4N6OB

Crystal structure of reduced legumain in complex with cystatin e/m
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
GELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords legumain
publication title Structure and mechanism of an aspartimide-dependent Peptide ligase in human legumain.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6oB00
1DVCA 3S67A 3KFQC 1TIJA 1ROAA 1LXEA 1EQKA 2KXGA 1A67A 3UL6A 1YVBI 1PFPA 3Q2PA 5LC6A 3PYJA 4EYCA 3KSED 4IT7A 1CEWI 3SVAA 5ELUA 5ELJA 3PXMA 1KWIA 4LZIA 4N6V0 3PS8A 3NX0A 1IV7A 1FUWA 4TX4A 1N9JA 2W9QA 4N6NB 5LC7A 1N5HA 1FA3A 3MWZA 1WNHA 2BO9B 2O9UX 1R4CA 1A90A 1N5PA 5EQLA 4N6OB 1IV9A 1MNLA 3L0RA 5A0OB 4N6UA 1NB3I 4N6MA 4N6TA 3K9MC 3IMAB 1RN7A 4ZM8A 3GAXA 1STFI 1NB5I 1GD3A 1M9GA 2CH9A 1CYUA 1MOLA 1G96A 1DVDA 2OCTA 1GD4A 4CCVA 2W9PA 1CYVA 3QRDA 4N6LA 3LH4A 3UL5A
chains in the Genus database with same CATH superfamily
2FNQA 2RGQA 4R9LA 3ECFA 1S5AA 4K1VA 4RNTA 1GMRA 1RGAA 2F98A 3ZFZA 1KD14 1I2GA 2L4VA 2CHCA 3CPW2 5EVHA 1R4YA 2R4IA 3Q3FA 3LT8A 1RGEA 3VGNA 3GZXB 4O2HA 1EKMA 2L1SA 1HKXA 1M1K4 2UUGC 4LMIA 3BNCA 1JB2A 4CPKA 1X1UA 4EXRA 1O7WB 1UGIA 2STDA 3RGAA 3V98A 1A67A 2KF5A 3K63A 1BRHA 3BLZA 1RGHA 1Y4KA 1PFPA 3MPHA 4IPBA 3LYGA 1OF5B 1TU5A 1M1XB 4EYCA 4KZ1A 5DREA 3BNBA 4IT7A 1I0VA 2GBWB 4FR9A 3X3ZA 1GS3A 1JJ22 2UX0A 1IQYA 4R80A 1A2PA 1OH0A 2BMRB 4EV5A 1IYYA 1WQLB 5KP3A 1IVWA 4U13A 1UCLA 2CKFB 3PZWA 3X42A 4KFFA 4LEHA 1BUJA 1YVSA 3WHOA 4EW5A 3NX0A 1IV7A 1FUWA 1JBTA 1BRNL 3S27A 5AEWB 1FYSA 2GSPA 2W2CA 4XDWA 3HIGA 3K5TA 1Q864 1JB5A 2GXFA 3AMOA 5CF2A 3OWUA 6RNTA 4N6NB 1BNGA 5D83A 3KCHA 3G6E3 1OHSA 3Q90A 1QJGA 1VQP3 1UW1A 3NBRA 3WMDA 1QAKA 3WDGB 1EEJA 1ULJB 1VQ53 1UCKA 3D3LA 2GEYA 1B2ZA 2V1LA 1WMOA 4HYZA 1B2SA 3MG1A 4BL3A 1FGMA 4OK0A 3EHCA 1AVLA 2MC8A 1IV9A 3HIIA 1MNLA 1KQS2 1UCJA 1RGGA 1W01A 3KSPA 3T8UA 1QALA 3GRDA 4XDVA 2BMQB 3GZBA 1EA2A 3KN4A 1AY7A 4J9AA 2RCDA 1OHPA 3E99A 1X1XA 4FCZA 3NUVA 2HMJB 3N54B 3CCS3 2C10A 3NM7A 2CX0A 1WMPA 3MYTA 4HM0B 3STDA 3SX1A 4XBXA 3CCE3 1W5ZA 4KT3B 1BIRA 3MHEA 3Q1CA 2IY2A 3EN8A 1JV2B 1BSBA 3LMLA 1RTUA 3FG4A 1DETA 1N8QA 2KF4A 1ZX2A 2BMOB 2XFSA 1I0XA 3T0UA 1UUWB 1AVKA 3CPOA 3IPTA 4L8PA 2D1WA 1NB5I 3JUNA 1VQ43 3OX9A 1YJ93 5KP4A 5BXQA 2YFLB 1W6CA 5IG4A 1RN4A 1GD4A 4CCVA 3CME3 5IEOA 3CCV3 3V92A 3SXXA 4GB5A 2Z6BA 3T8NA 1VQK3 1JB4A 1DVCA 4NPBA 1RGCA 1D6ZA 3DMCA 1NWWA 1BNFA 5I97A 5IF6A 3ZG0A 2IUKA 1W4NA 1TTOA 1SIHA 2C11A 4HVNA 1LXEA 4WP5A 4HM6B 2E2UA 3KIIA 1W6YA 4HM3B 2P0XA 3FCSB 1RDSA 2KXGA 1FZUA 3KZTA 4WFOA 2IMJA 3LTBA 1X1WA 3UL6A 1UDII 6STDA 2OTJ3 1BOXA 1JKGA 4JRFA 5BIRA 1NNVA 3JVCA 4OVMA 1OHOA 2Q07A 1AQZA 1N9EA 1IQ8A 1VQ93 3H51A 3PYJA 1J2BA 3LTDA 1GY6A 1BGSA 3SVAA 2B24B 1U5OA 5ELUA 2HMLB 3RNTA 5AIIA 1O7MB 3OWYA 1W02A 3B8LA 3CXC2 1M904 1AV4A 2A15A 4CDLA 3DXOA 4BU4A 1OCVA 1KWIA 3EC9A 3DH2A 3BU4A 3UJMA 1FUTA 1T2IA 3MKIA 1I2EA 4G1MB 4GHOA 1N9JA 3EF8A 4MMXB 1I2FA 5JPUA 1RRLA 1FUSA 1JBSA 1W7CA 2JDIH 1D6YA 3F8XA 1K8A4 2W9QA 1VQM3 1B21A 4FCMA 2CWUA 1DMQA 3AMOB 1ZGXA 3K0ZA 1OGZA 2XRXB 2XGLA 5AEUB 1SPUA 1RJOA 2CFLA 1YNVX 3LTAA 3NV0A 3RDEA 3A76A 1Q814 1FA3A 4BIRA 1RMSA 2BO9B 2Z76A 1B27A 3RGRA 1PYLA 1T3BA 1DYUA 4HM8B 1Q42A 2F5WA 1FGQA 1E3RA 1VQ63 3FLJA 3ZG5A 4KVHA 1K28A 2WGQA 3CNXA 3F7SA 3N8BA 4WHAA 3ROBA 3CC73 5A0OB 2XF3A 4HM7B 4LSOA 1YJN3 3FSDA 3EJVA 3U97A 3F9SA 5D82A 2XEPA 1K734 4J5GA 1WMNA 3S28A 2CWVA 1E97A 2KCDA 4N6TA 3WOEB 2FGTA 4RZMA 2P0MA 3DUKA 1HZ1A 1G0TA 3J7Yd 1SQWA 3IMAB 1Q40A 8RNTA 2LQVA 1NO3A 3F8HA 2OOVC 1STFI 1UGHI 2IA7A 2OQEC 1A2VA 4EBGA 1W00A 3WA2X 2CX1A 4RNZA 3SOYA 1VQL3 1JZDA 2K54A 3I563 3MSOA 4R1KA 3URPA 1EUIC 2E2VA 3F40A 3OV4A 3U1WA 5M1AA 1G02A 1TFKA 2CFWA 4HZBB 4ILFA 5AIHA 2Y74A 3NXJA 2BHMA 2CH9A 2J8XB 1O7GB 1RHLA 4FCJA 1T5YA 4HAAA 5KP1A 2CWTA 4PEJA 2AAEA 3DGOA 1OF5A 1BRIA 2BIRA 5G1KA 1BRKA 1QVG2 1CYVA 5JPPA 4ORLA 3G4S3 5G2GA 3LT9A 1MGWA 3QRDA 2WO0A 2YFIB 3FZWA 3SLUA 1UCIA 1F8NA 3UL5A 4N3VA 3DGNA 1LQGC 1S723 5JBSA 4MMZB 3NHXA 4K1UA 3CC43 2QA43 1Q9EA 1B2XA 1BRGA 1RRHA 3LZAA 1CQSA 1BANA 4H61A 1VQ73 4X2OA 1TIJA 1UI8A 2W0QA 1FW7A 4X2HA 1QMAA 1RCLA 2HMOB 3G0KA 2ZL8A 3V99A 5AIGA 4EC6A 3SEDA 1MWRA 1IVUA 1YVBI 2W03A 3D79A 1JKGB 1K41A 1NDOB 3Q2PA 5GSPA 3G8ZA 2C4BA 2ZDJA 5LC6A 1TRPA 1AR0A 3BIRA 1CEWI 2YX9A 3CD63 1YIJ3 5BU4A 2OWPA 1IVVA 2HMNB 3ER7A 5AI1A 5ELJA 1Q824 2CIUA 4RNYA 1GMQA 1YGEA 5IEPA 3B7CA 1RCKA 1I3IA 1MGRA 2GBXB 1MWTA 3PXMA 4FMBA 1NU3A 3NQYA 4R4KA 4O3VA 1LNHA 5FGOA 1IT7A 2UGIA 4H3UA 4R9KA 3CCM3 1JN5A 1LRAA 3NQZA 4WYKA 1SARA 5CXOA 3FF2A 1ZO2A 1FGTA 3FG3A 2IYJA 4HM4B 5IG3A 2CC3A 6GSPA 3HI7A 2PNCA 3D4AA 4JF8A 1MWUA 3A5EA 5LC7A 1YIT3 1B2UA 1SJWA 1E3VA 4O02B 3LTCA 2D42A 3MWZA 1WNHA 3CCJ3 1VQN3 5TGNA 2O9UX 4FMDA 2RBIA 1US1A 2QEX3 1R4CA 3CMA3 5EQLA 5G1LA 1IQXA 4MMYB 1GOUA 4N6OB 4L7KA 3ALAA 2K3DA 1RSNA 2Z77A 2P05A 3B4PA 2OQEA 1RNBA 1BNRA 1B20A 1LNIA 2INXA 2W56A 4AKZA 4CJNA 1W6GA 1I70A 3KKGA 3CCL3 4RBNA 1BAOA 1L5GB 1K9M4 4J5KA 4WWUC 1I3FA 1LOXA 4N6UA 5CK6A 3FH1A 3HZPA 1NB3I 2I9WA 5DRVA 3MG2A 5CF1A 4K90B 3X3XA 1VQO3 1KSIA 4XBYA 5AIFA 4N6MA 3WOFB 4HOHA 9RNTA 3K9MC 1B3SA 4HM5B 4NREA 1TJDA 3CNMA 4DKIA 1IU7A 2CFGA 1JBRA 3GAXA 8CHOA 1RGFA 1Q40B 3B4OA 4AEQA 2BT3A 5BVBA 1BNSA 5IG5A 5IW9A 5RNTA 2H0HA 4GL6A 1VQQA 4HJLB 4L8OA 4OUQA 4BTXA 2WOFA 1IT8A 3TDGA 3EQQB 3HX8A 1GD3A 2GU3A 3D5IA 1B2MA 1RNTA 3DZLA 1JZOA 1ULIB 1A2KA 2W6JH 1W2B2 2RNTA 3N9HA 2MF7A 2OCTA 3VSYA 1YHQ3 2RSXA 3VF1A 4HZ9B 5AYSC 4LYLB 1LOVA 2SARA 1MWSA 3CU3A 3WODG 3EE1A 4XB5A 3BB9A 3OWSA 3WR2A 7GSPA 3LH4A 4Q53A 2SBLA 2F86B 4KFEA 5IERA 1ISKA 1IVXA 1PU4A 2HMMB 3FG1A 4GSPA 1TP6A 1BRSA 4HBRA 3S67A 5IENA 2H0IA 3KFQC 3OXAA 2F4YA 1C54A 1JNQA 4HM1B 1ROAA 4IIAA 1UI7A 3AGNA 1U8CB 4BL2A 3GSPA 2QGUA 1STDA 1RGKA 3JUMA 1WTHA 1SIIA 2QIYA 4O8SA 4STDA 2KAAA 1EQKA 4BTYA 1HU9A 2JQ5A 1Q7HA 3HK4A 1IDPA 3PGBA 5M18A 5IG0A 4HM2B 1PY3A 2CFDA 3AHWA 4MEIA 1CH0A 3G713 3KE7A 1OACA 1O7HB 5FW5A 3EN1B 3M8CA 2GEXA 2KF6A 2XH9A 3G16A 2FXTA 3AHSA 3KSED 5HOHA 1ZS7A 1O7PB 3FGYA 1RKYA 2OTL3 3H3HA 3QK9A 3IJEB 2KRTA 3NM2A 3EBYA 1OUNA 2H0GA 1ASKA 3LXUX 1I8VA 3DGLA 1ROVA 1LOYA 1D6UA 2LYXA 3MG3A 4LZIA 3BNEA 1YI23 1OPYA 4N6V0 1FGRA 3PS8A 3D5GA 3HOHA 4HKVB 2GU1A 1BNEA 1HYFA 3SOAA 4TX4A 1GY5A 3BNDA 1BNIA 1JN5B 1LVNA 1RGLA 1TUHA 4NHFA 4QWTA 4WYKB 2IUJA 1N8R4 3NBBA 1V74A 3X3YA 2XSHB 2P09A 2AADA 2WGOA 3CCQ3 2CG0A 2XFTA 4AKYA 1RN1A 4XM4A 1VZZA 3UB1A 4FMAA 1N5HA 1UUVB 2F5MA 3I0YA 3DY5A 7RNTA 1GYBA 3S5CA 4MJDA 1VQ83 3PCRA 3FF0A 1BSDA 2B1XB 1A90A 1QVF2 1N5PA 3DM8A 3JUQA 4EV2A 1Q7Y4 1GMPA 3CCU3 2XSOB 3EX9A 1KC84 1GSPA 3S29A 2CW9A 3I553 1TFOA 3L0RA 4KFDA 1BSEA 2HOHA 2XR8B 2F99A 5AYRB 3NBJA 3F14A 5EEOA 1BNJA 3F7XA 1BUQA 1EG9B 2W56B 5HGRA 1GOVA 2CG1A 2RFRA 1GY7A 2F56A 3WA3A 1BVIA 4XBTA 5D81A 4BTWA 5STDA 1NJI4 1V58A 2ML5A 1LOWA 1RLSA 2BNGA 1T2HA 1YGWA 1GOYA 3D9RA 3K7CA 3JUPA 1IK3A 2KF3A 1RN7A 1JRQA 2CK3H 2P38A 4FMCA 3O8YA 1DMMA 4ZM8A 1C7HA 3GWRA 1X1YA 5CLKA 3NV0B 3X40A 5M19A 1QAFA 2PZVA 1TRQA 3EB8A 3CCR3 2BU4A 1OGXA 1LQMB 1W2ZA 2YFJB 2ML6A 3JUOA 2R41A 3PCSA 2Z7AA 3UNLA 1Z1SA 2WOHA 3DGYA 4J8TA 4K61A 3X41A 3FKAA 2CFKA 2OOVA 1V57A 2ZA4A 2O3OA 1BRJA 1M9GA 1YJW3 1BU4A 1DMNA 3DGMA 1DE3A 3AGOA 2E2TA 1CYUA 1MOLA 4I4KA 2K0MA 1G96A 1O7NB 1DVDA 1FGOA 3SYUA 4LGQA 3LOYA 3GZYB 1UUGB 7STDA 3GZRA 2W9PA 1BSAA 2XGNA 2W04A 2Y73A 2ZHXB 3OW22 4N6LA 2M7OA 3EBTA 4I5QA 3CC23 1BSCA 2HMKB
chains in the Genus database with same CATH topology
2FNQA 2RGQA 4R9LA 3ECFA 1S5AA 4K1VA 1KD14 2F98A 2L4VA 2CHCA 3CPW2 5EVHA 2R4IA 3LT8A 3GZXB 4O2HA 1EKMA 1M1K4 1HKXA 4LMIA 3BNCA 1JB2A 4EXRA 1O7WB 2STDA 3V98A 3RGAA 1A67A 3K63A 3BLZA 1Y4KA 1PFPA 3MPHA 4IPBA 3LYGA 1OF5B 1TU5A 1M1XB 4EYCA 4KZ1A 5DREA 3BNBA 4IT7A 2GBWB 4FR9A 3X3ZA 1GS3A 1JJ22 2UX0A 1IQYA 4R80A 1OH0A 2BMRB 4EV5A 1WQLB 5KP3A 1IVWA 4U13A 2CKFB 3PZWA 3X42A 4KFFA 4LEHA 3NX0A 1IV7A 1FUWA 3S27A 5AEWB 4XDWA 2W2CA 3HIGA 3K5TA 1Q864 1JB5A 2GXFA 3AMOA 5CF2A 3OWUA 4N6NB 5D83A 3G6E3 1OHSA 3Q90A 1QJGA 1VQP3 1UW1A 3NBRA 3WMDA 1QAKA 3WDGB 1ULJB 1VQ53 3D3LA 2GEYA 2V1LA 1WMOA 4HYZA 3MG1A 1FGMA 4OK0A 3EHCA 1AVLA 2MC8A 1IV9A 3HIIA 1MNLA 1KQS2 1W01A 3KSPA 3T8UA 1QALA 3GRDA 4XDVA 2BMQB 3GZBA 1EA2A 3KN4A 4J9AA 2RCDA 1OHPA 3E99A 4FCZA 3NUVA 2HMJB 3N54B 3CCS3 2C10A 3NM7A 3CCE3 1WMPA 3MYTA 4HM0B 3STDA 3SX1A 4XBXA 1W5ZA 3MHEA 3Q1CA 3EN8A 1JV2B 3LMLA 3FG4A 1N8QA 1ZX2A 2BMOB 2XFSA 3T0UA 1UUWB 1AVKA 3CPOA 3IPTA 4L8PA 2D1WA 1NB5I 3JUNA 1VQ43 3OX9A 1YJ93 5KP4A 5BXQA 2YFLB 1W6CA 5IG4A 1GD4A 4CCVA 3CME3 5IEOA 3CCV3 3V92A 3SXXA 4GB5A 2Z6BA 3T8NA 1VQK3 1JB4A 1DVCA 1D6ZA 3DMCA 1NWWA 5I97A 5IF6A 2IUKA 1W4NA 1SIHA 2C11A 4HVNA 1LXEA 4WP5A 4HM6B 2E2UA 3KIIA 1W6YA 4HM3B 2P0XA 3FCSB 2KXGA 3KZTA 4WFOA 2IMJA 3LTBA 3UL6A 6STDA 4JRFA 1JKGA 3JVCA 4OVMA 1OHOA 2Q07A 1N9EA 1IQ8A 1VQ93 3H51A 3PYJA 1J2BA 3LTDA 1GY6A 3SVAA 2B24B 1U5OA 5ELUA 2HMLB 5AIIA 1O7MB 3OWYA 1W02A 3B8LA 3CXC2 1M904 1AV4A 2A15A 4CDLA 3DXOA 1OCVA 1KWIA 3EC9A 3UJMA 3MKIA 4G1MB 1N9JA 3EF8A 4MMXB 5JPUA 1RRLA 1W7CA 2JDIH 1D6YA 3F8XA 1K8A4 2W9QA 1VQM3 4FCMA 2CWUA 1DMQA 3AMOB 5AEUB 3K0ZA 2XRXB 1OGZA 2XGLA 1SPUA 1RJOA 2CFLA 3LTAA 1Q814 3NV0A 3RDEA 3A76A 1FA3A 2BO9B 2Z76A 3RGRA 1DYUA 4HM8B 1Q42A 1FGQA 1E3RA 1VQ63 3FLJA 4KVHA 1K28A 2WGQA 3CNXA 3F7SA 3N8BA 4WHAA 3ROBA 3CC73 5A0OB 2XF3A 4HM7B 4LSOA 1YJN3 3FSDA 3EJVA 3U97A 3F9SA 5D82A 2XEPA 1K734 1WMNA 3S28A 2CWVA 1E97A 2KCDA 4N6TA 3WOEB 2FGTA 4RZMA 2P0MA 3DUKA 3J7Yd 1SQWA 3IMAB 1Q40A 2LQVA 1NO3A 3F8HA 2OOVC 1STFI 2IA7A 4EBGA 2OQEC 1A2VA 1VQL3 1W00A 3WA2X 4RNZA 3SOYA 2K54A 3I563 3MSOA 4R1KA 2E2VA 3F40A 3OV4A 3U1WA 3CC23 1TFKA 2CFWA 4HZBB 5AIHA 2Y74A 3NXJA 2BHMA 2CH9A 1O7GB 4FCJA 1T5YA 5KP1A 2CWTA 4PEJA 3DGOA 1OF5A 1QVG2 1CYVA 5JPPA 4ORLA 3G4S3 5G2GA 3LT9A 3QRDA 2WO0A 2YFIB 3FZWA 3SLUA 1F8NA 3UL5A 4N3VA 3DGNA 1S723 5JBSA 4MMZB 3NHXA 4K1UA 3CC43 2QA43 3LZAA 1RRHA 1CQSA 4H61A 1VQ73 4X2OA 1TIJA 1UI8A 2W0QA 4X2HA 1QMAA 2HMOB 3G0KA 2ZL8A 3V99A 5AIGA 4EC6A 3SEDA 1IVUA 1YVBI 2W03A 1JKGB 1K41A 1NDOB 3Q2PA 3G8ZA 2ZDJA 5LC6A 1AR0A 1CEWI 2YX9A 3CD63 1YIJ3 2OWPA 1IVVA 2HMNB 3ER7A 5AI1A 5ELJA 1Q824 2CIUA 4RNYA 1YGEA 5IEPA 3B7CA 2GBXB 3PXMA 4FMBA 1NU3A 3NQYA 4R4KA 4O3VA 1LNHA 5FGOA 1IT7A 4R9KA 4H3UA 3CCM3 1JN5A 3NQZA 4WYKA 5CXOA 3FF2A 1ZO2A 1FGTA 3FG3A 4HM4B 5IG3A 2CC3A 3HI7A 2PNCA 4JF8A 5LC7A 1YIT3 1SJWA 1E3VA 4O02B 3LTCA 2D42A 3MWZA 1WNHA 3CCJ3 1VQN3 5TGNA 2O9UX 4FMDA 1US1A 2QEX3 1R4CA 3CMA3 5EQLA 1IQXA 4MMYB 4N6OB 4L7KA 3ALAA 2Z77A 2P05A 3B4PA 2OQEA 2INXA 2W56A 4AKZA 1W6GA 3KKGA 3CCL3 4RBNA 1K9M4 1L5GB 4WWUC 1LOXA 4N6UA 5CK6A 3FH1A 3HZPA 1NB3I 2I9WA 5DRVA 3MG2A 5CF1A 4K90B 3X3XA 1VQO3 1KSIA 4XBYA 5AIFA 4N6MA 3WOFB 3K9MC 4HM5B 4NREA 3CNMA 1IU7A 2CFGA 3GAXA 8CHOA 1Q40B 3B4OA 4AEQA 2BT3A 5BVBA 5IG5A 5IW9A 4GL6A 4L8OA 4HJLB 4OUQA 4BTXA 2WOFA 1IT8A 3TDGA 3EQQB 3HX8A 1GD3A 2GU3A 3DZLA 1ULIB 1A2KA 2W6JH 1W2B2 3N9HA 2MF7A 2OCTA 3VSYA 1YHQ3 2RSXA 3VF1A 4HZ9B 5AYSC 3CU3A 3WODG 3EE1A 4XB5A 3BB9A 3OWSA 3LH4A 4Q53A 2SBLA 2F86B 4KFEA 5IERA 1ISKA 1IVXA 1PU4A 2HMMB 3FG1A 1TP6A 4HBRA 3S67A 5IENA 3KFQC 3OXAA 1JNQA 4HM1B 1ROAA 4IIAA 1UI7A 1U8CB 3JUMA 2QGUA 1STDA 4STDA 1WTHA 1SIIA 2QIYA 4O8SA 1EQKA 4BTYA 1HU9A 2JQ5A 3HK4A 1IDPA 3PGBA 5IG0A 4HM2B 2CFDA 4MEIA 3G713 3KE7A 1OACA 1O7HB 5FW5A 3EN1B 3M8CA 2GEXA 2XH9A 3G16A 2FXTA 3KSED 1O7PB 3FGYA 1RKYA 2OTL3 3H3HA 3QK9A 3IJEB 2KRTA 3NM2A 3EBYA 1OUNA 3LXUX 1ASKA 3DGLA 1ROVA 3MG3A 1D6UA 2LYXA 1YI23 4LZIA 3BNEA 1OPYA 4N6V0 1FGRA 3PS8A 4HKVB 2GU1A 3SOAA 4TX4A 1GY5A 3BNDA 2IUJA 1JN5B 1LVNA 4WYKB 1TUHA 4NHFA 4QWTA 1N8R4 3NBBA 1V74A 3X3YA 2XSHB 2P09A 2WGOA 3CCQ3 2CG0A 2XFTA 4AKYA 4XM4A 1VZZA 3UB1A 4FMAA 1N5HA 1UUVB 3I0YA 3DY5A 1GYBA 3S5CA 4MJDA 1VQ83 3PCRA 3FF0A 2B1XB 1A90A 1QVF2 1N5PA 3DM8A 3JUQA 4EV2A 1Q7Y4 3CCU3 2XSOB 3EX9A 1KC84 3S29A 2CW9A 3I553 1TFOA 3L0RA 4KFDA 2XR8B 2F99A 5AYRB 3NBJA 3F14A 5EEOA 1BUQA 3F7XA 1EG9B 2W56B 5HGRA 2CG1A 2RFRA 1GY7A 3WA3A 4XBTA 5D81A 4BTWA 5STDA 1NJI4 2ML5A 2BNGA 3D9RA 3K7CA 3JUPA 1IK3A 2P38A 1RN7A 1JRQA 2CK3H 4FMCA 2OTJ3 3O8YA 1DMMA 4ZM8A 1C7HA 3GWRA 5CLKA 3NV0B 3X40A 1QAFA 2PZVA 3EB8A 3CCR3 2YFJB 1OGXA 1W2ZA 3JUOA 3PCSA 2ML6A 3UNLA 2Z7AA 1Z1SA 2WOHA 4J8TA 4K61A 3X41A 3FKAA 2CFKA 2OOVA 2O3OA 1M9GA 1YJW3 1DMNA 3DGMA 2E2TA 1CYUA 1MOLA 4I4KA 2K0MA 1G96A 1O7NB 1DVDA 1FGOA 4LGQA 3LOYA 3GZYB 7STDA 3GZRA 2W9PA 2XGNA 2W04A 2Y73A 3OW22 4N6LA 2M7OA 3EBTA 3VGNA 2HMKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVC A;  3S67 A;  3KFQ C;  1TIJ A;  1ROA A;  1LXE A;  1EQK A;  2KXG A;  1A67 A;  3UL6 A;  1YVB I;  1PFP A;  3Q2P A;  5LC6 A;  3PYJ A;  4EYC A;  3KSE D;  4IT7 A;  1CEW I;  3SVA A;  5ELU A;  5ELJ A;  3PXM A;  1KWI A;  4LZI A;  4N6V 0;  3PS8 A;  3NX0 A;  1IV7 A;  1FUW A;  4TX4 A;  1N9J A;  2W9Q A;  4N6N B;  5LC7 A;  1N5H A;  1FA3 A;  3MWZ A;  1WNH A;  2BO9 B;  2O9U X;  1R4C A;  1A90 A;  1N5P A;  5EQL A;  4N6O B;  1IV9 A;  1MNL A;  3L0R A;  5A0O B;  4N6U A;  1NB3 I;  4N6M A;  4N6T A;  3K9M C;  3IMA B;  1RN7 A;  4ZM8 A;  3GAX A;  1STF I;  1NB5 I;  1GD3 A;  1M9G A;  2CH9 A;  1CYU A;  1MOL A;  1G96 A;  1DVD A;  2OCT A;  1GD4 A;  4CCV A;  2W9P A;  1CYV A;  3QRD A;  4N6L A;  3LH4 A;  3UL5 A; 
#chains in the Genus database with same CATH topology
 2FNQ A;  2RGQ A;  4R9L A;  3ECF A;  1S5A A;  4K1V A;  4RNT A;  1GMR A;  1RGA A;  2F98 A;  3ZFZ A;  1KD1 4;  1I2G A;  2L4V A;  2CHC A;  3CPW 2;  5EVH A;  1R4Y A;  2R4I A;  3Q3F A;  3LT8 A;  1RGE A;  3VGN A;  3GZX B;  4O2H A;  1EKM A;  2L1S A;  1HKX A;  1M1K 4;  2UUG C;  4LMI A;  3BNC A;  1JB2 A;  4CPK A;  1X1U A;  4EXR A;  1O7W B;  1UGI A;  2STD A;  3RGA A;  3V98 A;  1A67 A;  2KF5 A;  3K63 A;  1BRH A;  3BLZ A;  1RGH A;  1Y4K A;  1PFP A;  3MPH A;  4IPB A;  3LYG A;  1OF5 B;  1TU5 A;  1M1X B;  4EYC A;  4KZ1 A;  5DRE A;  3BNB A;  4IT7 A;  1I0V A;  2GBW B;  4FR9 A;  3X3Z A;  1GS3 A;  1JJ2 2;  2UX0 A;  1IQY A;  4R80 A;  1A2P A;  1OH0 A;  2BMR B;  4EV5 A;  1IYY A;  1WQL B;  5KP3 A;  1IVW A;  4U13 A;  1UCL A;  2CKF B;  3PZW A;  3X42 A;  4KFF A;  4LEH A;  1BUJ A;  1YVS A;  3WHO A;  4EW5 A;  3NX0 A;  1IV7 A;  1FUW A;  1JBT A;  1BRN L;  3S27 A;  5AEW B;  1FYS A;  2GSP A;  2W2C A;  4XDW A;  3HIG A;  3K5T A;  1Q86 4;  1JB5 A;  2GXF A;  3AMO A;  5CF2 A;  3OWU A;  6RNT A;  4N6N B;  1BNG A;  5D83 A;  3KCH A;  3G6E 3;  1OHS A;  3Q90 A;  1QJG A;  1VQP 3;  1UW1 A;  3NBR A;  3WMD A;  1QAK A;  3WDG B;  1EEJ A;  1ULJ B;  1VQ5 3;  1UCK A;  3D3L A;  2GEY A;  1B2Z A;  2V1L A;  1WMO A;  4HYZ A;  1B2S A;  3MG1 A;  4BL3 A;  1FGM A;  4OK0 A;  3EHC A;  1AVL A;  2MC8 A;  1IV9 A;  3HII A;  1MNL A;  1KQS 2;  1UCJ A;  1RGG A;  1W01 A;  3KSP A;  3T8U A;  1QAL A;  3GRD A;  4XDV A;  2BMQ B;  3GZB A;  1EA2 A;  3KN4 A;  1AY7 A;  4J9A A;  2RCD A;  1OHP A;  3E99 A;  1X1X A;  4FCZ A;  3NUV A;  2HMJ B;  3N54 B;  3CCS 3;  2C10 A;  3NM7 A;  2CX0 A;  1WMP A;  3MYT A;  4HM0 B;  3STD A;  3SX1 A;  4XBX A;  3CCE 3;  1W5Z A;  4KT3 B;  1BIR A;  3MHE A;  3Q1C A;  2IY2 A;  3EN8 A;  1JV2 B;  1BSB A;  3LML A;  1RTU A;  3FG4 A;  1DET A;  1N8Q A;  2KF4 A;  1ZX2 A;  2BMO B;  2XFS A;  1I0X A;  3T0U A;  1UUW B;  1AVK A;  3CPO A;  3IPT A;  4L8P A;  2D1W A;  1NB5 I;  3JUN A;  1VQ4 3;  3OX9 A;  1YJ9 3;  5KP4 A;  5BXQ A;  2YFL B;  1W6C A;  5IG4 A;  1RN4 A;  1GD4 A;  4CCV A;  3CME 3;  5IEO A;  3CCV 3;  3V92 A;  3SXX A;  4GB5 A;  2Z6B A;  3T8N A;  1VQK 3;  1JB4 A;  1DVC A;  4NPB A;  1RGC A;  1D6Z A;  3DMC A;  1NWW A;  1BNF A;  5I97 A;  5IF6 A;  3ZG0 A;  2IUK A;  1W4N A;  1TTO A;  1SIH A;  2C11 A;  4HVN A;  1LXE A;  4WP5 A;  4HM6 B;  2E2U A;  3KII A;  1W6Y A;  4HM3 B;  2P0X A;  3FCS B;  1RDS A;  2KXG A;  1FZU A;  3KZT A;  4WFO A;  2IMJ A;  3LTB A;  1X1W A;  3UL6 A;  1UDI I;  6STD A;  2OTJ 3;  1BOX A;  1JKG A;  4JRF A;  5BIR A;  1NNV A;  3JVC A;  4OVM A;  1OHO A;  2Q07 A;  1AQZ A;  1N9E A;  1IQ8 A;  1VQ9 3;  3H51 A;  3PYJ A;  1J2B A;  3LTD A;  1GY6 A;  1BGS A;  3SVA A;  2B24 B;  1U5O A;  5ELU A;  2HML B;  3RNT A;  5AII A;  1O7M B;  3OWY A;  1W02 A;  3B8L A;  3CXC 2;  1M90 4;  1AV4 A;  2A15 A;  4CDL A;  3DXO A;  4BU4 A;  1OCV A;  1KWI A;  3EC9 A;  3DH2 A;  3BU4 A;  3UJM A;  1FUT A;  1T2I A;  3MKI A;  1I2E A;  4G1M B;  4GHO A;  1N9J A;  3EF8 A;  4MMX B;  1I2F A;  5JPU A;  1RRL A;  1FUS A;  1JBS A;  1W7C A;  2JDI H;  1D6Y A;  3F8X A;  1K8A 4;  2W9Q A;  1VQM 3;  1B21 A;  4FCM A;  2CWU A;  1DMQ A;  3AMO B;  1ZGX A;  3K0Z A;  1OGZ A;  2XRX B;  2XGL A;  5AEU B;  1SPU A;  1RJO A;  2CFL A;  1YNV X;  3LTA A;  3NV0 A;  3RDE A;  3A76 A;  1Q81 4;  1FA3 A;  4BIR A;  1RMS A;  2BO9 B;  2Z76 A;  1B27 A;  3RGR A;  1PYL A;  1T3B A;  1DYU A;  4HM8 B;  1Q42 A;  2F5W A;  1FGQ A;  1E3R A;  1VQ6 3;  3FLJ A;  3ZG5 A;  4KVH A;  1K28 A;  2WGQ A;  3CNX A;  3F7S A;  3N8B A;  4WHA A;  3ROB A;  3CC7 3;  5A0O B;  2XF3 A;  4HM7 B;  4LSO A;  1YJN 3;  3FSD A;  3EJV A;  3U97 A;  3F9S A;  5D82 A;  2XEP A;  1K73 4;  4J5G A;  1WMN A;  3S28 A;  2CWV A;  1E97 A;  2KCD A;  4N6T A;  3WOE B;  2FGT A;  4RZM A;  2P0M A;  3DUK A;  1HZ1 A;  1G0T A;  3J7Y d;  1SQW A;  3IMA B;  1Q40 A;  8RNT A;  2LQV A;  1NO3 A;  3F8H A;  2OOV C;  1STF I;  1UGH I;  2IA7 A;  2OQE C;  1A2V A;  4EBG A;  1W00 A;  3WA2 X;  2CX1 A;  4RNZ A;  3SOY A;  1VQL 3;  1JZD A;  2K54 A;  3I56 3;  3MSO A;  4R1K A;  3URP A;  1EUI C;  2E2V A;  3F40 A;  3OV4 A;  3U1W A;  5M1A A;  1G02 A;  1TFK A;  2CFW A;  4HZB B;  4ILF A;  5AIH A;  2Y74 A;  3NXJ A;  2BHM A;  2CH9 A;  2J8X B;  1O7G B;  1RHL A;  4FCJ A;  1T5Y A;  4HAA A;  5KP1 A;  2CWT A;  4PEJ A;  2AAE A;  3DGO A;  1OF5 A;  1BRI A;  2BIR A;  5G1K A;  1BRK A;  1QVG 2;  1CYV A;  5JPP A;  4ORL A;  3G4S 3;  5G2G A;  3LT9 A;  1MGW A;  3QRD A;  2WO0 A;  2YFI B;  3FZW A;  3SLU A;  1UCI A;  1F8N A;  3UL5 A;  4N3V A;  3DGN A;  1LQG C;  1S72 3;  5JBS A;  4MMZ B;  3NHX A;  4K1U A;  3CC4 3;  2QA4 3;  1Q9E A;  1B2X A;  1BRG A;  1RRH A;  3LZA A;  1CQS A;  1BAN A;  4H61 A;  1VQ7 3;  4X2O A;  1TIJ A;  1UI8 A;  2W0Q A;  1FW7 A;  4X2H A;  1QMA A;  1RCL A;  2HMO B;  3G0K A;  2ZL8 A;  3V99 A;  5AIG A;  4EC6 A;  3SED A;  1MWR A;  1IVU A;  1YVB I;  2W03 A;  3D79 A;  1JKG B;  1K41 A;  1NDO B;  3Q2P A;  5GSP A;  3G8Z A;  2C4B A;  2ZDJ A;  5LC6 A;  1TRP A;  1AR0 A;  3BIR A;  1CEW I;  2YX9 A;  3CD6 3;  1YIJ 3;  5BU4 A;  2OWP A;  1IVV A;  2HMN B;  3ER7 A;  5AI1 A;  5ELJ A;  1Q82 4;  2CIU A;  4RNY A;  1GMQ A;  1YGE A;  5IEP A;  3B7C A;  1RCK A;  1I3I A;  1MGR A;  2GBX B;  1MWT A;  3PXM A;  4FMB A;  1NU3 A;  3NQY A;  4R4K A;  4O3V A;  1LNH A;  5FGO A;  1IT7 A;  2UGI A;  4H3U A;  4R9K A;  3CCM 3;  1JN5 A;  1LRA A;  3NQZ A;  4WYK A;  1SAR A;  5CXO A;  3FF2 A;  1ZO2 A;  1FGT A;  3FG3 A;  2IYJ A;  4HM4 B;  5IG3 A;  2CC3 A;  6GSP A;  3HI7 A;  2PNC A;  3D4A A;  4JF8 A;  1MWU A;  3A5E A;  5LC7 A;  1YIT 3;  1B2U A;  1SJW A;  1E3V A;  4O02 B;  3LTC A;  2D42 A;  3MWZ A;  1WNH A;  3CCJ 3;  1VQN 3;  5TGN A;  2O9U X;  4FMD A;  2RBI A;  1US1 A;  2QEX 3;  1R4C A;  3CMA 3;  5EQL A;  5G1L A;  1IQX A;  4MMY B;  1GOU A;  4N6O B;  4L7K A;  3ALA A;  2K3D A;  1RSN A;  2Z77 A;  2P05 A;  3B4P A;  2OQE A;  1RNB A;  1BNR A;  1B20 A;  1LNI A;  2INX A;  2W56 A;  4AKZ A;  4CJN A;  1W6G A;  1I70 A;  3KKG A;  3CCL 3;  4RBN A;  1BAO A;  1L5G B;  1K9M 4;  4J5K A;  4WWU C;  1I3F A;  1LOX A;  4N6U A;  5CK6 A;  3FH1 A;  3HZP A;  1NB3 I;  2I9W A;  5DRV A;  3MG2 A;  5CF1 A;  4K90 B;  3X3X A;  1VQO 3;  1KSI A;  4XBY A;  5AIF A;  4N6M A;  3WOF B;  4HOH A;  9RNT A;  3K9M C;  1B3S A;  4HM5 B;  4NRE A;  1TJD A;  3CNM A;  4DKI A;  1IU7 A;  2CFG A;  1JBR A;  3GAX A;  8CHO A;  1RGF A;  1Q40 B;  3B4O A;  4AEQ A;  2BT3 A;  5BVB A;  1BNS A;  5IG5 A;  5IW9 A;  5RNT A;  2H0H A;  4GL6 A;  1VQQ A;  4HJL B;  4L8O A;  4OUQ A;  4BTX A;  2WOF A;  1IT8 A;  3TDG A;  3EQQ B;  3HX8 A;  1GD3 A;  2GU3 A;  3D5I A;  1B2M A;  1RNT A;  3DZL A;  1JZO A;  1ULI B;  1A2K A;  2W6J H;  1W2B 2;  2RNT A;  3N9H A;  2MF7 A;  2OCT A;  3VSY A;  1YHQ 3;  2RSX A;  3VF1 A;  4HZ9 B;  5AYS C;  4LYL B;  1LOV A;  2SAR A;  1MWS A;  3CU3 A;  3WOD G;  3EE1 A;  4XB5 A;  3BB9 A;  3OWS A;  3WR2 A;  7GSP A;  3LH4 A;  4Q53 A;  2SBL A;  2F86 B;  4KFE A;  5IER A;  1ISK A;  1IVX A;  1PU4 A;  2HMM B;  3FG1 A;  4GSP A;  1TP6 A;  1BRS A;  4HBR A;  3S67 A;  5IEN A;  2H0I A;  3KFQ C;  3OXA A;  2F4Y A;  1C54 A;  1JNQ A;  4HM1 B;  1ROA A;  4IIA A;  1UI7 A;  3AGN A;  1U8C B;  4BL2 A;  3GSP A;  2QGU A;  1STD A;  1RGK A;  3JUM A;  1WTH A;  1SII A;  2QIY A;  4O8S A;  4STD A;  2KAA A;  1EQK A;  4BTY A;  1HU9 A;  2JQ5 A;  1Q7H A;  3HK4 A;  1IDP A;  3PGB A;  5M18 A;  5IG0 A;  4HM2 B;  1PY3 A;  2CFD A;  3AHW A;  4MEI A;  1CH0 A;  3G71 3;  3KE7 A;  1OAC A;  1O7H B;  5FW5 A;  3EN1 B;  3M8C A;  2GEX A;  2KF6 A;  2XH9 A;  3G16 A;  2FXT A;  3AHS A;  3KSE D;  5HOH A;  1ZS7 A;  1O7P B;  3FGY A;  1RKY A;  2OTL 3;  3H3H A;  3QK9 A;  3IJE B;  2KRT A;  3NM2 A;  3EBY A;  1OUN A;  2H0G A;  1ASK A;  3LXU X;  1I8V A;  3DGL A;  1ROV A;  1LOY A;  1D6U A;  2LYX A;  3MG3 A;  4LZI A;  3BNE A;  1YI2 3;  1OPY A;  4N6V 0;  1FGR A;  3PS8 A;  3D5G A;  3HOH A;  4HKV B;  2GU1 A;  1BNE A;  1HYF A;  3SOA A;  4TX4 A;  1GY5 A;  3BND A;  1BNI A;  1JN5 B;  1LVN A;  1RGL A;  1TUH A;  4NHF A;  4QWT A;  4WYK B;  2IUJ A;  1N8R 4;  3NBB A;  1V74 A;  3X3Y A;  2XSH B;  2P09 A;  2AAD A;  2WGO A;  3CCQ 3;  2CG0 A;  2XFT A;  4AKY A;  1RN1 A;  4XM4 A;  1VZZ A;  3UB1 A;  4FMA A;  1N5H A;  1UUV B;  2F5M A;  3I0Y A;  3DY5 A;  7RNT A;  1GYB A;  3S5C A;  4MJD A;  1VQ8 3;  3PCR A;  3FF0 A;  1BSD A;  2B1X B;  1A90 A;  1QVF 2;  1N5P A;  3DM8 A;  3JUQ A;  4EV2 A;  1Q7Y 4;  1GMP A;  3CCU 3;  2XSO B;  3EX9 A;  1KC8 4;  1GSP A;  3S29 A;  2CW9 A;  3I55 3;  1TFO A;  3L0R A;  4KFD A;  1BSE A;  2HOH A;  2XR8 B;  2F99 A;  5AYR B;  3NBJ A;  3F14 A;  5EEO A;  1BNJ A;  3F7X A;  1BUQ A;  1EG9 B;  2W56 B;  5HGR A;  1GOV A;  2CG1 A;  2RFR A;  1GY7 A;  2F56 A;  3WA3 A;  1BVI A;  4XBT A;  5D81 A;  4BTW A;  5STD A;  1NJI 4;  1V58 A;  2ML5 A;  1LOW A;  1RLS A;  2BNG A;  1T2H A;  1YGW A;  1GOY A;  3D9R A;  3K7C A;  3JUP A;  1IK3 A;  2KF3 A;  1RN7 A;  1JRQ A;  2CK3 H;  2P38 A;  4FMC A;  3O8Y A;  1DMM A;  4ZM8 A;  1C7H A;  3GWR A;  1X1Y A;  5CLK A;  3NV0 B;  3X40 A;  5M19 A;  1QAF A;  2PZV A;  1TRQ A;  3EB8 A;  3CCR 3;  2BU4 A;  1OGX A;  1LQM B;  1W2Z A;  2YFJ B;  2ML6 A;  3JUO A;  2R41 A;  3PCS A;  2Z7A A;  3UNL A;  1Z1S A;  2WOH A;  3DGY A;  4J8T A;  4K61 A;  3X41 A;  3FKA A;  2CFK A;  2OOV A;  1V57 A;  2ZA4 A;  2O3O A;  1BRJ A;  1M9G A;  1YJW 3;  1BU4 A;  1DMN A;  3DGM A;  1DE3 A;  3AGO A;  2E2T A;  1CYU A;  1MOL A;  4I4K A;  2K0M A;  1G96 A;  1O7N B;  1DVD A;  1FGO A;  3SYU A;  4LGQ A;  3LOY A;  3GZY B;  1UUG B;  7STD A;  3GZR A;  2W9P A;  1BSA A;  2XGN A;  2W04 A;  2Y73 A;  2ZHX B;  3OW2 2;  4N6L A;  2M7O A;  3EBT A;  4I5Q A;  3CC2 3;  1BSC A;  2HMK B; 
#chains in the Genus database with same CATH homology
 2FNQ A;  2RGQ A;  4R9L A;  3ECF A;  1S5A A;  4K1V A;  1KD1 4;  2F98 A;  2L4V A;  2CHC A;  3CPW 2;  5EVH A;  2R4I A;  3LT8 A;  3GZX B;  4O2H A;  1EKM A;  1M1K 4;  1HKX A;  4LMI A;  3BNC A;  1JB2 A;  4EXR A;  1O7W B;  2STD A;  3V98 A;  3RGA A;  1A67 A;  3K63 A;  3BLZ A;  1Y4K A;  1PFP A;  3MPH A;  4IPB A;  3LYG A;  1OF5 B;  1TU5 A;  1M1X B;  4EYC A;  4KZ1 A;  5DRE A;  3BNB A;  4IT7 A;  2GBW B;  4FR9 A;  3X3Z A;  1GS3 A;  1JJ2 2;  2UX0 A;  1IQY A;  4R80 A;  1OH0 A;  2BMR B;  4EV5 A;  1WQL B;  5KP3 A;  1IVW A;  4U13 A;  2CKF B;  3PZW A;  3X42 A;  4KFF A;  4LEH A;  3NX0 A;  1IV7 A;  1FUW A;  3S27 A;  5AEW B;  4XDW A;  2W2C A;  3HIG A;  3K5T A;  1Q86 4;  1JB5 A;  2GXF A;  3AMO A;  5CF2 A;  3OWU A;  4N6N B;  5D83 A;  3G6E 3;  1OHS A;  3Q90 A;  1QJG A;  1VQP 3;  1UW1 A;  3NBR A;  3WMD A;  1QAK A;  3WDG B;  1ULJ B;  1VQ5 3;  3D3L A;  2GEY A;  2V1L A;  1WMO A;  4HYZ A;  3MG1 A;  1FGM A;  4OK0 A;  3EHC A;  1AVL A;  2MC8 A;  1IV9 A;  3HII A;  1MNL A;  1KQS 2;  1W01 A;  3KSP A;  3T8U A;  1QAL A;  3GRD A;  4XDV A;  2BMQ B;  3GZB A;  1EA2 A;  3KN4 A;  4J9A A;  2RCD A;  1OHP A;  3E99 A;  4FCZ A;  3NUV A;  2HMJ B;  3N54 B;  3CCS 3;  2C10 A;  3NM7 A;  3CCE 3;  1WMP A;  3MYT A;  4HM0 B;  3STD A;  3SX1 A;  4XBX A;  1W5Z A;  3MHE A;  3Q1C A;  3EN8 A;  1JV2 B;  3LML A;  3FG4 A;  1N8Q A;  1ZX2 A;  2BMO B;  2XFS A;  3T0U A;  1UUW B;  1AVK A;  3CPO A;  3IPT A;  4L8P A;  2D1W A;  1NB5 I;  3JUN A;  1VQ4 3;  3OX9 A;  1YJ9 3;  5KP4 A;  5BXQ A;  2YFL B;  1W6C A;  5IG4 A;  1GD4 A;  4CCV A;  3CME 3;  5IEO A;  3CCV 3;  3V92 A;  3SXX A;  4GB5 A;  2Z6B A;  3T8N A;  1VQK 3;  1JB4 A;  1DVC A;  1D6Z A;  3DMC A;  1NWW A;  5I97 A;  5IF6 A;  2IUK A;  1W4N A;  1SIH A;  2C11 A;  4HVN A;  1LXE A;  4WP5 A;  4HM6 B;  2E2U A;  3KII A;  1W6Y A;  4HM3 B;  2P0X A;  3FCS B;  2KXG A;  3KZT A;  4WFO A;  2IMJ A;  3LTB A;  3UL6 A;  6STD A;  4JRF A;  1JKG A;  3JVC A;  4OVM A;  1OHO A;  2Q07 A;  1N9E A;  1IQ8 A;  1VQ9 3;  3H51 A;  3PYJ A;  1J2B A;  3LTD A;  1GY6 A;  3SVA A;  2B24 B;  1U5O A;  5ELU A;  2HML B;  5AII A;  1O7M B;  3OWY A;  1W02 A;  3B8L A;  3CXC 2;  1M90 4;  1AV4 A;  2A15 A;  4CDL A;  3DXO A;  1OCV A;  1KWI A;  3EC9 A;  3UJM A;  3MKI A;  4G1M B;  1N9J A;  3EF8 A;  4MMX B;  5JPU A;  1RRL A;  1W7C A;  2JDI H;  1D6Y A;  3F8X A;  1K8A 4;  2W9Q A;  1VQM 3;  4FCM A;  2CWU A;  1DMQ A;  3AMO B;  5AEU B;  3K0Z A;  2XRX B;  1OGZ A;  2XGL A;  1SPU A;  1RJO A;  2CFL A;  3LTA A;  1Q81 4;  3NV0 A;  3RDE A;  3A76 A;  1FA3 A;  2BO9 B;  2Z76 A;  3RGR A;  1DYU A;  4HM8 B;  1Q42 A;  1FGQ A;  1E3R A;  1VQ6 3;  3FLJ A;  4KVH A;  1K28 A;  2WGQ A;  3CNX A;  3F7S A;  3N8B A;  4WHA A;  3ROB A;  3CC7 3;  5A0O B;  2XF3 A;  4HM7 B;  4LSO A;  1YJN 3;  3FSD A;  3EJV A;  3U97 A;  3F9S A;  5D82 A;  2XEP A;  1K73 4;  1WMN A;  3S28 A;  2CWV A;  1E97 A;  2KCD A;  4N6T A;  3WOE B;  2FGT A;  4RZM A;  2P0M A;  3DUK A;  3J7Y d;  1SQW A;  3IMA B;  1Q40 A;  2LQV A;  1NO3 A;  3F8H A;  2OOV C;  1STF I;  2IA7 A;  4EBG A;  2OQE C;  1A2V A;  1VQL 3;  1W00 A;  3WA2 X;  4RNZ A;  3SOY A;  2K54 A;  3I56 3;  3MSO A;  4R1K A;  2E2V A;  3F40 A;  3OV4 A;  3U1W A;  3CC2 3;  1TFK A;  2CFW A;  4HZB B;  5AIH A;  2Y74 A;  3NXJ A;  2BHM A;  2CH9 A;  1O7G B;  4FCJ A;  1T5Y A;  5KP1 A;  2CWT A;  4PEJ A;  3DGO A;  1OF5 A;  1QVG 2;  1CYV A;  5JPP A;  4ORL A;  3G4S 3;  5G2G A;  3LT9 A;  3QRD A;  2WO0 A;  2YFI B;  3FZW A;  3SLU A;  1F8N A;  3UL5 A;  4N3V A;  3DGN A;  1S72 3;  5JBS A;  4MMZ B;  3NHX A;  4K1U A;  3CC4 3;  2QA4 3;  3LZA A;  1RRH A;  1CQS A;  4H61 A;  1VQ7 3;  4X2O A;  1TIJ A;  1UI8 A;  2W0Q A;  4X2H A;  1QMA A;  2HMO B;  3G0K A;  2ZL8 A;  3V99 A;  5AIG A;  4EC6 A;  3SED A;  1IVU A;  1YVB I;  2W03 A;  1JKG B;  1K41 A;  1NDO B;  3Q2P A;  3G8Z A;  2ZDJ A;  5LC6 A;  1AR0 A;  1CEW I;  2YX9 A;  3CD6 3;  1YIJ 3;  2OWP A;  1IVV A;  2HMN B;  3ER7 A;  5AI1 A;  5ELJ A;  1Q82 4;  2CIU A;  4RNY A;  1YGE A;  5IEP A;  3B7C A;  2GBX B;  3PXM A;  4FMB A;  1NU3 A;  3NQY A;  4R4K A;  4O3V A;  1LNH A;  5FGO A;  1IT7 A;  4R9K A;  4H3U A;  3CCM 3;  1JN5 A;  3NQZ A;  4WYK A;  5CXO A;  3FF2 A;  1ZO2 A;  1FGT A;  3FG3 A;  4HM4 B;  5IG3 A;  2CC3 A;  3HI7 A;  2PNC A;  4JF8 A;  5LC7 A;  1YIT 3;  1SJW A;  1E3V A;  4O02 B;  3LTC A;  2D42 A;  3MWZ A;  1WNH A;  3CCJ 3;  1VQN 3;  5TGN A;  2O9U X;  4FMD A;  1US1 A;  2QEX 3;  1R4C A;  3CMA 3;  5EQL A;  1IQX A;  4MMY B;  4N6O B;  4L7K A;  3ALA A;  2Z77 A;  2P05 A;  3B4P A;  2OQE A;  2INX A;  2W56 A;  4AKZ A;  1W6G A;  3KKG A;  3CCL 3;  4RBN A;  1K9M 4;  1L5G B;  4WWU C;  1LOX A;  4N6U A;  5CK6 A;  3FH1 A;  3HZP A;  1NB3 I;  2I9W A;  5DRV A;  3MG2 A;  5CF1 A;  4K90 B;  3X3X A;  1VQO 3;  1KSI A;  4XBY A;  5AIF A;  4N6M A;  3WOF B;  3K9M C;  4HM5 B;  4NRE A;  3CNM A;  1IU7 A;  2CFG A;  3GAX A;  8CHO A;  1Q40 B;  3B4O A;  4AEQ A;  2BT3 A;  5BVB A;  5IG5 A;  5IW9 A;  4GL6 A;  4L8O A;  4HJL B;  4OUQ A;  4BTX A;  2WOF A;  1IT8 A;  3TDG A;  3EQQ B;  3HX8 A;  1GD3 A;  2GU3 A;  3DZL A;  1ULI B;  1A2K A;  2W6J H;  1W2B 2;  3N9H A;  2MF7 A;  2OCT A;  3VSY A;  1YHQ 3;  2RSX A;  3VF1 A;  4HZ9 B;  5AYS C;  3CU3 A;  3WOD G;  3EE1 A;  4XB5 A;  3BB9 A;  3OWS A;  3LH4 A;  4Q53 A;  2SBL A;  2F86 B;  4KFE A;  5IER A;  1ISK A;  1IVX A;  1PU4 A;  2HMM B;  3FG1 A;  1TP6 A;  4HBR A;  3S67 A;  5IEN A;  3KFQ C;  3OXA A;  1JNQ A;  4HM1 B;  1ROA A;  4IIA A;  1UI7 A;  1U8C B;  3JUM A;  2QGU A;  1STD A;  4STD A;  1WTH A;  1SII A;  2QIY A;  4O8S A;  1EQK A;  4BTY A;  1HU9 A;  2JQ5 A;  3HK4 A;  1IDP A;  3PGB A;  5IG0 A;  4HM2 B;  2CFD A;  4MEI A;  3G71 3;  3KE7 A;  1OAC A;  1O7H B;  5FW5 A;  3EN1 B;  3M8C A;  2GEX A;  2XH9 A;  3G16 A;  2FXT A;  3KSE D;  1O7P B;  3FGY A;  1RKY A;  2OTL 3;  3H3H A;  3QK9 A;  3IJE B;  2KRT A;  3NM2 A;  3EBY A;  1OUN A;  3LXU X;  1ASK A;  3DGL A;  1ROV A;  3MG3 A;  1D6U A;  2LYX A;  1YI2 3;  4LZI A;  3BNE A;  1OPY A;  4N6V 0;  1FGR A;  3PS8 A;  4HKV B;  2GU1 A;  3SOA A;  4TX4 A;  1GY5 A;  3BND A;  2IUJ A;  1JN5 B;  1LVN A;  4WYK B;  1TUH A;  4NHF A;  4QWT A;  1N8R 4;  3NBB A;  1V74 A;  3X3Y A;  2XSH B;  2P09 A;  2WGO A;  3CCQ 3;  2CG0 A;  2XFT A;  4AKY A;  4XM4 A;  1VZZ A;  3UB1 A;  4FMA A;  1N5H A;  1UUV B;  3I0Y A;  3DY5 A;  1GYB A;  3S5C A;  4MJD A;  1VQ8 3;  3PCR A;  3FF0 A;  2B1X B;  1A90 A;  1QVF 2;  1N5P A;  3DM8 A;  3JUQ A;  4EV2 A;  1Q7Y 4;  3CCU 3;  2XSO B;  3EX9 A;  1KC8 4;  3S29 A;  2CW9 A;  3I55 3;  1TFO A;  3L0R A;  4KFD A;  2XR8 B;  2F99 A;  5AYR B;  3NBJ A;  3F14 A;  5EEO A;  1BUQ A;  3F7X A;  1EG9 B;  2W56 B;  5HGR A;  2CG1 A;  2RFR A;  1GY7 A;  3WA3 A;  4XBT A;  5D81 A;  4BTW A;  5STD A;  1NJI 4;  2ML5 A;  2BNG A;  3D9R A;  3K7C A;  3JUP A;  1IK3 A;  2P38 A;  1RN7 A;  1JRQ A;  2CK3 H;  4FMC A;  2OTJ 3;  3O8Y A;  1DMM A;  4ZM8 A;  1C7H A;  3GWR A;  5CLK A;  3NV0 B;  3X40 A;  1QAF A;  2PZV A;  3EB8 A;  3CCR 3;  2YFJ B;  1OGX A;  1W2Z A;  3JUO A;  3PCS A;  2ML6 A;  3UNL A;  2Z7A A;  1Z1S A;  2WOH A;  4J8T A;  4K61 A;  3X41 A;  3FKA A;  2CFK A;  2OOV A;  2O3O A;  1M9G A;  1YJW 3;  1DMN A;  3DGM A;  2E2T A;  1CYU A;  1MOL A;  4I4K A;  2K0M A;  1G96 A;  1O7N B;  1DVD A;  1FGO A;  4LGQ A;  3LOY A;  3GZY B;  7STD A;  3GZR A;  2W9P A;  2XGN A;  2W04 A;  2Y73 A;  3OW2 2;  4N6L A;  2M7O A;  3EBT A;  3VGN A;  2HMK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...