4N6OB

Crystal structure of reduced legumain in complex with cystatin e/m
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
b'GELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords legumain
publication title Structure and mechanism of an aspartimide-dependent Peptide ligase in human legumain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6oB00
4TX4A 1A90A 1R4CA 3SVAA 1EQKA 1RN7A 3L0RA 2KXGA 1A67A 1N9JA 1MNLA 4IT7A 1WNHA 1LXEA 1DVDA 1ROAA 3KFQC 1N5HA 3PS8A 3PYJA 4ZM8A 4N6MA 5ELUA 1MOLA 1GD4A 3MWZA 1DVCA 1TIJA 4N6NB 5LC7A 5EQLA 1FUWA 1FA3A 2BO9B 5ELJA 3UL5A 5LC6A 2W9PA 3NX0A 1GD3A 1N5PA 4N6LA 3K9MC 1CEWI 1YVBI 1G96A 5A0OB 3KSED 1PFPA 3Q2PA 2O9UX 4N6UA 3GAXA 1IV9A 1STFI 4N6OB 2W9QA 4EYCA 4N6TA 4N6V0 3QRDA 4LZIA 1NB5I 1CYVA 4CCVA 3LH4A 1NB3I 1CYUA 3UL6A 3IMAB 3S67A 1M9GA 2CH9A 1KWIA 2OCTA 3PXMA 1IV7A
chains in the Genus database with same CATH superfamily
1EG9B 1WQLB 1YIJ3 1F8NA 4WWUC 1OCVA 3LTDA 1BANA 3ZG5A 2CIUA 1W00A 4MEIA 1A67A 1TRQA 4GHOA 4PEJA 4I4KA 3G6E3 1N9JA 1T2IA 3CXC2 2CC3A 1NWWA 1WMPA 3OWUA 1JBTA 1W6GA 3F9SA 3V98A 1SIIA 3A76A 1ROAA 5STDA 3WMDA 5M1AA 4FMAA 1CQSA 1BSCA 4HYZA 4R1KA 4ILFA 3Q1CA 2F98A 5IG0A 4R9LA 5BXQA 2QGUA 3MG1A 2JQ5A 3MYTA 1OHOA 1QJGA 3PYJA 4FCZA 1FGTA 1R4YA 1O7PB 4FMBA 4BTXA 3OXAA 1E3VA 2WOHA 2XEPA 3B7CA 1JB5A 1MOLA 4N3VA 1DE3A 3QK9A 3D4AA 1BGSA 2OOVA 1GD4A 3X41A 3CCV3 2INXA 2P09A 4GB5A 4O8SA 1W2ZA 5G2GA 4AKYA 3CCU3 1VQ63 1W01A 3T0UA 4J9AA 5M19A 1IQXA 1TIJA 2BIRA 4N6NB 4HM1B 3HX8A 1RN1A 4HZBB 5LC7A 1GS3A 1VQQA 3DGYA 1FUWA 1VZZA 2Y73A 3FH1A 4O2HA 2ML5A 4U13A 1LOXA 3D79A 2XFTA 1W7CA 1GSPA 3I0YA 1BRIA 1E97A 1GYBA 1MWUA 2C10A 1SARA 4JF8A 5IF6A 4HM3B 2WO0A 2OQEA 9RNTA 1GMQA 4EBGA 3X40A 2A15A 3SLUA 3SYUA 3BU4A 4O3VA 2YFLB 4HZ9B 4K61A 1X1UA 3K9MC 2OOVC 3I563 4XDWA 1B21A 3OWSA 1CEWI 1K8A4 3LYGA 2W04A 1E3RA 1SQWA 2WGQA 5A0OB 1BNSA 3M8CA 2Z6BA 2Y74A 3SOYA 1B27A 4L8PA 3MKIA 4GSPA 4NREA 3MHEA 2CWVA 1ISKA 1IV9A 1RLSA 1VQK3 2CFGA 1W6CA 3NHXA 1MWSA 4AKZA 3EBTA 1YHQ3 2P0MA 3EX9A 2CFKA 3PCRA 2P05A 3SEDA 1O7NB 1US1A 3FZWA 3K0ZA 3K5TA 4N6V0 3FG1A 1PY3A 2W2CA 4XB5A 2QA43 1VQ43 1B2MA 1VQ93 4STDA 1ZGXA 1V57A 1JNQA 1I2GA 3KSPA 1TFKA 3EE1A 4QWTA 5GSPA 1L5GB 3CD63 1LOVA 1TTOA 5JPPA 1UI8A 3NBRA 4CCVA 1YIT3 2OQEC 1B2ZA 1B3SA 1BRHA 2F5MA 3LH4A 3D5IA 1QVG2 1IVWA 1GOYA 4LYLB 4LMIA 3FG3A 1OF5A 4BIRA 1HZ1A 1DYUA 1V58A 1LQMB 2K54A 2F4YA 2HMNB 2RSXA 1FYSA 3IMAB 3NBJA 4O02B 3S67A 3ALAA 1U5OA 1JZDA 1NNVA 1O7MB 1UCIA 2ZL8A 2CX1A 2CH9A 2H0IA 2B24B 3AHWA 4FMCA 4L7KA 2CKFB 1LOWA 3AMOA 5DRVA 1VQ83 2CX0A 3CPOA 3FCSB 2GBWB 5AI1A 1AQZA 2STDA 3O8YA 2I9WA 7STDA 3X3ZA 3EBYA 1I8VA 3DGLA 1A90A 4K90B 1RGFA 4R9KA 3SVAA 5IW9A 1AVLA 1QVF2 5IERA 1RGLA 1BNJA 3NV0B 4XDVA 3FG4A 2W6JH 3G0KA 5KP4A 5BIRA 2GSPA 3CME3 4BL2A 1YNVX 4R4KA 3NQZA 4KT3B 1YVSA 2L1SA 3JUNA 1FZUA 1MNLA 1WNHA 1ZO2A 3J7Yd 5CLKA 3OW22 3DGOA 1K41A 2XRXB 5TGNA 3BIRA 2P38A 2MC8A 4EC6A 1NU3A 5CF1A 6RNTA 1TUHA 1O7GB 1VQM3 1FGQA 1SJWA 2IYJA 1JN5B 2ZDJA 5D83A 3SX1A 3JVCA 1RCLA 1DETA 4CDLA 1BSDA 3DZLA 3X3XA 2W0QA 2H0GA 1TU5A 1S5AA 3LT8A 2CWTA 2KCDA 3NM7A 1YJW3 5BVBA 1NO3A 5DREA 3CMA3 1GY5A 1DMNA 2Q07A 1Q40A 3LTBA 4J5GA 5AIIA 1IT8A 3CCS3 2CFLA 3CC73 1UCLA 1S723 1RJOA 4KFDA 3WA2X 2XGLA 1RGHA 5M18A 1UUWB 1O7HB 1ULIB 3KIIA 1B2XA 1QALA 1VQ53 3EHCA 3DUKA 4CPKA 2GXFA 3WOFB 1V74A 1WMNA 2O3OA 1M904 1Q7Y4 2OTL3 1ASKA 1D6ZA 1I0XA 2XR8B 1QAFA 3KZTA 4J8TA 5JBSA 4LGQA 1PU4A 1D6YA 3BNDA 5AIGA 1MGRA 1B2SA 2M7OA 4HKVB 3BLZA 3GZBA 2YFIB 1OPYA 1WTHA 1Z1SA 5JPUA 3HIGA 1IVXA 1AVKA 3KE7A 3OX9A 4RNZA 2QIYA 4CJNA 1IT7A 2FXTA 4N6LA 3SXXA 5AYRB 2CWUA 2CFDA 1AR0A 2CHCA 4WFOA 4KVHA 1RNBA 1TFOA 2F99A 1JKGB 1KC84 4G1MB 3LXUX 2OTJ3 1I2FA 2Z7AA 4J5KA 2O9UX 5AIHA 3EC9A 2ZHXB 2IUKA 1EKMA 3JUOA 3MG3A 1I0VA 4EYCA 4N6TA 1AY7A 3FF0A 1Y4KA 1J2BA 2HMKB 1UGHI 2FGTA 1NB5I 1CYVA 1TRPA 3VF1A 3B4OA 1FGMA 3UNLA 2IY2A 1RHLA 3N54B 3NM2A 3CCQ3 1IVVA 4RNYA 3S5CA 1BNFA 1NB3I 3NUVA 1BRNL 1W2B2 5IEPA 3K63A 4HM4B 2F56A 2LQVA 1I70A 1M9GA 4X2HA 4AEQA 3S28A 2GU3A 1RMSA 3NBBA 3CCL3 2H0HA 1IDPA 3S27A 2F86B 1IU7A 1M1K4 4LEHA 1U8CB 2HMLB 4WYKA 1DMMA 1JZOA 1W6YA 3AGOA 3CPW2 1KD14 3B4PA 4GL6A 5G1LA 1UW1A 4KZ1A 3WA3A 3FKAA 3CU3A 2Z76A 4HM2B 4TX4A 4OK0A 2AADA 5EEOA 5AYSC 1RN7A 1HKXA 1NDOB 1T2HA 3MG2A 5CXOA 2C4BA 3RGRA 3S29A 1QAKA 5HOHA 2IUJA 2CFWA 4EV5A 3NV0A 4L8OA 1RN4A 3Q3FA 1B20A 1PYLA 4NPBA 3URPA 1RGEA 2JDIH 3DM8A 2XF3A 3G16A 3F7XA 3CCJ3 1BRKA 2XSHB 4HJLB 2K0MA 1O7WB 3V99A 2E2VA 3KFQC 4BTYA 4HM0B 1G0TA 1RDSA 3DGMA 1UCKA 1N5HA 1VQO3 3BNCA 3PS8A 2D42A 2XH9A 3BB9A 1GMPA 3ECFA 3DXOA 2XFSA 5IG5A 1BRGA 1GOVA 1OGZA 4DKIA 2KF4A 1TJDA 1M1XB 1EA2A 3DGNA 4X2OA 3G8ZA 5CF2A 4HAAA 1STDA 1X1YA 2CK3H 2WOFA 4RNTA 3K7CA 3DH2A 3EF8A 2W03A 2XGNA 2YX9A 3JUQA 1MWTA 6STDA 2E2UA 2IMJA 2BU4A 3PCSA 3N8BA 1FW7A 1RCKA 2CG0A 1C7HA 1YGWA 1A2KA 1CH0A 2B1XB 1FA3A 3EB8A 3WDGB 1BVIA 4WP5A 3U1WA 5BU4A 1LNHA 2ML6A 3CNMA 4RZMA 3GRDA 1BNEA 5AEUB 1SIHA 3F40A 1LNIA 1BIRA 3IJEB 2BNGA 2W9PA 5LC6A 3UL5A 3X3YA 1ZS7A 1JB4A 1EEJA 1BU4A 2W56B 3NX0A 4HVNA 3D5GA 3WR2A 3JUPA 1KSIA 4OUQA 1Q824 1UGIA 1JRQA 3FLJA 3LZAA 3CC43 3STDA 3GZXB 1DMQA 3LTCA 4H61A 5RNTA 3EQQB 1I3FA 3HK4A 2P0XA 1RSNA 4XBTA 3ZFZA 2BMOB 2F5WA 1LRAA 1W5ZA 3ROBA 1OGXA 1A2VA 3T8NA 1GOUA 1BUQA 5FGOA 1I2EA 3CCM3 3SOAA 4XM4A 3DMCA 3UB1A 1JKGA 3Q2PA 1OHSA 4N6UA 2PZVA 4FR9A 3GAXA 1STFI 4N6OB 1JBSA 2BT3A 4FCMA 1Q7HA 1RNTA 2UX0A 1HYFA 3F14A 4XBYA 1UUVB 2RFRA 4MJDA 1ULJB 3DY5A 3BNEA 4LZIA 2HMMB 4KFEA 3GSPA 1Q864 3N9HA 4MMYB 2RCDA 5D82A 3VGNA 3LMLA 1B2UA 4BU4A 2BHMA 4BL3A 4MMZB 5KP3A 2PNCA 2UGIA 5AEWB 4EV2A 1UI7A 2AAEA 3KCHA 1BAOA 3WOEB 5FW5A 1FUSA 2CW9A 1UDII 4BTWA 2GEXA 3FSDA 4Q53A 4IIAA 2KAAA 1RRLA 2J8XB 1VQ73 3B8LA 3HI7A 3OWYA 4NHFA 1N8R4 1TP6A 3PXMA 5IENA 1IV7A 1EUIC 2KF3A 3EN8A 1IQYA 1BNGA 1BNIA 1FGOA 3BNBA 1IYYA 1Q40B 1YJ93 3LTAA 1UUGB 1R4CA 1RTUA 1EQKA 3TDGA 1N9EA 2HMJB 3CCR3 4KFFA 1BRJA 2RNTA 3L0RA 3ER7A 2KXGA 4RBNA 1GY7A 1BSAA 2V1LA 2RBIA 1RGAA 1N8QA 3AGNA 3GZRA 3H51A 4IT7A 1G02A 1LXEA 4FCJA 4HM6B 1WMOA 1DVDA 1VQP3 1JV2B 1SPUA 2R41A 5IG3A 1BUJA 1K734 2BMRB 4ORLA 1BOXA 8CHOA 3ZG0A 1K9M4 2FNQA 2UUGC 3H3HA 1OACA 3Q90A 3G713 2OWPA 3LT9A 3F8XA 2D1WA 1YGEA 1I3IA 4HM8B 1JJ22 3AHSA 4ZM8A 2GBXB 4N6MA 4K1VA 5ELUA 3U97A 4EXRA 2L4VA 3EJVA 5HGRA 2MF7A 4MMXB 3MWZA 1IQ8A 2KRTA 3GWRA 4JRFA 5EVHA 1DVCA 3E99A 2HMOB 2R4IA 1YI23 3V92A 1JB2A 1LVNA 2QEX3 4XBXA 1X1XA 6GSPA 5EQLA 2IA7A 7GSPA 4R80A 1W4NA 3WHOA 3RDEA 1C54A 3HOHA 1VQL3 3GZYB 3NXJA 2BO9B 1QMAA 4HM7B 5ELJA 1JBRA 1W02A 1JN5A 5AIFA 3RGAA 2HOHA 1FGRA 2K3DA 1OHPA 3A5EA 1Q9EA 4HOHA 3RNTA 3F7SA 4LSOA 2YFJB 1GD3A 2SBLA 2KF5A 3I553 1Q42A 2KF6A 5D81A 1HU9A 1MWRA 3FF2A 4K1UA 2W56A 5I97A 1ZX2A 1AV4A 1RGCA 3CNXA 1RGKA 1OH0A 1N5PA 5G1KA 1ROVA 2GEYA 1IK3A 5IG4A 3CC23 3T8UA 3UJMA 1BNRA 1YVBI 1K28A 4FMDA 4H3UA 5KP1A 1RRHA 3WODG 3IPTA 3LOYA 1G96A 4WYKB 3F8HA 3KSED 1PFPA 1NJI4 1LOYA 3VSYA 3D3LA 3X42A 2C11A 2E2TA 1D6UA 2W9QA 1MGWA 1UCJA 3JUMA 1RGGA 1Q814 1FUTA 2LYXA 3QRDA 7RNTA 3D9RA 2GU1A 4HBRA 5CK6A 1LQGC 1T5YA 8RNTA 3PGBA 1BSEA 4WHAA 3OV4A 4EW5A 3G4S3 1X1WA 4IPBA 1OF5B 4OVMA 1T3BA 3KKGA 1KQS2 2CG1A 1OUNA 4HM5B 1CYUA 3EN1B 3UL6A 3FGYA 1A2PA 2BMQB 2Z77A 1GY6A 4I5QA 1RKYA 1IVUA 3AMOB 2XSOB 3HZPA 3CCE3 2RGQA 2ZA4A 3PZWA 3HIIA 3NQYA 1BRSA 2WGOA 1KWIA 3MSOA 5IEOA 1VQN3 2OCTA 3MPHA 2SARA 1BSBA 3KN4A 1YJN3 1GMRA
chains in the Genus database with same CATH topology
1EG9B 1WQLB 1YIJ3 1F8NA 4WWUC 1OCVA 3LTDA 2CIUA 1W00A 4MEIA 1A67A 4PEJA 4I4KA 3G6E3 1N9JA 3CXC2 2CC3A 1NWWA 1WMPA 3OWUA 1W6GA 3F9SA 3V98A 1SIIA 3A76A 1ROAA 5STDA 3WMDA 4FMAA 1CQSA 4HYZA 4R1KA 3Q1CA 2F98A 5IG0A 4R9LA 5BXQA 2QGUA 3MG1A 2JQ5A 3MYTA 1OHOA 1QJGA 3PYJA 4FCZA 1FGTA 4FMBA 1O7PB 4BTXA 3OXAA 1E3VA 2WOHA 2XEPA 3B7CA 1JB5A 1MOLA 4N3VA 3QK9A 2OOVA 1GD4A 3X41A 3CCV3 2INXA 2P09A 4GB5A 4O8SA 1W2ZA 5G2GA 4AKYA 3CCU3 1VQ63 1W01A 3T0UA 4J9AA 1IQXA 1TIJA 4N6NB 4HM1B 3HX8A 4HZBB 5LC7A 1GS3A 1FUWA 1VZZA 2Y73A 3FH1A 4O2HA 2ML5A 4U13A 1LOXA 2XFTA 1W7CA 3I0YA 1E97A 1GYBA 2C10A 4JF8A 5IF6A 4HM3B 2WO0A 2OQEA 4EBGA 3X40A 2A15A 3SLUA 4O3VA 2YFLB 4HZ9B 4K61A 3K9MC 3I563 2OOVC 4XDWA 3OWSA 1K8A4 1CEWI 3LYGA 2W04A 1E3RA 1SQWA 2WGQA 5A0OB 3M8CA 2Z6BA 2Y74A 3SOYA 4L8PA 3MKIA 4NREA 3MHEA 2CWVA 1ISKA 1IV9A 1VQK3 2CFGA 1W6CA 3NHXA 1YHQ3 4AKZA 3EBTA 2P0MA 3EX9A 2CFKA 3PCRA 2P05A 3SEDA 1O7NB 1US1A 3FZWA 3K0ZA 3K5TA 4N6V0 3FG1A 4XB5A 2W2CA 2QA43 1VQ43 1VQ93 4STDA 1JNQA 3KSPA 4QWTA 1TFKA 3EE1A 1L5GB 3CD63 5JPPA 1UI8A 3NBRA 4CCVA 1YIT3 2OQEC 1QVG2 3LH4A 1IVWA 4LMIA 3FG3A 1OF5A 1DYUA 2K54A 2RSXA 2HMNB 3IMAB 3NBJA 3S67A 4O02B 3ALAA 1U5OA 3NBBA 1O7MB 4FMCA 2ZL8A 2CH9A 4L7KA 2B24B 5DRVA 1VQ83 2CKFB 3AMOA 3CPOA 3FCSB 2GBWB 5AI1A 2STDA 3O8YA 2I9WA 7STDA 3X3ZA 3EBYA 3DGLA 1A90A 4K90B 4R9KA 3SVAA 5IW9A 1AVLA 1QVF2 5IERA 3NV0B 4XDVA 3FG4A 2W6JH 3G0KA 5KP4A 3CME3 4R4KA 3NQZA 3JUNA 1MNLA 3J7Yd 1WNHA 1ZO2A 5CLKA 3OW22 3DGOA 1K41A 2XRXB 5TGNA 4EC6A 2P38A 2MC8A 5CF1A 1NU3A 1TUHA 1O7GB 1VQM3 1FGQA 1SJWA 1JN5B 2ZDJA 5D83A 3SX1A 3JVCA 4CDLA 3DZLA 3X3XA 2W0QA 1TU5A 1S5AA 3LT8A 2CWTA 2KCDA 3NM7A 1YJW3 5BVBA 1NO3A 5DREA 3CMA3 1GY5A 1DMNA 2Q07A 1Q40A 3LTBA 5AIIA 1IT8A 3CCS3 2CFLA 3CC73 1S723 1RJOA 4KFDA 3WA2X 2XGLA 1UUWB 1O7HB 1ULIB 3KIIA 1QALA 1VQ53 3EHCA 3DUKA 2GXFA 3WOFB 1V74A 1WMNA 2O3OA 1M904 1Q7Y4 2OTL3 1ASKA 1D6ZA 2XR8B 1QAFA 3KZTA 4J8TA 5JBSA 4LGQA 1PU4A 1D6YA 3BNDA 5AIGA 2M7OA 4HKVB 3BLZA 3GZBA 2YFIB 1OPYA 1WTHA 1Z1SA 5JPUA 3HIGA 1IVXA 1AVKA 3KE7A 3OX9A 4RNZA 2QIYA 1IT7A 2FXTA 4N6LA 3SXXA 5AYRB 2CWUA 2CFDA 1AR0A 2CHCA 4WFOA 4KVHA 1TFOA 2F99A 1JKGB 1KC84 4G1MB 3LXUX 2OTJ3 2Z7AA 5AIHA 2O9UX 3EC9A 2IUKA 1EKMA 3JUOA 3MG3A 4EYCA 4N6TA 3FF0A 1Y4KA 1J2BA 2HMKB 2FGTA 1NB5I 1CYVA 3VF1A 3B4OA 1FGMA 3UNLA 3N54B 3NM2A 3CCQ3 1IVVA 4RNYA 3S5CA 1NB3I 3NUVA 1W2B2 5IEPA 3K63A 4HM4B 2LQVA 1M9GA 4X2HA 4AEQA 3S28A 2GU3A 3CCL3 1IDPA 3S27A 2F86B 1IU7A 1M1K4 4LEHA 1U8CB 2HMLB 4WYKA 1DMMA 1W6YA 3CPW2 1KD14 3B4PA 4GL6A 1UW1A 4KZ1A 3WA3A 3FKAA 3CU3A 2Z76A 4HM2B 4TX4A 4OK0A 5EEOA 5AYSC 1RN7A 1HKXA 1NDOB 5CXOA 3MG2A 3RGRA 3S29A 1QAKA 2IUJA 2CFWA 4EV5A 3NV0A 4L8OA 2JDIH 3DM8A 2XF3A 3G16A 3F7XA 3CCJ3 4HJLB 2XSHB 2K0MA 1O7WB 3V99A 2E2VA 3KFQC 4BTYA 4HM0B 3DGMA 1N5HA 1VQO3 3BNCA 3PS8A 2D42A 2XH9A 3BB9A 3ECFA 3DXOA 2XFSA 5IG5A 1OGZA 1M1XB 1EA2A 3DGNA 4X2OA 3G8ZA 5CF2A 1STDA 2CK3H 2WOFA 3K7CA 3EF8A 2W03A 2XGNA 2YX9A 3JUQA 6STDA 2E2UA 2IMJA 3PCSA 3N8BA 2CG0A 1C7HA 1A2KA 1FA3A 2B1XB 3EB8A 3WDGB 4WP5A 3U1WA 1LNHA 2ML6A 3CNMA 4RZMA 3GRDA 5AEUB 1SIHA 3F40A 3UL5A 3IJEB 2BNGA 2W9PA 5LC6A 3X3YA 1JB4A 3NX0A 4HVNA 2W56B 3JUPA 1KSIA 4OUQA 1Q824 1JRQA 3FLJA 3LZAA 3CC43 3STDA 3GZXB 1DMQA 3LTCA 4H61A 3EQQB 3HK4A 2P0XA 4XBTA 2BMOB 1W5ZA 3ROBA 1OGXA 1A2VA 3T8NA 1BUQA 5FGOA 3CCM3 3SOAA 4XM4A 3DMCA 3UB1A 1JKGA 3Q2PA 1OHSA 4N6UA 2PZVA 4FR9A 3GAXA 1STFI 4N6OB 2BT3A 4FCMA 2UX0A 4XBYA 3F14A 1UUVB 2RFRA 4MJDA 1ULJB 3DY5A 3BNEA 4LZIA 2HMMB 4KFEA 1Q864 3N9HA 4MMYB 2RCDA 5D82A 3VGNA 3LMLA 2BHMA 4MMZB 5KP3A 2PNCA 5AEWB 4EV2A 1UI7A 3WOEB 5FW5A 2CW9A 4BTWA 2GEXA 3FSDA 4Q53A 4IIAA 1RRLA 1VQ73 3B8LA 3HI7A 3OWYA 4NHFA 1N8R4 1TP6A 3PXMA 5IENA 1IV7A 3EN8A 1IQYA 1FGOA 3BNBA 1Q40B 1YJ93 3LTAA 1R4CA 1EQKA 3TDGA 1N9EA 2HMJB 3CCR3 4KFFA 3L0RA 4RBNA 3ER7A 2KXGA 1GY7A 2V1LA 1N8QA 3GZRA 3H51A 4IT7A 1LXEA 4FCJA 4HM6B 1WMOA 1DVDA 1VQP3 1JV2B 1SPUA 5IG3A 1K734 2BMRB 4ORLA 8CHOA 1K9M4 2FNQA 3H3HA 1OACA 3Q90A 3G713 2OWPA 3LT9A 3F8XA 2D1WA 1YGEA 4HM8B 1JJ22 4ZM8A 2GBXB 4N6MA 4K1VA 5ELUA 3U97A 4EXRA 2L4VA 3EJVA 5HGRA 2MF7A 4MMXB 3MWZA 1IQ8A 2KRTA 3GWRA 4JRFA 5EVHA 1DVCA 3E99A 2HMOB 2R4IA 1YI23 3V92A 1JB2A 1LVNA 2QEX3 4XBXA 5EQLA 2IA7A 4R80A 1W4NA 3RDEA 1VQL3 3GZYB 3NXJA 2BO9B 1QMAA 4HM7B 5ELJA 1W02A 1JN5A 5AIFA 3RGAA 1FGRA 1OHPA 3F7SA 4LSOA 2YFJB 1GD3A 2SBLA 3I553 1Q42A 5D81A 1HU9A 3FF2A 4K1UA 2W56A 5I97A 1ZX2A 1AV4A 3CNXA 1OH0A 1N5PA 1ROVA 2GEYA 1IK3A 5IG4A 3CC23 3T8UA 3UJMA 1YVBI 1K28A 4FMDA 4H3UA 5KP1A 1RRHA 3WODG 3IPTA 3LOYA 1G96A 4WYKB 3F8HA 3KSED 1PFPA 1NJI4 3VSYA 3D3LA 3X42A 2C11A 2E2TA 1D6UA 2W9QA 3JUMA 1Q814 2LYXA 3QRDA 3D9RA 2GU1A 4HBRA 5CK6A 1T5YA 3PGBA 4WHAA 3OV4A 3G4S3 4IPBA 1OF5B 4OVMA 3KKGA 1KQS2 2CG1A 1OUNA 4HM5B 1CYUA 3EN1B 3UL6A 3FGYA 2BMQB 2Z77A 1GY6A 1RKYA 1IVUA 3AMOB 2XSOB 3HZPA 3CCE3 2RGQA 3PZWA 3HIIA 3NQYA 2WGOA 1KWIA 3MSOA 5IEOA 1VQN3 2OCTA 3MPHA 3KN4A 1YJN3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TX4 A;  1A90 A;  1R4C A;  3SVA A;  1EQK A;  1RN7 A;  3L0R A;  2KXG A;  1A67 A;  1N9J A;  1MNL A;  4IT7 A;  1WNH A;  1LXE A;  1DVD A;  1ROA A;  3KFQ C;  1N5H A;  3PS8 A;  3PYJ A;  4ZM8 A;  4N6M A;  5ELU A;  1MOL A;  1GD4 A;  3MWZ A;  1DVC A;  1TIJ A;  4N6N B;  5LC7 A;  5EQL A;  1FUW A;  1FA3 A;  2BO9 B;  5ELJ A;  3UL5 A;  5LC6 A;  2W9P A;  3NX0 A;  1GD3 A;  1N5P A;  4N6L A;  3K9M C;  1CEW I;  1YVB I;  1G96 A;  5A0O B;  3KSE D;  1PFP A;  3Q2P A;  2O9U X;  4N6U A;  3GAX A;  1IV9 A;  1STF I;  4N6O B;  2W9Q A;  4EYC A;  4N6T A;  4N6V 0;  3QRD A;  4LZI A;  1NB5 I;  1CYV A;  4CCV A;  3LH4 A;  1NB3 I;  1CYU A;  3UL6 A;  3IMA B;  3S67 A;  1M9G A;  2CH9 A;  1KWI A;  2OCT A;  3PXM A;  1IV7 A; 
#chains in the Genus database with same CATH topology
 1EG9 B;  1WQL B;  1YIJ 3;  1F8N A;  4WWU C;  1OCV A;  3LTD A;  1BAN A;  3ZG5 A;  2CIU A;  1W00 A;  4MEI A;  1A67 A;  1TRQ A;  4GHO A;  4PEJ A;  4I4K A;  3G6E 3;  1N9J A;  1T2I A;  3CXC 2;  2CC3 A;  1NWW A;  1WMP A;  3OWU A;  1JBT A;  1W6G A;  3F9S A;  3V98 A;  1SII A;  3A76 A;  1ROA A;  5STD A;  3WMD A;  5M1A A;  4FMA A;  1CQS A;  1BSC A;  4HYZ A;  4R1K A;  4ILF A;  3Q1C A;  2F98 A;  5IG0 A;  4R9L A;  5BXQ A;  2QGU A;  3MG1 A;  2JQ5 A;  3MYT A;  1OHO A;  1QJG A;  3PYJ A;  4FCZ A;  1FGT A;  1R4Y A;  1O7P B;  4FMB A;  4BTX A;  3OXA A;  1E3V A;  2WOH A;  2XEP A;  3B7C A;  1JB5 A;  1MOL A;  4N3V A;  1DE3 A;  3QK9 A;  3D4A A;  1BGS A;  2OOV A;  1GD4 A;  3X41 A;  3CCV 3;  2INX A;  2P09 A;  4GB5 A;  4O8S A;  1W2Z A;  5G2G A;  4AKY A;  3CCU 3;  1VQ6 3;  1W01 A;  3T0U A;  4J9A A;  5M19 A;  1IQX A;  1TIJ A;  2BIR A;  4N6N B;  4HM1 B;  3HX8 A;  1RN1 A;  4HZB B;  5LC7 A;  1GS3 A;  1VQQ A;  3DGY A;  1FUW A;  1VZZ A;  2Y73 A;  3FH1 A;  4O2H A;  2ML5 A;  4U13 A;  1LOX A;  3D79 A;  2XFT A;  1W7C A;  1GSP A;  3I0Y A;  1BRI A;  1E97 A;  1GYB A;  1MWU A;  2C10 A;  1SAR A;  4JF8 A;  5IF6 A;  4HM3 B;  2WO0 A;  2OQE A;  9RNT A;  1GMQ A;  4EBG A;  3X40 A;  2A15 A;  3SLU A;  3SYU A;  3BU4 A;  4O3V A;  2YFL B;  4HZ9 B;  4K61 A;  1X1U A;  3K9M C;  2OOV C;  3I56 3;  4XDW A;  1B21 A;  3OWS A;  1CEW I;  1K8A 4;  3LYG A;  2W04 A;  1E3R A;  1SQW A;  2WGQ A;  5A0O B;  1BNS A;  3M8C A;  2Z6B A;  2Y74 A;  3SOY A;  1B27 A;  4L8P A;  3MKI A;  4GSP A;  4NRE A;  3MHE A;  2CWV A;  1ISK A;  1IV9 A;  1RLS A;  1VQK 3;  2CFG A;  1W6C A;  3NHX A;  1MWS A;  4AKZ A;  3EBT A;  1YHQ 3;  2P0M A;  3EX9 A;  2CFK A;  3PCR A;  2P05 A;  3SED A;  1O7N B;  1US1 A;  3FZW A;  3K0Z A;  3K5T A;  4N6V 0;  3FG1 A;  1PY3 A;  2W2C A;  4XB5 A;  2QA4 3;  1VQ4 3;  1B2M A;  1VQ9 3;  4STD A;  1ZGX A;  1V57 A;  1JNQ A;  1I2G A;  3KSP A;  1TFK A;  3EE1 A;  4QWT A;  5GSP A;  1L5G B;  3CD6 3;  1LOV A;  1TTO A;  5JPP A;  1UI8 A;  3NBR A;  4CCV A;  1YIT 3;  2OQE C;  1B2Z A;  1B3S A;  1BRH A;  2F5M A;  3LH4 A;  3D5I A;  1QVG 2;  1IVW A;  1GOY A;  4LYL B;  4LMI A;  3FG3 A;  1OF5 A;  4BIR A;  1HZ1 A;  1DYU A;  1V58 A;  1LQM B;  2K54 A;  2F4Y A;  2HMN B;  2RSX A;  1FYS A;  3IMA B;  3NBJ A;  4O02 B;  3S67 A;  3ALA A;  1U5O A;  1JZD A;  1NNV A;  1O7M B;  1UCI A;  2ZL8 A;  2CX1 A;  2CH9 A;  2H0I A;  2B24 B;  3AHW A;  4FMC A;  4L7K A;  2CKF B;  1LOW A;  3AMO A;  5DRV A;  1VQ8 3;  2CX0 A;  3CPO A;  3FCS B;  2GBW B;  5AI1 A;  1AQZ A;  2STD A;  3O8Y A;  2I9W A;  7STD A;  3X3Z A;  3EBY A;  1I8V A;  3DGL A;  1A90 A;  4K90 B;  1RGF A;  4R9K A;  3SVA A;  5IW9 A;  1AVL A;  1QVF 2;  5IER A;  1RGL A;  1BNJ A;  3NV0 B;  4XDV A;  3FG4 A;  2W6J H;  3G0K A;  5KP4 A;  5BIR A;  2GSP A;  3CME 3;  4BL2 A;  1YNV X;  4R4K A;  3NQZ A;  4KT3 B;  1YVS A;  2L1S A;  3JUN A;  1FZU A;  1MNL A;  1WNH A;  1ZO2 A;  3J7Y d;  5CLK A;  3OW2 2;  3DGO A;  1K41 A;  2XRX B;  5TGN A;  3BIR A;  2P38 A;  2MC8 A;  4EC6 A;  1NU3 A;  5CF1 A;  6RNT A;  1TUH A;  1O7G B;  1VQM 3;  1FGQ A;  1SJW A;  2IYJ A;  1JN5 B;  2ZDJ A;  5D83 A;  3SX1 A;  3JVC A;  1RCL A;  1DET A;  4CDL A;  1BSD A;  3DZL A;  3X3X A;  2W0Q A;  2H0G A;  1TU5 A;  1S5A A;  3LT8 A;  2CWT A;  2KCD A;  3NM7 A;  1YJW 3;  5BVB A;  1NO3 A;  5DRE A;  3CMA 3;  1GY5 A;  1DMN A;  2Q07 A;  1Q40 A;  3LTB A;  4J5G A;  5AII A;  1IT8 A;  3CCS 3;  2CFL A;  3CC7 3;  1UCL A;  1S72 3;  1RJO A;  4KFD A;  3WA2 X;  2XGL A;  1RGH A;  5M18 A;  1UUW B;  1O7H B;  1ULI B;  3KII A;  1B2X A;  1QAL A;  1VQ5 3;  3EHC A;  3DUK A;  4CPK A;  2GXF A;  3WOF B;  1V74 A;  1WMN A;  2O3O A;  1M90 4;  1Q7Y 4;  2OTL 3;  1ASK A;  1D6Z A;  1I0X A;  2XR8 B;  1QAF A;  3KZT A;  4J8T A;  5JBS A;  4LGQ A;  1PU4 A;  1D6Y A;  3BND A;  5AIG A;  1MGR A;  1B2S A;  2M7O A;  4HKV B;  3BLZ A;  3GZB A;  2YFI B;  1OPY A;  1WTH A;  1Z1S A;  5JPU A;  3HIG A;  1IVX A;  1AVK A;  3KE7 A;  3OX9 A;  4RNZ A;  2QIY A;  4CJN A;  1IT7 A;  2FXT A;  4N6L A;  3SXX A;  5AYR B;  2CWU A;  2CFD A;  1AR0 A;  2CHC A;  4WFO A;  4KVH A;  1RNB A;  1TFO A;  2F99 A;  1JKG B;  1KC8 4;  4G1M B;  3LXU X;  2OTJ 3;  1I2F A;  2Z7A A;  4J5K A;  2O9U X;  5AIH A;  3EC9 A;  2ZHX B;  2IUK A;  1EKM A;  3JUO A;  3MG3 A;  1I0V A;  4EYC A;  4N6T A;  1AY7 A;  3FF0 A;  1Y4K A;  1J2B A;  2HMK B;  1UGH I;  2FGT A;  1NB5 I;  1CYV A;  1TRP A;  3VF1 A;  3B4O A;  1FGM A;  3UNL A;  2IY2 A;  1RHL A;  3N54 B;  3NM2 A;  3CCQ 3;  1IVV A;  4RNY A;  3S5C A;  1BNF A;  1NB3 I;  3NUV A;  1BRN L;  1W2B 2;  5IEP A;  3K63 A;  4HM4 B;  2F56 A;  2LQV A;  1I70 A;  1M9G A;  4X2H A;  4AEQ A;  3S28 A;  2GU3 A;  1RMS A;  3NBB A;  3CCL 3;  2H0H A;  1IDP A;  3S27 A;  2F86 B;  1IU7 A;  1M1K 4;  4LEH A;  1U8C B;  2HML B;  4WYK A;  1DMM A;  1JZO A;  1W6Y A;  3AGO A;  3CPW 2;  1KD1 4;  3B4P A;  4GL6 A;  5G1L A;  1UW1 A;  4KZ1 A;  3WA3 A;  3FKA A;  3CU3 A;  2Z76 A;  4HM2 B;  4TX4 A;  4OK0 A;  2AAD A;  5EEO A;  5AYS C;  1RN7 A;  1HKX A;  1NDO B;  1T2H A;  3MG2 A;  5CXO A;  2C4B A;  3RGR A;  3S29 A;  1QAK A;  5HOH A;  2IUJ A;  2CFW A;  4EV5 A;  3NV0 A;  4L8O A;  1RN4 A;  3Q3F A;  1B20 A;  1PYL A;  4NPB A;  3URP A;  1RGE A;  2JDI H;  3DM8 A;  2XF3 A;  3G16 A;  3F7X A;  3CCJ 3;  1BRK A;  2XSH B;  4HJL B;  2K0M A;  1O7W B;  3V99 A;  2E2V A;  3KFQ C;  4BTY A;  4HM0 B;  1G0T A;  1RDS A;  3DGM A;  1UCK A;  1N5H A;  1VQO 3;  3BNC A;  3PS8 A;  2D42 A;  2XH9 A;  3BB9 A;  1GMP A;  3ECF A;  3DXO A;  2XFS A;  5IG5 A;  1BRG A;  1GOV A;  1OGZ A;  4DKI A;  2KF4 A;  1TJD A;  1M1X B;  1EA2 A;  3DGN A;  4X2O A;  3G8Z A;  5CF2 A;  4HAA A;  1STD A;  1X1Y A;  2CK3 H;  2WOF A;  4RNT A;  3K7C A;  3DH2 A;  3EF8 A;  2W03 A;  2XGN A;  2YX9 A;  3JUQ A;  1MWT A;  6STD A;  2E2U A;  2IMJ A;  2BU4 A;  3PCS A;  3N8B A;  1FW7 A;  1RCK A;  2CG0 A;  1C7H A;  1YGW A;  1A2K A;  1CH0 A;  2B1X B;  1FA3 A;  3EB8 A;  3WDG B;  1BVI A;  4WP5 A;  3U1W A;  5BU4 A;  1LNH A;  2ML6 A;  3CNM A;  4RZM A;  3GRD A;  1BNE A;  5AEU B;  1SIH A;  3F40 A;  1LNI A;  1BIR A;  3IJE B;  2BNG A;  2W9P A;  5LC6 A;  3UL5 A;  3X3Y A;  1ZS7 A;  1JB4 A;  1EEJ A;  1BU4 A;  2W56 B;  3NX0 A;  4HVN A;  3D5G A;  3WR2 A;  3JUP A;  1KSI A;  4OUQ A;  1Q82 4;  1UGI A;  1JRQ A;  3FLJ A;  3LZA A;  3CC4 3;  3STD A;  3GZX B;  1DMQ A;  3LTC A;  4H61 A;  5RNT A;  3EQQ B;  1I3F A;  3HK4 A;  2P0X A;  1RSN A;  4XBT A;  3ZFZ A;  2BMO B;  2F5W A;  1LRA A;  1W5Z A;  3ROB A;  1OGX A;  1A2V A;  3T8N A;  1GOU A;  1BUQ A;  5FGO A;  1I2E A;  3CCM 3;  3SOA A;  4XM4 A;  3DMC A;  3UB1 A;  1JKG A;  3Q2P A;  1OHS A;  4N6U A;  2PZV A;  4FR9 A;  3GAX A;  1STF I;  4N6O B;  1JBS A;  2BT3 A;  4FCM A;  1Q7H A;  1RNT A;  2UX0 A;  1HYF A;  3F14 A;  4XBY A;  1UUV B;  2RFR A;  4MJD A;  1ULJ B;  3DY5 A;  3BNE A;  4LZI A;  2HMM B;  4KFE A;  3GSP A;  1Q86 4;  3N9H A;  4MMY B;  2RCD A;  5D82 A;  3VGN A;  3LML A;  1B2U A;  4BU4 A;  2BHM A;  4BL3 A;  4MMZ B;  5KP3 A;  2PNC A;  2UGI A;  5AEW B;  4EV2 A;  1UI7 A;  2AAE A;  3KCH A;  1BAO A;  3WOE B;  5FW5 A;  1FUS A;  2CW9 A;  1UDI I;  4BTW A;  2GEX A;  3FSD A;  4Q53 A;  4IIA A;  2KAA A;  1RRL A;  2J8X B;  1VQ7 3;  3B8L A;  3HI7 A;  3OWY A;  4NHF A;  1N8R 4;  1TP6 A;  3PXM A;  5IEN A;  1IV7 A;  1EUI C;  2KF3 A;  3EN8 A;  1IQY A;  1BNG A;  1BNI A;  1FGO A;  3BNB A;  1IYY A;  1Q40 B;  1YJ9 3;  3LTA A;  1UUG B;  1R4C A;  1RTU A;  1EQK A;  3TDG A;  1N9E A;  2HMJ B;  3CCR 3;  4KFF A;  1BRJ A;  2RNT A;  3L0R A;  3ER7 A;  2KXG A;  4RBN A;  1GY7 A;  1BSA A;  2V1L A;  2RBI A;  1RGA A;  1N8Q A;  3AGN A;  3GZR A;  3H51 A;  4IT7 A;  1G02 A;  1LXE A;  4FCJ A;  4HM6 B;  1WMO A;  1DVD A;  1VQP 3;  1JV2 B;  1SPU A;  2R41 A;  5IG3 A;  1BUJ A;  1K73 4;  2BMR B;  4ORL A;  1BOX A;  8CHO A;  3ZG0 A;  1K9M 4;  2FNQ A;  2UUG C;  3H3H A;  1OAC A;  3Q90 A;  3G71 3;  2OWP A;  3LT9 A;  3F8X A;  2D1W A;  1YGE A;  1I3I A;  4HM8 B;  1JJ2 2;  3AHS A;  4ZM8 A;  2GBX B;  4N6M A;  4K1V A;  5ELU A;  3U97 A;  4EXR A;  2L4V A;  3EJV A;  5HGR A;  2MF7 A;  4MMX B;  3MWZ A;  1IQ8 A;  2KRT A;  3GWR A;  4JRF A;  5EVH A;  1DVC A;  3E99 A;  2HMO B;  2R4I A;  1YI2 3;  3V92 A;  1JB2 A;  1LVN A;  2QEX 3;  4XBX A;  1X1X A;  6GSP A;  5EQL A;  2IA7 A;  7GSP A;  4R80 A;  1W4N A;  3WHO A;  3RDE A;  1C54 A;  3HOH A;  1VQL 3;  3GZY B;  3NXJ A;  2BO9 B;  1QMA A;  4HM7 B;  5ELJ A;  1JBR A;  1W02 A;  1JN5 A;  5AIF A;  3RGA A;  2HOH A;  1FGR A;  2K3D A;  1OHP A;  3A5E A;  1Q9E A;  4HOH A;  3RNT A;  3F7S A;  4LSO A;  2YFJ B;  1GD3 A;  2SBL A;  2KF5 A;  3I55 3;  1Q42 A;  2KF6 A;  5D81 A;  1HU9 A;  1MWR A;  3FF2 A;  4K1U A;  2W56 A;  5I97 A;  1ZX2 A;  1AV4 A;  1RGC A;  3CNX A;  1RGK A;  1OH0 A;  1N5P A;  5G1K A;  1ROV A;  2GEY A;  1IK3 A;  5IG4 A;  3CC2 3;  3T8U A;  3UJM A;  1BNR A;  1YVB I;  1K28 A;  4FMD A;  4H3U A;  5KP1 A;  1RRH A;  3WOD G;  3IPT A;  3LOY A;  1G96 A;  4WYK B;  3F8H A;  3KSE D;  1PFP A;  1NJI 4;  1LOY A;  3VSY A;  3D3L A;  3X42 A;  2C11 A;  2E2T A;  1D6U A;  2W9Q A;  1MGW A;  1UCJ A;  3JUM A;  1RGG A;  1Q81 4;  1FUT A;  2LYX A;  3QRD A;  7RNT A;  3D9R A;  2GU1 A;  4HBR A;  5CK6 A;  1LQG C;  1T5Y A;  8RNT A;  3PGB A;  1BSE A;  4WHA A;  3OV4 A;  4EW5 A;  3G4S 3;  1X1W A;  4IPB A;  1OF5 B;  4OVM A;  1T3B A;  3KKG A;  1KQS 2;  2CG1 A;  1OUN A;  4HM5 B;  1CYU A;  3EN1 B;  3UL6 A;  3FGY A;  1A2P A;  2BMQ B;  2Z77 A;  1GY6 A;  4I5Q A;  1RKY A;  1IVU A;  3AMO B;  2XSO B;  3HZP A;  3CCE 3;  2RGQ A;  2ZA4 A;  3PZW A;  3HII A;  3NQY A;  1BRS A;  2WGO A;  1KWI A;  3MSO A;  5IEO A;  1VQN 3;  2OCT A;  3MPH A;  2SAR A;  1BSB A;  3KN4 A;  1YJN 3;  1GMR A; 
#chains in the Genus database with same CATH homology
 1EG9 B;  1WQL B;  1YIJ 3;  1F8N A;  4WWU C;  1OCV A;  3LTD A;  2CIU A;  1W00 A;  4MEI A;  1A67 A;  4PEJ A;  4I4K A;  3G6E 3;  1N9J A;  3CXC 2;  2CC3 A;  1NWW A;  1WMP A;  3OWU A;  1W6G A;  3F9S A;  3V98 A;  1SII A;  3A76 A;  1ROA A;  5STD A;  3WMD A;  4FMA A;  1CQS A;  4HYZ A;  4R1K A;  3Q1C A;  2F98 A;  5IG0 A;  4R9L A;  5BXQ A;  2QGU A;  3MG1 A;  2JQ5 A;  3MYT A;  1OHO A;  1QJG A;  3PYJ A;  4FCZ A;  1FGT A;  4FMB A;  1O7P B;  4BTX A;  3OXA A;  1E3V A;  2WOH A;  2XEP A;  3B7C A;  1JB5 A;  1MOL A;  4N3V A;  3QK9 A;  2OOV A;  1GD4 A;  3X41 A;  3CCV 3;  2INX A;  2P09 A;  4GB5 A;  4O8S A;  1W2Z A;  5G2G A;  4AKY A;  3CCU 3;  1VQ6 3;  1W01 A;  3T0U A;  4J9A A;  1IQX A;  1TIJ A;  4N6N B;  4HM1 B;  3HX8 A;  4HZB B;  5LC7 A;  1GS3 A;  1FUW A;  1VZZ A;  2Y73 A;  3FH1 A;  4O2H A;  2ML5 A;  4U13 A;  1LOX A;  2XFT A;  1W7C A;  3I0Y A;  1E97 A;  1GYB A;  2C10 A;  4JF8 A;  5IF6 A;  4HM3 B;  2WO0 A;  2OQE A;  4EBG A;  3X40 A;  2A15 A;  3SLU A;  4O3V A;  2YFL B;  4HZ9 B;  4K61 A;  3K9M C;  3I56 3;  2OOV C;  4XDW A;  3OWS A;  1K8A 4;  1CEW I;  3LYG A;  2W04 A;  1E3R A;  1SQW A;  2WGQ A;  5A0O B;  3M8C A;  2Z6B A;  2Y74 A;  3SOY A;  4L8P A;  3MKI A;  4NRE A;  3MHE A;  2CWV A;  1ISK A;  1IV9 A;  1VQK 3;  2CFG A;  1W6C A;  3NHX A;  1YHQ 3;  4AKZ A;  3EBT A;  2P0M A;  3EX9 A;  2CFK A;  3PCR A;  2P05 A;  3SED A;  1O7N B;  1US1 A;  3FZW A;  3K0Z A;  3K5T A;  4N6V 0;  3FG1 A;  4XB5 A;  2W2C A;  2QA4 3;  1VQ4 3;  1VQ9 3;  4STD A;  1JNQ A;  3KSP A;  4QWT A;  1TFK A;  3EE1 A;  1L5G B;  3CD6 3;  5JPP A;  1UI8 A;  3NBR A;  4CCV A;  1YIT 3;  2OQE C;  1QVG 2;  3LH4 A;  1IVW A;  4LMI A;  3FG3 A;  1OF5 A;  1DYU A;  2K54 A;  2RSX A;  2HMN B;  3IMA B;  3NBJ A;  3S67 A;  4O02 B;  3ALA A;  1U5O A;  3NBB A;  1O7M B;  4FMC A;  2ZL8 A;  2CH9 A;  4L7K A;  2B24 B;  5DRV A;  1VQ8 3;  2CKF B;  3AMO A;  3CPO A;  3FCS B;  2GBW B;  5AI1 A;  2STD A;  3O8Y A;  2I9W A;  7STD A;  3X3Z A;  3EBY A;  3DGL A;  1A90 A;  4K90 B;  4R9K A;  3SVA A;  5IW9 A;  1AVL A;  1QVF 2;  5IER A;  3NV0 B;  4XDV A;  3FG4 A;  2W6J H;  3G0K A;  5KP4 A;  3CME 3;  4R4K A;  3NQZ A;  3JUN A;  1MNL A;  3J7Y d;  1WNH A;  1ZO2 A;  5CLK A;  3OW2 2;  3DGO A;  1K41 A;  2XRX B;  5TGN A;  4EC6 A;  2P38 A;  2MC8 A;  5CF1 A;  1NU3 A;  1TUH A;  1O7G B;  1VQM 3;  1FGQ A;  1SJW A;  1JN5 B;  2ZDJ A;  5D83 A;  3SX1 A;  3JVC A;  4CDL A;  3DZL A;  3X3X A;  2W0Q A;  1TU5 A;  1S5A A;  3LT8 A;  2CWT A;  2KCD A;  3NM7 A;  1YJW 3;  5BVB A;  1NO3 A;  5DRE A;  3CMA 3;  1GY5 A;  1DMN A;  2Q07 A;  1Q40 A;  3LTB A;  5AII A;  1IT8 A;  3CCS 3;  2CFL A;  3CC7 3;  1S72 3;  1RJO A;  4KFD A;  3WA2 X;  2XGL A;  1UUW B;  1O7H B;  1ULI B;  3KII A;  1QAL A;  1VQ5 3;  3EHC A;  3DUK A;  2GXF A;  3WOF B;  1V74 A;  1WMN A;  2O3O A;  1M90 4;  1Q7Y 4;  2OTL 3;  1ASK A;  1D6Z A;  2XR8 B;  1QAF A;  3KZT A;  4J8T A;  5JBS A;  4LGQ A;  1PU4 A;  1D6Y A;  3BND A;  5AIG A;  2M7O A;  4HKV B;  3BLZ A;  3GZB A;  2YFI B;  1OPY A;  1WTH A;  1Z1S A;  5JPU A;  3HIG A;  1IVX A;  1AVK A;  3KE7 A;  3OX9 A;  4RNZ A;  2QIY A;  1IT7 A;  2FXT A;  4N6L A;  3SXX A;  5AYR B;  2CWU A;  2CFD A;  1AR0 A;  2CHC A;  4WFO A;  4KVH A;  1TFO A;  2F99 A;  1JKG B;  1KC8 4;  4G1M B;  3LXU X;  2OTJ 3;  2Z7A A;  5AIH A;  2O9U X;  3EC9 A;  2IUK A;  1EKM A;  3JUO A;  3MG3 A;  4EYC A;  4N6T A;  3FF0 A;  1Y4K A;  1J2B A;  2HMK B;  2FGT A;  1NB5 I;  1CYV A;  3VF1 A;  3B4O A;  1FGM A;  3UNL A;  3N54 B;  3NM2 A;  3CCQ 3;  1IVV A;  4RNY A;  3S5C A;  1NB3 I;  3NUV A;  1W2B 2;  5IEP A;  3K63 A;  4HM4 B;  2LQV A;  1M9G A;  4X2H A;  4AEQ A;  3S28 A;  2GU3 A;  3CCL 3;  1IDP A;  3S27 A;  2F86 B;  1IU7 A;  1M1K 4;  4LEH A;  1U8C B;  2HML B;  4WYK A;  1DMM A;  1W6Y A;  3CPW 2;  1KD1 4;  3B4P A;  4GL6 A;  1UW1 A;  4KZ1 A;  3WA3 A;  3FKA A;  3CU3 A;  2Z76 A;  4HM2 B;  4TX4 A;  4OK0 A;  5EEO A;  5AYS C;  1RN7 A;  1HKX A;  1NDO B;  5CXO A;  3MG2 A;  3RGR A;  3S29 A;  1QAK A;  2IUJ A;  2CFW A;  4EV5 A;  3NV0 A;  4L8O A;  2JDI H;  3DM8 A;  2XF3 A;  3G16 A;  3F7X A;  3CCJ 3;  4HJL B;  2XSH B;  2K0M A;  1O7W B;  3V99 A;  2E2V A;  3KFQ C;  4BTY A;  4HM0 B;  3DGM A;  1N5H A;  1VQO 3;  3BNC A;  3PS8 A;  2D42 A;  2XH9 A;  3BB9 A;  3ECF A;  3DXO A;  2XFS A;  5IG5 A;  1OGZ A;  1M1X B;  1EA2 A;  3DGN A;  4X2O A;  3G8Z A;  5CF2 A;  1STD A;  2CK3 H;  2WOF A;  3K7C A;  3EF8 A;  2W03 A;  2XGN A;  2YX9 A;  3JUQ A;  6STD A;  2E2U A;  2IMJ A;  3PCS A;  3N8B A;  2CG0 A;  1C7H A;  1A2K A;  1FA3 A;  2B1X B;  3EB8 A;  3WDG B;  4WP5 A;  3U1W A;  1LNH A;  2ML6 A;  3CNM A;  4RZM A;  3GRD A;  5AEU B;  1SIH A;  3F40 A;  3UL5 A;  3IJE B;  2BNG A;  2W9P A;  5LC6 A;  3X3Y A;  1JB4 A;  3NX0 A;  4HVN A;  2W56 B;  3JUP A;  1KSI A;  4OUQ A;  1Q82 4;  1JRQ A;  3FLJ A;  3LZA A;  3CC4 3;  3STD A;  3GZX B;  1DMQ A;  3LTC A;  4H61 A;  3EQQ B;  3HK4 A;  2P0X A;  4XBT A;  2BMO B;  1W5Z A;  3ROB A;  1OGX A;  1A2V A;  3T8N A;  1BUQ A;  5FGO A;  3CCM 3;  3SOA A;  4XM4 A;  3DMC A;  3UB1 A;  1JKG A;  3Q2P A;  1OHS A;  4N6U A;  2PZV A;  4FR9 A;  3GAX A;  1STF I;  4N6O B;  2BT3 A;  4FCM A;  2UX0 A;  4XBY A;  3F14 A;  1UUV B;  2RFR A;  4MJD A;  1ULJ B;  3DY5 A;  3BNE A;  4LZI A;  2HMM B;  4KFE A;  1Q86 4;  3N9H A;  4MMY B;  2RCD A;  5D82 A;  3VGN A;  3LML A;  2BHM A;  4MMZ B;  5KP3 A;  2PNC A;  5AEW B;  4EV2 A;  1UI7 A;  3WOE B;  5FW5 A;  2CW9 A;  4BTW A;  2GEX A;  3FSD A;  4Q53 A;  4IIA A;  1RRL A;  1VQ7 3;  3B8L A;  3HI7 A;  3OWY A;  4NHF A;  1N8R 4;  1TP6 A;  3PXM A;  5IEN A;  1IV7 A;  3EN8 A;  1IQY A;  1FGO A;  3BNB A;  1Q40 B;  1YJ9 3;  3LTA A;  1R4C A;  1EQK A;  3TDG A;  1N9E A;  2HMJ B;  3CCR 3;  4KFF A;  3L0R A;  4RBN A;  3ER7 A;  2KXG A;  1GY7 A;  2V1L A;  1N8Q A;  3GZR A;  3H51 A;  4IT7 A;  1LXE A;  4FCJ A;  4HM6 B;  1WMO A;  1DVD A;  1VQP 3;  1JV2 B;  1SPU A;  5IG3 A;  1K73 4;  2BMR B;  4ORL A;  8CHO A;  1K9M 4;  2FNQ A;  3H3H A;  1OAC A;  3Q90 A;  3G71 3;  2OWP A;  3LT9 A;  3F8X A;  2D1W A;  1YGE A;  4HM8 B;  1JJ2 2;  4ZM8 A;  2GBX B;  4N6M A;  4K1V A;  5ELU A;  3U97 A;  4EXR A;  2L4V A;  3EJV A;  5HGR A;  2MF7 A;  4MMX B;  3MWZ A;  1IQ8 A;  2KRT A;  3GWR A;  4JRF A;  5EVH A;  1DVC A;  3E99 A;  2HMO B;  2R4I A;  1YI2 3;  3V92 A;  1JB2 A;  1LVN A;  2QEX 3;  4XBX A;  5EQL A;  2IA7 A;  4R80 A;  1W4N A;  3RDE A;  1VQL 3;  3GZY B;  3NXJ A;  2BO9 B;  1QMA A;  4HM7 B;  5ELJ A;  1W02 A;  1JN5 A;  5AIF A;  3RGA A;  1FGR A;  1OHP A;  3F7S A;  4LSO A;  2YFJ B;  1GD3 A;  2SBL A;  3I55 3;  1Q42 A;  5D81 A;  1HU9 A;  3FF2 A;  4K1U A;  2W56 A;  5I97 A;  1ZX2 A;  1AV4 A;  3CNX A;  1OH0 A;  1N5P A;  1ROV A;  2GEY A;  1IK3 A;  5IG4 A;  3CC2 3;  3T8U A;  3UJM A;  1YVB I;  1K28 A;  4FMD A;  4H3U A;  5KP1 A;  1RRH A;  3WOD G;  3IPT A;  3LOY A;  1G96 A;  4WYK B;  3F8H A;  3KSE D;  1PFP A;  1NJI 4;  3VSY A;  3D3L A;  3X42 A;  2C11 A;  2E2T A;  1D6U A;  2W9Q A;  3JUM A;  1Q81 4;  2LYX A;  3QRD A;  3D9R A;  2GU1 A;  4HBR A;  5CK6 A;  1T5Y A;  3PGB A;  4WHA A;  3OV4 A;  3G4S 3;  4IPB A;  1OF5 B;  4OVM A;  3KKG A;  1KQS 2;  2CG1 A;  1OUN A;  4HM5 B;  1CYU A;  3EN1 B;  3UL6 A;  3FGY A;  2BMQ B;  2Z77 A;  1GY6 A;  1RKY A;  1IVU A;  3AMO B;  2XSO B;  3HZP A;  3CCE 3;  2RGQ A;  3PZW A;  3HII A;  3NQY A;  2WGO A;  1KWI A;  3MSO A;  5IEO A;  1VQN 3;  2OCT A;  3MPH A;  3KN4 A;  1YJN 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...