1OGXA

High resolution crystal structure of ketosteroid isomerase mutant d40n(d38n, ti numbering) from pseudomonas putida complexed with equilenin at 2.0 a resolution.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Detection of Large Pka Perturbation of an Inhibitor and a Catalytic Group at an Enzyme Active Site, a Mechanistic Basis for Catalytic Power of Many Enzymes
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ogxA00
3GRDA 4X2OA 5D82A 3OWSA 5CF1A 4I4KA 1OF5A 5DRVA 1Q40A 3A76A 1U5OA 3SOAA 3UNLA 5BVBA 3NBRA 3EBTA 3CNXA 3FLJA 5JPUA 3EN8A 1Z1SA 2B1XB 1TP6A 2XSOB 3OX9A 5AIIA 5IEPA 3MSOA 3LYGA 1JB4A 1WQLB 3NV0B 4L8OA 1OUNA 5AI1A 4HM2B 3ECFA 1JB2A 4ORLA 4HM5B 1O7HB 4HM3B 2GBWB 4LGQA 5G2GA 1OGXA 3NM2A 8CHOA 3F9SA 1O7NB 4XBTA 2HMOB 1OF5B 3F7SA 1Q40B 4HM6B 5KP1A 4OVMA 3F8HA 2CKFB 1TUHA 3EJVA 3I0YA 3MKIA 4LEHA 1C7HA 3KZTA 4K1VA 5AIHA 4HM1B 3FZWA 1NU3A 4XDVA 5IERA 5IG3A 2BMRB 4XBYA 3LZAA 3ROBA 3EC9A 3DUKA 1VZZA 2XRXB 2PZVA 1E97A 3UJMA 3NV0A 3H51A 2BNGA 4N3VA 3HZPA 1ZX2A 3T8UA 3FF0A 1GY7A 1ZO2A 3D9RA 3F14A 2UX0A 2XSHB 3NXJA 4LMIA 3FH1A 4XDWA 5TGNA 3OV4A 3GWRA 5AEUB 3STDA 1UUVB 1Q42A 3B8LA 5IG0A 5HGRA 1ULIB 4J8TA 3JUOA 3KKGA 1NDOB 5DREA 1HKXA 2YFJB 4HKVB 1E3VA 1DMQA 2HMJB 3FKAA 1JN5A 2STDA 4U13A 3E99A 5CLKA 5CF2A 1W01A 4XM4A 1OHPA 4OUQA 1UUWB 4HM8B 3Q90A 6STDA 4X2HA 2R4IA 5KP4A 5D83A 1OHSA 1IDPA 2IMJA 4GB5A 4WYKA 1GS3A 1W00A 3RGRA 2CHCA 3RGAA 5AIFA 4XB5A 1S5AA 1OPYA 3BB9A 5AEWB 1JB5A 1DMMA 1O7GB 3FGYA 3JUNA 4J9AA 3HX8A 4HM0B 5KP3A 2Z7AA 3F8XA 1JN5B 2A15A 5CK6A 2HMNB 4CDLA 3FF2A 3DXOA 3EHCA 3S5CA 4HM7B 1ULJB 1STDA 3EF8A 4HZ9B 4IIAA 2F99A 4WYKB 4RZMA 3MG3A 1W6YA 5IG4A 3KSPA 3VGNA 3B7CA 2OWPA 3OWUA 4L8PA 4KVHA 1O7PB 4FCMA 4R9LA 1OHOA 3CU3A 4HZBB 3F40A 3NHXA 2BMOB 1JKGB 5STDA 2B24B 1O7WB 3KE7A 3G16A 1CQSA 1AR0A 4L7KA 4MJDA 3NUVA 3MYTA 3G0KA 2RFRA 3K7CA 3M8CA 1OCVA 3T8NA 3OWYA 2JQ5A 1QMAA 2YFLB 7STDA 2GEXA 3JUPA 4HM4B 2GBXB 1BUQA 2HMMB 4HJLB 2INXA 2W2CA 3F7XA 1DMNA 1GY6A 2YFIB 2XR8B 5CXOA 5JPPA 4K1UA 3MHEA 2I9WA 2HMLB 2F86B 2BMQB 3WMDA 3OXAA 1EG9B 3BLZA 1QJGA 1EA2A 4HVNA 5FW5A 4PEJA 3B4OA 4WWUC 3EX9A 3GZBA 3EBYA 3DZLA 3K0ZA 2K54A 3JUQA 4R9KA 3EQQB 3JUMA 2Z76A 5IEOA 3HK4A 1JKGA 3CNMA 1GYBA 3MG2A 4FCJA 1ASKA 4WP5A 4STDA 5BXQA 1OH0A 1A2KA 2RCDA 2QGUA 1K41A 3IPTA 3GZYB 1W02A 3DMCA 3G8ZA 2GXFA 5D81A 1GY5A 1ISKA 3SOYA 3H3HA 5IG5A 3SEDA 2RGQA 3GZRA 3MG1A 3VSYA 3DM8A 2HMKB 1SJWA 1O7MB 4H3UA 4XBXA 3EN1B 3FSDA 2GEYA 2Z77A 3CPOA 5IENA 5EVHA 1E3RA 4Q53A 4R1KA 1NWWA 3B4PA 2F98A 1OGZA 5AIGA 5IF6A 3ER7A 2QIYA 3GZXB
chains in the Genus database with same CATH superfamily
1IQXA 1BU4A 3UL5A 1VQP3 1R4CA 4AEQA 3GRDA 1Q7HA 4X2OA 5D82A 3OWSA 2C4BA 3BIRA 4I4KA 5CF1A 1OF5A 5DRVA 1Q40A 2CFDA 3A76A 1U5OA 3SOAA 1MGRA 2W6JH 3UNLA 1M1K4 3SXXA 3CCL3 3Q1CA 7GSPA 5BVBA 3AMOA 2OTJ3 2P09A 3NBRA 1U8CB 2WGOA 1VQ73 3EBTA 2HOHA 3CNXA 3FLJA 4CPKA 5JPUA 1UI8A 1MWRA 1I70A 2CK3H 3EN8A 1Z1SA 3HI7A 1HYFA 2B1XB 1TP6A 2XSOB 3OX9A 5AIIA 5IEPA 1STFI 2FNQA 3MSOA 3T0UA 1BNEA 1AQZA 4EXRA 1IV7A 3LYGA 1JB4A 1WQLB 3NV0B 1I2GA 1F8NA 1UCJA 4FMCA 4L8OA 3CCS3 3ZG0A 1TJDA 1IV9A 1OUNA 5AI1A 1K8A4 1RJOA 3IMAB 4HM2B 4O2HA 3SLUA 3ECFA 2Z6BA 3FG1A 1JZOA 3S67A 1TU5A 3FCSB 2K0MA 1YGEA 1JB2A 3X41A 3DGMA 1T3BA 4N6TA 4ORLA 2AADA 1FUSA 4HM5B 1RGEA 1RDSA 1RSNA 3DGLA 4BTYA 4N6OB 1O7HB 2OQEC 4HM3B 1Q824 2GBWB 2CFLA 3D3LA 3K63A 4LGQA 1BNFA 1RGHA 1YJW3 1MOLA 1IQ8A 5G2GA 1BUJA 1FUTA 1OGXA 4BTWA 1NB5I 1IYYA 3NM2A 5LC6A 8CHOA 1ROVA 1RGAA 4FMAA 3F9SA 1T2IA 1O7NB 2F5WA 1BRGA 4XBTA 2HMOB 1FGMA 1OF5B 3F7SA 1Y4KA 1Q40B 4HM6B 1C54A 5KP1A 1JNQA 1SIIA 4OVMA 1HU9A 4DKIA 1BOXA 3CME3 2H0IA 1GOYA 3F8HA 3RNTA 1MGWA 1UCLA 3D5IA 2CKFB 5JBSA 1TUHA 4WHAA 3EJVA 1JBTA 1WNHA 3I0YA 3MKIA 1C7HA 4LEHA 3KZTA 1DETA 4K1VA 5AIHA 1FGRA 4HM1B 1TRPA 1CYUA 1B20A 2ZL8A 3FZWA 1RKYA 2MF7A 1NU3A 3WR2A 1GD4A 2F5MA 2ZDJA 3DGOA 4XDVA 3CC23 1QAFA 5IERA 9RNTA 1PY3A 5IG3A 3ZFZA 3V99A 2BMRB 4XBYA 1ZGXA 4HAAA 3LZAA 1MWTA 1BSDA 4NHFA 3ROBA 6RNTA 3CCE3 4EW5A 4BIRA 1BNGA 3EC9A 2ZA4A 3A5EA 3DUKA 3WOFB 2WOHA 1VZZA 3LTAA 5M18A 1FW7A 2XRXB 2PZVA 1RGKA 2CH9A 2WOFA 2WO0A 1E97A 3UJMA 4KZ1A 4EBGA 3X3XA 1DYUA 5AYRB 3NV0A 2QA43 3H51A 2BNGA 4N3VA 3HZPA 1ZX2A 3L0RA 1JV2B 3GSPA 3T8UA 3FF0A 1GY7A 2C11A 1ZO2A 4KT3B 3D9RA 3F14A 1GD3A 2UX0A 2XSHB 5FGOA 1KSIA 3NXJA 1BSCA 1VQN3 4LMIA 5IW9A 3CMA3 3RDEA 1BVIA 3PYJA 1PYLA 1IT7A 1QVF2 3FH1A 4XDWA 5TGNA 3OV4A 3CCU3 1YVBI 1KC84 3S29A 5I97A 3GWRA 5AEUB 2W0QA 3HIGA 3STDA 2FGTA 1UGIA 1UUVB 1N8QA 1Q42A 1T5YA 2CFKA 2OTL3 1GMRA 4HBRA 3NQYA 3B8LA 5IG0A 4WFOA 3KCHA 5HGRA 2OOVA 2W9QA 3BNDA 3GAXA 1EEJA 1ULIB 1IVUA 2XF3A 2C10A 4J8TA 4RNYA 1W6CA 2LYXA 3JUOA 3KKGA 5BIRA 2KF5A 5HOHA 2H0GA 1NDOB 4R4KA 5DREA 1GOUA 1G0TA 4NPBA 1RN7A 1LNIA 1RRLA 1LOWA 1FGOA 2BIRA 1IT8A 2GU3A 2SARA 1LXEA 1HKXA 2Q07A 2YFJB 4HKVB 1I8VA 1E3VA 2XFTA 3ZG5A 1UW1A 3FG4A 1DMQA 3DY5A 2HMJB 3FKAA 2CG0A 1FA3A 1JN5A 2IY2A 1VQL3 1JBSA 2STDA 1US1A 1RTUA 4U13A 2ML6A 3X40A 1B2XA 4N6NB 1V58A 3E99A 1VQM3 3CC73 1WMPA 1A2VA 3MWZA 1VQK3 5CLKA 3CXC2 4N6LA 5CF2A 3LTBA 3URPA 1W01A 4XM4A 1OHPA 4OUQA 4LYLB 1UUWB 4EV2A 1SPUA 4HM8B 1DVCA 3OW22 4AKZA 1B27A 3Q90A 6STDA 4N6MA 4X2HA 1UCKA 2R4IA 5KP4A 1BGSA 1VQ83 4N6V0 1BIRA 4QWTA 3LXUX 1NNVA 5M1AA 5M19A 3D79A 1J2BA 5D83A 1OHSA 1BRSA 3U97A 1IDPA 2IMJA 2KCDA 2L1SA 4GB5A 4WYKA 1GS3A 1BAOA 1V74A 1Q7Y4 3G6E3 1N8R4 2BHMA 3S27A 1W00A 2CX1A 2W03A 1UUGB 3RGRA 1YGWA 2CHCA 3DGNA 1TTOA 3I563 1AVKA 3NBJA 3RGAA 1GOVA 2BU4A 5AIFA 3V92A 4XB5A 1S5AA 5EQLA 1X1YA 1OPYA 3BB9A 2OCTA 1YVSA 5AEWB 3J7Yd 3CCQ3 1DMMA 1JB5A 3X42A 1O7GB 1FYSA 1X1UA 3FGYA 1CYVA 2IYJA 3JUNA 2O3OA 4J9AA 3HX8A 3CCR3 4HM0B 1N5PA 1IVVA 1BRIA 5KP3A 1HZ1A 2Z7AA 3F8XA 1JN5B 3BNCA 2A15A 3KN4A 3LOYA 4RBNA 6GSPA 2RSXA 5CK6A 2HMNB 1K734 3WA3A 1W2ZA 3V98A 4CDLA 1NO3A 3FF2A 2CX0A 1I2EA 3Q2PA 4LZIA 1QVG2 2CFWA 1MWSA 4OK0A 3UL6A 2L4VA 3CCJ3 4O8SA 3G4S3 1BSBA 2KF6A 3DXOA 4H61A 1WMNA 3EHCA 2W9PA 3S5CA 2W56A 4HM7B 1ULJB 4BTXA 4CJNA 3WHOA 4JRFA 2GU1A 3SYUA 1R4YA 1YIJ3 1RNBA 3K5TA 3O8YA 4I5QA 2P0MA 2UUGC 1STDA 3EF8A 4HZ9B 4CCVA 2D42A 2M7OA 3NX0A 1A90A 4IIAA 1W6GA 1VQ53 1RCKA 1VQ93 4BL2A 2LQVA 1I0VA 3CD63 4K90B 1PFPA 1SARA 2F99A 4WYKB 1LQGC 4EV5A 4RZMA 3PCSA 8RNTA 2IUKA 4HOHA 2P05A 1BNJA 1EKMA 3MG3A 1YIT3 1W6YA 7RNTA 5IG4A 3KSPA 5G1KA 5ELJA 2FXTA 2W04A 2OQEA 2AAEA 1BRHA 2Y73A 4MMYB 1BSAA 2Y74A 3VGNA 4MEIA 3B7CA 2OWPA 2SBLA 3OWUA 4L8PA 2IA7A 1D6ZA 3Q3FA 4KVHA 1WTHA 1O7PB 3PZWA 2UGIA 4MMXB 4FCMA 2CWVA 1RGFA 1OHOA 1N9JA 4R9LA 4BL3A 5BU4A 3CU3A 1PU4A 1Q814 1W7CA 3LT9A 4HZBB 1EQKA 1TFKA 3HOHA 3F40A 3WA2X 3SX1A 2KF4A 1IU7A 3AGNA 3NHXA 1W2B2 3NQZA 4IPBA 2BMOB 2CW9A 2RNTA 1JKGB 2D1WA 2B24B 4O02B 5STDA 4NREA 1AVLA 3PGBA 3X3YA 4FCZA 4FR9A 1YI23 1O7WB 1ROAA 3KE7A 4G1MB 3G16A 3MPHA 2F4YA 1RMSA 1CQSA 1VQ43 3DGYA 1AR0A 4L7KA 4MJDA 3NUVA 1KQS2 3MYTA 3NBBA 3G0KA 2RFRA 3K7CA 3QRDA 3M8CA 1OCVA 3G713 1UI7A 2KAAA 3T8NA 1BRNL 2W56B 5G1LA 3OWYA 2JQ5A 3UB1A 1M904 1JBRA 1QMAA 2YFLB 4BU4A 7STDA 1GMQA 1B2MA 3BU4A 2GEXA 3JUPA 1JJ22 4HM4B 2GBXB 1L5GB 2XGNA 1BUQA 2JDIH 1YJ93 1UDII 2HMMB 4ILFA 5ELUA 3ALAA 1TRQA 1I0XA 4HJLB 2INXA 1BRJA 2W2CA 3KFQC 1FZUA 3WDGB 3DH2A 2CIUA 2KXGA 3F7XA 1SIHA 1YJN3 2XFSA 1DMNA 1GY6A 1RCLA 1BRKA 3PXMA 1RHLA 2P0XA 2YFIB 1N5HA 1W5ZA 1OACA 2XR8B 4J5KA 2P38A 2F56A 5CXOA 2CWTA 3D5GA 1I2FA 1V57A 1KWIA 1CEWI 5JPPA 1B2UA 1VQO3 5A0OB 1WMOA 4K1UA 2KF3A 3MHEA 3AHWA 1AV4A 4R80A 2J8XB 2KRTA 3WODG 2I9WA 2HMLB 2F86B 1BANA 3BNBA 2XEPA 2BMQB 3TDGA 3LMLA 3WOEB 1RN1A 3AGOA 1Q9EA 3SVAA 3WMDA 3OXAA 1EG9B 2V1LA 1GSPA 3BLZA 2XH9A 4EYCA 1RNTA 1QJGA 2ML5A 3HIIA 4J5GA 3N54B 1EA2A 2E2VA 3N8BA 4HVNA 5FW5A 4PEJA 3B4OA 3LH4A 1G96A 4WWUC 3EX9A 1B3SA 4LSOA 3GZBA 3EBYA 3NM7A 3I553 1B21A 1I3IA 3DZLA 3K0ZA 1M1XB 2R41A 2K54A 3LTCA 3LTDA 4FMDA 4JF8A 4N6UA 4O3VA 1IVXA 3BNEA 3D4AA 3JUQA 1JZDA 4R9KA 2MC8A 1LOYA 1M9GA 1KD14 3EQQB 1AY7A 3JUMA 2Z76A 1NB3I 5EEOA 1BNIA 1B2ZA 5RNTA 3CCV3 5IEOA 3KIIA 4IT7A 1ZS7A 3HK4A 2YX9A 3FG3A 1DE3A 1JKGA 3CNMA 1RGLA 3EE1A 3S28A 1GYBA 3MG2A 1IQYA 2OOVC 4FCJA 1FUWA 1ASKA 3CC43 1QALA 1X1XA 4WP5A 1S723 1RN4A 1X1WA 4STDA 5BXQA 1OH0A 1EUIC 2IUJA 1A2KA 2RCDA 3AMOB 3QK9A 1N9EA 2QGUA 3VF1A 1B2SA 1K41A 2PNCA 3IPTA 3GZYB 3PCRA 5GSPA 1W02A 3DMCA 2BO9B 3G8ZA 3IJEB 1UGHI 5LC7A 1LOVA 3LT8A 1LOXA 2E2UA 2GXFA 1A2PA 2CC3A 5D81A 1GY5A 4MMZB 1ISKA 1G02A 4EC6A 1FGTA 1YHQ3 2E2TA 2CG1A 4GSPA 3SOYA 1Q864 4TX4A 1VQQA 3H3HA 4KFEA 5IG5A 3SEDA 2RGQA 1LNHA 3GZRA 1TFOA 3K9MC 2QEX3 3MG1A 3VSYA 2CFGA 1W4NA 3U1WA 3DM8A 4ZM8A 1YNVX 3CPW2 2HMKB 4K61A 1GMPA 2BT3A 3PS8A 1SJWA 1O7MB 1RGCA 4H3UA 1VQ63 1SQWA 2XGLA 1CH0A 4GL6A 3EN1B 4XBXA 1LQMB 1LVNA 3FSDA 2GEYA 1D6UA 2Z77A 4KFDA 4AKYA 5AYSC 3CPOA 1NJI4 1LRAA 5IENA 1BSEA 4FMBA 1I3FA 2GSPA 1FGQA 3JVCA 2O9UX 1DVDA 5EVHA 1E3RA 1T2HA 1K9M4 1BNSA 4RNZA 4Q53A 4HYZA 1RGGA 2RBIA 3N9HA 4KFFA 4R1KA 3X3ZA 2WGQA 1NWWA 2CWUA 2H0HA 1MWUA 1JRQA 1TIJA 4RNTA 3CCM3 1A67A 1IK3A 1RLSA 2K3DA 1UCIA 3B4PA 2F98A 1K28A 1OGZA 5AIGA 1IVWA 2ZHXB 3EB8A 4GHOA 5IF6A 1BNRA 1D6YA 3KSED 1MNLA 3AHSA 3ER7A 1QAKA 1RRHA 2QIYA 3GZXB
chains in the Genus database with same CATH topology
1IQXA 3UL5A 1VQP3 1R4CA 4AEQA 3GRDA 4X2OA 5D82A 3OWSA 5CF1A 4I4KA 1OF5A 5DRVA 1Q40A 2CFDA 3A76A 1U5OA 3SOAA 2W6JH 3UNLA 1M1K4 3SXXA 3CCL3 3Q1CA 5BVBA 3AMOA 2OTJ3 2P09A 3NBRA 1U8CB 2WGOA 1VQ73 3EBTA 3CNXA 3FLJA 5JPUA 1UI8A 2CK3H 3EN8A 1Z1SA 3HI7A 2B1XB 1TP6A 2XSOB 3OX9A 5AIIA 5IEPA 1STFI 2FNQA 3MSOA 3T0UA 4EXRA 1IV7A 3LYGA 1JB4A 1WQLB 3NV0B 1F8NA 4FMCA 4L8OA 3CCS3 1IV9A 1OUNA 5AI1A 1K8A4 1RJOA 3IMAB 4HM2B 4O2HA 3SLUA 3ECFA 2Z6BA 3FG1A 3S67A 1TU5A 3FCSB 2K0MA 1YGEA 1JB2A 3X41A 3DGMA 4ORLA 4N6TA 4HM5B 3DGLA 4BTYA 4N6OB 1O7HB 2OQEC 4HM3B 1Q824 2GBWB 2CFLA 3D3LA 3K63A 4LGQA 1YJW3 1MOLA 1IQ8A 5G2GA 1OGXA 4BTWA 1NB5I 3NM2A 5LC6A 8CHOA 1ROVA 4FMAA 3F9SA 1O7NB 4XBTA 2HMOB 1FGMA 1OF5B 3F7SA 1Y4KA 1Q40B 4HM6B 5KP1A 1JNQA 1SIIA 4OVMA 1HU9A 3CME3 3F8HA 2CKFB 5JBSA 1TUHA 4WHAA 3EJVA 1WNHA 3I0YA 3MKIA 1C7HA 4LEHA 3KZTA 4K1VA 5AIHA 1FGRA 4HM1B 1CYUA 2ZL8A 3FZWA 1RKYA 2MF7A 1NU3A 1GD4A 3DGOA 2ZDJA 4XDVA 3CC23 1QAFA 5IERA 5IG3A 3V99A 2BMRB 4XBYA 3LZAA 4NHFA 3CCE3 3ROBA 3EC9A 3DUKA 3WOFB 2WOHA 1VZZA 3LTAA 2XRXB 2PZVA 2CH9A 2WOFA 2WO0A 1E97A 3UJMA 4KZ1A 4EBGA 3X3XA 1DYUA 5AYRB 3NV0A 2QA43 3H51A 2BNGA 4N3VA 3HZPA 1ZX2A 3L0RA 1JV2B 3T8UA 3FF0A 1GY7A 2C11A 1ZO2A 3D9RA 3F14A 1GD3A 2UX0A 2XSHB 5FGOA 1KSIA 3NXJA 1VQN3 4LMIA 5IW9A 3CMA3 3RDEA 3PYJA 1IT7A 1QVF2 3FH1A 4XDWA 5TGNA 3OV4A 3CCU3 1YVBI 1KC84 3S29A 5I97A 3GWRA 5AEUB 2W0QA 3HIGA 3STDA 2FGTA 1UUVB 1N8QA 1Q42A 1T5YA 2CFKA 2OTL3 4HBRA 3NQYA 3B8LA 5IG0A 4WFOA 5HGRA 2OOVA 2W9QA 3BNDA 3GAXA 1ULIB 1IVUA 2XF3A 2C10A 4J8TA 4RNYA 1W6CA 2LYXA 3JUOA 3KKGA 4R4KA 1NDOB 5DREA 1RN7A 1RRLA 1FGOA 1IT8A 2GU3A 1LXEA 1HKXA 2Q07A 2YFJB 4HKVB 1E3VA 2XFTA 1UW1A 3FG4A 1DMQA 3DY5A 2HMJB 3FKAA 2CG0A 1FA3A 1JN5A 1VQL3 2STDA 1US1A 4U13A 2ML6A 3X40A 4N6NB 3E99A 1VQM3 3CC73 1WMPA 1A2VA 3MWZA 1VQK3 5CLKA 3CXC2 4N6LA 5CF2A 3LTBA 1W01A 4XM4A 1OHPA 4OUQA 4EV2A 1UUWB 1SPUA 4HM8B 1DVCA 3OW22 4AKZA 3Q90A 6STDA 4N6MA 4X2HA 2R4IA 5KP4A 1VQ83 4N6V0 4QWTA 3LXUX 1J2BA 5D83A 1OHSA 3U97A 1IDPA 2IMJA 2KCDA 4GB5A 4WYKA 1GS3A 1V74A 1Q7Y4 3G6E3 1N8R4 2BHMA 3S27A 1W00A 2W03A 3RGRA 2CHCA 3DGNA 3I563 1AVKA 3NBJA 3RGAA 5AIFA 3V92A 4XB5A 1S5AA 5EQLA 1OPYA 3BB9A 2OCTA 5AEWB 3J7Yd 3CCQ3 1DMMA 1JB5A 3X42A 1O7GB 3FGYA 1CYVA 3JUNA 4J9AA 2O3OA 3HX8A 3CCR3 4HM0B 1N5PA 1IVVA 5KP3A 2Z7AA 3F8XA 1JN5B 3BNCA 2A15A 3KN4A 3LOYA 4RBNA 2RSXA 5CK6A 2HMNB 1K734 3WA3A 1W2ZA 3V98A 4CDLA 1NO3A 3FF2A 3Q2PA 4LZIA 1QVG2 2CFWA 4OK0A 3UL6A 2L4VA 3CCJ3 4O8SA 3G4S3 3DXOA 4H61A 1WMNA 3EHCA 2W9PA 3S5CA 2W56A 4HM7B 1ULJB 4BTXA 4JRFA 2GU1A 1YIJ3 3K5TA 3O8YA 2P0MA 1STDA 3EF8A 4HZ9B 4CCVA 2D42A 2M7OA 3NX0A 1A90A 4IIAA 1W6GA 1VQ53 1VQ93 2LQVA 3CD63 4K90B 1PFPA 2F99A 4WYKB 4EV5A 4RZMA 3PCSA 2IUKA 2P05A 3MG3A 1EKMA 1YIT3 1W6YA 5IG4A 3KSPA 5ELJA 2FXTA 2W04A 2OQEA 2Y73A 4MMYB 2Y74A 3VGNA 4MEIA 3B7CA 2OWPA 2SBLA 3OWUA 4L8PA 2IA7A 1D6ZA 4KVHA 1WTHA 1O7PB 3PZWA 4MMXB 4FCMA 2CWVA 4R9LA 1OHOA 1N9JA 3CU3A 1PU4A 1Q814 1W7CA 3LT9A 4HZBB 1EQKA 1TFKA 3F40A 3WA2X 3SX1A 1IU7A 3NHXA 1W2B2 3NQZA 4IPBA 2BMOB 2CW9A 4O02B 1JKGB 2D1WA 2B24B 5STDA 3X3YA 4NREA 1AVLA 3PGBA 1YI23 4FCZA 4FR9A 1O7WB 1ROAA 3KE7A 4G1MB 3G16A 3MPHA 1CQSA 1VQ43 1AR0A 4L7KA 4MJDA 3NUVA 1KQS2 3MYTA 3NBBA 3G0KA 2RFRA 3K7CA 3QRDA 3M8CA 1OCVA 3G713 1UI7A 3T8NA 2W56B 3UB1A 3OWYA 2JQ5A 1M904 1QMAA 2YFLB 7STDA 2GEXA 3JUPA 1JJ22 4HM4B 2GBXB 1L5GB 2XGNA 1BUQA 2JDIH 1YJ93 2HMMB 5ELUA 3ALAA 4HJLB 2INXA 2W2CA 3KFQC 3WDGB 2CIUA 2KXGA 3F7XA 1SIHA 1YJN3 2XFSA 1DMNA 1GY6A 3PXMA 2P0XA 2YFIB 1N5HA 1W5ZA 1OACA 2XR8B 5CXOA 2P38A 2CWTA 1KWIA 1CEWI 5JPPA 1VQO3 5A0OB 1WMOA 4K1UA 3MHEA 1AV4A 4R80A 2KRTA 3WODG 2I9WA 2HMLB 2F86B 3BNBA 2XEPA 2BMQB 3TDGA 3LMLA 3WOEB 3SVAA 3WMDA 3OXAA 1EG9B 2V1LA 3BLZA 2XH9A 4EYCA 1QJGA 2ML5A 3HIIA 3N54B 1EA2A 2E2VA 3N8BA 4HVNA 5FW5A 4PEJA 3B4OA 3LH4A 1G96A 4WWUC 3EX9A 4LSOA 3GZBA 3EBYA 3NM7A 3I553 3DZLA 3K0ZA 3LTDA 1M1XB 3LTCA 2K54A 4FMDA 4N6UA 4JF8A 4O3VA 1IVXA 3BNEA 3JUQA 4R9KA 2MC8A 1M9GA 1KD14 3EQQB 3JUMA 2Z76A 1NB3I 5EEOA 3CCV3 5IEOA 3KIIA 4IT7A 3HK4A 2YX9A 3FG3A 1JKGA 3CNMA 3EE1A 3S28A 1GYBA 3MG2A 1IQYA 2OOVC 4FCJA 1FUWA 1ASKA 3CC43 1QALA 4WP5A 1S723 4STDA 5BXQA 1OH0A 2IUJA 1A2KA 2RCDA 3AMOB 3QK9A 1N9EA 2QGUA 3VF1A 1K41A 2PNCA 3IPTA 3GZYB 3PCRA 1W02A 3DMCA 2BO9B 3G8ZA 3IJEB 5LC7A 3LT8A 1LOXA 2E2UA 2GXFA 2CC3A 5D81A 1GY5A 4MMZB 1ISKA 4EC6A 1FGTA 1YHQ3 2E2TA 2CG1A 3SOYA 1Q864 4TX4A 3H3HA 4KFEA 5IG5A 3SEDA 2RGQA 1LNHA 3GZRA 1TFOA 3K9MC 2QEX3 3MG1A 3VSYA 2CFGA 1W4NA 3U1WA 3DM8A 4ZM8A 3CPW2 2HMKB 4K61A 2BT3A 3PS8A 1SJWA 1O7MB 4H3UA 1VQ63 1SQWA 2XGLA 4GL6A 4XBXA 3EN1B 1LVNA 3FSDA 2GEYA 1D6UA 2Z77A 4KFDA 4AKYA 5AYSC 3CPOA 1NJI4 5IENA 4FMBA 1FGQA 3JVCA 2O9UX 1DVDA 5EVHA 1E3RA 1K9M4 4RNZA 4Q53A 4HYZA 3N9HA 4KFFA 4R1KA 3X3ZA 2WGQA 1NWWA 2CWUA 1JRQA 1TIJA 3CCM3 1A67A 1IK3A 3B4PA 2F98A 1K28A 1OGZA 5AIGA 1IVWA 3EB8A 5IF6A 1D6YA 3KSED 1MNLA 3ER7A 1QAKA 1RRHA 2QIYA 3GZXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GRD A;  4X2O A;  5D82 A;  3OWS A;  5CF1 A;  4I4K A;  1OF5 A;  5DRV A;  1Q40 A;  3A76 A;  1U5O A;  3SOA A;  3UNL A;  5BVB A;  3NBR A;  3EBT A;  3CNX A;  3FLJ A;  5JPU A;  3EN8 A;  1Z1S A;  2B1X B;  1TP6 A;  2XSO B;  3OX9 A;  5AII A;  5IEP A;  3MSO A;  3LYG A;  1JB4 A;  1WQL B;  3NV0 B;  4L8O A;  1OUN A;  5AI1 A;  4HM2 B;  3ECF A;  1JB2 A;  4ORL A;  4HM5 B;  1O7H B;  4HM3 B;  2GBW B;  4LGQ A;  5G2G A;  1OGX A;  3NM2 A;  8CHO A;  3F9S A;  1O7N B;  4XBT A;  2HMO B;  1OF5 B;  3F7S A;  1Q40 B;  4HM6 B;  5KP1 A;  4OVM A;  3F8H A;  2CKF B;  1TUH A;  3EJV A;  3I0Y A;  3MKI A;  4LEH A;  1C7H A;  3KZT A;  4K1V A;  5AIH A;  4HM1 B;  3FZW A;  1NU3 A;  4XDV A;  5IER A;  5IG3 A;  2BMR B;  4XBY A;  3LZA A;  3ROB A;  3EC9 A;  3DUK A;  1VZZ A;  2XRX B;  2PZV A;  1E97 A;  3UJM A;  3NV0 A;  3H51 A;  2BNG A;  4N3V A;  3HZP A;  1ZX2 A;  3T8U A;  3FF0 A;  1GY7 A;  1ZO2 A;  3D9R A;  3F14 A;  2UX0 A;  2XSH B;  3NXJ A;  4LMI A;  3FH1 A;  4XDW A;  5TGN A;  3OV4 A;  3GWR A;  5AEU B;  3STD A;  1UUV B;  1Q42 A;  3B8L A;  5IG0 A;  5HGR A;  1ULI B;  4J8T A;  3JUO A;  3KKG A;  1NDO B;  5DRE A;  1HKX A;  2YFJ B;  4HKV B;  1E3V A;  1DMQ A;  2HMJ B;  3FKA A;  1JN5 A;  2STD A;  4U13 A;  3E99 A;  5CLK A;  5CF2 A;  1W01 A;  4XM4 A;  1OHP A;  4OUQ A;  1UUW B;  4HM8 B;  3Q90 A;  6STD A;  4X2H A;  2R4I A;  5KP4 A;  5D83 A;  1OHS A;  1IDP A;  2IMJ A;  4GB5 A;  4WYK A;  1GS3 A;  1W00 A;  3RGR A;  2CHC A;  3RGA A;  5AIF A;  4XB5 A;  1S5A A;  1OPY A;  3BB9 A;  5AEW B;  1JB5 A;  1DMM A;  1O7G B;  3FGY A;  3JUN A;  4J9A A;  3HX8 A;  4HM0 B;  5KP3 A;  2Z7A A;  3F8X A;  1JN5 B;  2A15 A;  5CK6 A;  2HMN B;  4CDL A;  3FF2 A;  3DXO A;  3EHC A;  3S5C A;  4HM7 B;  1ULJ B;  1STD A;  3EF8 A;  4HZ9 B;  4IIA A;  2F99 A;  4WYK B;  4RZM A;  3MG3 A;  1W6Y A;  5IG4 A;  3KSP A;  3VGN A;  3B7C A;  2OWP A;  3OWU A;  4L8P A;  4KVH A;  1O7P B;  4FCM A;  4R9L A;  1OHO A;  3CU3 A;  4HZB B;  3F40 A;  3NHX A;  2BMO B;  1JKG B;  5STD A;  2B24 B;  1O7W B;  3KE7 A;  3G16 A;  1CQS A;  1AR0 A;  4L7K A;  4MJD A;  3NUV A;  3MYT A;  3G0K A;  2RFR A;  3K7C A;  3M8C A;  1OCV A;  3T8N A;  3OWY A;  2JQ5 A;  1QMA A;  2YFL B;  7STD A;  2GEX A;  3JUP A;  4HM4 B;  2GBX B;  1BUQ A;  2HMM B;  4HJL B;  2INX A;  2W2C A;  3F7X A;  1DMN A;  1GY6 A;  2YFI B;  2XR8 B;  5CXO A;  5JPP A;  4K1U A;  3MHE A;  2I9W A;  2HML B;  2F86 B;  2BMQ B;  3WMD A;  3OXA A;  1EG9 B;  3BLZ A;  1QJG A;  1EA2 A;  4HVN A;  5FW5 A;  4PEJ A;  3B4O A;  4WWU C;  3EX9 A;  3GZB A;  3EBY A;  3DZL A;  3K0Z A;  2K54 A;  3JUQ A;  4R9K A;  3EQQ B;  3JUM A;  2Z76 A;  5IEO A;  3HK4 A;  1JKG A;  3CNM A;  1GYB A;  3MG2 A;  4FCJ A;  1ASK A;  4WP5 A;  4STD A;  5BXQ A;  1OH0 A;  1A2K A;  2RCD A;  2QGU A;  1K41 A;  3IPT A;  3GZY B;  1W02 A;  3DMC A;  3G8Z A;  2GXF A;  5D81 A;  1GY5 A;  1ISK A;  3SOY A;  3H3H A;  5IG5 A;  3SED A;  2RGQ A;  3GZR A;  3MG1 A;  3VSY A;  3DM8 A;  2HMK B;  1SJW A;  1O7M B;  4H3U A;  4XBX A;  3EN1 B;  3FSD A;  2GEY A;  2Z77 A;  3CPO A;  5IEN A;  5EVH A;  1E3R A;  4Q53 A;  4R1K A;  1NWW A;  3B4P A;  2F98 A;  1OGZ A;  5AIG A;  5IF6 A;  3ER7 A;  2QIY A;  3GZX B; 
#chains in the Genus database with same CATH topology
 1IQX A;  1BU4 A;  3UL5 A;  1VQP 3;  1R4C A;  4AEQ A;  3GRD A;  1Q7H A;  4X2O A;  5D82 A;  3OWS A;  2C4B A;  3BIR A;  4I4K A;  5CF1 A;  1OF5 A;  5DRV A;  1Q40 A;  2CFD A;  3A76 A;  1U5O A;  3SOA A;  1MGR A;  2W6J H;  3UNL A;  1M1K 4;  3SXX A;  3CCL 3;  3Q1C A;  7GSP A;  5BVB A;  3AMO A;  2OTJ 3;  2P09 A;  3NBR A;  1U8C B;  2WGO A;  1VQ7 3;  3EBT A;  2HOH A;  3CNX A;  3FLJ A;  4CPK A;  5JPU A;  1UI8 A;  1MWR A;  1I70 A;  2CK3 H;  3EN8 A;  1Z1S A;  3HI7 A;  1HYF A;  2B1X B;  1TP6 A;  2XSO B;  3OX9 A;  5AII A;  5IEP A;  1STF I;  2FNQ A;  3MSO A;  3T0U A;  1BNE A;  1AQZ A;  4EXR A;  1IV7 A;  3LYG A;  1JB4 A;  1WQL B;  3NV0 B;  1I2G A;  1F8N A;  1UCJ A;  4FMC A;  4L8O A;  3CCS 3;  3ZG0 A;  1TJD A;  1IV9 A;  1OUN A;  5AI1 A;  1K8A 4;  1RJO A;  3IMA B;  4HM2 B;  4O2H A;  3SLU A;  3ECF A;  2Z6B A;  3FG1 A;  1JZO A;  3S67 A;  1TU5 A;  3FCS B;  2K0M A;  1YGE A;  1JB2 A;  3X41 A;  3DGM A;  1T3B A;  4N6T A;  4ORL A;  2AAD A;  1FUS A;  4HM5 B;  1RGE A;  1RDS A;  1RSN A;  3DGL A;  4BTY A;  4N6O B;  1O7H B;  2OQE C;  4HM3 B;  1Q82 4;  2GBW B;  2CFL A;  3D3L A;  3K63 A;  4LGQ A;  1BNF A;  1RGH A;  1YJW 3;  1MOL A;  1IQ8 A;  5G2G A;  1BUJ A;  1FUT A;  1OGX A;  4BTW A;  1NB5 I;  1IYY A;  3NM2 A;  5LC6 A;  8CHO A;  1ROV A;  1RGA A;  4FMA A;  3F9S A;  1T2I A;  1O7N B;  2F5W A;  1BRG A;  4XBT A;  2HMO B;  1FGM A;  1OF5 B;  3F7S A;  1Y4K A;  1Q40 B;  4HM6 B;  1C54 A;  5KP1 A;  1JNQ A;  1SII A;  4OVM A;  1HU9 A;  4DKI A;  1BOX A;  3CME 3;  2H0I A;  1GOY A;  3F8H A;  3RNT A;  1MGW A;  1UCL A;  3D5I A;  2CKF B;  5JBS A;  1TUH A;  4WHA A;  3EJV A;  1JBT A;  1WNH A;  3I0Y A;  3MKI A;  1C7H A;  4LEH A;  3KZT A;  1DET A;  4K1V A;  5AIH A;  1FGR A;  4HM1 B;  1TRP A;  1CYU A;  1B20 A;  2ZL8 A;  3FZW A;  1RKY A;  2MF7 A;  1NU3 A;  3WR2 A;  1GD4 A;  2F5M A;  2ZDJ A;  3DGO A;  4XDV A;  3CC2 3;  1QAF A;  5IER A;  9RNT A;  1PY3 A;  5IG3 A;  3ZFZ A;  3V99 A;  2BMR B;  4XBY A;  1ZGX A;  4HAA A;  3LZA A;  1MWT A;  1BSD A;  4NHF A;  3ROB A;  6RNT A;  3CCE 3;  4EW5 A;  4BIR A;  1BNG A;  3EC9 A;  2ZA4 A;  3A5E A;  3DUK A;  3WOF B;  2WOH A;  1VZZ A;  3LTA A;  5M18 A;  1FW7 A;  2XRX B;  2PZV A;  1RGK A;  2CH9 A;  2WOF A;  2WO0 A;  1E97 A;  3UJM A;  4KZ1 A;  4EBG A;  3X3X A;  1DYU A;  5AYR B;  3NV0 A;  2QA4 3;  3H51 A;  2BNG A;  4N3V A;  3HZP A;  1ZX2 A;  3L0R A;  1JV2 B;  3GSP A;  3T8U A;  3FF0 A;  1GY7 A;  2C11 A;  1ZO2 A;  4KT3 B;  3D9R A;  3F14 A;  1GD3 A;  2UX0 A;  2XSH B;  5FGO A;  1KSI A;  3NXJ A;  1BSC A;  1VQN 3;  4LMI A;  5IW9 A;  3CMA 3;  3RDE A;  1BVI A;  3PYJ A;  1PYL A;  1IT7 A;  1QVF 2;  3FH1 A;  4XDW A;  5TGN A;  3OV4 A;  3CCU 3;  1YVB I;  1KC8 4;  3S29 A;  5I97 A;  3GWR A;  5AEU B;  2W0Q A;  3HIG A;  3STD A;  2FGT A;  1UGI A;  1UUV B;  1N8Q A;  1Q42 A;  1T5Y A;  2CFK A;  2OTL 3;  1GMR A;  4HBR A;  3NQY A;  3B8L A;  5IG0 A;  4WFO A;  3KCH A;  5HGR A;  2OOV A;  2W9Q A;  3BND A;  3GAX A;  1EEJ A;  1ULI B;  1IVU A;  2XF3 A;  2C10 A;  4J8T A;  4RNY A;  1W6C A;  2LYX A;  3JUO A;  3KKG A;  5BIR A;  2KF5 A;  5HOH A;  2H0G A;  1NDO B;  4R4K A;  5DRE A;  1GOU A;  1G0T A;  4NPB A;  1RN7 A;  1LNI A;  1RRL A;  1LOW A;  1FGO A;  2BIR A;  1IT8 A;  2GU3 A;  2SAR A;  1LXE A;  1HKX A;  2Q07 A;  2YFJ B;  4HKV B;  1I8V A;  1E3V A;  2XFT A;  3ZG5 A;  1UW1 A;  3FG4 A;  1DMQ A;  3DY5 A;  2HMJ B;  3FKA A;  2CG0 A;  1FA3 A;  1JN5 A;  2IY2 A;  1VQL 3;  1JBS A;  2STD A;  1US1 A;  1RTU A;  4U13 A;  2ML6 A;  3X40 A;  1B2X A;  4N6N B;  1V58 A;  3E99 A;  1VQM 3;  3CC7 3;  1WMP A;  1A2V A;  3MWZ A;  1VQK 3;  5CLK A;  3CXC 2;  4N6L A;  5CF2 A;  3LTB A;  3URP A;  1W01 A;  4XM4 A;  1OHP A;  4OUQ A;  4LYL B;  1UUW B;  4EV2 A;  1SPU A;  4HM8 B;  1DVC A;  3OW2 2;  4AKZ A;  1B27 A;  3Q90 A;  6STD A;  4N6M A;  4X2H A;  1UCK A;  2R4I A;  5KP4 A;  1BGS A;  1VQ8 3;  4N6V 0;  1BIR A;  4QWT A;  3LXU X;  1NNV A;  5M1A A;  5M19 A;  3D79 A;  1J2B A;  5D83 A;  1OHS A;  1BRS A;  3U97 A;  1IDP A;  2IMJ A;  2KCD A;  2L1S A;  4GB5 A;  4WYK A;  1GS3 A;  1BAO A;  1V74 A;  1Q7Y 4;  3G6E 3;  1N8R 4;  2BHM A;  3S27 A;  1W00 A;  2CX1 A;  2W03 A;  1UUG B;  3RGR A;  1YGW A;  2CHC A;  3DGN A;  1TTO A;  3I56 3;  1AVK A;  3NBJ A;  3RGA A;  1GOV A;  2BU4 A;  5AIF A;  3V92 A;  4XB5 A;  1S5A A;  5EQL A;  1X1Y A;  1OPY A;  3BB9 A;  2OCT A;  1YVS A;  5AEW B;  3J7Y d;  3CCQ 3;  1DMM A;  1JB5 A;  3X42 A;  1O7G B;  1FYS A;  1X1U A;  3FGY A;  1CYV A;  2IYJ A;  3JUN A;  2O3O A;  4J9A A;  3HX8 A;  3CCR 3;  4HM0 B;  1N5P A;  1IVV A;  1BRI A;  5KP3 A;  1HZ1 A;  2Z7A A;  3F8X A;  1JN5 B;  3BNC A;  2A15 A;  3KN4 A;  3LOY A;  4RBN A;  6GSP A;  2RSX A;  5CK6 A;  2HMN B;  1K73 4;  3WA3 A;  1W2Z A;  3V98 A;  4CDL A;  1NO3 A;  3FF2 A;  2CX0 A;  1I2E A;  3Q2P A;  4LZI A;  1QVG 2;  2CFW A;  1MWS A;  4OK0 A;  3UL6 A;  2L4V A;  3CCJ 3;  4O8S A;  3G4S 3;  1BSB A;  2KF6 A;  3DXO A;  4H61 A;  1WMN A;  3EHC A;  2W9P A;  3S5C A;  2W56 A;  4HM7 B;  1ULJ B;  4BTX A;  4CJN A;  3WHO A;  4JRF A;  2GU1 A;  3SYU A;  1R4Y A;  1YIJ 3;  1RNB A;  3K5T A;  3O8Y A;  4I5Q A;  2P0M A;  2UUG C;  1STD A;  3EF8 A;  4HZ9 B;  4CCV A;  2D42 A;  2M7O A;  3NX0 A;  1A90 A;  4IIA A;  1W6G A;  1VQ5 3;  1RCK A;  1VQ9 3;  4BL2 A;  2LQV A;  1I0V A;  3CD6 3;  4K90 B;  1PFP A;  1SAR A;  2F99 A;  4WYK B;  1LQG C;  4EV5 A;  4RZM A;  3PCS A;  8RNT A;  2IUK A;  4HOH A;  2P05 A;  1BNJ A;  1EKM A;  3MG3 A;  1YIT 3;  1W6Y A;  7RNT A;  5IG4 A;  3KSP A;  5G1K A;  5ELJ A;  2FXT A;  2W04 A;  2OQE A;  2AAE A;  1BRH A;  2Y73 A;  4MMY B;  1BSA A;  2Y74 A;  3VGN A;  4MEI A;  3B7C A;  2OWP A;  2SBL A;  3OWU A;  4L8P A;  2IA7 A;  1D6Z A;  3Q3F A;  4KVH A;  1WTH A;  1O7P B;  3PZW A;  2UGI A;  4MMX B;  4FCM A;  2CWV A;  1RGF A;  1OHO A;  1N9J A;  4R9L A;  4BL3 A;  5BU4 A;  3CU3 A;  1PU4 A;  1Q81 4;  1W7C A;  3LT9 A;  4HZB B;  1EQK A;  1TFK A;  3HOH A;  3F40 A;  3WA2 X;  3SX1 A;  2KF4 A;  1IU7 A;  3AGN A;  3NHX A;  1W2B 2;  3NQZ A;  4IPB A;  2BMO B;  2CW9 A;  2RNT A;  1JKG B;  2D1W A;  2B24 B;  4O02 B;  5STD A;  4NRE A;  1AVL A;  3PGB A;  3X3Y A;  4FCZ A;  4FR9 A;  1YI2 3;  1O7W B;  1ROA A;  3KE7 A;  4G1M B;  3G16 A;  3MPH A;  2F4Y A;  1RMS A;  1CQS A;  1VQ4 3;  3DGY A;  1AR0 A;  4L7K A;  4MJD A;  3NUV A;  1KQS 2;  3MYT A;  3NBB A;  3G0K A;  2RFR A;  3K7C A;  3QRD A;  3M8C A;  1OCV A;  3G71 3;  1UI7 A;  2KAA A;  3T8N A;  1BRN L;  2W56 B;  5G1L A;  3OWY A;  2JQ5 A;  3UB1 A;  1M90 4;  1JBR A;  1QMA A;  2YFL B;  4BU4 A;  7STD A;  1GMQ A;  1B2M A;  3BU4 A;  2GEX A;  3JUP A;  1JJ2 2;  4HM4 B;  2GBX B;  1L5G B;  2XGN A;  1BUQ A;  2JDI H;  1YJ9 3;  1UDI I;  2HMM B;  4ILF A;  5ELU A;  3ALA A;  1TRQ A;  1I0X A;  4HJL B;  2INX A;  1BRJ A;  2W2C A;  3KFQ C;  1FZU A;  3WDG B;  3DH2 A;  2CIU A;  2KXG A;  3F7X A;  1SIH A;  1YJN 3;  2XFS A;  1DMN A;  1GY6 A;  1RCL A;  1BRK A;  3PXM A;  1RHL A;  2P0X A;  2YFI B;  1N5H A;  1W5Z A;  1OAC A;  2XR8 B;  4J5K A;  2P38 A;  2F56 A;  5CXO A;  2CWT A;  3D5G A;  1I2F A;  1V57 A;  1KWI A;  1CEW I;  5JPP A;  1B2U A;  1VQO 3;  5A0O B;  1WMO A;  4K1U A;  2KF3 A;  3MHE A;  3AHW A;  1AV4 A;  4R80 A;  2J8X B;  2KRT A;  3WOD G;  2I9W A;  2HML B;  2F86 B;  1BAN A;  3BNB A;  2XEP A;  2BMQ B;  3TDG A;  3LML A;  3WOE B;  1RN1 A;  3AGO A;  1Q9E A;  3SVA A;  3WMD A;  3OXA A;  1EG9 B;  2V1L A;  1GSP A;  3BLZ A;  2XH9 A;  4EYC A;  1RNT A;  1QJG A;  2ML5 A;  3HII A;  4J5G A;  3N54 B;  1EA2 A;  2E2V A;  3N8B A;  4HVN A;  5FW5 A;  4PEJ A;  3B4O A;  3LH4 A;  1G96 A;  4WWU C;  3EX9 A;  1B3S A;  4LSO A;  3GZB A;  3EBY A;  3NM7 A;  3I55 3;  1B21 A;  1I3I A;  3DZL A;  3K0Z A;  1M1X B;  2R41 A;  2K54 A;  3LTC A;  3LTD A;  4FMD A;  4JF8 A;  4N6U A;  4O3V A;  1IVX A;  3BNE A;  3D4A A;  3JUQ A;  1JZD A;  4R9K A;  2MC8 A;  1LOY A;  1M9G A;  1KD1 4;  3EQQ B;  1AY7 A;  3JUM A;  2Z76 A;  1NB3 I;  5EEO A;  1BNI A;  1B2Z A;  5RNT A;  3CCV 3;  5IEO A;  3KII A;  4IT7 A;  1ZS7 A;  3HK4 A;  2YX9 A;  3FG3 A;  1DE3 A;  1JKG A;  3CNM A;  1RGL A;  3EE1 A;  3S28 A;  1GYB A;  3MG2 A;  1IQY A;  2OOV C;  4FCJ A;  1FUW A;  1ASK A;  3CC4 3;  1QAL A;  1X1X A;  4WP5 A;  1S72 3;  1RN4 A;  1X1W A;  4STD A;  5BXQ A;  1OH0 A;  1EUI C;  2IUJ A;  1A2K A;  2RCD A;  3AMO B;  3QK9 A;  1N9E A;  2QGU A;  3VF1 A;  1B2S A;  1K41 A;  2PNC A;  3IPT A;  3GZY B;  3PCR A;  5GSP A;  1W02 A;  3DMC A;  2BO9 B;  3G8Z A;  3IJE B;  1UGH I;  5LC7 A;  1LOV A;  3LT8 A;  1LOX A;  2E2U A;  2GXF A;  1A2P A;  2CC3 A;  5D81 A;  1GY5 A;  4MMZ B;  1ISK A;  1G02 A;  4EC6 A;  1FGT A;  1YHQ 3;  2E2T A;  2CG1 A;  4GSP A;  3SOY A;  1Q86 4;  4TX4 A;  1VQQ A;  3H3H A;  4KFE A;  5IG5 A;  3SED A;  2RGQ A;  1LNH A;  3GZR A;  1TFO A;  3K9M C;  2QEX 3;  3MG1 A;  3VSY A;  2CFG A;  1W4N A;  3U1W A;  3DM8 A;  4ZM8 A;  1YNV X;  3CPW 2;  2HMK B;  4K61 A;  1GMP A;  2BT3 A;  3PS8 A;  1SJW A;  1O7M B;  1RGC A;  4H3U A;  1VQ6 3;  1SQW A;  2XGL A;  1CH0 A;  4GL6 A;  3EN1 B;  4XBX A;  1LQM B;  1LVN A;  3FSD A;  2GEY A;  1D6U A;  2Z77 A;  4KFD A;  4AKY A;  5AYS C;  3CPO A;  1NJI 4;  1LRA A;  5IEN A;  1BSE A;  4FMB A;  1I3F A;  2GSP A;  1FGQ A;  3JVC A;  2O9U X;  1DVD A;  5EVH A;  1E3R A;  1T2H A;  1K9M 4;  1BNS A;  4RNZ A;  4Q53 A;  4HYZ A;  1RGG A;  2RBI A;  3N9H A;  4KFF A;  4R1K A;  3X3Z A;  2WGQ A;  1NWW A;  2CWU A;  2H0H A;  1MWU A;  1JRQ A;  1TIJ A;  4RNT A;  3CCM 3;  1A67 A;  1IK3 A;  1RLS A;  2K3D A;  1UCI A;  3B4P A;  2F98 A;  1K28 A;  1OGZ A;  5AIG A;  1IVW A;  2ZHX B;  3EB8 A;  4GHO A;  5IF6 A;  1BNR A;  1D6Y A;  3KSE D;  1MNL A;  3AHS A;  3ER7 A;  1QAK A;  1RRH A;  2QIY A;  3GZX B; 
#chains in the Genus database with same CATH homology
 1IQX A;  3UL5 A;  1VQP 3;  1R4C A;  4AEQ A;  3GRD A;  4X2O A;  5D82 A;  3OWS A;  5CF1 A;  4I4K A;  1OF5 A;  5DRV A;  1Q40 A;  2CFD A;  3A76 A;  1U5O A;  3SOA A;  2W6J H;  3UNL A;  1M1K 4;  3SXX A;  3CCL 3;  3Q1C A;  5BVB A;  3AMO A;  2OTJ 3;  2P09 A;  3NBR A;  1U8C B;  2WGO A;  1VQ7 3;  3EBT A;  3CNX A;  3FLJ A;  5JPU A;  1UI8 A;  2CK3 H;  3EN8 A;  1Z1S A;  3HI7 A;  2B1X B;  1TP6 A;  2XSO B;  3OX9 A;  5AII A;  5IEP A;  1STF I;  2FNQ A;  3MSO A;  3T0U A;  4EXR A;  1IV7 A;  3LYG A;  1JB4 A;  1WQL B;  3NV0 B;  1F8N A;  4FMC A;  4L8O A;  3CCS 3;  1IV9 A;  1OUN A;  5AI1 A;  1K8A 4;  1RJO A;  3IMA B;  4HM2 B;  4O2H A;  3SLU A;  3ECF A;  2Z6B A;  3FG1 A;  3S67 A;  1TU5 A;  3FCS B;  2K0M A;  1YGE A;  1JB2 A;  3X41 A;  3DGM A;  4ORL A;  4N6T A;  4HM5 B;  3DGL A;  4BTY A;  4N6O B;  1O7H B;  2OQE C;  4HM3 B;  1Q82 4;  2GBW B;  2CFL A;  3D3L A;  3K63 A;  4LGQ A;  1YJW 3;  1MOL A;  1IQ8 A;  5G2G A;  1OGX A;  4BTW A;  1NB5 I;  3NM2 A;  5LC6 A;  8CHO A;  1ROV A;  4FMA A;  3F9S A;  1O7N B;  4XBT A;  2HMO B;  1FGM A;  1OF5 B;  3F7S A;  1Y4K A;  1Q40 B;  4HM6 B;  5KP1 A;  1JNQ A;  1SII A;  4OVM A;  1HU9 A;  3CME 3;  3F8H A;  2CKF B;  5JBS A;  1TUH A;  4WHA A;  3EJV A;  1WNH A;  3I0Y A;  3MKI A;  1C7H A;  4LEH A;  3KZT A;  4K1V A;  5AIH A;  1FGR A;  4HM1 B;  1CYU A;  2ZL8 A;  3FZW A;  1RKY A;  2MF7 A;  1NU3 A;  1GD4 A;  3DGO A;  2ZDJ A;  4XDV A;  3CC2 3;  1QAF A;  5IER A;  5IG3 A;  3V99 A;  2BMR B;  4XBY A;  3LZA A;  4NHF A;  3CCE 3;  3ROB A;  3EC9 A;  3DUK A;  3WOF B;  2WOH A;  1VZZ A;  3LTA A;  2XRX B;  2PZV A;  2CH9 A;  2WOF A;  2WO0 A;  1E97 A;  3UJM A;  4KZ1 A;  4EBG A;  3X3X A;  1DYU A;  5AYR B;  3NV0 A;  2QA4 3;  3H51 A;  2BNG A;  4N3V A;  3HZP A;  1ZX2 A;  3L0R A;  1JV2 B;  3T8U A;  3FF0 A;  1GY7 A;  2C11 A;  1ZO2 A;  3D9R A;  3F14 A;  1GD3 A;  2UX0 A;  2XSH B;  5FGO A;  1KSI A;  3NXJ A;  1VQN 3;  4LMI A;  5IW9 A;  3CMA 3;  3RDE A;  3PYJ A;  1IT7 A;  1QVF 2;  3FH1 A;  4XDW A;  5TGN A;  3OV4 A;  3CCU 3;  1YVB I;  1KC8 4;  3S29 A;  5I97 A;  3GWR A;  5AEU B;  2W0Q A;  3HIG A;  3STD A;  2FGT A;  1UUV B;  1N8Q A;  1Q42 A;  1T5Y A;  2CFK A;  2OTL 3;  4HBR A;  3NQY A;  3B8L A;  5IG0 A;  4WFO A;  5HGR A;  2OOV A;  2W9Q A;  3BND A;  3GAX A;  1ULI B;  1IVU A;  2XF3 A;  2C10 A;  4J8T A;  4RNY A;  1W6C A;  2LYX A;  3JUO A;  3KKG A;  4R4K A;  1NDO B;  5DRE A;  1RN7 A;  1RRL A;  1FGO A;  1IT8 A;  2GU3 A;  1LXE A;  1HKX A;  2Q07 A;  2YFJ B;  4HKV B;  1E3V A;  2XFT A;  1UW1 A;  3FG4 A;  1DMQ A;  3DY5 A;  2HMJ B;  3FKA A;  2CG0 A;  1FA3 A;  1JN5 A;  1VQL 3;  2STD A;  1US1 A;  4U13 A;  2ML6 A;  3X40 A;  4N6N B;  3E99 A;  1VQM 3;  3CC7 3;  1WMP A;  1A2V A;  3MWZ A;  1VQK 3;  5CLK A;  3CXC 2;  4N6L A;  5CF2 A;  3LTB A;  1W01 A;  4XM4 A;  1OHP A;  4OUQ A;  4EV2 A;  1UUW B;  1SPU A;  4HM8 B;  1DVC A;  3OW2 2;  4AKZ A;  3Q90 A;  6STD A;  4N6M A;  4X2H A;  2R4I A;  5KP4 A;  1VQ8 3;  4N6V 0;  4QWT A;  3LXU X;  1J2B A;  5D83 A;  1OHS A;  3U97 A;  1IDP A;  2IMJ A;  2KCD A;  4GB5 A;  4WYK A;  1GS3 A;  1V74 A;  1Q7Y 4;  3G6E 3;  1N8R 4;  2BHM A;  3S27 A;  1W00 A;  2W03 A;  3RGR A;  2CHC A;  3DGN A;  3I56 3;  1AVK A;  3NBJ A;  3RGA A;  5AIF A;  3V92 A;  4XB5 A;  1S5A A;  5EQL A;  1OPY A;  3BB9 A;  2OCT A;  5AEW B;  3J7Y d;  3CCQ 3;  1DMM A;  1JB5 A;  3X42 A;  1O7G B;  3FGY A;  1CYV A;  3JUN A;  4J9A A;  2O3O A;  3HX8 A;  3CCR 3;  4HM0 B;  1N5P A;  1IVV A;  5KP3 A;  2Z7A A;  3F8X A;  1JN5 B;  3BNC A;  2A15 A;  3KN4 A;  3LOY A;  4RBN A;  2RSX A;  5CK6 A;  2HMN B;  1K73 4;  3WA3 A;  1W2Z A;  3V98 A;  4CDL A;  1NO3 A;  3FF2 A;  3Q2P A;  4LZI A;  1QVG 2;  2CFW A;  4OK0 A;  3UL6 A;  2L4V A;  3CCJ 3;  4O8S A;  3G4S 3;  3DXO A;  4H61 A;  1WMN A;  3EHC A;  2W9P A;  3S5C A;  2W56 A;  4HM7 B;  1ULJ B;  4BTX A;  4JRF A;  2GU1 A;  1YIJ 3;  3K5T A;  3O8Y A;  2P0M A;  1STD A;  3EF8 A;  4HZ9 B;  4CCV A;  2D42 A;  2M7O A;  3NX0 A;  1A90 A;  4IIA A;  1W6G A;  1VQ5 3;  1VQ9 3;  2LQV A;  3CD6 3;  4K90 B;  1PFP A;  2F99 A;  4WYK B;  4EV5 A;  4RZM A;  3PCS A;  2IUK A;  2P05 A;  3MG3 A;  1EKM A;  1YIT 3;  1W6Y A;  5IG4 A;  3KSP A;  5ELJ A;  2FXT A;  2W04 A;  2OQE A;  2Y73 A;  4MMY B;  2Y74 A;  3VGN A;  4MEI A;  3B7C A;  2OWP A;  2SBL A;  3OWU A;  4L8P A;  2IA7 A;  1D6Z A;  4KVH A;  1WTH A;  1O7P B;  3PZW A;  4MMX B;  4FCM A;  2CWV A;  4R9L A;  1OHO A;  1N9J A;  3CU3 A;  1PU4 A;  1Q81 4;  1W7C A;  3LT9 A;  4HZB B;  1EQK A;  1TFK A;  3F40 A;  3WA2 X;  3SX1 A;  1IU7 A;  3NHX A;  1W2B 2;  3NQZ A;  4IPB A;  2BMO B;  2CW9 A;  4O02 B;  1JKG B;  2D1W A;  2B24 B;  5STD A;  3X3Y A;  4NRE A;  1AVL A;  3PGB A;  1YI2 3;  4FCZ A;  4FR9 A;  1O7W B;  1ROA A;  3KE7 A;  4G1M B;  3G16 A;  3MPH A;  1CQS A;  1VQ4 3;  1AR0 A;  4L7K A;  4MJD A;  3NUV A;  1KQS 2;  3MYT A;  3NBB A;  3G0K A;  2RFR A;  3K7C A;  3QRD A;  3M8C A;  1OCV A;  3G71 3;  1UI7 A;  3T8N A;  2W56 B;  3UB1 A;  3OWY A;  2JQ5 A;  1M90 4;  1QMA A;  2YFL B;  7STD A;  2GEX A;  3JUP A;  1JJ2 2;  4HM4 B;  2GBX B;  1L5G B;  2XGN A;  1BUQ A;  2JDI H;  1YJ9 3;  2HMM B;  5ELU A;  3ALA A;  4HJL B;  2INX A;  2W2C A;  3KFQ C;  3WDG B;  2CIU A;  2KXG A;  3F7X A;  1SIH A;  1YJN 3;  2XFS A;  1DMN A;  1GY6 A;  3PXM A;  2P0X A;  2YFI B;  1N5H A;  1W5Z A;  1OAC A;  2XR8 B;  5CXO A;  2P38 A;  2CWT A;  1KWI A;  1CEW I;  5JPP A;  1VQO 3;  5A0O B;  1WMO A;  4K1U A;  3MHE A;  1AV4 A;  4R80 A;  2KRT A;  3WOD G;  2I9W A;  2HML B;  2F86 B;  3BNB A;  2XEP A;  2BMQ B;  3TDG A;  3LML A;  3WOE B;  3SVA A;  3WMD A;  3OXA A;  1EG9 B;  2V1L A;  3BLZ A;  2XH9 A;  4EYC A;  1QJG A;  2ML5 A;  3HII A;  3N54 B;  1EA2 A;  2E2V A;  3N8B A;  4HVN A;  5FW5 A;  4PEJ A;  3B4O A;  3LH4 A;  1G96 A;  4WWU C;  3EX9 A;  4LSO A;  3GZB A;  3EBY A;  3NM7 A;  3I55 3;  3DZL A;  3K0Z A;  3LTD A;  1M1X B;  3LTC A;  2K54 A;  4FMD A;  4N6U A;  4JF8 A;  4O3V A;  1IVX A;  3BNE A;  3JUQ A;  4R9K A;  2MC8 A;  1M9G A;  1KD1 4;  3EQQ B;  3JUM A;  2Z76 A;  1NB3 I;  5EEO A;  3CCV 3;  5IEO A;  3KII A;  4IT7 A;  3HK4 A;  2YX9 A;  3FG3 A;  1JKG A;  3CNM A;  3EE1 A;  3S28 A;  1GYB A;  3MG2 A;  1IQY A;  2OOV C;  4FCJ A;  1FUW A;  1ASK A;  3CC4 3;  1QAL A;  4WP5 A;  1S72 3;  4STD A;  5BXQ A;  1OH0 A;  2IUJ A;  1A2K A;  2RCD A;  3AMO B;  3QK9 A;  1N9E A;  2QGU A;  3VF1 A;  1K41 A;  2PNC A;  3IPT A;  3GZY B;  3PCR A;  1W02 A;  3DMC A;  2BO9 B;  3G8Z A;  3IJE B;  5LC7 A;  3LT8 A;  1LOX A;  2E2U A;  2GXF A;  2CC3 A;  5D81 A;  1GY5 A;  4MMZ B;  1ISK A;  4EC6 A;  1FGT A;  1YHQ 3;  2E2T A;  2CG1 A;  3SOY A;  1Q86 4;  4TX4 A;  3H3H A;  4KFE A;  5IG5 A;  3SED A;  2RGQ A;  1LNH A;  3GZR A;  1TFO A;  3K9M C;  2QEX 3;  3MG1 A;  3VSY A;  2CFG A;  1W4N A;  3U1W A;  3DM8 A;  4ZM8 A;  3CPW 2;  2HMK B;  4K61 A;  2BT3 A;  3PS8 A;  1SJW A;  1O7M B;  4H3U A;  1VQ6 3;  1SQW A;  2XGL A;  4GL6 A;  4XBX A;  3EN1 B;  1LVN A;  3FSD A;  2GEY A;  1D6U A;  2Z77 A;  4KFD A;  4AKY A;  5AYS C;  3CPO A;  1NJI 4;  5IEN A;  4FMB A;  1FGQ A;  3JVC A;  2O9U X;  1DVD A;  5EVH A;  1E3R A;  1K9M 4;  4RNZ A;  4Q53 A;  4HYZ A;  3N9H A;  4KFF A;  4R1K A;  3X3Z A;  2WGQ A;  1NWW A;  2CWU A;  1JRQ A;  1TIJ A;  3CCM 3;  1A67 A;  1IK3 A;  3B4P A;  2F98 A;  1K28 A;  1OGZ A;  5AIG A;  1IVW A;  3EB8 A;  5IF6 A;  1D6Y A;  3KSE D;  1MNL A;  3ER7 A;  1QAK A;  1RRH A;  2QIY A;  3GZX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...