 3LTDA 2INXA 2OQEC 1NO3A 1IK3A 3BNDA 3EE1A 4HKVB 1N9EA 1VZZA 2Y73A 2OCTA 2WGQA 1IT7A 1SJWA 3N54B 4HM3B 1N8R4 3ER7A 1FGQA 4H3UA 4JF8A 1E97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKA A;  3I0Y A;  3MG2 A;  3DUK A;  4XM4 A;  3EN8 A;  3OWY A;  3SOY A;  1ULJ B;  1OHO A;  5D83 A;  1Q40 B;  4LGQ A;  1STD A;  5BXQ A;  3OV4 A;  1O7H B;  3HX8 A;  3SOA A;  1OCV A;  2BMR B;  2Z77 A;  2QGU A;  3CU3 A;  2XR8 B;  6STD A;  4U13 A;  2BNG A;  3GWR A;  3RGA A;  3B4P A;  3MYT A;  2STD A;  2YFL B;  3BB9 A;  3VSY A;  3F7S A;  2CHC A;  1C7H A;  3B4O A;  2F98 A;  2RGQ A;  2IMJ A;  4K1V A;  4HZB B;  1JB4 A;  2F99 A;  2YFI B;  5AIH A;  4HM5 B;  3EBT A;  2HMO B;  3NBR A;  5AII A;  4XDW A;  2GEX A;  3VGN A;  3Q90 A;  3WMD A;  3K7C A;  1OGZ A;  4WWU C;  5AEW B;  5IG5 A;  2GEY A;  5JPU A;  1JKG B;  3G16 A;  4XBX A;  3JUO A;  1E3V A;  5DRE A;  3F9S A;  2GBW B;  3EBY A;  4HM1 B;  3GZY B;  5AI1 A;  1EA2 A;  2B1X B;  3STD A;  4L8O A;  1JN5 B;  3FF0 A;  4HM6 B;  1IDP A;  1ULI B;  4HM0 B;  1GS3 A;  3F8H A;  4MJD A;  1GYB A;  3G0K A;  4Q53 A;  1ISK A;  5IG3 A;  3NV0 A;  3OX9 A;  4X2H A;  5JPP A;  4LMI A;  3OWS A;  4LEH A;  2RFR A;  1O7M B;  3HK4 A;  1A2K A;  1JB5 A;  3B8L A;  3MG3 A;  5STD A;  1GY5 A;  1ZO2 A;  2OWP A;  4STD A;  1OH0 A;  1OHS A;  2W2C A;  2B24 B;  5DRV A;  3FSD A;  5KP4 A;  1BUQ A;  1TP6 A;  1DMQ A;  1Z1S A;  1E3R A;  4OVM A;  3DMC A;  3LZA A;  3S5C A;  1EG9 B;  2HMM B;  1NU3 A;  4R9K A;  4HM7 B;  2HMK B;  1ASK A;  1JB2 A;  3FZW A;  1U5O A;  3ROB A;  3DXO A;  3F14 A;  1S5A A;  3FF2 A;  3EHC A;  4XBY A;  3HZP A;  1W02 A;  3RGR A;  3F8X A;  5G2G A;  4J9A A;  1K41 A;  1O7N B;  1Q42 A;  5TGN A;  1O7G B;  1DMN A;  2R4I A;  2XSO B;  5IF6 A;  3OXA A;  4GB5 A;  3FLJ A;  4K1U A;  3BLZ A;  1NDO B;  4R9L A;  4CDL A;  1OUN A;  5IEP A;  3K0Z A;  3JUN A;  4FCJ A;  5D81 A;  2F86 B;  2Z7A A;  3UJM A;  5D82 A;  3F7X A;  7STD A;  2UX0 A;  3MKI A;  5CK6 A;  4WP5 A;  2JQ5 A;  1W01 A;  2HMJ B;  3F40 A;  3KKG A;  4HM2 B;  5IG0 A;  4KVH A;  1OF5 A;  1OHP A;  3NV0 B;  5AEU B;  5CF2 A;  4XB5 A;  3T8U A;  3NUV A;  1WQL B;  4HVN A;  5HGR A;  3M8C A;  3GRD A;  3A76 A;  3NM2 A;  3EX9 A;  4HM8 B;  3CNX A;  3JUP A;  3T8N A;  4ORL A;  4HM4 B;  1QJG A;  3KSP A;  4PEJ A;  4HZ9 B;  1DMM A;  3OWU A;  4IIA A;  3MG1 A;  4WYK A;  8CHO A;  3DM8 A;  3IPT A;  3MHE A;  4FCM A;  2PZV A;  3EC9 A;  1GY6 A;  4L7K A;  4XBT A;  3D9R A;  2HMN B;  1UUW B;  5FW5 A;  4L8P A;  3H51 A;  1W6Y A;  4HJL B;  1NWW A;  3KZT A;  5CF1 A;  2A15 A;  4R1K A;  5KP3 A;  1O7P B;  4J8T A;  2BMQ B;  3CNM A;  1Q40 A;  3GZB A;  3SED A;  3NHX A;  4OUQ A;  3GZX B;  3LYG A;  5IG4 A;  2GXF A;  1W00 A;  5IEN A;  3UNL A;  3JUM A;  5CXO A;  2XSH B;  3FH1 A;  3CPO A;  1CQS A;  3H3H A;  2K54 A;  1O7W B;  2GBX B;  2HML B;  3DZL A;  2RCD A;  4X2O A;  3MSO A;  3NXJ A;  2Z76 A;  1OPY A;  1OF5 B;  5KP1 A;  3E99 A;  3EN1 B;  3G8Z A;  5IEO A;  2XRX B;  1OGX A;  2YFJ B;  5CLK A;  2CKF B;  1ZX2 A;  4XDV A;  5BVB A;  2I9W A;  1UUV B;  1HKX A;  1JKG A;  3FGY A;  3GZR A;  3KE7 A;  4N3V A;  3ECF A;  5AIG A;  5IER A;  1AR0 A;  4RZM A;  1QMA A;  1JN5 A;  2QIY A;  3JUQ A;  2BMO B;  5EVH A;  5AIF A;  4I4K A;  3EF8 A;  4WYK B;  3B7C A;  1GY7 A;  3EJV A;  3EQQ B;  1TUH A;  2INX A;  4HKV B;  1VZZ A;  1SJW A;  4HM3 B;  3ER7 A;  4H3U A;  1E97 A; 
#chains in the Genus database with same CATH topology
 2BHM A;  1YVS A;  3FKA A;  2KF5 A;  3I0Y A;  3DUK A;  1LRA A;  3MG2 A;  4XM4 A;  1X1U A;  3LT9 A;  1QVF 2;  2QA4 3;  1I2G A;  3EN8 A;  4BTW A;  3NM7 A;  3FCS B;  3OWY A;  1ULJ B;  1FGT A;  1OHO A;  3SOY A;  3ZFZ A;  1BVI A;  1TFK A;  5D83 A;  5A0O B;  1Q40 B;  1RSN A;  2KXG A;  4LGQ A;  2D1W A;  1STD A;  5BXQ A;  1RLS A;  3OV4 A;  3CCL 3;  2MC8 A;  2KF6 A;  2KAA A;  1O7H B;  1DET A;  3HX8 A;  4JRF A;  1W2B 2;  2QEX 3;  3SOA A;  1OCV A;  3LTC A;  5M18 A;  2Z6B A;  3IJE B;  2CFD A;  3I55 3;  1YHQ 3;  3MPH A;  3DGL A;  2OTJ 3;  2BMR B;  3UB1 A;  2GU1 A;  2CG0 A;  2ML6 A;  1W2Z A;  2Z77 A;  2H0G A;  4FR9 A;  2QGU A;  2GSP A;  3CU3 A;  4WHA A;  1STF I;  2AAD A;  2XR8 B;  6STD A;  1DVC A;  1UCI A;  4U13 A;  3DH2 A;  1FW7 A;  3AGN A;  2BNG A;  9RNT A;  2F5W A;  1RGG A;  3GWR A;  1GOY A;  2W0Q A;  3B4P A;  3KSE D;  1B2S A;  3RGA A;  2V1L A;  2XFS A;  3WOD G;  3ZG0 A;  3PS8 A;  2L4V A;  1W7C A;  2STD A;  3MYT A;  2YFL B;  3SYU A;  3BB9 A;  1BNR A;  4N6M A;  3VSY A;  1WTH A;  1NNV A;  3F7S A;  2SBL A;  5BIR A;  3CCR 3;  4HOH A;  2CHC A;  2KF3 A;  1C7H A;  3IMA B;  3B4O A;  2E2U A;  2F98 A;  4LSO A;  1M1X B;  2RGQ A;  1Q7Y 4;  1BNS A;  3CC2 3;  1RHL A;  2IMJ A;  4K1V A;  3X42 A;  3X40 A;  1FUT A;  4HZB B;  1TJD A;  1BNF A;  1IVV A;  1JB4 A;  1TFO A;  3L0R A;  1IV7 A;  1LOX A;  4EV5 A;  1NB5 I;  2P38 A;  2SAR A;  1BSE A;  1T2H A;  3CCE 3;  2H0H A;  3PCR A;  2F99 A;  2YFI B;  1YJ9 3;  3AMO B;  5AIH A;  1VQK 3;  4HM5 B;  3EBT A;  3O8Y A;  1X1W A;  1LOV A;  2HMO B;  3NBR A;  3NBB A;  4XDW A;  5AII A;  3S27 A;  2PNC A;  4BU4 A;  1BRN L;  2W9Q A;  2GEX A;  3VGN A;  5BU4 A;  3Q90 A;  2XGL A;  3D3L A;  3WMD A;  1VQ4 3;  1CEW I;  1UCL A;  2P05 A;  3K7C A;  1OGZ A;  3G4S 3;  1FA3 A;  4WWU C;  5AEW B;  5IG5 A;  2GEY A;  2ZDJ A;  5JPU A;  1JKG B;  2BU4 A;  2F4Y A;  3G16 A;  4RNY A;  4XBX A;  4EBG A;  3JUO A;  3URP A;  5RNT A;  1RGK A;  4R4K A;  1E3V A;  5DRE A;  2WOF A;  1BIR A;  3F9S A;  5LC7 A;  1B2X A;  1JV2 B;  1RJO A;  2GBW B;  1JZD A;  1SIH A;  2IY2 A;  3RNT A;  1RGL A;  3EBY A;  4HM1 B;  3GZY B;  5I97 A;  4KFE A;  5AI1 A;  1BOX A;  1EA2 A;  3KCH A;  5AYS C;  1AVK A;  2B1X B;  4IPB A;  3STD A;  4L8O A;  1JN5 B;  3FF0 A;  3AHW A;  1IDP A;  3KFQ C;  4HM6 B;  1ULI B;  2KCD A;  1TRP A;  3D5G A;  4HM0 B;  1GS3 A;  3F8H A;  4O8S A;  3CME 3;  3VF1 A;  4BIR A;  3CCQ 3;  1ZS7 A;  3G71 3;  4MJD A;  1GMR A;  3NQZ A;  1HU9 A;  1I2E A;  1GYB A;  2XH9 A;  3G0K A;  1RDS A;  1NB3 I;  4Q53 A;  3BNC A;  4ILF A;  1ISK A;  5IG3 A;  3NV0 A;  3OX9 A;  4X2H A;  4CJN A;  1KSI A;  1US1 A;  4LMI A;  5JPP A;  3OWS A;  1UCK A;  1I2F A;  2MF7 A;  3DGO A;  1RMS A;  1BNG A;  4LEH A;  1JBR A;  2CW9 A;  1D6Z A;  2RFR A;  1BAO A;  3K63 A;  1BNE A;  1LQM B;  1O7M B;  4BTY A;  2CFG A;  3HK4 A;  1Y4K A;  3CPW 2;  1YVB I;  1YIT 3;  3I56 3;  1KD1 4;  1A2K A;  1BRJ A;  4RNT A;  1Q7H A;  1JB5 A;  1GMQ A;  3B8L A;  4FCZ A;  3GAX A;  1Q81 4;  1OAC A;  3HOH A;  3MG3 A;  2W56 A;  1B2Z A;  5G1L A;  2E2T A;  4K61 A;  5STD A;  1AQZ A;  1RNT A;  1GY5 A;  1ZO2 A;  2OWP A;  4NPB A;  4I5Q A;  4STD A;  4EV2 A;  1OH0 A;  1OHS A;  2W2C A;  1CYU A;  1RGH A;  2B24 B;  5DRV A;  3WHO A;  1PFP A;  3N8B A;  4FMB A;  3LTA A;  3FSD A;  1AVL A;  3LTB A;  5KP4 A;  1B27 A;  1KQS 2;  1BUQ A;  1EEJ A;  1TP6 A;  1VQO 3;  4O3V A;  1BRS A;  2C11 A;  1RRL A;  7RNT A;  1FUW A;  1BSB A;  4KFF A;  4KFD A;  3X41 A;  3WA2 X;  2KF4 A;  1JBS A;  1SQW A;  1JJ2 2;  1N8Q A;  1DMQ A;  3CCU 3;  1GD4 A;  3PXM A;  2LQV A;  2FGT A;  2UUG C;  3CCM 3;  1B3S A;  2YX9 A;  1Z1S A;  3CCV 3;  1YGE A;  5ELU A;  1AY7 A;  2HOH A;  1LXE A;  2XGN A;  1Q82 4;  1E3R A;  4OVM A;  2JDI H;  3SVA A;  1B2M A;  3DMC A;  1L5G B;  3LZA A;  5FGO A;  1BRK A;  3DGN A;  3JVC A;  1EG9 B;  3S5C A;  2HMM B;  1NU3 A;  2E2V A;  4HM7 B;  2UGI A;  4R9K A;  3BNB A;  2HMK B;  1ASK A;  1JB2 A;  3FZW A;  1U5O A;  3DXO A;  2W6J H;  3ROB A;  3AHS A;  1WMP A;  3F14 A;  1DYU A;  1S5A A;  2FXT A;  2P0X A;  3N9H A;  1DVD A;  3FF2 A;  2W04 A;  1YJW 3;  2LYX A;  1BGS A;  1W5Z A;  5EEO A;  3BU4 A;  3ALA A;  1YGW A;  3EHC A;  3PGB A;  4K90 B;  4OK0 A;  4EC6 A;  2CIU A;  4H61 A;  1D6Y A;  3T0U A;  4XBY A;  3HZP A;  3KN4 A;  1W02 A;  3RGR A;  3F8X A;  2CK3 H;  1VQL 3;  1ZGX A;  1B20 A;  5G2G A;  4J9A A;  1K41 A;  1D6U A;  1O7N B;  1PYL A;  3SX1 A;  1Q42 A;  3Q1C A;  5TGN A;  1O7G B;  1I3I A;  1DMN A;  2R4I A;  1V57 A;  1SPU A;  2XSO B;  5IF6 A;  7GSP A;  2O3O A;  3OXA A;  3DGY A;  4RNZ A;  1UDI I;  4GB5 A;  2CFW A;  1VQ8 3;  3ZG5 A;  1BRG A;  1X1X A;  3K5T A;  3WA3 A;  4BL2 A;  4FMD A;  1CH0 A;  1R4Y A;  3UL5 A;  1BRI A;  2M7O A;  3FLJ A;  4K1U A;  3BLZ A;  1UW1 A;  1NDO B;  4R9L A;  1PU4 A;  1VQP 3;  1GOU A;  4CDL A;  1OUN A;  5IEP A;  1WNH A;  1MNL A;  1N5H A;  3K0Z A;  3JUN A;  1IV9 A;  4FCJ A;  1QAK A;  5D81 A;  2GU3 A;  2F86 B;  4J5G A;  4EXR A;  1LNI A;  2Z7A A;  3UJM A;  5D82 A;  2ML5 A;  3F7X A;  3HIG A;  2CWV A;  7STD A;  2UX0 A;  1ROA A;  3TDG A;  3MKI A;  1IVX A;  5CK6 A;  2OOV A;  2C4B A;  4WP5 A;  2JQ5 A;  1Q9E A;  1W01 A;  1UI7 A;  3MWZ A;  2HMJ B;  4J5K A;  3F40 A;  4AEQ A;  3KKG A;  1UUG B;  3D79 A;  4HM2 B;  2OOV C;  1RGC A;  1MWT A;  3Q2P A;  4KVH A;  3QRD A;  1RCK A;  5EQL A;  1OF5 A;  5IG0 A;  4AKZ A;  1OHP A;  3HII A;  1J2B A;  3NV0 B;  1N5P A;  3HI7 A;  1RTU A;  5AEU B;  1LOY A;  1A90 A;  1RN1 A;  1RRH A;  1MWU A;  2IUK A;  5CF2 A;  1G0T A;  1EUI C;  1TTO A;  4XB5 A;  3T8U A;  3LT8 A;  3EB8 A;  3WR2 A;  4ZM8 A;  1C54 A;  3NUV A;  3LML A;  1WQL B;  4HVN A;  3SXX A;  3QK9 A;  2K3D A;  5HGR A;  2CG1 A;  2IUJ A;  3M8C A;  1T2I A;  3GRD A;  1G02 A;  2W56 B;  4N6U A;  4O02 B;  3FG4 A;  1A2P A;  4EW5 A;  1TIJ A;  3LH4 A;  4EYC A;  1VQQ A;  4N6N B;  3CCJ 3;  1JRQ A;  1NJI 4;  5G1K A;  2FNQ A;  3A76 A;  1MGW A;  1QAF A;  1WMO A;  3V92 A;  3NM2 A;  3EX9 A;  4HM8 B;  1BSA A;  3CNX A;  1QAL A;  2W9P A;  3JUP A;  3LXU X;  3T8N A;  1LVN A;  3DY5 A;  4ORL A;  4HM4 B;  1QJG A;  3CCS 3;  3DGM A;  3KSP A;  4PEJ A;  2Y74 A;  1I70 A;  4HZ9 B;  5JBS A;  1DMM A;  2WOH A;  1BNJ A;  1A67 A;  3OWU A;  4IIA A;  1VQ7 3;  3GSP A;  6GSP A;  1M90 4;  4HBR A;  3V99 A;  1LOW A;  3MG1 A;  4WYK A;  3UL6 A;  1VQN 3;  1G96 A;  2P09 A;  1CYV A;  1VQM 3;  1DE3 A;  4R80 A;  8CHO A;  1N9J A;  3DM8 A;  3IPT A;  3MHE A;  4GHO A;  2K0M A;  2BO9 B;  2RBI A;  4FCM A;  1K73 4;  2J8X B;  2CFL A;  1F8N A;  1I0V A;  2PZV A;  2W03 A;  2WO0 A;  3EC9 A;  5AYR B;  2O9U X;  1GY6 A;  5HOH A;  1JZO A;  2XFT A;  4L7K A;  1K8A 4;  4IT7 A;  4XBT A;  1GD3 A;  4FMC A;  3D9R A;  2HMN B;  1UUW B;  4CCV A;  1I0X A;  3CC7 3;  1MWR A;  4L8P A;  5FW5 A;  3H51 A;  4N6O B;  1W6Y A;  4HJL B;  4MMX B;  1IVW A;  1NWW A;  1RKY A;  3KZT A;  3BIR A;  4CPK A;  1TRQ A;  1FYS A;  1V74 A;  1V58 A;  1BNI A;  2BIR A;  1R4C A;  1U8C B;  2A15 A;  2AAE A;  4R1K A;  1IT8 A;  5KP3 A;  4BL3 A;  5CF1 A;  4RBN A;  1EKM A;  2F5M A;  2ZHX B;  3X3X A;  3OW2 2;  1O7P B;  1VQ6 3;  4J8T A;  2BMQ B;  3FG1 A;  1VQ5 3;  3CNM A;  1Q40 A;  3GZB A;  5GSP A;  3S67 A;  6RNT A;  3SED A;  3NHX A;  4OUQ A;  3RDE A;  1GMP A;  4N6V 0;  1M9G A;  1IQY A;  1ROV A;  3GZX B;  1RN4 A;  1WMN A;  1KC8 4;  2CWU A;  3LYG A;  1YNV X;  4QWT A;  5IG4 A;  2GXF A;  3PCS A;  1PY3 A;  2CX0 A;  5ELJ A;  1FUS A;  2WGO A;  4LZI A;  3PYJ A;  4KT3 B;  1W00 A;  5IEN A;  1S72 3;  1M1K 4;  2CWT A;  1K9M 4;  2OTL 3;  3K9M C;  1W4N A;  2P0M A;  3UNL A;  4O2H A;  1FGM A;  3X3Z A;  3JUM A;  1EQK A;  1RCL A;  5CXO A;  1IQ8 A;  3NX0 A;  2XSH B;  4G1M B;  1MGR A;  2XEP A;  3FH1 A;  3CPO A;  1IVU A;  3CMA 3;  4LYL B;  4GL6 A;  4AKY A;  2BT3 A;  1CQS A;  2D42 A;  3H3H A;  2H0I A;  1IYY A;  2K54 A;  4MEI A;  1KWI A;  1UGI A;  1O7W B;  2GBX B;  2HML B;  3J7Y d;  2ZL8 A;  3DZL A;  1UI8 A;  1T5Y A;  1MOL A;  4KZ1 A;  2RNT A;  3D4A A;  3CXC 2;  5LC6 A;  1RGA A;  2RCD A;  3FG3 A;  2C10 A;  4X2O A;  3MSO A;  1YI2 3;  3CC4 3;  3NXJ A;  2R41 A;  1TU5 A;  1BUJ A;  1B2U A;  1BSD A;  4HYZ A;  2Z76 A;  1OPY A;  1OF5 B;  2Q07 A;  3AGO A;  3NQY A;  3AMO A;  3E99 A;  1BU4 A;  5KP1 A;  5IW9 A;  4BTX A;  5M19 A;  3EN1 B;  3WDG B;  3G8Z A;  3LOY A;  3NBJ A;  4TX4 A;  5IEO A;  1W6G A;  1GSP A;  3U97 A;  3WOE B;  2XRX B;  2CC3 A;  2XF3 A;  1RNB A;  1OGX A;  2YFJ B;  4NRE A;  5CLK A;  1IQX A;  1SAR A;  1HYF A;  2CKF B;  1IU7 A;  1ZX2 A;  3V98 A;  4XDV A;  3U1W A;  4HAA A;  5BVB A;  2I9W A;  1UUV B;  1HKX A;  1JKG A;  1BSC A;  1QVG 2;  2CH9 A;  1LNH A;  1JNQ A;  2ZA4 A;  3FGY A;  8RNT A;  3KII A;  3GZR A;  4NHF A;  1RGE A;  3KE7 A;  4N3V A;  1X1Y A;  3G6E 3;  4MMY B;  5M1A A;  3ECF A;  1VQ9 3;  5AIG A;  1RN7 A;  5IER A;  1T3B A;  1AR0 A;  1UGH I;  2F56 A;  2IA7 A;  1FGR A;  1K28 A;  1QMA A;  4RZM A;  1BAN A;  1UCJ A;  2IYJ A;  2CX1 A;  3SLU A;  1JN5 A;  2KRT A;  4N6T A;  1HZ1 A;  2QIY A;  3JUQ A;  1YIJ 3;  4FMA A;  1LQG C;  2BMO B;  1FGO A;  3PZW A;  4N6L A;  3Q3F A;  1AV4 A;  1W6C A;  2L1S A;  2CFK A;  5EVH A;  5AIF A;  3S29 A;  4I4K A;  1A2V A;  3EF8 A;  4WYK B;  1Q86 4;  3B7C A;  2RSX A;  1JBT A;  1GOV A;  1GY7 A;  4MMZ B;  3A5E A;  3EJV A;  4WFO A;  2OQE A;  3EQQ B;  3X3Y A;  4GSP A;  1SII A;  3BNE A;  3WOF B;  1TUH A;  1YJN 3;  4DKI A;  1RGF A;  1FZU A;  1MWS A;  3D5I A;  3CD6 3;  3S28 A;  3LTD A;  2INX A;  2OQE C;  1NO3 A;  1IK3 A;  3BND A;  3EE1 A;  4HKV B;  1N9E A;  1VZZ A;  2Y73 A;  1I3F A;  2OCT A;  2WGQ A;  1IT7 A;  1B21 A;  1SJW A;  3N54 B;  4HM3 B;  1N8R 4;  3ER7 A;  1BRH A;  1FGQ A;  1I8V A;  4H3U A;  4JF8 A;  1E97 A; 
#chains in the Genus database with same CATH homology
 2BHM A;  3FKA A;  3I0Y A;  3MG2 A;  3DUK A;  4XM4 A;  3LT9 A;  1QVF 2;  2QA4 3;  3EN8 A;  4BTW A;  3NM7 A;  3FCS B;  3OWY A;  1ULJ B;  1FGT A;  1OHO A;  3SOY A;  1TFK A;  5D83 A;  5A0O B;  1Q40 B;  2KXG A;  4LGQ A;  2D1W A;  1STD A;  5BXQ A;  3OV4 A;  3CCL 3;  2MC8 A;  1O7H B;  3HX8 A;  4JRF A;  1W2B 2;  2QEX 3;  3SOA A;  1OCV A;  3LTC A;  2Z6B A;  3IJE B;  2CFD A;  3I55 3;  1YHQ 3;  3MPH A;  3DGL A;  2OTJ 3;  2BMR B;  3UB1 A;  2GU1 A;  2CG0 A;  2ML6 A;  1W2Z A;  2Z77 A;  4FR9 A;  2QGU A;  4WHA A;  3CU3 A;  1STF I;  2XR8 B;  6STD A;  1DVC A;  4U13 A;  2BNG A;  3GWR A;  2W0Q A;  3B4P A;  3RGA A;  3KSE D;  3WOD G;  2V1L A;  2XFS A;  3PS8 A;  2L4V A;  1W7C A;  2STD A;  3MYT A;  2YFL B;  3BB9 A;  4N6M A;  3VSY A;  1WTH A;  3F7S A;  3CCR 3;  2SBL A;  2CHC A;  1C7H A;  3IMA B;  3B4O A;  2E2U A;  2F98 A;  4LSO A;  1M1X B;  2RGQ A;  1Q7Y 4;  3CC2 3;  2IMJ A;  4K1V A;  3X42 A;  3X40 A;  4HZB B;  1IVV A;  1JB4 A;  1TFO A;  3L0R A;  1IV7 A;  1LOX A;  4EV5 A;  1NB5 I;  2P38 A;  3CCE 3;  3PCR A;  2F99 A;  2YFI B;  1YJ9 3;  3AMO B;  5AIH A;  1VQK 3;  4HM5 B;  3EBT A;  3O8Y A;  2HMO B;  3NBB A;  3NBR A;  5AII A;  4XDW A;  3S27 A;  2PNC A;  2W9Q A;  2GEX A;  3VGN A;  3Q90 A;  2XGL A;  3D3L A;  3WMD A;  1VQ4 3;  1CEW I;  2P05 A;  3K7C A;  1OGZ A;  3G4S 3;  1FA3 A;  4WWU C;  5AEW B;  5IG5 A;  2GEY A;  2ZDJ A;  5JPU A;  1JKG B;  3G16 A;  4RNY A;  4XBX A;  4EBG A;  3JUO A;  4R4K A;  1E3V A;  5DRE A;  2WOF A;  3F9S A;  5LC7 A;  1JV2 B;  1RJO A;  2GBW B;  1SIH A;  3EBY A;  4HM1 B;  3GZY B;  5I97 A;  4KFE A;  5AI1 A;  1EA2 A;  5AYS C;  1AVK A;  2B1X B;  4IPB A;  3STD A;  4L8O A;  1JN5 B;  3FF0 A;  4HM6 B;  1IDP A;  3KFQ C;  1ULI B;  2KCD A;  4HM0 B;  1GS3 A;  3F8H A;  4O8S A;  3CME 3;  3VF1 A;  3CCQ 3;  3G71 3;  4MJD A;  3NQZ A;  1HU9 A;  1GYB A;  2XH9 A;  3G0K A;  1NB3 I;  4Q53 A;  3BNC A;  1ISK A;  5IG3 A;  3NV0 A;  3OX9 A;  4X2H A;  1KSI A;  1US1 A;  4LMI A;  5JPP A;  3OWS A;  2MF7 A;  3DGO A;  4LEH A;  2CW9 A;  1D6Z A;  2RFR A;  3K63 A;  4BTY A;  3CPW 2;  1O7M B;  2CFG A;  3HK4 A;  1Y4K A;  1YVB I;  1YIT 3;  3I56 3;  1KD1 4;  1A2K A;  1JB5 A;  4FCZ A;  3B8L A;  1Q81 4;  3GAX A;  1OAC A;  3MG3 A;  2W56 A;  2E2T A;  4K61 A;  5STD A;  1GY5 A;  1ZO2 A;  2OWP A;  4STD A;  4EV2 A;  1OH0 A;  1OHS A;  2W2C A;  1CYU A;  2B24 B;  5DRV A;  1PFP A;  3N8B A;  4FMB A;  3LTA A;  3FSD A;  1AVL A;  3LTB A;  5KP4 A;  1KQS 2;  1BUQ A;  1TP6 A;  1VQO 3;  4O3V A;  2C11 A;  1RRL A;  1FUW A;  4KFF A;  4KFD A;  3X41 A;  3WA2 X;  1SQW A;  1JJ2 2;  1N8Q A;  1DMQ A;  3CCU 3;  1GD4 A;  3PXM A;  2LQV A;  2FGT A;  3CCM 3;  2YX9 A;  1Z1S A;  3CCV 3;  1YGE A;  5ELU A;  1LXE A;  2XGN A;  1Q82 4;  1E3R A;  4OVM A;  2JDI H;  3SVA A;  3DMC A;  1L5G B;  3LZA A;  5FGO A;  3JVC A;  3DGN A;  3S5C A;  1EG9 B;  2HMM B;  1NU3 A;  2E2V A;  4HM7 B;  4R9K A;  3BNB A;  2HMK B;  1ASK A;  1JB2 A;  3FZW A;  1U5O A;  3DXO A;  2W6J H;  3ROB A;  3F14 A;  1WMP A;  1DYU A;  1S5A A;  2FXT A;  2P0X A;  3N9H A;  1DVD A;  3FF2 A;  2W04 A;  1YJW 3;  2LYX A;  1W5Z A;  5EEO A;  3ALA A;  3PGB A;  3EHC A;  4K90 B;  4OK0 A;  4EC6 A;  2CIU A;  4H61 A;  1D6Y A;  3T0U A;  4XBY A;  3HZP A;  3KN4 A;  1W02 A;  3RGR A;  3F8X A;  2CK3 H;  1VQL 3;  5G2G A;  4J9A A;  1K41 A;  1D6U A;  1O7N B;  3SX1 A;  1Q42 A;  3Q1C A;  5TGN A;  1O7G B;  1DMN A;  2R4I A;  1SPU A;  2XSO B;  5IF6 A;  2O3O A;  3OXA A;  4RNZ A;  4GB5 A;  2CFW A;  1VQ8 3;  3K5T A;  3WA3 A;  4FMD A;  3UL5 A;  2M7O A;  3FLJ A;  4K1U A;  3BLZ A;  1UW1 A;  1NDO B;  4R9L A;  1PU4 A;  4CDL A;  1OUN A;  5IEP A;  1WNH A;  1MNL A;  1N5H A;  3K0Z A;  3JUN A;  1IV9 A;  4FCJ A;  1QAK A;  5D81 A;  2GU3 A;  2F86 B;  4EXR A;  2Z7A A;  3UJM A;  5D82 A;  2ML5 A;  3F7X A;  3HIG A;  2CWV A;  7STD A;  2UX0 A;  1ROA A;  3TDG A;  3MKI A;  1IVX A;  5CK6 A;  2OOV A;  4WP5 A;  2JQ5 A;  1W01 A;  1UI7 A;  3MWZ A;  2HMJ B;  4AEQ A;  3F40 A;  3KKG A;  4HM2 B;  2OOV C;  5IG0 A;  3Q2P A;  4KVH A;  5EQL A;  3QRD A;  1J2B A;  1OF5 A;  4AKZ A;  1OHP A;  3HII A;  3NV0 B;  1N5P A;  3HI7 A;  5AEU B;  1A90 A;  1RRH A;  2IUK A;  5CF2 A;  4XB5 A;  3T8U A;  3LT8 A;  3EB8 A;  4ZM8 A;  3NUV A;  3LML A;  1WQL B;  4HVN A;  3SXX A;  3QK9 A;  5HGR A;  2CG1 A;  2IUJ A;  3M8C A;  3GRD A;  2W56 B;  4N6U A;  4O02 B;  3FG4 A;  1TIJ A;  3LH4 A;  4EYC A;  4N6N B;  3CCJ 3;  1JRQ A;  1NJI 4;  2FNQ A;  3A76 A;  1QAF A;  1WMO A;  3V92 A;  3NM2 A;  3EX9 A;  4HM8 B;  3CNX A;  3LXU X;  1QAL A;  2W9P A;  3JUP A;  3T8N A;  1LVN A;  3DY5 A;  4ORL A;  4HM4 B;  1QJG A;  3CCS 3;  3DGM A;  3KSP A;  4PEJ A;  2Y74 A;  4HZ9 B;  5JBS A;  1DMM A;  2WOH A;  1A67 A;  3OWU A;  4IIA A;  1VQ7 3;  1M90 4;  4HBR A;  3V99 A;  3UL6 A;  3MG1 A;  4WYK A;  1VQN 3;  1G96 A;  2P09 A;  1CYV A;  1VQM 3;  4R80 A;  8CHO A;  1N9J A;  3DM8 A;  3IPT A;  3MHE A;  2K0M A;  2BO9 B;  4FCM A;  1K73 4;  2CFL A;  1F8N A;  2PZV A;  2W03 A;  2WO0 A;  3EC9 A;  5AYR B;  2O9U X;  1GY6 A;  1K8A 4;  2XFT A;  4L7K A;  4IT7 A;  4XBT A;  1GD3 A;  4FMC A;  3D9R A;  2HMN B;  1UUW B;  4CCV A;  3CC7 3;  4L8P A;  5FW5 A;  3H51 A;  4N6O B;  1W6Y A;  4HJL B;  4MMX B;  1IVW A;  1NWW A;  1RKY A;  3KZT A;  1V74 A;  1R4C A;  1U8C B;  2A15 A;  4R1K A;  5KP3 A;  1IT8 A;  5CF1 A;  4RBN A;  1EKM A;  3X3X A;  3OW2 2;  1O7P B;  1VQ6 3;  4J8T A;  2BMQ B;  3FG1 A;  1VQ5 3;  3CNM A;  1Q40 A;  3GZB A;  3S67 A;  3SED A;  3NHX A;  4OUQ A;  3RDE A;  4N6V 0;  1M9G A;  1IQY A;  1ROV A;  3GZX B;  1WMN A;  1KC8 4;  2CWU A;  3LYG A;  4QWT A;  5IG4 A;  2GXF A;  3PCS A;  5ELJ A;  2WGO A;  4LZI A;  3PYJ A;  1S72 3;  1W00 A;  5IEN A;  1M1K 4;  2CWT A;  1K9M 4;  2OTL 3;  3K9M C;  1W4N A;  2P0M A;  3UNL A;  4O2H A;  1FGM A;  3X3Z A;  3JUM A;  1EQK A;  5CXO A;  1IQ8 A;  3NX0 A;  2XSH B;  4G1M B;  2XEP A;  3FH1 A;  3CPO A;  1IVU A;  3CMA 3;  4GL6 A;  4AKY A;  2BT3 A;  1CQS A;  2D42 A;  3H3H A;  2K54 A;  4MEI A;  1KWI A;  1O7W B;  2GBX B;  2HML B;  3J7Y d;  2ZL8 A;  3DZL A;  1UI8 A;  1T5Y A;  1MOL A;  4KZ1 A;  3CXC 2;  5LC6 A;  2RCD A;  3FG3 A;  2C10 A;  4X2O A;  3MSO A;  1YI2 3;  3CC4 3;  3NXJ A;  1TU5 A;  4HYZ A;  2Z76 A;  1OPY A;  1OF5 B;  2Q07 A;  3NQY A;  5KP1 A;  3AMO A;  3E99 A;  1VQP 3;  5IW9 A;  4BTX A;  3EN1 B;  3WDG B;  3G8Z A;  3LOY A;  3NBJ A;  4TX4 A;  5IEO A;  1W6G A;  3U97 A;  3WOE B;  2XRX B;  2CC3 A;  2XF3 A;  1OGX A;  2YFJ B;  4NRE A;  5CLK A;  1IQX A;  2CKF B;  1IU7 A;  1ZX2 A;  3V98 A;  4XDV A;  3U1W A;  5BVB A;  2I9W A;  1UUV B;  1HKX A;  1JKG A;  1QVG 2;  2CH9 A;  1LNH A;  1JNQ A;  3FGY A;  3KII A;  3GZR A;  4NHF A;  3KE7 A;  4N3V A;  3G6E 3;  4MMY B;  3ECF A;  1VQ9 3;  5AIG A;  1RN7 A;  5IER A;  2IA7 A;  1AR0 A;  1FGR A;  1K28 A;  1QMA A;  4RZM A;  3SLU A;  1JN5 A;  2KRT A;  4N6T A;  2QIY A;  3JUQ A;  1YIJ 3;  4FMA A;  2BMO B;  1FGO A;  3PZW A;  4N6L A;  1AV4 A;  1W6C A;  2CFK A;  5EVH A;  5AIF A;  3S29 A;  4I4K A;  1A2V A;  3EF8 A;  4WYK B;  1Q86 4;  3B7C A;  2RSX A;  1GY7 A;  4MMZ B;  3EJV A;  2OQE A;  4WFO A;  3X3Y A;  3EQQ B;  1SII A;  3BNE A;  3WOF B;  1TUH A;  1YJN 3;  3CD6 3;  3S28 A;  3LTD A;  2INX A;  2OQE C;  1NO3 A;  1IK3 A;  3BND A;  3EE1 A;  4HKV B;  1N9E A;  1VZZ A;  2Y73 A;  2OCT A;  2WGQ A;  1IT7 A;  1SJW A;  3N54 B;  4HM3 B;  1N8R 4;  3ER7 A;  1FGQ A;  4H3U A;  4JF8 A;  1E97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...