4N6OB

Crystal structure of reduced legumain in complex with cystatin e/m
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
b'GELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords legumain
publication title Structure and mechanism of an aspartimide-dependent Peptide ligase in human legumain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6oB00
1DVCA 1STFI 1R4CA 1CEWI 1GD4A 1CYVA 4N6NB 1NB3I 3L0RA 4IT7A 2O9UX 4N6TA 1LXEA 5A0OB 5ELUA 3GAXA 3PXMA 2CH9A 4N6V0 3IMAB 5ELJA 3PS8A 3MWZA 2OCTA 1A90A 1YVBI 1MOLA 3SVAA 2BO9B 3Q2PA 1IV9A 1N5PA 4CCVA 1EQKA 1WNHA 1M9GA 4TX4A 1NB5I 2W9PA 3QRDA 1IV7A 4N6MA 4N6OB 3UL5A 1FA3A 1A67A 3KFQC 3LH4A 1RN7A 1ROAA 1PFPA 1CYUA 5LC6A 1GD3A 1MNLA 1FUWA 3S67A 3NX0A 1TIJA 5EQLA 4EYCA 2KXGA 3PYJA 4N6LA 1DVDA 3KSED 1G96A 1KWIA 2W9QA 5LC7A 4LZIA 4ZM8A 1N5HA 3K9MC 4N6UA 1N9JA 3UL6A
chains in the Genus database with same CATH superfamily
4FMBA 1A2VA 3NQYA 2OOVA 3SLUA 5BVBA 1N9EA 4Q53A 3SOYA 3AHSA 2E2UA 4AKZA 1MGRA 3MPHA 5IEPA 3SEDA 1TRQA 1SJWA 1IU7A 2IUJA 3NM7A 1GS3A 3Q90A 2K0MA 1OGZA 1GD4A 3EBYA 1BNSA 1CYVA 3DGLA 3GZRA 3JUQA 2QGUA 3EBTA 3JVCA 5FW5A 1C54A 1RRLA 2MF7A 4OK0A 3GRDA 3ZFZA 4O02B 3V92A 3BNCA 3MG2A 3D5GA 2LQVA 2BU4A 3F9SA 1PY3A 4WWUC 3L0RA 2JDIH 1Q864 2O9UX 2GU3A 1VQO3 1VQ73 1ZS7A 3G8ZA 1I3IA 1IT7A 4XBXA 2HMNB 1RN4A 1B2SA 1LRAA 1U5OA 3FZWA 2CFLA 1RN1A 3MG1A 5ELUA 4R4KA 4HM5B 1QAKA 4FMDA 1AR0A 1QVG2 1JN5B 3NBRA 3DM8A 5AIGA 1NNVA 2Z77A 4FCJA 4BIRA 3CME3 1EA2A 1JZOA 1RGEA 3PS8A 5EVHA 5IENA 1RCKA 3JUOA 1CH0A 2XEPA 3NBBA 3S29A 1NO3A 2Z76A 3CCS3 4FMAA 1Q42A 3D4AA 1RGCA 3FG3A 3KSPA 1Q814 1JBRA 1FUTA 1W6YA 5DREA 4HJLB 3V98A 1RDSA 4PEJA 3F7XA 1HYFA 3T8UA 3X3YA 1EQKA 1GMPA 2F99A 2W56B 3ECFA 4HBRA 3DH2A 2CX0A 1M9GA 3B4PA 4TX4A 3CCM3 1FGQA 2W9PA 1BOXA 3QRDA 3KN4A 2CKFB 4EV5A 3LTCA 1WMPA 2CW9A 3Q1CA 4K61A 2OQEA 3CD63 4R1KA 4HM3B 1B20A 3CNXA 3EHCA 1Z1SA 3G6E3 2K3DA 4HM7B 1FA3A 1FGRA 3LH4A 5AEUB 1OHPA 2KF3A 2XFSA 3WMDA 5G2GA 2YFJB 2XRXB 2BNGA 1ROAA 3RGAA 5IW9A 4NREA 3I0YA 4R9KA 2KF5A 1CYUA 3DZLA 1CQSA 2IYJA 4HM6B 1BRJA 1OHOA 5LC6A 4I5QA 1PU4A 2OTL3 3CCL3 4JRFA 1YGEA 5JPUA 3LXUX 4HM1B 2RGQA 4HM4B 2Z6BA 4RNZA 3KCHA 2OWPA 4WP5A 3S67A 5M18A 2BT3A 4XBYA 3RDEA 2Y73A 3IJEB 1BU4A 3OV4A 2KXGA 1IVXA 2B24B 4KZ1A 3DMCA 3GZYB 3CMA3 1BVIA 1ZGXA 3KSED 1KWIA 2W9QA 1ULJB 3FG1A 1BANA 2GBWB 1FYSA 2CIUA 3SYUA 2BMQB 1BRKA 4ZM8A 2JQ5A 3WA3A 1BSBA 1S723 1HZ1A 2V1LA 2ML5A 1IK3A 1YHQ3 2OOVC 1NWWA 3EE1A 1B21A 1JV2B 2IA7A 1DYUA 2OTJ3 3PZWA 1X1XA 4N6UA 1W7CA 2GXFA 3AMOA 2H0GA 5AYSC 1YJN3 2UUGC 3UL6A 1OF5A 4GSPA 1WMNA 2IUKA 2XR8B 4R9LA 3K0ZA 1GMQA 1FW7A 1STFI 1I70A 4R80A 5IEOA 1RGAA 1V58A 3OWYA 4LSOA 2GU1A 1CEWI 1IVWA 1PYLA 2L4VA 1I8VA 1HKXA 1GOUA 3F14A 4WFOA 4EBGA 4BU4A 4J9AA 4WHAA 1RKYA 2QIYA 2BIRA 5EEOA 2ZA4A 4L8PA 1BRHA 1KQS2 1BRGA 4IT7A 4ORLA 3EJVA 3AMOB 3AGNA 2FXTA 3HOHA 2CG1A 1W6CA 1JNQA 1Q9EA 1D6UA 1TJDA 3B7CA 4U13A 7STDA 1OF5B 5CF2A 3CCV3 2HMKB 5A0OB 5JPPA 1JRQA 1YJ93 3PXMA 2RFRA 1BNRA 1B3SA 1GY7A 2FGTA 1BNFA 3DXOA 4BTYA 1JN5A 3STDA 1EKMA 1X1UA 1ZX2A 5G1KA 3CNMA 4EXRA 1T5YA 1NU3A 3IMAB 4O8SA 1RRHA 3D9RA 1RGKA 2KRTA 1RGLA 5ELJA 1VQK3 4RBNA 1TTOA 3DUKA 1LQGC 3ROBA 1OPYA 2GEXA 1NJI4 2OCTA 1TFKA 5DRVA 3FGYA 5AYRB 1O7MB 3HIIA 4X2OA 1A90A 1YVBI 2Z7AA 3D79A 5IERA 2CC3A 3X3ZA 3FLJA 3G713 1IV9A 3EC9A 3VF1A 1SIIA 3MSOA 4GHOA 4N3VA 1N5PA 2OQEC 3DGOA 3GZBA 2ZHXB 1EG9B 1I2FA 3CXC2 4CCVA 2QA43 3EN8A 1IQYA 2W56A 3D3LA 3BU4A 3NBJA 4RZMA 3VGNA 2HMOB 1UCIA 1A2KA 1V74A 3G16A 3NM2A 3OWUA 3V99A 2BHMA 3RGRA 3X40A 5IF6A 5BIRA 1NB5I 1IV7A 1US1A 4N6MA 2K54A 2YFLB 4XDWA 2P05A 8CHOA 3CC43 1AQZA 1A2PA 1RHLA 2CFDA 5KP3A 4G1MB 4KFDA 1YGWA 2XFTA 1VQQA 2SARA 5M1AA 2MC8A 5AI1A 1PFPA 1R4YA 3NV0A 3BNBA 1O7GB 3WOFB 2CK3H 2XGNA 1WMOA 2W2CA 1YI23 2D1WA 1K734 3WODG 1LQMB 1MNLA 2CWUA 4FMCA 4H61A 4K1VA 5RNTA 3FKAA 1SQWA 5CF1A 1FUWA 2GSPA 1G02A 4KT3B 5IG0A 4X2HA 4ILFA 1TIJA 3LTDA 5EQLA 3IPTA 2B1XB 3G0KA 4EW5A 2AADA 2XH9A 1LOXA 1W01A 3X42A 5AIIA 5JBSA 3GSPA 3EX9A 4QWTA 3EF8A 2C10A 3ER7A 1VQ93 1BSCA 4LZIA 3S27A 1O7PB 3I563 4HYZA 3FG4A 4RNYA 3G4S3 1N5HA 3NV0B 2RCDA 2UGIA 3T0UA 2P0MA 4GB5A 1LOYA 2QEX3 3EN1B 4WYKB 4DKIA 2ML6A 2W03A 2M7OA 1BNEA 1N9JA 3WA2X 5FGOA 2SBLA 3OX9A 4NHFA 1I2EA 1OACA 3LT8A 1DVCA 3KZTA 1E97A 1VQ43 3ZG0A 5I97A 3PCSA 3WOEB 2CX1A 2KF4A 2YFIB 3E99A 2CFWA 2WGQA 3NXJA 1GY6A 1QMAA 1R4CA 1YVSA 1RTUA 1MWTA 5KP1A 3URPA 1UI7A 2R4IA 2WO0A 4O3VA 5BU4A 2C4BA 3S5CA 1WQLB 2LYXA 3CC23 1TP6A 2CFKA 2O3OA 1DETA 1W4NA 3F8XA 6GSPA 4NPBA 2HMJB 4HM0B 1E3RA 4J5GA 1AY7A 1MWRA 1O7WB 1GOYA 1MWUA 2RNTA 4XBTA 6STDA 1V57A 3LYGA 3NUVA 2RBIA 1LXEA 1U8CB 3F40A 2R41A 3UNLA 1EUIC 1N8QA 1VQ83 3O8YA 3LTAA 3T8NA 3WHOA 3B4OA 3CCR3 2WOFA 3GAXA 3HI7A 1Y4KA 1TUHA 4L8OA 1GYBA 4LYLB 1BNJA 2CH9A 4N6V0 4H3UA 1E3VA 2F56A 1B2XA 4OUQA 4IPBA 2AAEA 3FSDA 9RNTA 1K28A 1GOVA 1B2UA 4AEQA 4BL3A 3EQQB 2Y74A 4HZBB 4MMZB 1JKGA 2XGLA 4GL6A 2E2VA 4KVHA 2IMJA 4LEHA 1IVUA 4J5KA 2P38A 1JBSA 4CPKA 3OXAA 1JB2A 1MOLA 3SVAA 3Q2PA 3X3XA 1FGTA 3A76A 3LTBA 1AVLA 3KIIA 1T3BA 1C7HA 3CCU3 1ROVA 1BUJA 3UB1A 1T2HA 4BTWA 3F7SA 4CDLA 2F4YA 4LGQA 4OVMA 4HM8B 4MEIA 1B2ZA 1SARA 1BUQA 3S28A 3BIRA 1GY5A 2ZDJA 1DMNA 1BRIA 4KFFA 3CU3A 4XDVA 1UCKA 4N6OB 1T2IA 1BAOA 3KKGA 1M1K4 1O7NB 4HVNA 1A67A 3KFQC 2F86B 1S5AA 1JKGB 1Q7HA 2KAAA 1X1YA 5AIHA 1RN7A 3MKIA 1GMRA 1UDII 4I4KA 3H51A 1K8A4 2F5MA 1DMMA 1ISKA 3U1WA 1MGWA 4FR9A 3U97A 3CCQ3 1Q40A 1UW1A 3X41A 3AGOA 1ASKA 4BL2A 4EV2A 1FUSA 1RCLA 2C11A 1IQ8A 1W6GA 4HZ9B 1I0VA 3NX0A 3QK9A 5IG3A 1K9M4 1G0TA 2YX9A 1UGIA 5CK6A 3PYJA 4N6LA 5TGNA 1G96A 1OCVA 2WOHA 1MWSA 1FZUA 2XF3A 3H3HA 2INXA 3HX8A 2GEYA 3PGBA 1QAFA 1KSIA 5LC7A 4CJNA 1LOVA 2ZL8A 5IG4A 5HGRA 1YNVX 1TFOA 1VQN3 3BLZA 3CPOA 3FF0A 1BNIA 4HM2B 1B2MA 2I9WA 2F5WA 1ULIB 1D6YA 4HKVB 3EB8A 1JB4A 3HIGA 2XSHB 3JUPA 3K9MC 4HOHA 5G1LA 3VSYA 4LMIA 1GSPA 1Q40B 1RGHA 4MMYB 4WYKA 1K41A 1OUNA 3LMLA 3JUNA 4RNTA 4MJDA 3DGMA 1YIJ3 2D42A 2P09A 5BXQA 1LOWA 2XSOB 3SOAA 2CWVA 3LOYA 5CXOA 1RSNA 2W0QA 5D83A 2GBXB 3N8BA 1UGHI 3LT9A 1TU5A 1UUGB 1ZO2A 4N6NB 2PNCA 1BRSA 1I0XA 1B27A 1NB3I 1AVKA 1QJGA 1WTHA 2KF6A 2W6JH 3N54B 1M904 1STDA 3WR2A 4N6TA 1IDPA 2IY2A 1BIRA 3K5TA 1SIHA 1NDOB 1RNBA 1J2BA 3SX1A 1BSEA 2W04A 3GWRA 2HMLB 3HK4A 5IG5A 1VZZA 3NHXA 1F8NA 2E2TA 1L5GB 3UJMA 1X1WA 2BMOB 3RNTA 1IYYA 3I553 3PCRA 4EC6A 3FF2A 1LNIA 1YJW3 1W02A 1UUVB 3JUMA 1BSAA 5AIFA 6RNTA 1M1XB 5KP4A 1LVNA 1FGMA 3B8LA 1BNGA 3MWZA 1I3FA 1OGXA 1IQXA 1QALA 3J7Yd 1W5ZA 3DY5A 3K7CA 1KC84 3CPW2 2BO9B 5D81A 5GSPA 1AV4A 4STDA 3CC73 8RNTA 7GSPA 1D6ZA 1EEJA 2WGOA 2CFGA 1N8R4 2J8XB 3KE7A 1SPUA 2CG0A 5CLKA 5AEWB 3N9HA 3F8HA 4XB5A 3CCE3 1W2B2 2KCDA 1JBTA 2L1SA 1WNHA 2H0HA 5STDA 4IIAA 1RGGA 3A5EA 4BTXA 1VQ53 3ALAA 3BNEA 4MMXB 4KFEA 4J8TA 4FCZA 3UL5A 1RNTA 1FGOA 3OW22 1Q824 1UUWB 2BMRB 4O2HA 1IVVA 1JB5A 1LNHA 3MG3A 3DGNA 1BSDA 2HMMB 3FH1A 1DE3A 1OH0A 1RLSA 3Q3FA 1HU9A 4JF8A 5HOHA 4K1UA 1VQP3 2A15A 3ZG5A 1OHSA 3BNDA 2P0XA 1GD3A 1RGFA 3M8CA 4HAAA 2UX0A 2RSXA 5M19A 3DGYA 2CWTA 3CCJ3 1RMSA 3AHWA 1TRPA 3SXXA 4EYCA 2F98A 1DMQA 2PZVA 3LZAA 4K90B 1Q7Y4 2Q07A 3TDGA 1KD14 1UCLA 1DVDA 3D5IA 2H0IA 1JJ22 4XM4A 1IT8A 2FNQA 3HZPA 3WDGB 1RJOA 1UI8A 3BB9A 4FCMA 1VQM3 3MHEA 1I2GA 1YIT3 1UCJA 3K63A 3OWSA 3MYTA 1VQL3 3GZXB 3NQZA 1W00A 1VQ63 2HOHA 1O7HB 1W2ZA 3FCSB 2STDA 1JZDA 7RNTA 4L7KA 4AKYA 1QVF2 1BGSA 5D82A 2CHCA 1BRNL
chains in the Genus database with same CATH topology
4FMBA 1A2VA 3NQYA 2OOVA 3SLUA 5BVBA 1N9EA 4Q53A 3SOYA 4AKZA 2E2UA 5IEPA 3MPHA 3SEDA 1SJWA 1IU7A 2IUJA 3NM7A 1GS3A 3Q90A 2K0MA 1OGZA 1GD4A 3EBYA 1CYVA 3DGLA 3GZRA 3JUQA 2QGUA 3EBTA 3JVCA 5FW5A 1RRLA 2MF7A 4OK0A 3GRDA 4O02B 3V92A 3BNCA 3MG2A 2LQVA 3F9SA 4WWUC 3L0RA 2JDIH 1Q864 2O9UX 2GU3A 1VQO3 1VQ73 3G8ZA 1IT7A 4XBXA 2HMNB 1U5OA 3FZWA 2CFLA 3MG1A 5ELUA 4R4KA 4HM5B 1QAKA 4FMDA 1AR0A 1QVG2 1JN5B 3NBRA 3DM8A 5AIGA 2Z77A 4FCJA 3CME3 1EA2A 5EVHA 3PS8A 5IENA 3JUOA 2XEPA 3NBBA 3S29A 1NO3A 2Z76A 3CCS3 4FMAA 1Q42A 3FG3A 3KSPA 1Q814 1W6YA 5DREA 4HJLB 3V98A 4PEJA 3F7XA 3T8UA 3X3YA 1EQKA 2F99A 2W56B 3ECFA 4HBRA 1M9GA 3B4PA 4TX4A 3CCM3 1FGQA 2W9PA 3QRDA 3KN4A 2CKFB 4EV5A 3LTCA 1WMPA 2CW9A 3Q1CA 4K61A 2OQEA 3CD63 4R1KA 4HM3B 3CNXA 3EHCA 3G6E3 1Z1SA 4HM7B 1FA3A 1FGRA 3LH4A 5AEUB 1OHPA 2XFSA 3WMDA 5G2GA 2YFJB 2XRXB 2BNGA 1ROAA 3RGAA 5IW9A 4NREA 3I0YA 4R9KA 1CYUA 3DZLA 1CQSA 4HM6B 1PU4A 1OHOA 5LC6A 2OTL3 3CCL3 4JRFA 1YGEA 5JPUA 3LXUX 4HM1B 2RGQA 4HM4B 2Z6BA 4RNZA 2OWPA 4WP5A 3S67A 2BT3A 4XBYA 3RDEA 2Y73A 3IJEB 3OV4A 2KXGA 1IVXA 2B24B 4KZ1A 3DMCA 3GZYB 3CMA3 3KSED 1KWIA 2W9QA 1ULJB 3FG1A 2GBWB 2CIUA 2BMQB 4ZM8A 2JQ5A 3WA3A 1S723 2V1LA 2ML5A 1IK3A 1YHQ3 2OOVC 1NWWA 3EE1A 1JV2B 2IA7A 1DYUA 2OTJ3 3PZWA 4N6UA 1W7CA 2GXFA 3AMOA 5AYSC 1YJN3 3UL6A 1OF5A 2IUKA 1WMNA 2XR8B 4R9LA 3K0ZA 1STFI 4R80A 5IEOA 3OWYA 4LSOA 2GU1A 1CEWI 1IVWA 2L4VA 1HKXA 3F14A 4WFOA 4EBGA 4J9AA 4WHAA 1RKYA 2QIYA 5EEOA 4L8PA 1KQS2 4IT7A 4ORLA 3EJVA 3AMOB 2FXTA 2CG1A 7STDA 1W6CA 1JNQA 3B7CA 1D6UA 4U13A 1OF5B 5CF2A 3CCV3 2HMKB 5A0OB 5JPPA 1JRQA 1YJ93 3PXMA 2RFRA 1GY7A 2FGTA 4BTYA 3DXOA 1JN5A 3STDA 1EKMA 1ZX2A 3CNMA 4EXRA 1T5YA 1NU3A 3IMAB 4O8SA 1RRHA 3D9RA 2KRTA 1VQK3 5ELJA 4RBNA 3DUKA 3ROBA 1OPYA 2GEXA 1NJI4 2OCTA 1TFKA 5DRVA 3FGYA 5AYRB 1O7MB 3HIIA 4X2OA 1A90A 1YVBI 2Z7AA 5IERA 2CC3A 3X3ZA 3FLJA 3G713 1IV9A 3EC9A 3VF1A 1SIIA 3MSOA 4N3VA 3CXC2 1N5PA 2OQEC 3DGOA 3GZBA 1EG9B 4CCVA 2QA43 3EN8A 1IQYA 2W56A 3D3LA 3NBJA 4RZMA 3VGNA 1VQN3 2HMOB 1V74A 1A2KA 3V99A 3G16A 3NM2A 3OWUA 3X40A 2BHMA 3RGRA 5IF6A 1NB5I 1IV7A 1US1A 4N6MA 2K54A 2YFLB 4XDWA 2P05A 8CHOA 3CC43 2CFDA 5KP3A 4G1MB 4KFDA 2XFTA 2MC8A 5AI1A 1PFPA 3NV0A 3BNBA 1O7GB 3WOFB 2CK3H 2XGNA 1WMOA 2W2CA 1YI23 2D1WA 1K734 3WODG 2CWUA 1MNLA 4FMCA 4H61A 4K1VA 3FKAA 1SQWA 5CF1A 1FUWA 5IG0A 4X2HA 1TIJA 3LTDA 5EQLA 3IPTA 2B1XB 3G0KA 2XH9A 1LOXA 1W01A 3X42A 5AIIA 5JBSA 3EX9A 4QWTA 3EF8A 2C10A 3ER7A 1VQ93 4LZIA 3S27A 1O7PB 3I563 4HYZA 3FG4A 4RNYA 3G4S3 1N5HA 3NV0B 2RCDA 3T0UA 2P0MA 4GB5A 2QEX3 3EN1B 4WYKB 2ML6A 2W03A 2M7OA 3WA2X 1N9JA 5FGOA 2SBLA 3OX9A 4NHFA 1OACA 3LT8A 1DVCA 3KZTA 1E97A 1VQ43 5I97A 3PCSA 3WOEB 2YFIB 3E99A 2CFWA 2WGQA 3NXJA 1GY6A 1QMAA 1R4CA 5KP1A 1UI7A 2R4IA 2WO0A 4O3VA 3S5CA 1WQLB 2LYXA 3CC23 1TP6A 2CFKA 2O3OA 1W4NA 3F8XA 2HMJB 4HM0B 1E3RA 1O7WB 4XBTA 6STDA 3LYGA 3NUVA 1LXEA 1U8CB 3F40A 3UNLA 1N8QA 1VQ83 3O8YA 3LTAA 3T8NA 3B4OA 3CCR3 2WOFA 3GAXA 3HI7A 1Y4KA 1TUHA 4L8OA 1GYBA 2CH9A 4N6V0 4H3UA 1E3VA 4OUQA 4IPBA 3FSDA 1K28A 4AEQA 3EQQB 2Y74A 4HZBB 4MMZB 1JKGA 2XGLA 4GL6A 2E2VA 4KVHA 2IMJA 4LEHA 1IVUA 2P38A 3OXAA 1JB2A 1MOLA 3SVAA 3Q2PA 3X3XA 1FGTA 3A76A 3LTBA 1AVLA 3KIIA 1C7HA 3CCU3 1ROVA 3UB1A 4BTWA 3F7SA 4CDLA 4LGQA 4OVMA 4HM8B 4MEIA 1BUQA 3S28A 1GY5A 2ZDJA 1DMNA 4KFFA 3CU3A 4XDVA 4N6OB 1M1K4 3KKGA 1O7NB 4HVNA 1A67A 3KFQC 2F86B 1S5AA 1JKGB 5AIHA 1RN7A 3MKIA 4I4KA 3H51A 1K8A4 1DMMA 1ISKA 3U1WA 4FR9A 3U97A 3CCQ3 1Q40A 1UW1A 3X41A 1ASKA 4EV2A 2C11A 1IQ8A 1W6GA 4HZ9B 3NX0A 3QK9A 5IG3A 1K9M4 2YX9A 5CK6A 3PYJA 4N6LA 5TGNA 1G96A 1OCVA 2WOHA 2XF3A 3H3HA 3HX8A 2INXA 3PGBA 2GEYA 1QAFA 1KSIA 5LC7A 2ZL8A 5IG4A 5HGRA 1TFOA 3BLZA 3CPOA 3FF0A 4HM2B 2I9WA 4HKVB 1ULIB 1D6YA 1VQP3 3EB8A 1JB4A 3HIGA 2XSHB 3JUPA 3K9MC 3VSYA 4LMIA 1Q40B 4MMYB 4WYKA 1K41A 1OUNA 3LMLA 3JUNA 4MJDA 3DGMA 1YIJ3 2D42A 2P09A 5BXQA 2XSOB 3SOAA 2CWVA 3LOYA 5CXOA 2W0QA 5D83A 2GBXB 3N8BA 1TU5A 3LT9A 1ZO2A 4N6NB 2PNCA 1NB3I 1QJGA 1WTHA 2W6JH 1AVKA 3N54B 1M904 1STDA 4N6TA 1IDPA 3K5TA 1SIHA 1NDOB 1J2BA 3SX1A 2W04A 3GWRA 2HMLB 3HK4A 5IG5A 1VZZA 3NHXA 1F8NA 2E2TA 1L5GB 3UJMA 2BMOB 3I553 3PCRA 4EC6A 3FF2A 1YJW3 1W02A 1UUVB 3JUMA 5AIFA 1M1XB 5KP4A 1LVNA 1FGMA 3B8LA 3MWZA 1OGXA 1IQXA 1QALA 3J7Yd 1W5ZA 3DY5A 3K7CA 1KC84 3CPW2 2BO9B 5D81A 1AV4A 4STDA 3CC73 1D6ZA 2WGOA 2CFGA 1N8R4 3KE7A 5AEWB 1SPUA 2CG0A 5CLKA 1W2B2 3N9HA 3F8HA 4XB5A 3CCE3 2KCDA 1WNHA 5STDA 4IIAA 4BTXA 1VQ53 3ALAA 3BNEA 4MMXB 4KFEA 4J8TA 4FCZA 3UL5A 1FGOA 3OW22 1Q824 1UUWB 2BMRB 4O2HA 1IVVA 1JB5A 1LNHA 3MG3A 3DGNA 3FH1A 2HMMB 1OH0A 4JF8A 1HU9A 4K1UA 2A15A 1OHSA 3BNDA 2P0XA 1GD3A 3M8CA 2UX0A 2RSXA 2CWTA 3CCJ3 3SXXA 4EYCA 2F98A 1DMQA 2PZVA 3LZAA 4K90B 1Q7Y4 2Q07A 3TDGA 1KD14 1DVDA 1JJ22 4XM4A 1IT8A 2FNQA 3HZPA 3WDGB 1RJOA 1UI8A 3BB9A 4FCMA 1VQM3 3MHEA 1YIT3 3K63A 3OWSA 3MYTA 1VQL3 3GZXB 3NQZA 1W00A 1VQ63 1O7HB 1W2ZA 3FCSB 2STDA 4L7KA 4AKYA 1QVF2 5D82A 2CHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVC A;  1STF I;  1R4C A;  1CEW I;  1GD4 A;  1CYV A;  4N6N B;  1NB3 I;  3L0R A;  4IT7 A;  2O9U X;  4N6T A;  1LXE A;  5A0O B;  5ELU A;  3GAX A;  3PXM A;  2CH9 A;  4N6V 0;  3IMA B;  5ELJ A;  3PS8 A;  3MWZ A;  2OCT A;  1A90 A;  1YVB I;  1MOL A;  3SVA A;  2BO9 B;  3Q2P A;  1IV9 A;  1N5P A;  4CCV A;  1EQK A;  1WNH A;  1M9G A;  4TX4 A;  1NB5 I;  2W9P A;  3QRD A;  1IV7 A;  4N6M A;  4N6O B;  3UL5 A;  1FA3 A;  1A67 A;  3KFQ C;  3LH4 A;  1RN7 A;  1ROA A;  1PFP A;  1CYU A;  5LC6 A;  1GD3 A;  1MNL A;  1FUW A;  3S67 A;  3NX0 A;  1TIJ A;  5EQL A;  4EYC A;  2KXG A;  3PYJ A;  4N6L A;  1DVD A;  3KSE D;  1G96 A;  1KWI A;  2W9Q A;  5LC7 A;  4LZI A;  4ZM8 A;  1N5H A;  3K9M C;  4N6U A;  1N9J A;  3UL6 A; 
#chains in the Genus database with same CATH topology
 4FMB A;  1A2V A;  3NQY A;  2OOV A;  3SLU A;  5BVB A;  1N9E A;  4Q53 A;  3SOY A;  3AHS A;  2E2U A;  4AKZ A;  1MGR A;  3MPH A;  5IEP A;  3SED A;  1TRQ A;  1SJW A;  1IU7 A;  2IUJ A;  3NM7 A;  1GS3 A;  3Q90 A;  2K0M A;  1OGZ A;  1GD4 A;  3EBY A;  1BNS A;  1CYV A;  3DGL A;  3GZR A;  3JUQ A;  2QGU A;  3EBT A;  3JVC A;  5FW5 A;  1C54 A;  1RRL A;  2MF7 A;  4OK0 A;  3GRD A;  3ZFZ A;  4O02 B;  3V92 A;  3BNC A;  3MG2 A;  3D5G A;  2LQV A;  2BU4 A;  3F9S A;  1PY3 A;  4WWU C;  3L0R A;  2JDI H;  1Q86 4;  2O9U X;  2GU3 A;  1VQO 3;  1VQ7 3;  1ZS7 A;  3G8Z A;  1I3I A;  1IT7 A;  4XBX A;  2HMN B;  1RN4 A;  1B2S A;  1LRA A;  1U5O A;  3FZW A;  2CFL A;  1RN1 A;  3MG1 A;  5ELU A;  4R4K A;  4HM5 B;  1QAK A;  4FMD A;  1AR0 A;  1QVG 2;  1JN5 B;  3NBR A;  3DM8 A;  5AIG A;  1NNV A;  2Z77 A;  4FCJ A;  4BIR A;  3CME 3;  1EA2 A;  1JZO A;  1RGE A;  3PS8 A;  5EVH A;  5IEN A;  1RCK A;  3JUO A;  1CH0 A;  2XEP A;  3NBB A;  3S29 A;  1NO3 A;  2Z76 A;  3CCS 3;  4FMA A;  1Q42 A;  3D4A A;  1RGC A;  3FG3 A;  3KSP A;  1Q81 4;  1JBR A;  1FUT A;  1W6Y A;  5DRE A;  4HJL B;  3V98 A;  1RDS A;  4PEJ A;  3F7X A;  1HYF A;  3T8U A;  3X3Y A;  1EQK A;  1GMP A;  2F99 A;  2W56 B;  3ECF A;  4HBR A;  3DH2 A;  2CX0 A;  1M9G A;  3B4P A;  4TX4 A;  3CCM 3;  1FGQ A;  2W9P A;  1BOX A;  3QRD A;  3KN4 A;  2CKF B;  4EV5 A;  3LTC A;  1WMP A;  2CW9 A;  3Q1C A;  4K61 A;  2OQE A;  3CD6 3;  4R1K A;  4HM3 B;  1B20 A;  3CNX A;  3EHC A;  1Z1S A;  3G6E 3;  2K3D A;  4HM7 B;  1FA3 A;  1FGR A;  3LH4 A;  5AEU B;  1OHP A;  2KF3 A;  2XFS A;  3WMD A;  5G2G A;  2YFJ B;  2XRX B;  2BNG A;  1ROA A;  3RGA A;  5IW9 A;  4NRE A;  3I0Y A;  4R9K A;  2KF5 A;  1CYU A;  3DZL A;  1CQS A;  2IYJ A;  4HM6 B;  1BRJ A;  1OHO A;  5LC6 A;  4I5Q A;  1PU4 A;  2OTL 3;  3CCL 3;  4JRF A;  1YGE A;  5JPU A;  3LXU X;  4HM1 B;  2RGQ A;  4HM4 B;  2Z6B A;  4RNZ A;  3KCH A;  2OWP A;  4WP5 A;  3S67 A;  5M18 A;  2BT3 A;  4XBY A;  3RDE A;  2Y73 A;  3IJE B;  1BU4 A;  3OV4 A;  2KXG A;  1IVX A;  2B24 B;  4KZ1 A;  3DMC A;  3GZY B;  3CMA 3;  1BVI A;  1ZGX A;  3KSE D;  1KWI A;  2W9Q A;  1ULJ B;  3FG1 A;  1BAN A;  2GBW B;  1FYS A;  2CIU A;  3SYU A;  2BMQ B;  1BRK A;  4ZM8 A;  2JQ5 A;  3WA3 A;  1BSB A;  1S72 3;  1HZ1 A;  2V1L A;  2ML5 A;  1IK3 A;  1YHQ 3;  2OOV C;  1NWW A;  3EE1 A;  1B21 A;  1JV2 B;  2IA7 A;  1DYU A;  2OTJ 3;  3PZW A;  1X1X A;  4N6U A;  1W7C A;  2GXF A;  3AMO A;  2H0G A;  5AYS C;  1YJN 3;  2UUG C;  3UL6 A;  1OF5 A;  4GSP A;  1WMN A;  2IUK A;  2XR8 B;  4R9L A;  3K0Z A;  1GMQ A;  1FW7 A;  1STF I;  1I70 A;  4R80 A;  5IEO A;  1RGA A;  1V58 A;  3OWY A;  4LSO A;  2GU1 A;  1CEW I;  1IVW A;  1PYL A;  2L4V A;  1I8V A;  1HKX A;  1GOU A;  3F14 A;  4WFO A;  4EBG A;  4BU4 A;  4J9A A;  4WHA A;  1RKY A;  2QIY A;  2BIR A;  5EEO A;  2ZA4 A;  4L8P A;  1BRH A;  1KQS 2;  1BRG A;  4IT7 A;  4ORL A;  3EJV A;  3AMO B;  3AGN A;  2FXT A;  3HOH A;  2CG1 A;  1W6C A;  1JNQ A;  1Q9E A;  1D6U A;  1TJD A;  3B7C A;  4U13 A;  7STD A;  1OF5 B;  5CF2 A;  3CCV 3;  2HMK B;  5A0O B;  5JPP A;  1JRQ A;  1YJ9 3;  3PXM A;  2RFR A;  1BNR A;  1B3S A;  1GY7 A;  2FGT A;  1BNF A;  3DXO A;  4BTY A;  1JN5 A;  3STD A;  1EKM A;  1X1U A;  1ZX2 A;  5G1K A;  3CNM A;  4EXR A;  1T5Y A;  1NU3 A;  3IMA B;  4O8S A;  1RRH A;  3D9R A;  1RGK A;  2KRT A;  1RGL A;  5ELJ A;  1VQK 3;  4RBN A;  1TTO A;  3DUK A;  1LQG C;  3ROB A;  1OPY A;  2GEX A;  1NJI 4;  2OCT A;  1TFK A;  5DRV A;  3FGY A;  5AYR B;  1O7M B;  3HII A;  4X2O A;  1A90 A;  1YVB I;  2Z7A A;  3D79 A;  5IER A;  2CC3 A;  3X3Z A;  3FLJ A;  3G71 3;  1IV9 A;  3EC9 A;  3VF1 A;  1SII A;  3MSO A;  4GHO A;  4N3V A;  1N5P A;  2OQE C;  3DGO A;  3GZB A;  2ZHX B;  1EG9 B;  1I2F A;  3CXC 2;  4CCV A;  2QA4 3;  3EN8 A;  1IQY A;  2W56 A;  3D3L A;  3BU4 A;  3NBJ A;  4RZM A;  3VGN A;  2HMO B;  1UCI A;  1A2K A;  1V74 A;  3G16 A;  3NM2 A;  3OWU A;  3V99 A;  2BHM A;  3RGR A;  3X40 A;  5IF6 A;  5BIR A;  1NB5 I;  1IV7 A;  1US1 A;  4N6M A;  2K54 A;  2YFL B;  4XDW A;  2P05 A;  8CHO A;  3CC4 3;  1AQZ A;  1A2P A;  1RHL A;  2CFD A;  5KP3 A;  4G1M B;  4KFD A;  1YGW A;  2XFT A;  1VQQ A;  2SAR A;  5M1A A;  2MC8 A;  5AI1 A;  1PFP A;  1R4Y A;  3NV0 A;  3BNB A;  1O7G B;  3WOF B;  2CK3 H;  2XGN A;  1WMO A;  2W2C A;  1YI2 3;  2D1W A;  1K73 4;  3WOD G;  1LQM B;  1MNL A;  2CWU A;  4FMC A;  4H61 A;  4K1V A;  5RNT A;  3FKA A;  1SQW A;  5CF1 A;  1FUW A;  2GSP A;  1G02 A;  4KT3 B;  5IG0 A;  4X2H A;  4ILF A;  1TIJ A;  3LTD A;  5EQL A;  3IPT A;  2B1X B;  3G0K A;  4EW5 A;  2AAD A;  2XH9 A;  1LOX A;  1W01 A;  3X42 A;  5AII A;  5JBS A;  3GSP A;  3EX9 A;  4QWT A;  3EF8 A;  2C10 A;  3ER7 A;  1VQ9 3;  1BSC A;  4LZI A;  3S27 A;  1O7P B;  3I56 3;  4HYZ A;  3FG4 A;  4RNY A;  3G4S 3;  1N5H A;  3NV0 B;  2RCD A;  2UGI A;  3T0U A;  2P0M A;  4GB5 A;  1LOY A;  2QEX 3;  3EN1 B;  4WYK B;  4DKI A;  2ML6 A;  2W03 A;  2M7O A;  1BNE A;  1N9J A;  3WA2 X;  5FGO A;  2SBL A;  3OX9 A;  4NHF A;  1I2E A;  1OAC A;  3LT8 A;  1DVC A;  3KZT A;  1E97 A;  1VQ4 3;  3ZG0 A;  5I97 A;  3PCS A;  3WOE B;  2CX1 A;  2KF4 A;  2YFI B;  3E99 A;  2CFW A;  2WGQ A;  3NXJ A;  1GY6 A;  1QMA A;  1R4C A;  1YVS A;  1RTU A;  1MWT A;  5KP1 A;  3URP A;  1UI7 A;  2R4I A;  2WO0 A;  4O3V A;  5BU4 A;  2C4B A;  3S5C A;  1WQL B;  2LYX A;  3CC2 3;  1TP6 A;  2CFK A;  2O3O A;  1DET A;  1W4N A;  3F8X A;  6GSP A;  4NPB A;  2HMJ B;  4HM0 B;  1E3R A;  4J5G A;  1AY7 A;  1MWR A;  1O7W B;  1GOY A;  1MWU A;  2RNT A;  4XBT A;  6STD A;  1V57 A;  3LYG A;  3NUV A;  2RBI A;  1LXE A;  1U8C B;  3F40 A;  2R41 A;  3UNL A;  1EUI C;  1N8Q A;  1VQ8 3;  3O8Y A;  3LTA A;  3T8N A;  3WHO A;  3B4O A;  3CCR 3;  2WOF A;  3GAX A;  3HI7 A;  1Y4K A;  1TUH A;  4L8O A;  1GYB A;  4LYL B;  1BNJ A;  2CH9 A;  4N6V 0;  4H3U A;  1E3V A;  2F56 A;  1B2X A;  4OUQ A;  4IPB A;  2AAE A;  3FSD A;  9RNT A;  1K28 A;  1GOV A;  1B2U A;  4AEQ A;  4BL3 A;  3EQQ B;  2Y74 A;  4HZB B;  4MMZ B;  1JKG A;  2XGL A;  4GL6 A;  2E2V A;  4KVH A;  2IMJ A;  4LEH A;  1IVU A;  4J5K A;  2P38 A;  1JBS A;  4CPK A;  3OXA A;  1JB2 A;  1MOL A;  3SVA A;  3Q2P A;  3X3X A;  1FGT A;  3A76 A;  3LTB A;  1AVL A;  3KII A;  1T3B A;  1C7H A;  3CCU 3;  1ROV A;  1BUJ A;  3UB1 A;  1T2H A;  4BTW A;  3F7S A;  4CDL A;  2F4Y A;  4LGQ A;  4OVM A;  4HM8 B;  4MEI A;  1B2Z A;  1SAR A;  1BUQ A;  3S28 A;  3BIR A;  1GY5 A;  2ZDJ A;  1DMN A;  1BRI A;  4KFF A;  3CU3 A;  4XDV A;  1UCK A;  4N6O B;  1T2I A;  1BAO A;  3KKG A;  1M1K 4;  1O7N B;  4HVN A;  1A67 A;  3KFQ C;  2F86 B;  1S5A A;  1JKG B;  1Q7H A;  2KAA A;  1X1Y A;  5AIH A;  1RN7 A;  3MKI A;  1GMR A;  1UDI I;  4I4K A;  3H51 A;  1K8A 4;  2F5M A;  1DMM A;  1ISK A;  3U1W A;  1MGW A;  4FR9 A;  3U97 A;  3CCQ 3;  1Q40 A;  1UW1 A;  3X41 A;  3AGO A;  1ASK A;  4BL2 A;  4EV2 A;  1FUS A;  1RCL A;  2C11 A;  1IQ8 A;  1W6G A;  4HZ9 B;  1I0V A;  3NX0 A;  3QK9 A;  5IG3 A;  1K9M 4;  1G0T A;  2YX9 A;  1UGI A;  5CK6 A;  3PYJ A;  4N6L A;  5TGN A;  1G96 A;  1OCV A;  2WOH A;  1MWS A;  1FZU A;  2XF3 A;  3H3H A;  2INX A;  3HX8 A;  2GEY A;  3PGB A;  1QAF A;  1KSI A;  5LC7 A;  4CJN A;  1LOV A;  2ZL8 A;  5IG4 A;  5HGR A;  1YNV X;  1TFO A;  1VQN 3;  3BLZ A;  3CPO A;  3FF0 A;  1BNI A;  4HM2 B;  1B2M A;  2I9W A;  2F5W A;  1ULI B;  1D6Y A;  4HKV B;  3EB8 A;  1JB4 A;  3HIG A;  2XSH B;  3JUP A;  3K9M C;  4HOH A;  5G1L A;  3VSY A;  4LMI A;  1GSP A;  1Q40 B;  1RGH A;  4MMY B;  4WYK A;  1K41 A;  1OUN A;  3LML A;  3JUN A;  4RNT A;  4MJD A;  3DGM A;  1YIJ 3;  2D42 A;  2P09 A;  5BXQ A;  1LOW A;  2XSO B;  3SOA A;  2CWV A;  3LOY A;  5CXO A;  1RSN A;  2W0Q A;  5D83 A;  2GBX B;  3N8B A;  1UGH I;  3LT9 A;  1TU5 A;  1UUG B;  1ZO2 A;  4N6N B;  2PNC A;  1BRS A;  1I0X A;  1B27 A;  1NB3 I;  1AVK A;  1QJG A;  1WTH A;  2KF6 A;  2W6J H;  3N54 B;  1M90 4;  1STD A;  3WR2 A;  4N6T A;  1IDP A;  2IY2 A;  1BIR A;  3K5T A;  1SIH A;  1NDO B;  1RNB A;  1J2B A;  3SX1 A;  1BSE A;  2W04 A;  3GWR A;  2HML B;  3HK4 A;  5IG5 A;  1VZZ A;  3NHX A;  1F8N A;  2E2T A;  1L5G B;  3UJM A;  1X1W A;  2BMO B;  3RNT A;  1IYY A;  3I55 3;  3PCR A;  4EC6 A;  3FF2 A;  1LNI A;  1YJW 3;  1W02 A;  1UUV B;  3JUM A;  1BSA A;  5AIF A;  6RNT A;  1M1X B;  5KP4 A;  1LVN A;  1FGM A;  3B8L A;  1BNG A;  3MWZ A;  1I3F A;  1OGX A;  1IQX A;  1QAL A;  3J7Y d;  1W5Z A;  3DY5 A;  3K7C A;  1KC8 4;  3CPW 2;  2BO9 B;  5D81 A;  5GSP A;  1AV4 A;  4STD A;  3CC7 3;  8RNT A;  7GSP A;  1D6Z A;  1EEJ A;  2WGO A;  2CFG A;  1N8R 4;  2J8X B;  3KE7 A;  1SPU A;  2CG0 A;  5CLK A;  5AEW B;  3N9H A;  3F8H A;  4XB5 A;  3CCE 3;  1W2B 2;  2KCD A;  1JBT A;  2L1S A;  1WNH A;  2H0H A;  5STD A;  4IIA A;  1RGG A;  3A5E A;  4BTX A;  1VQ5 3;  3ALA A;  3BNE A;  4MMX B;  4KFE A;  4J8T A;  4FCZ A;  3UL5 A;  1RNT A;  1FGO A;  3OW2 2;  1Q82 4;  1UUW B;  2BMR B;  4O2H A;  1IVV A;  1JB5 A;  1LNH A;  3MG3 A;  3DGN A;  1BSD A;  2HMM B;  3FH1 A;  1DE3 A;  1OH0 A;  1RLS A;  3Q3F A;  1HU9 A;  4JF8 A;  5HOH A;  4K1U A;  1VQP 3;  2A15 A;  3ZG5 A;  1OHS A;  3BND A;  2P0X A;  1GD3 A;  1RGF A;  3M8C A;  4HAA A;  2UX0 A;  2RSX A;  5M19 A;  3DGY A;  2CWT A;  3CCJ 3;  1RMS A;  3AHW A;  1TRP A;  3SXX A;  4EYC A;  2F98 A;  1DMQ A;  2PZV A;  3LZA A;  4K90 B;  1Q7Y 4;  2Q07 A;  3TDG A;  1KD1 4;  1UCL A;  1DVD A;  3D5I A;  2H0I A;  1JJ2 2;  4XM4 A;  1IT8 A;  2FNQ A;  3HZP A;  3WDG B;  1RJO A;  1UI8 A;  3BB9 A;  4FCM A;  1VQM 3;  3MHE A;  1I2G A;  1YIT 3;  1UCJ A;  3K63 A;  3OWS A;  3MYT A;  1VQL 3;  3GZX B;  3NQZ A;  1W00 A;  1VQ6 3;  2HOH A;  1O7H B;  1W2Z A;  3FCS B;  2STD A;  1JZD A;  7RNT A;  4L7K A;  4AKY A;  1QVF 2;  1BGS A;  5D82 A;  2CHC A;  1BRN L; 
#chains in the Genus database with same CATH homology
 4FMB A;  1A2V A;  3NQY A;  2OOV A;  3SLU A;  5BVB A;  1N9E A;  4Q53 A;  3SOY A;  4AKZ A;  2E2U A;  5IEP A;  3MPH A;  3SED A;  1SJW A;  1IU7 A;  2IUJ A;  3NM7 A;  1GS3 A;  3Q90 A;  2K0M A;  1OGZ A;  1GD4 A;  3EBY A;  1CYV A;  3DGL A;  3GZR A;  3JUQ A;  2QGU A;  3EBT A;  3JVC A;  5FW5 A;  1RRL A;  2MF7 A;  4OK0 A;  3GRD A;  4O02 B;  3V92 A;  3BNC A;  3MG2 A;  2LQV A;  3F9S A;  4WWU C;  3L0R A;  2JDI H;  1Q86 4;  2O9U X;  2GU3 A;  1VQO 3;  1VQ7 3;  3G8Z A;  1IT7 A;  4XBX A;  2HMN B;  1U5O A;  3FZW A;  2CFL A;  3MG1 A;  5ELU A;  4R4K A;  4HM5 B;  1QAK A;  4FMD A;  1AR0 A;  1QVG 2;  1JN5 B;  3NBR A;  3DM8 A;  5AIG A;  2Z77 A;  4FCJ A;  3CME 3;  1EA2 A;  5EVH A;  3PS8 A;  5IEN A;  3JUO A;  2XEP A;  3NBB A;  3S29 A;  1NO3 A;  2Z76 A;  3CCS 3;  4FMA A;  1Q42 A;  3FG3 A;  3KSP A;  1Q81 4;  1W6Y A;  5DRE A;  4HJL B;  3V98 A;  4PEJ A;  3F7X A;  3T8U A;  3X3Y A;  1EQK A;  2F99 A;  2W56 B;  3ECF A;  4HBR A;  1M9G A;  3B4P A;  4TX4 A;  3CCM 3;  1FGQ A;  2W9P A;  3QRD A;  3KN4 A;  2CKF B;  4EV5 A;  3LTC A;  1WMP A;  2CW9 A;  3Q1C A;  4K61 A;  2OQE A;  3CD6 3;  4R1K A;  4HM3 B;  3CNX A;  3EHC A;  3G6E 3;  1Z1S A;  4HM7 B;  1FA3 A;  1FGR A;  3LH4 A;  5AEU B;  1OHP A;  2XFS A;  3WMD A;  5G2G A;  2YFJ B;  2XRX B;  2BNG A;  1ROA A;  3RGA A;  5IW9 A;  4NRE A;  3I0Y A;  4R9K A;  1CYU A;  3DZL A;  1CQS A;  4HM6 B;  1PU4 A;  1OHO A;  5LC6 A;  2OTL 3;  3CCL 3;  4JRF A;  1YGE A;  5JPU A;  3LXU X;  4HM1 B;  2RGQ A;  4HM4 B;  2Z6B A;  4RNZ A;  2OWP A;  4WP5 A;  3S67 A;  2BT3 A;  4XBY A;  3RDE A;  2Y73 A;  3IJE B;  3OV4 A;  2KXG A;  1IVX A;  2B24 B;  4KZ1 A;  3DMC A;  3GZY B;  3CMA 3;  3KSE D;  1KWI A;  2W9Q A;  1ULJ B;  3FG1 A;  2GBW B;  2CIU A;  2BMQ B;  4ZM8 A;  2JQ5 A;  3WA3 A;  1S72 3;  2V1L A;  2ML5 A;  1IK3 A;  1YHQ 3;  2OOV C;  1NWW A;  3EE1 A;  1JV2 B;  2IA7 A;  1DYU A;  2OTJ 3;  3PZW A;  4N6U A;  1W7C A;  2GXF A;  3AMO A;  5AYS C;  1YJN 3;  3UL6 A;  1OF5 A;  2IUK A;  1WMN A;  2XR8 B;  4R9L A;  3K0Z A;  1STF I;  4R80 A;  5IEO A;  3OWY A;  4LSO A;  2GU1 A;  1CEW I;  1IVW A;  2L4V A;  1HKX A;  3F14 A;  4WFO A;  4EBG A;  4J9A A;  4WHA A;  1RKY A;  2QIY A;  5EEO A;  4L8P A;  1KQS 2;  4IT7 A;  4ORL A;  3EJV A;  3AMO B;  2FXT A;  2CG1 A;  7STD A;  1W6C A;  1JNQ A;  3B7C A;  1D6U A;  4U13 A;  1OF5 B;  5CF2 A;  3CCV 3;  2HMK B;  5A0O B;  5JPP A;  1JRQ A;  1YJ9 3;  3PXM A;  2RFR A;  1GY7 A;  2FGT A;  4BTY A;  3DXO A;  1JN5 A;  3STD A;  1EKM A;  1ZX2 A;  3CNM A;  4EXR A;  1T5Y A;  1NU3 A;  3IMA B;  4O8S A;  1RRH A;  3D9R A;  2KRT A;  1VQK 3;  5ELJ A;  4RBN A;  3DUK A;  3ROB A;  1OPY A;  2GEX A;  1NJI 4;  2OCT A;  1TFK A;  5DRV A;  3FGY A;  5AYR B;  1O7M B;  3HII A;  4X2O A;  1A90 A;  1YVB I;  2Z7A A;  5IER A;  2CC3 A;  3X3Z A;  3FLJ A;  3G71 3;  1IV9 A;  3EC9 A;  3VF1 A;  1SII A;  3MSO A;  4N3V A;  3CXC 2;  1N5P A;  2OQE C;  3DGO A;  3GZB A;  1EG9 B;  4CCV A;  2QA4 3;  3EN8 A;  1IQY A;  2W56 A;  3D3L A;  3NBJ A;  4RZM A;  3VGN A;  1VQN 3;  2HMO B;  1V74 A;  1A2K A;  3V99 A;  3G16 A;  3NM2 A;  3OWU A;  3X40 A;  2BHM A;  3RGR A;  5IF6 A;  1NB5 I;  1IV7 A;  1US1 A;  4N6M A;  2K54 A;  2YFL B;  4XDW A;  2P05 A;  8CHO A;  3CC4 3;  2CFD A;  5KP3 A;  4G1M B;  4KFD A;  2XFT A;  2MC8 A;  5AI1 A;  1PFP A;  3NV0 A;  3BNB A;  1O7G B;  3WOF B;  2CK3 H;  2XGN A;  1WMO A;  2W2C A;  1YI2 3;  2D1W A;  1K73 4;  3WOD G;  2CWU A;  1MNL A;  4FMC A;  4H61 A;  4K1V A;  3FKA A;  1SQW A;  5CF1 A;  1FUW A;  5IG0 A;  4X2H A;  1TIJ A;  3LTD A;  5EQL A;  3IPT A;  2B1X B;  3G0K A;  2XH9 A;  1LOX A;  1W01 A;  3X42 A;  5AII A;  5JBS A;  3EX9 A;  4QWT A;  3EF8 A;  2C10 A;  3ER7 A;  1VQ9 3;  4LZI A;  3S27 A;  1O7P B;  3I56 3;  4HYZ A;  3FG4 A;  4RNY A;  3G4S 3;  1N5H A;  3NV0 B;  2RCD A;  3T0U A;  2P0M A;  4GB5 A;  2QEX 3;  3EN1 B;  4WYK B;  2ML6 A;  2W03 A;  2M7O A;  3WA2 X;  1N9J A;  5FGO A;  2SBL A;  3OX9 A;  4NHF A;  1OAC A;  3LT8 A;  1DVC A;  3KZT A;  1E97 A;  1VQ4 3;  5I97 A;  3PCS A;  3WOE B;  2YFI B;  3E99 A;  2CFW A;  2WGQ A;  3NXJ A;  1GY6 A;  1QMA A;  1R4C A;  5KP1 A;  1UI7 A;  2R4I A;  2WO0 A;  4O3V A;  3S5C A;  1WQL B;  2LYX A;  3CC2 3;  1TP6 A;  2CFK A;  2O3O A;  1W4N A;  3F8X A;  2HMJ B;  4HM0 B;  1E3R A;  1O7W B;  4XBT A;  6STD A;  3LYG A;  3NUV A;  1LXE A;  1U8C B;  3F40 A;  3UNL A;  1N8Q A;  1VQ8 3;  3O8Y A;  3LTA A;  3T8N A;  3B4O A;  3CCR 3;  2WOF A;  3GAX A;  3HI7 A;  1Y4K A;  1TUH A;  4L8O A;  1GYB A;  2CH9 A;  4N6V 0;  4H3U A;  1E3V A;  4OUQ A;  4IPB A;  3FSD A;  1K28 A;  4AEQ A;  3EQQ B;  2Y74 A;  4HZB B;  4MMZ B;  1JKG A;  2XGL A;  4GL6 A;  2E2V A;  4KVH A;  2IMJ A;  4LEH A;  1IVU A;  2P38 A;  3OXA A;  1JB2 A;  1MOL A;  3SVA A;  3Q2P A;  3X3X A;  1FGT A;  3A76 A;  3LTB A;  1AVL A;  3KII A;  1C7H A;  3CCU 3;  1ROV A;  3UB1 A;  4BTW A;  3F7S A;  4CDL A;  4LGQ A;  4OVM A;  4HM8 B;  4MEI A;  1BUQ A;  3S28 A;  1GY5 A;  2ZDJ A;  1DMN A;  4KFF A;  3CU3 A;  4XDV A;  4N6O B;  1M1K 4;  3KKG A;  1O7N B;  4HVN A;  1A67 A;  3KFQ C;  2F86 B;  1S5A A;  1JKG B;  5AIH A;  1RN7 A;  3MKI A;  4I4K A;  3H51 A;  1K8A 4;  1DMM A;  1ISK A;  3U1W A;  4FR9 A;  3U97 A;  3CCQ 3;  1Q40 A;  1UW1 A;  3X41 A;  1ASK A;  4EV2 A;  2C11 A;  1IQ8 A;  1W6G A;  4HZ9 B;  3NX0 A;  3QK9 A;  5IG3 A;  1K9M 4;  2YX9 A;  5CK6 A;  3PYJ A;  4N6L A;  5TGN A;  1G96 A;  1OCV A;  2WOH A;  2XF3 A;  3H3H A;  3HX8 A;  2INX A;  3PGB A;  2GEY A;  1QAF A;  1KSI A;  5LC7 A;  2ZL8 A;  5IG4 A;  5HGR A;  1TFO A;  3BLZ A;  3CPO A;  3FF0 A;  4HM2 B;  2I9W A;  4HKV B;  1ULI B;  1D6Y A;  1VQP 3;  3EB8 A;  1JB4 A;  3HIG A;  2XSH B;  3JUP A;  3K9M C;  3VSY A;  4LMI A;  1Q40 B;  4MMY B;  4WYK A;  1K41 A;  1OUN A;  3LML A;  3JUN A;  4MJD A;  3DGM A;  1YIJ 3;  2D42 A;  2P09 A;  5BXQ A;  2XSO B;  3SOA A;  2CWV A;  3LOY A;  5CXO A;  2W0Q A;  5D83 A;  2GBX B;  3N8B A;  1TU5 A;  3LT9 A;  1ZO2 A;  4N6N B;  2PNC A;  1NB3 I;  1QJG A;  1WTH A;  2W6J H;  1AVK A;  3N54 B;  1M90 4;  1STD A;  4N6T A;  1IDP A;  3K5T A;  1SIH A;  1NDO B;  1J2B A;  3SX1 A;  2W04 A;  3GWR A;  2HML B;  3HK4 A;  5IG5 A;  1VZZ A;  3NHX A;  1F8N A;  2E2T A;  1L5G B;  3UJM A;  2BMO B;  3I55 3;  3PCR A;  4EC6 A;  3FF2 A;  1YJW 3;  1W02 A;  1UUV B;  3JUM A;  5AIF A;  1M1X B;  5KP4 A;  1LVN A;  1FGM A;  3B8L A;  3MWZ A;  1OGX A;  1IQX A;  1QAL A;  3J7Y d;  1W5Z A;  3DY5 A;  3K7C A;  1KC8 4;  3CPW 2;  2BO9 B;  5D81 A;  1AV4 A;  4STD A;  3CC7 3;  1D6Z A;  2WGO A;  2CFG A;  1N8R 4;  3KE7 A;  5AEW B;  1SPU A;  2CG0 A;  5CLK A;  1W2B 2;  3N9H A;  3F8H A;  4XB5 A;  3CCE 3;  2KCD A;  1WNH A;  5STD A;  4IIA A;  4BTX A;  1VQ5 3;  3ALA A;  3BNE A;  4MMX B;  4KFE A;  4J8T A;  4FCZ A;  3UL5 A;  1FGO A;  3OW2 2;  1Q82 4;  1UUW B;  2BMR B;  4O2H A;  1IVV A;  1JB5 A;  1LNH A;  3MG3 A;  3DGN A;  3FH1 A;  2HMM B;  1OH0 A;  4JF8 A;  1HU9 A;  4K1U A;  2A15 A;  1OHS A;  3BND A;  2P0X A;  1GD3 A;  3M8C A;  2UX0 A;  2RSX A;  2CWT A;  3CCJ 3;  3SXX A;  4EYC A;  2F98 A;  1DMQ A;  2PZV A;  3LZA A;  4K90 B;  1Q7Y 4;  2Q07 A;  3TDG A;  1KD1 4;  1DVD A;  1JJ2 2;  4XM4 A;  1IT8 A;  2FNQ A;  3HZP A;  3WDG B;  1RJO A;  1UI8 A;  3BB9 A;  4FCM A;  1VQM 3;  3MHE A;  1YIT 3;  3K63 A;  3OWS A;  3MYT A;  1VQL 3;  3GZX B;  3NQZ A;  1W00 A;  1VQ6 3;  1O7H B;  1W2Z A;  3FCS B;  2STD A;  4L7K A;  4AKY A;  1QVF 2;  5D82 A;  2CHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...