4N6OB

Crystal structure of reduced legumain in complex with cystatin e/m
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
GELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords legumain
publication title Structure and mechanism of an aspartimide-dependent Peptide ligase in human legumain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6oB00
2KXGA 1TIJA 1G96A 4N6V0 1KWIA 1NB5I 4N6MA 3UL6A 3QRDA 2CH9A 1WNHA 4CCVA 1DVDA 4IT7A 1CEWI 1GD3A 1RN7A 3SVAA 1IV9A 4LZIA 2BO9B 4N6LA 3S67A 3UL5A 1A67A 3MWZA 3IMAB 1MOLA 4N6NB 1NB3I 3PYJA 3KSED 1LXEA 3PXMA 4N6TA 4EYCA 1FA3A 1MNLA 3PS8A 2OCTA 3K9MC 1EQKA 5EQLA 3GAXA 1CYVA 3KFQC 1N9JA 1CYUA 1YVBI 1ROAA 1R4CA 1PFPA 1FUWA 4ZM8A 5LC6A 2W9PA 1A90A 2O9UX 1N5HA 1GD4A 4N6OB 1STFI 4N6UA 5A0OB 5LC7A 1IV7A 5ELJA 3NX0A 5ELUA 1DVCA 3Q2PA 4TX4A 3L0RA 1N5PA 2W9QA 1M9GA 3LH4A
chains in the Genus database with same CATH superfamily
4BU4A 3UJMA 4BL2A 3CCM3 3Q1CA 1IQ8A 1BIRA 1TRQA 4MJDA 1G96A 1SARA 1TTOA 3AHWA 3DZLA 1RNBA 1KWIA 2GSPA 2ZDJA 3EBYA 2KF6A 1VQ83 3RGAA 1B21A 4KFDA 2IUJA 3G16A 3AMOA 1YHQ3 1IQYA 1EUIC 2IYJA 3QRDA 4J8TA 1PY3A 1N9EA 1W4NA 1VQQA 1SIHA 1JB2A 2HMOB 2CFKA 3F8XA 4HZ9B 3URPA 5I97A 1GSPA 1HZ1A 4KFEA 3DGLA 1LQGC 1W5ZA 2BIRA 1JN5B 1AY7A 2RSXA 4HOHA 3LZAA 3EN1B 1DETA 1D6YA 2I9WA 1BUQA 2F98A 5BVBA 3SLUA 2K54A 4HYZA 3FCSB 2MF7A 1Q40A 1IV9A 2ZHXB 2E2TA 4JRFA 4LZIA 5IENA 4HM5B 1JNQA 2E2VA 1RTUA 2GEYA 1IQXA 4XBYA 8CHOA 2P05A 1B2XA 4I5QA 1YIT3 1SPUA 3T8NA 1US1A 3NHXA 4CPKA 1B20A 4K61A 3CCR3 1MWTA 1G0TA 1GOYA 1LVNA 3A5EA 3EX9A 3KSED 4FCZA 2GEXA 3K63A 3F8HA 4EYCA 1JBTA 1PU4A 2B24B 4FMCA 2OCTA 2Z77A 1GMRA 3LTAA 1J2BA 1QALA 1DYUA 5JBSA 2L4VA 1EQKA 2QEX3 3EN8A 1BRJA 2KAAA 3BB9A 1D6UA 1CYVA 3QK9A 1O7WB 3MKIA 1BNGA 3MYTA 3BNCA 1R4YA 1I0VA 1M1K4 3CCL3 1OHSA 2SBLA 5G2GA 1GMQA 3PGBA 1UI8A 3WODG 5BIRA 1S5AA 1BRSA 2FNQA 1CH0A 1R4CA 3NQYA 1B27A 2XSHB 3ZG5A 4BTWA 2ZL8A 4NPBA 3CNMA 3VGNA 1YI23 2Z7AA 4ZM8A 4PEJA 4CJNA 7STDA 2O9UX 4R9KA 5AIGA 1LOXA 1A2PA 5IW9A 2Z6BA 1RGHA 7RNTA 3WMDA 1BSEA 5HOHA 3GRDA 2W6JH 3X3YA 2GBWB 1B2ZA 1WQLB 3HZPA 1NU3A 3CCJ3 1I8VA 3CCS3 2GU1A 2INXA 4N6UA 1HKXA 3F9SA 5A0OB 1FYSA 2QGUA 3PCRA 3HX8A 4XBXA 3JVCA 1TRPA 4BTYA 1STDA 3IPTA 4MMXB 1IV7A 2CIUA 5ELJA 1RGAA 2F86B 5EEOA 4N3VA 6RNTA 1ZO2A 1RGGA 4OK0A 5STDA 1MGWA 1UGIA 2RBIA 3EE1A 2LQVA 2W56A 4HJLB 4HM1B 1WTHA 1N5PA 3L0RA 5CXOA 3CD63 3SOAA 4HM8B 2CX0A 1FGOA 3S29A 3BNDA 4FMAA 4CDLA 4K90B 1VQK3 1GY6A 2BT3A 2ZA4A 1BANA 3D3LA 3EC9A 6GSPA 5BXQA 3S28A 1QAFA 3BLZA 1YJW3 1TP6A 3HOHA 3LTDA 4HM2B 5FW5A 1ULJB 1TIJA 3G6E3 1T2HA 2P38A 5IG3A 1V58A 4RNZA 3KCHA 4DKIA 1GY7A 1QAKA 2XFTA 1LOVA 2BMRB 1E3RA 2JQ5A 5AEUB 1JKGB 1UCKA 4KT3B 1ASKA 2XF3A 1IVVA 3NQZA 3DM8A 3LOYA 1IU7A 1OHPA 1K28A 2WO0A 2XH9A 2BNGA 2F99A 1WNHA 1SJWA 5IEPA 3I0YA 3DGOA 1Q7Y4 1RN4A 1O7GB 3G713 5RNTA 1BU4A 4XDVA 2WOHA 1YNVX 1I2EA 1BOXA 4LEHA 3CME3 3OWSA 2D1WA 1V74A 4IIAA 2CWVA 3AGOA 3BIRA 1JJ22 4N6LA 4J5KA 5CF2A 3CXC2 1DE3A 3S67A 3UL5A 1A67A 3MWZA 2KF5A 1VQO3 1T3BA 3CPW2 1W2B2 1W7CA 2IUKA 4L7KA 3PCSA 4K1UA 5G1LA 2IY2A 1BNRA 5GSPA 3DH2A 3CCU3 1GOUA 2R41A 3GZYB 3PXMA 5AYSC 2KF3A 4N6TA 1UCIA 1YVSA 2H0IA 3T8UA 1C54A 1FA3A 1MNLA 1EA2A 1OHOA 4EW5A 1BUJA 3NM7A 1RCLA 1VZZA 4LMIA 3LYGA 2XRXB 3FG3A 3NXJA 5KP3A 1YGWA 3U97A 4WYKA 4BL3A 2PNCA 1GY5A 5EQLA 1NNVA 1W6YA 2WOFA 4H3UA 1BRIA 3OW22 1BSBA 1ZS7A 2CKFB 3K5TA 1DMMA 5D81A 4LGQA 1OPYA 2CFLA 2OTJ3 3CCQ3 3ZG0A 1N9JA 1NO3A 4ILFA 3JUOA 4WWUC 1BRHA 5D82A 3BNBA 3LMLA 1D6ZA 4KZ1A 4NREA 3FG4A 1HU9A 4WP5A 5G1KA 3LTBA 3NBBA 2Q07A 3ROBA 1FUTA 4Q53A 3Q3FA 3NBJA 4HVNA 1BVIA 4O3VA 1FUWA 3CPOA 3IJEB 2H0HA 1L5GB 1FGRA 4XBTA 4KFFA 3O8YA 3UNLA 5CF1A 1RSNA 3GSPA 1AVLA 1UUVB 2QA43 3CMA3 3D5IA 4R1KA 2GBXB 2CX1A 1DMQA 2D42A 1VQ43 3DXOA 2RGQA 5AIHA 1OF5A 3GWRA 1VQ93 3MG3A 5CK6A 3I553 2K0MA 3STDA 2MC8A 2JDIH 1RJOA 1KSIA 3KE7A 4HBRA 3LT9A 1OUNA 4R9LA 2AAEA 5IEOA 3V92A 4HM7B 1UI7A 1RRLA 4U13A 1I70A 2OOVA 3X3XA 1M904 1RGKA 3BU4A 2XFSA 4WHAA 1VQ63 1E3VA 3NM2A 1V57A 1JBRA 1SQWA 1K734 2W9QA 1QJGA 3MHEA 3N8BA 2W03A 1C7HA 1F8NA 2J8XB 3SOYA 1NDOB 2XGNA 4R4KA 4RNTA 3LTCA 2OTL3 2WGQA 1VQL3 1M9GA 5BU4A 2CFDA 1I3FA 3H51A 4NHFA 1W2ZA 1BNJA 3KN4A 3RNTA 2XR8B 4O02B 1KD14 1I3IA 2V1LA 1X1UA 2HMNB 1RDSA 2CHCA 1RHLA 4JF8A 2PZVA 4LSOA 2K3DA 5M1AA 5IF6A 3NV0A 4N6V0 1ISKA 5HGRA 1A2VA 1NB5I 1E97A 3DGMA 1JZDA 2SARA 1YGEA 3MG2A 4GL6A 1LNIA 2UGIA 3FKAA 5FGOA 4GHOA 3WHOA 3CCV3 4N6MA 3MSOA 4EBGA 2A15A 5AEWB 4HKVB 3D79A 2FXTA 2CH9A 3SX1A 3AMOB 1NWWA 2OOVC 1MWRA 4OUQA 2CW9A 3SXXA 4BTXA 9RNTA 1OGXA 1UGHI 3EHCA 3B7CA 4FMDA 2BMQB 4ORLA 4CCVA 1VQ73 1DVDA 4IT7A 3GZRA 1CEWI 1TFKA 1O7NB 1GD3A 3F14A 1IYYA 3WA3A 1LRAA 1RN7A 3SVAA 3GZXB 4EC6A 3CNXA 3CC23 5IG4A 4O8SA 4STDA 1Q40B 2BMOB 1RMSA 3D5GA 1MOLA 2HMMB 3T0UA 3WOFB 1X1WA 1LOYA 2F5MA 3M8CA 3RGRA 1ROVA 1JB4A 3X3ZA 2HMKB 2HMJB 5M19A 3G8ZA 3WDGB 3PYJA 1RGLA 1IT7A 2CWUA 3FF0A 3ER7A 3PS8A 5D83A 3SEDA 1LQMB 1Q42A 4GB5A 3D9RA 3ECFA 3JUNA 3OWYA 2FGTA 1JB5A 1UCJA 1LOWA 1RGEA 8RNTA 2UUGC 2CWTA 4R80A 4AKYA 1BRNL 3DGNA 3NBRA 2IA7A 5AI1A 1G02A 1I0XA 1OF5B 3S5CA 3X41A 5AIIA 1W6GA 2P09A 2C4BA 3OXAA 3MG1A 1YIJ3 1QVF2 2LYXA 1ROAA 1Y4KA 2O3OA 5JPUA 3PZWA 1NJI4 1BNSA 1W02A 2CC3A 7GSPA 1X1YA 4L8PA 1JV2B 3WR2A 3AHSA 1FW7A 4XDWA 1BNEA 3EBTA 4GSPA 1FGTA 1JRQA 4BIRA 2F56A 1IK3A 4FCJA 2W9PA 4MEIA 2STDA 1U8CB 4AKZA 1GYBA 1TU5A 3FSDA 1AVKA 1RRHA 1TUHA 4K1VA 1N5HA 1I2GA 1O7MB 1WMOA 4FR9A 1O7PB 4AEQA 2GXFA 2KRTA 1YJN3 5IG0A 3CC43 4HAAA 2C10A 3Q90A 1STFI 3OV4A 1GMPA 1RGCA 1B2MA 3X42A 5LC7A 1VQN3 1GOVA 1Q864 3NX0A 4XM4A 2AADA 2YX9A 3JUQA 4L8OA 2YFIB 3NV0B 3DMCA 1RLSA 2XEPA 3ZFZA 1KC84 3EQQB 2BU4A 3A76A 1N8QA 3B4PA 2ML6A 3Q2PA 4TX4A 2W04A 1BAOA 1QMAA 1N8R4 1B2UA 1U5OA 2W56B 2YFJB 1OCVA 1ZX2A 2KCDA 4I4KA 3AGNA 1K9M4 2P0MA 1RCKA 1KQS2 3G4S3 3FZWA 5TGNA 1MWSA 1UUWB 1FGMA 2W2CA 2YFLB 1UUGB 3E99A 3OWUA 4FCMA 4KVHA 2KXGA 3J7Yd 1EG9B 1PYLA 1Q7HA 3K7CA 3LT8A 3RDEA 2UX0A 1OGZA 1UW1A 1UCLA 1JKGA 2WGOA 4FMBA 3N9HA 1VQP3 1AQZA 3WOEB 1YJ93 3HK4A 1RNTA 3CCE3 1IVUA 1AV4A 1HYFA 3K0ZA 1RGFA 2OQEA 4G1MB 3UL6A 1SIIA 5KP4A 5JPPA 1JBSA 3MPHA 5AYRB 1M1XB 1GS3A 3VSYA 1BGSA 3GZBA 2CFGA 1OH0A 4WFOA 1K8A4 4EV2A 4X2HA 3TDGA 3V98A 5AIFA 1A2KA 2ML5A 3EF8A 4J5GA 4OVMA 3JUPA 3WA2X 3S27A 3I563 3KKGA 4MMYB 1VQM3 2BO9B 1BNIA 3IMAB 4J9AA 1B3SA 4MMZB 4RBNA 1WMNA 1IT8A 1IDPA 1W00A 4N6NB 2QIYA 2P0XA 3DY5A 1LNHA 3LXUX 4RNYA 1NB3I 1FZUA 3VF1A 1BNFA 1QVG2 1WMPA 3KIIA 3X40A 1LXEA 1RN1A 1MGRA 4H61A 1IVWA 1JN5A 1O7HB 1Z1SA 3F7XA 2IMJA 3KSPA 3SYUA 1Q824 1FGQA 3K9MC 3HI7A 2OQEC 5IG5A 1CQSA 4RZMA 2R4IA 1S723 3UB1A 1I2FA 4IPBA 3CC73 2KF4A 3GAXA 5IERA 4WYKB 3FF2A 1EEJA 3G0KA 1MWUA 1AR0A 4HM3B 2OWPA 2RFRA 3KFQC 1ZGXA 2XGLA 1CYUA 1YVBI 2CG0A 4X2OA 5DREA 1TJDA 2BHMA 3BNEA 1UDII 3U1WA 1BSDA 1IVXA 2F5WA 5M18A 2GU3A 5CLKA 1PFPA 1W01A 2M7OA 3OX9A 2H0GA 2Y74A 3FLJA 3V99A 2RNTA 1BSCA 3ALAA 5LC6A 6STDA 1A90A 3B4OA 1W6CA 1FUSA 3CU3A 1T5YA 2Z76A 3KZTA 4HZBB 3D4AA 1BRKA 2CFWA 3EB8A 1OACA 3FGYA 1GD4A 2L1SA 3H3HA 4N6OB 1BRGA 2XSOB 4EXRA 1Q9EA 2RCDA 1EKMA 4QWTA 3NUVA 2Y73A 1DMNA 3FH1A 5EVHA 5ELUA 1VQ53 1DVCA 3F40A 3DGYA 1Q814 4O2HA 4HM4B 4XB5A 1JZOA 3F7SA 1BSAA 3EJVA 4HM0B 2W0QA 3HIIA 5DRVA 1X1XA 2C11A 1T2IA 2F4YA 2HOHA 3DUKA 3HIGA 2E2UA 4HM6B 3N54B 1B2SA 3FG1A 4EV5A 3B8LA 5KP1A 1ULIB 2CG1A 1TFOA 1K41A 3JUMA 3LH4A 4LYLB 1RKYA 2HMLB 2B1XB 2CK3H
chains in the Genus database with same CATH topology
3UJMA 3CCM3 3Q1CA 1IQ8A 4MJDA 1G96A 3DZLA 1KWIA 2ZDJA 3EBYA 1VQ83 3RGAA 4KFDA 2IUJA 3G16A 3AMOA 1YHQ3 1IQYA 3QRDA 4J8TA 1N9EA 1W4NA 2HMOB 1SIHA 1JB2A 2CFKA 3F8XA 4HZ9B 5I97A 4KFEA 3DGLA 1W5ZA 1JN5B 2RSXA 3LZAA 3EN1B 1BUQA 1D6YA 2I9WA 2F98A 5BVBA 3SLUA 2K54A 4HYZA 3FCSB 2MF7A 1Q40A 1IV9A 2E2TA 4JRFA 4LZIA 5IENA 4HM5B 1JNQA 2E2VA 2GEYA 1IQXA 4XBYA 8CHOA 2P05A 1YIT3 1SPUA 3T8NA 1US1A 3NHXA 4K61A 3CCR3 4FCZA 1LVNA 3EX9A 3KSED 2GEXA 3K63A 3F8HA 4EYCA 1PU4A 2B24B 4FMCA 2OCTA 2Z77A 3LTAA 1J2BA 1QALA 1DYUA 5JBSA 2L4VA 1EQKA 2QEX3 3EN8A 3BB9A 1D6UA 1CYVA 3QK9A 1O7WB 3MKIA 3MYTA 3BNCA 1M1K4 3CCL3 1OHSA 2SBLA 5G2GA 3PGBA 1UI8A 3WODG 1S5AA 2FNQA 1R4CA 3NQYA 2XSHB 4BTWA 2ZL8A 3CNMA 3VGNA 1YI23 2Z7AA 4ZM8A 4PEJA 7STDA 2O9UX 4R9KA 5AIGA 1LOXA 5IW9A 2Z6BA 3WMDA 3GRDA 2W6JH 3X3YA 2GBWB 1WQLB 3HZPA 1NU3A 3CCJ3 3CCS3 2GU1A 2INXA 4N6UA 1HKXA 3F9SA 5A0OB 2QGUA 3PCRA 3HX8A 4XBXA 3JVCA 4BTYA 1STDA 3IPTA 4MMXB 1IV7A 2CIUA 5ELJA 2F86B 5EEOA 4N3VA 1ZO2A 4OK0A 5STDA 3EE1A 4HJLB 2LQVA 2W56A 4HM1B 1WTHA 1N5PA 3L0RA 5CXOA 3CD63 3SOAA 4HM8B 1FGOA 3S29A 3BNDA 4FMAA 4CDLA 4K90B 1VQK3 1GY6A 2BT3A 3D3LA 3EC9A 5BXQA 3S28A 1QAFA 3BLZA 1YJW3 1TP6A 3LTDA 4HM2B 5FW5A 1ULJB 1TIJA 3G6E3 5IG3A 2P38A 4RNZA 1GY7A 1QAKA 2XFTA 2BMRB 1E3RA 2JQ5A 5AEUB 1JKGB 1ASKA 2XF3A 1IVVA 3NQZA 3DM8A 3LOYA 1IU7A 1OHPA 1K28A 2WO0A 2XH9A 2BNGA 2F99A 1WNHA 1SJWA 3I0YA 3DGOA 1Q7Y4 1O7GB 3G713 4XDVA 2WOHA 4LEHA 3CME3 3OWSA 2D1WA 1V74A 4IIAA 2CWVA 1JJ22 4N6LA 5CF2A 3CXC2 3S67A 3UL5A 1A67A 3MWZA 1VQO3 3CPW2 1W2B2 1W7CA 2IUKA 4L7KA 3PCSA 4K1UA 3CCU3 5AYSC 3GZYB 3PXMA 3T8UA 4N6TA 1FA3A 1MNLA 1EA2A 1OHOA 3NM7A 1VZZA 4LMIA 3LYGA 2XRXB 3FG3A 3NXJA 5KP3A 3U97A 4WYKA 2PNCA 1GY5A 5EQLA 1W6YA 2WOFA 3OW22 4H3UA 2CKFB 3K5TA 1DMMA 5D81A 4LGQA 1OPYA 2CFLA 2OTJ3 3CCQ3 1N9JA 1NO3A 4WWUC 3JUOA 5D82A 3BNBA 3LMLA 1D6ZA 4KZ1A 4NREA 3FG4A 1HU9A 4WP5A 3LTBA 3NBBA 2Q07A 3ROBA 4Q53A 4HVNA 3NBJA 4O3VA 1FUWA 3CPOA 3IJEB 1L5GB 3UNLA 1FGRA 4XBTA 4KFFA 3O8YA 5CF1A 1AVLA 1UUVB 2QA43 3CMA3 4R1KA 2GBXB 1DMQA 2D42A 1VQ43 3DXOA 2RGQA 5AIHA 1OF5A 3GWRA 1VQ93 3MG3A 5CK6A 3I553 2K0MA 3STDA 2MC8A 2JDIH 1RJOA 1KSIA 3KE7A 4HBRA 3LT9A 1OUNA 4R9LA 5IEOA 3V92A 4HM7B 1UI7A 1RRLA 4U13A 2OOVA 3X3XA 1M904 2XFSA 4WHAA 1VQ63 1E3VA 3NM2A 1SQWA 1K734 2W9QA 1QJGA 3MHEA 3N8BA 2W03A 1C7HA 1F8NA 3SOYA 1NDOB 2XGNA 4R4KA 3LTCA 2OTL3 2WGQA 1VQL3 1M9GA 2CFDA 3H51A 4NHFA 1W2ZA 3KN4A 2XR8B 4O02B 1KD14 2V1LA 2HMNB 2CHCA 4JF8A 2PZVA 4LSOA 5IF6A 3NV0A 4N6V0 1ISKA 5HGRA 1A2VA 1NB5I 1E97A 3DGMA 1YGEA 3MG2A 4GL6A 5FGOA 3FKAA 3CCV3 4N6MA 3MSOA 4EBGA 2A15A 5AEWB 4HKVB 2FXTA 2CH9A 3SX1A 3AMOB 1NWWA 2OOVC 4OUQA 3SXXA 2CW9A 4BTXA 1OGXA 3EHCA 3B7CA 4FMDA 2BMQB 4ORLA 4CCVA 1VQ73 1DVDA 4IT7A 3GZRA 1CEWI 1TFKA 1O7NB 1GD3A 3F14A 3WA3A 1RN7A 3SVAA 3GZXB 4EC6A 3CNXA 3CC23 5IG4A 4O8SA 4STDA 1Q40B 2BMOB 1MOLA 2HMMB 3T0UA 3WOFB 3M8CA 3RGRA 1ROVA 1JB4A 3X3ZA 2HMKB 2HMJB 3G8ZA 3WDGB 3PYJA 1IT7A 2CWUA 3FF0A 3ER7A 3PS8A 5D83A 3SEDA 1Q42A 4GB5A 3D9RA 3ECFA 3JUNA 3OWYA 2FGTA 1JB5A 2CWTA 4R80A 4AKYA 3DGNA 3NBRA 2IA7A 5AI1A 1OF5B 3S5CA 3X41A 5AIIA 1W6GA 2P09A 3OXAA 3MG1A 1YIJ3 1QVF2 2LYXA 1ROAA 1Y4KA 2O3OA 5JPUA 3PZWA 1NJI4 1W02A 2CC3A 4L8PA 1JV2B 4XDWA 3EBTA 1FGTA 1JRQA 1IK3A 4FCJA 2W9PA 4MEIA 2STDA 1U8CB 4AKZA 1GYBA 1TU5A 3FSDA 1AVKA 1RRHA 1TUHA 4K1VA 1N5HA 1WMOA 1O7MB 4FR9A 1O7PB 4AEQA 2GXFA 2KRTA 1YJN3 5IG0A 3CC43 2C10A 3Q90A 1STFI 3OV4A 3X42A 5LC7A 1VQN3 1Q864 3NX0A 4XM4A 2YX9A 3JUQA 4L8OA 2YFIB 3NV0B 3DMCA 2XEPA 1KC84 3EQQB 3A76A 1N8QA 3B4PA 2ML6A 3Q2PA 4TX4A 2W04A 1QMAA 1N8R4 1U5OA 2W56B 2YFJB 1OCVA 1ZX2A 2KCDA 4I4KA 1K9M4 2P0MA 1KQS2 3G4S3 3FZWA 5TGNA 1UUWB 1FGMA 2W2CA 2YFLB 3E99A 3OWUA 4FCMA 4KVHA 2KXGA 3J7Yd 1EG9B 3K7CA 3LT8A 3RDEA 2UX0A 1OGZA 1UW1A 1JKGA 2WGOA 4FMBA 3N9HA 1VQP3 3WOEB 1YJ93 3HK4A 3CCE3 1IVUA 1AV4A 3K0ZA 2OQEA 4G1MB 3UL6A 1SIIA 5KP4A 5JPPA 3MPHA 5AYRB 1M1XB 1GS3A 3VSYA 1K8A4 3GZBA 2CFGA 1OH0A 4WFOA 4EV2A 4X2HA 3TDGA 3V98A 5AIFA 1A2KA 2ML5A 3EF8A 4OVMA 3JUPA 3WA2X 3S27A 3I563 3KKGA 4MMYB 1VQM3 2BO9B 3IMAB 4J9AA 4MMZB 4RBNA 1WMNA 1IT8A 1IDPA 1W00A 4N6NB 2QIYA 2P0XA 3DY5A 1LNHA 3LXUX 4RNYA 1NB3I 3VF1A 1QVG2 1WMPA 3KIIA 3X40A 1LXEA 4H61A 1IVWA 1JN5A 1O7HB 1Z1SA 3F7XA 2IMJA 3KSPA 1Q824 1FGQA 3K9MC 3HI7A 2OQEC 5IG5A 1CQSA 4RZMA 2R4IA 1S723 3UB1A 4IPBA 3CC73 3GAXA 5IERA 4WYKB 3FF2A 3G0KA 1AR0A 4HM3B 2OWPA 2RFRA 3KFQC 2XGLA 1CYUA 1YVBI 2CG0A 4X2OA 5DREA 2BHMA 3BNEA 3U1WA 1IVXA 2GU3A 5CLKA 1PFPA 1W01A 2M7OA 3OX9A 2Y74A 3FLJA 3V99A 3ALAA 5LC6A 6STDA 1A90A 3B4OA 1W6CA 3CU3A 1T5YA 2Z76A 3KZTA 4HZBB 3EB8A 2CFWA 1OACA 3FGYA 1GD4A 3H3HA 4N6OB 4EXRA 2XSOB 2RCDA 1EKMA 4QWTA 3NUVA 2Y73A 1DMNA 3FH1A 5EVHA 5ELUA 1VQ53 1DVCA 3F40A 1Q814 4O2HA 4HM4B 4XB5A 3F7SA 3EJVA 4HM0B 2W0QA 3HIIA 5DRVA 2C11A 5IEPA 3HIGA 3DUKA 2E2UA 4HM6B 3N54B 3FG1A 4EV5A 3B8LA 5KP1A 1ULIB 2CG1A 1TFOA 1K41A 3JUMA 3LH4A 1RKYA 2HMLB 2B1XB 2CK3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXG A;  1TIJ A;  1G96 A;  4N6V 0;  1KWI A;  1NB5 I;  4N6M A;  3UL6 A;  3QRD A;  2CH9 A;  1WNH A;  4CCV A;  1DVD A;  4IT7 A;  1CEW I;  1GD3 A;  1RN7 A;  3SVA A;  1IV9 A;  4LZI A;  2BO9 B;  4N6L A;  3S67 A;  3UL5 A;  1A67 A;  3MWZ A;  3IMA B;  1MOL A;  4N6N B;  1NB3 I;  3PYJ A;  3KSE D;  1LXE A;  3PXM A;  4N6T A;  4EYC A;  1FA3 A;  1MNL A;  3PS8 A;  2OCT A;  3K9M C;  1EQK A;  5EQL A;  3GAX A;  1CYV A;  3KFQ C;  1N9J A;  1CYU A;  1YVB I;  1ROA A;  1R4C A;  1PFP A;  1FUW A;  4ZM8 A;  5LC6 A;  2W9P A;  1A90 A;  2O9U X;  1N5H A;  1GD4 A;  4N6O B;  1STF I;  4N6U A;  5A0O B;  5LC7 A;  1IV7 A;  5ELJ A;  3NX0 A;  5ELU A;  1DVC A;  3Q2P A;  4TX4 A;  3L0R A;  1N5P A;  2W9Q A;  1M9G A;  3LH4 A; 
#chains in the Genus database with same CATH topology
 4BU4 A;  3UJM A;  4BL2 A;  3CCM 3;  3Q1C A;  1IQ8 A;  1BIR A;  1TRQ A;  4MJD A;  1G96 A;  1SAR A;  1TTO A;  3AHW A;  3DZL A;  1RNB A;  1KWI A;  2GSP A;  2ZDJ A;  3EBY A;  2KF6 A;  1VQ8 3;  3RGA A;  1B21 A;  4KFD A;  2IUJ A;  3G16 A;  3AMO A;  1YHQ 3;  1IQY A;  1EUI C;  2IYJ A;  3QRD A;  4J8T A;  1PY3 A;  1N9E A;  1W4N A;  1VQQ A;  1SIH A;  1JB2 A;  2HMO B;  2CFK A;  3F8X A;  4HZ9 B;  3URP A;  5I97 A;  1GSP A;  1HZ1 A;  4KFE A;  3DGL A;  1LQG C;  1W5Z A;  2BIR A;  1JN5 B;  1AY7 A;  2RSX A;  4HOH A;  3LZA A;  3EN1 B;  1DET A;  1D6Y A;  2I9W A;  1BUQ A;  2F98 A;  5BVB A;  3SLU A;  2K54 A;  4HYZ A;  3FCS B;  2MF7 A;  1Q40 A;  1IV9 A;  2ZHX B;  2E2T A;  4JRF A;  4LZI A;  5IEN A;  4HM5 B;  1JNQ A;  2E2V A;  1RTU A;  2GEY A;  1IQX A;  4XBY A;  8CHO A;  2P05 A;  1B2X A;  4I5Q A;  1YIT 3;  1SPU A;  3T8N A;  1US1 A;  3NHX A;  4CPK A;  1B20 A;  4K61 A;  3CCR 3;  1MWT A;  1G0T A;  1GOY A;  1LVN A;  3A5E A;  3EX9 A;  3KSE D;  4FCZ A;  2GEX A;  3K63 A;  3F8H A;  4EYC A;  1JBT A;  1PU4 A;  2B24 B;  4FMC A;  2OCT A;  2Z77 A;  1GMR A;  3LTA A;  1J2B A;  1QAL A;  1DYU A;  5JBS A;  2L4V A;  1EQK A;  2QEX 3;  3EN8 A;  1BRJ A;  2KAA A;  3BB9 A;  1D6U A;  1CYV A;  3QK9 A;  1O7W B;  3MKI A;  1BNG A;  3MYT A;  3BNC A;  1R4Y A;  1I0V A;  1M1K 4;  3CCL 3;  1OHS A;  2SBL A;  5G2G A;  1GMQ A;  3PGB A;  1UI8 A;  3WOD G;  5BIR A;  1S5A A;  1BRS A;  2FNQ A;  1CH0 A;  1R4C A;  3NQY A;  1B27 A;  2XSH B;  3ZG5 A;  4BTW A;  2ZL8 A;  4NPB A;  3CNM A;  3VGN A;  1YI2 3;  2Z7A A;  4ZM8 A;  4PEJ A;  4CJN A;  7STD A;  2O9U X;  4R9K A;  5AIG A;  1LOX A;  1A2P A;  5IW9 A;  2Z6B A;  1RGH A;  7RNT A;  3WMD A;  1BSE A;  5HOH A;  3GRD A;  2W6J H;  3X3Y A;  2GBW B;  1B2Z A;  1WQL B;  3HZP A;  1NU3 A;  3CCJ 3;  1I8V A;  3CCS 3;  2GU1 A;  2INX A;  4N6U A;  1HKX A;  3F9S A;  5A0O B;  1FYS A;  2QGU A;  3PCR A;  3HX8 A;  4XBX A;  3JVC A;  1TRP A;  4BTY A;  1STD A;  3IPT A;  4MMX B;  1IV7 A;  2CIU A;  5ELJ A;  1RGA A;  2F86 B;  5EEO A;  4N3V A;  6RNT A;  1ZO2 A;  1RGG A;  4OK0 A;  5STD A;  1MGW A;  1UGI A;  2RBI A;  3EE1 A;  2LQV A;  2W56 A;  4HJL B;  4HM1 B;  1WTH A;  1N5P A;  3L0R A;  5CXO A;  3CD6 3;  3SOA A;  4HM8 B;  2CX0 A;  1FGO A;  3S29 A;  3BND A;  4FMA A;  4CDL A;  4K90 B;  1VQK 3;  1GY6 A;  2BT3 A;  2ZA4 A;  1BAN A;  3D3L A;  3EC9 A;  6GSP A;  5BXQ A;  3S28 A;  1QAF A;  3BLZ A;  1YJW 3;  1TP6 A;  3HOH A;  3LTD A;  4HM2 B;  5FW5 A;  1ULJ B;  1TIJ A;  3G6E 3;  1T2H A;  2P38 A;  5IG3 A;  1V58 A;  4RNZ A;  3KCH A;  4DKI A;  1GY7 A;  1QAK A;  2XFT A;  1LOV A;  2BMR B;  1E3R A;  2JQ5 A;  5AEU B;  1JKG B;  1UCK A;  4KT3 B;  1ASK A;  2XF3 A;  1IVV A;  3NQZ A;  3DM8 A;  3LOY A;  1IU7 A;  1OHP A;  1K28 A;  2WO0 A;  2XH9 A;  2BNG A;  2F99 A;  1WNH A;  1SJW A;  5IEP A;  3I0Y A;  3DGO A;  1Q7Y 4;  1RN4 A;  1O7G B;  3G71 3;  5RNT A;  1BU4 A;  4XDV A;  2WOH A;  1YNV X;  1I2E A;  1BOX A;  4LEH A;  3CME 3;  3OWS A;  2D1W A;  1V74 A;  4IIA A;  2CWV A;  3AGO A;  3BIR A;  1JJ2 2;  4N6L A;  4J5K A;  5CF2 A;  3CXC 2;  1DE3 A;  3S67 A;  3UL5 A;  1A67 A;  3MWZ A;  2KF5 A;  1VQO 3;  1T3B A;  3CPW 2;  1W2B 2;  1W7C A;  2IUK A;  4L7K A;  3PCS A;  4K1U A;  5G1L A;  2IY2 A;  1BNR A;  5GSP A;  3DH2 A;  3CCU 3;  1GOU A;  2R41 A;  3GZY B;  3PXM A;  5AYS C;  2KF3 A;  4N6T A;  1UCI A;  1YVS A;  2H0I A;  3T8U A;  1C54 A;  1FA3 A;  1MNL A;  1EA2 A;  1OHO A;  4EW5 A;  1BUJ A;  3NM7 A;  1RCL A;  1VZZ A;  4LMI A;  3LYG A;  2XRX B;  3FG3 A;  3NXJ A;  5KP3 A;  1YGW A;  3U97 A;  4WYK A;  4BL3 A;  2PNC A;  1GY5 A;  5EQL A;  1NNV A;  1W6Y A;  2WOF A;  4H3U A;  1BRI A;  3OW2 2;  1BSB A;  1ZS7 A;  2CKF B;  3K5T A;  1DMM A;  5D81 A;  4LGQ A;  1OPY A;  2CFL A;  2OTJ 3;  3CCQ 3;  3ZG0 A;  1N9J A;  1NO3 A;  4ILF A;  3JUO A;  4WWU C;  1BRH A;  5D82 A;  3BNB A;  3LML A;  1D6Z A;  4KZ1 A;  4NRE A;  3FG4 A;  1HU9 A;  4WP5 A;  5G1K A;  3LTB A;  3NBB A;  2Q07 A;  3ROB A;  1FUT A;  4Q53 A;  3Q3F A;  3NBJ A;  4HVN A;  1BVI A;  4O3V A;  1FUW A;  3CPO A;  3IJE B;  2H0H A;  1L5G B;  1FGR A;  4XBT A;  4KFF A;  3O8Y A;  3UNL A;  5CF1 A;  1RSN A;  3GSP A;  1AVL A;  1UUV B;  2QA4 3;  3CMA 3;  3D5I A;  4R1K A;  2GBX B;  2CX1 A;  1DMQ A;  2D42 A;  1VQ4 3;  3DXO A;  2RGQ A;  5AIH A;  1OF5 A;  3GWR A;  1VQ9 3;  3MG3 A;  5CK6 A;  3I55 3;  2K0M A;  3STD A;  2MC8 A;  2JDI H;  1RJO A;  1KSI A;  3KE7 A;  4HBR A;  3LT9 A;  1OUN A;  4R9L A;  2AAE A;  5IEO A;  3V92 A;  4HM7 B;  1UI7 A;  1RRL A;  4U13 A;  1I70 A;  2OOV A;  3X3X A;  1M90 4;  1RGK A;  3BU4 A;  2XFS A;  4WHA A;  1VQ6 3;  1E3V A;  3NM2 A;  1V57 A;  1JBR A;  1SQW A;  1K73 4;  2W9Q A;  1QJG A;  3MHE A;  3N8B A;  2W03 A;  1C7H A;  1F8N A;  2J8X B;  3SOY A;  1NDO B;  2XGN A;  4R4K A;  4RNT A;  3LTC A;  2OTL 3;  2WGQ A;  1VQL 3;  1M9G A;  5BU4 A;  2CFD A;  1I3F A;  3H51 A;  4NHF A;  1W2Z A;  1BNJ A;  3KN4 A;  3RNT A;  2XR8 B;  4O02 B;  1KD1 4;  1I3I A;  2V1L A;  1X1U A;  2HMN B;  1RDS A;  2CHC A;  1RHL A;  4JF8 A;  2PZV A;  4LSO A;  2K3D A;  5M1A A;  5IF6 A;  3NV0 A;  4N6V 0;  1ISK A;  5HGR A;  1A2V A;  1NB5 I;  1E97 A;  3DGM A;  1JZD A;  2SAR A;  1YGE A;  3MG2 A;  4GL6 A;  1LNI A;  2UGI A;  3FKA A;  5FGO A;  4GHO A;  3WHO A;  3CCV 3;  4N6M A;  3MSO A;  4EBG A;  2A15 A;  5AEW B;  4HKV B;  3D79 A;  2FXT A;  2CH9 A;  3SX1 A;  3AMO B;  1NWW A;  2OOV C;  1MWR A;  4OUQ A;  2CW9 A;  3SXX A;  4BTX A;  9RNT A;  1OGX A;  1UGH I;  3EHC A;  3B7C A;  4FMD A;  2BMQ B;  4ORL A;  4CCV A;  1VQ7 3;  1DVD A;  4IT7 A;  3GZR A;  1CEW I;  1TFK A;  1O7N B;  1GD3 A;  3F14 A;  1IYY A;  3WA3 A;  1LRA A;  1RN7 A;  3SVA A;  3GZX B;  4EC6 A;  3CNX A;  3CC2 3;  5IG4 A;  4O8S A;  4STD A;  1Q40 B;  2BMO B;  1RMS A;  3D5G A;  1MOL A;  2HMM B;  3T0U A;  3WOF B;  1X1W A;  1LOY A;  2F5M A;  3M8C A;  3RGR A;  1ROV A;  1JB4 A;  3X3Z A;  2HMK B;  2HMJ B;  5M19 A;  3G8Z A;  3WDG B;  3PYJ A;  1RGL A;  1IT7 A;  2CWU A;  3FF0 A;  3ER7 A;  3PS8 A;  5D83 A;  3SED A;  1LQM B;  1Q42 A;  4GB5 A;  3D9R A;  3ECF A;  3JUN A;  3OWY A;  2FGT A;  1JB5 A;  1UCJ A;  1LOW A;  1RGE A;  8RNT A;  2UUG C;  2CWT A;  4R80 A;  4AKY A;  1BRN L;  3DGN A;  3NBR A;  2IA7 A;  5AI1 A;  1G02 A;  1I0X A;  1OF5 B;  3S5C A;  3X41 A;  5AII A;  1W6G A;  2P09 A;  2C4B A;  3OXA A;  3MG1 A;  1YIJ 3;  1QVF 2;  2LYX A;  1ROA A;  1Y4K A;  2O3O A;  5JPU A;  3PZW A;  1NJI 4;  1BNS A;  1W02 A;  2CC3 A;  7GSP A;  1X1Y A;  4L8P A;  1JV2 B;  3WR2 A;  3AHS A;  1FW7 A;  4XDW A;  1BNE A;  3EBT A;  4GSP A;  1FGT A;  1JRQ A;  4BIR A;  2F56 A;  1IK3 A;  4FCJ A;  2W9P A;  4MEI A;  2STD A;  1U8C B;  4AKZ A;  1GYB A;  1TU5 A;  3FSD A;  1AVK A;  1RRH A;  1TUH A;  4K1V A;  1N5H A;  1I2G A;  1O7M B;  1WMO A;  4FR9 A;  1O7P B;  4AEQ A;  2GXF A;  2KRT A;  1YJN 3;  5IG0 A;  3CC4 3;  4HAA A;  2C10 A;  3Q90 A;  1STF I;  3OV4 A;  1GMP A;  1RGC A;  1B2M A;  3X42 A;  5LC7 A;  1VQN 3;  1GOV A;  1Q86 4;  3NX0 A;  4XM4 A;  2AAD A;  2YX9 A;  3JUQ A;  4L8O A;  2YFI B;  3NV0 B;  3DMC A;  1RLS A;  2XEP A;  3ZFZ A;  1KC8 4;  3EQQ B;  2BU4 A;  3A76 A;  1N8Q A;  3B4P A;  2ML6 A;  3Q2P A;  4TX4 A;  2W04 A;  1BAO A;  1QMA A;  1N8R 4;  1B2U A;  1U5O A;  2W56 B;  2YFJ B;  1OCV A;  1ZX2 A;  2KCD A;  4I4K A;  3AGN A;  1K9M 4;  2P0M A;  1RCK A;  1KQS 2;  3G4S 3;  3FZW A;  5TGN A;  1MWS A;  1UUW B;  1FGM A;  2W2C A;  2YFL B;  1UUG B;  3E99 A;  3OWU A;  4FCM A;  4KVH A;  2KXG A;  3J7Y d;  1EG9 B;  1PYL A;  1Q7H A;  3K7C A;  3LT8 A;  3RDE A;  2UX0 A;  1OGZ A;  1UW1 A;  1UCL A;  1JKG A;  2WGO A;  4FMB A;  3N9H A;  1VQP 3;  1AQZ A;  3WOE B;  1YJ9 3;  3HK4 A;  1RNT A;  3CCE 3;  1IVU A;  1AV4 A;  1HYF A;  3K0Z A;  1RGF A;  2OQE A;  4G1M B;  3UL6 A;  1SII A;  5KP4 A;  5JPP A;  1JBS A;  3MPH A;  5AYR B;  1M1X B;  1GS3 A;  3VSY A;  1BGS A;  3GZB A;  2CFG A;  1OH0 A;  4WFO A;  1K8A 4;  4EV2 A;  4X2H A;  3TDG A;  3V98 A;  5AIF A;  1A2K A;  2ML5 A;  3EF8 A;  4J5G A;  4OVM A;  3JUP A;  3WA2 X;  3S27 A;  3I56 3;  3KKG A;  4MMY B;  1VQM 3;  2BO9 B;  1BNI A;  3IMA B;  4J9A A;  1B3S A;  4MMZ B;  4RBN A;  1WMN A;  1IT8 A;  1IDP A;  1W00 A;  4N6N B;  2QIY A;  2P0X A;  3DY5 A;  1LNH A;  3LXU X;  4RNY A;  1NB3 I;  1FZU A;  3VF1 A;  1BNF A;  1QVG 2;  1WMP A;  3KII A;  3X40 A;  1LXE A;  1RN1 A;  1MGR A;  4H61 A;  1IVW A;  1JN5 A;  1O7H B;  1Z1S A;  3F7X A;  2IMJ A;  3KSP A;  3SYU A;  1Q82 4;  1FGQ A;  3K9M C;  3HI7 A;  2OQE C;  5IG5 A;  1CQS A;  4RZM A;  2R4I A;  1S72 3;  3UB1 A;  1I2F A;  4IPB A;  3CC7 3;  2KF4 A;  3GAX A;  5IER A;  4WYK B;  3FF2 A;  1EEJ A;  3G0K A;  1MWU A;  1AR0 A;  4HM3 B;  2OWP A;  2RFR A;  3KFQ C;  1ZGX A;  2XGL A;  1CYU A;  1YVB I;  2CG0 A;  4X2O A;  5DRE A;  1TJD A;  2BHM A;  3BNE A;  1UDI I;  3U1W A;  1BSD A;  1IVX A;  2F5W A;  5M18 A;  2GU3 A;  5CLK A;  1PFP A;  1W01 A;  2M7O A;  3OX9 A;  2H0G A;  2Y74 A;  3FLJ A;  3V99 A;  2RNT A;  1BSC A;  3ALA A;  5LC6 A;  6STD A;  1A90 A;  3B4O A;  1W6C A;  1FUS A;  3CU3 A;  1T5Y A;  2Z76 A;  3KZT A;  4HZB B;  3D4A A;  1BRK A;  2CFW A;  3EB8 A;  1OAC A;  3FGY A;  1GD4 A;  2L1S A;  3H3H A;  4N6O B;  1BRG A;  2XSO B;  4EXR A;  1Q9E A;  2RCD A;  1EKM A;  4QWT A;  3NUV A;  2Y73 A;  1DMN A;  3FH1 A;  5EVH A;  5ELU A;  1VQ5 3;  1DVC A;  3F40 A;  3DGY A;  1Q81 4;  4O2H A;  4HM4 B;  4XB5 A;  1JZO A;  3F7S A;  1BSA A;  3EJV A;  4HM0 B;  2W0Q A;  3HII A;  5DRV A;  1X1X A;  2C11 A;  1T2I A;  2F4Y A;  2HOH A;  3DUK A;  3HIG A;  2E2U A;  4HM6 B;  3N54 B;  1B2S A;  3FG1 A;  4EV5 A;  3B8L A;  5KP1 A;  1ULI B;  2CG1 A;  1TFO A;  1K41 A;  3JUM A;  3LH4 A;  4LYL B;  1RKY A;  2HML B;  2B1X B;  2CK3 H; 
#chains in the Genus database with same CATH homology
 3UJM A;  3CCM 3;  3Q1C A;  1IQ8 A;  4MJD A;  1G96 A;  3DZL A;  1KWI A;  2ZDJ A;  3EBY A;  1VQ8 3;  3RGA A;  4KFD A;  2IUJ A;  3G16 A;  3AMO A;  1YHQ 3;  1IQY A;  3QRD A;  4J8T A;  1N9E A;  1W4N A;  2HMO B;  1SIH A;  1JB2 A;  2CFK A;  3F8X A;  4HZ9 B;  5I97 A;  4KFE A;  3DGL A;  1W5Z A;  1JN5 B;  2RSX A;  3LZA A;  3EN1 B;  1BUQ A;  1D6Y A;  2I9W A;  2F98 A;  5BVB A;  3SLU A;  2K54 A;  4HYZ A;  3FCS B;  2MF7 A;  1Q40 A;  1IV9 A;  2E2T A;  4JRF A;  4LZI A;  5IEN A;  4HM5 B;  1JNQ A;  2E2V A;  2GEY A;  1IQX A;  4XBY A;  8CHO A;  2P05 A;  1YIT 3;  1SPU A;  3T8N A;  1US1 A;  3NHX A;  4K61 A;  3CCR 3;  4FCZ A;  1LVN A;  3EX9 A;  3KSE D;  2GEX A;  3K63 A;  3F8H A;  4EYC A;  1PU4 A;  2B24 B;  4FMC A;  2OCT A;  2Z77 A;  3LTA A;  1J2B A;  1QAL A;  1DYU A;  5JBS A;  2L4V A;  1EQK A;  2QEX 3;  3EN8 A;  3BB9 A;  1D6U A;  1CYV A;  3QK9 A;  1O7W B;  3MKI A;  3MYT A;  3BNC A;  1M1K 4;  3CCL 3;  1OHS A;  2SBL A;  5G2G A;  3PGB A;  1UI8 A;  3WOD G;  1S5A A;  2FNQ A;  1R4C A;  3NQY A;  2XSH B;  4BTW A;  2ZL8 A;  3CNM A;  3VGN A;  1YI2 3;  2Z7A A;  4ZM8 A;  4PEJ A;  7STD A;  2O9U X;  4R9K A;  5AIG A;  1LOX A;  5IW9 A;  2Z6B A;  3WMD A;  3GRD A;  2W6J H;  3X3Y A;  2GBW B;  1WQL B;  3HZP A;  1NU3 A;  3CCJ 3;  3CCS 3;  2GU1 A;  2INX A;  4N6U A;  1HKX A;  3F9S A;  5A0O B;  2QGU A;  3PCR A;  3HX8 A;  4XBX A;  3JVC A;  4BTY A;  1STD A;  3IPT A;  4MMX B;  1IV7 A;  2CIU A;  5ELJ A;  2F86 B;  5EEO A;  4N3V A;  1ZO2 A;  4OK0 A;  5STD A;  3EE1 A;  4HJL B;  2LQV A;  2W56 A;  4HM1 B;  1WTH A;  1N5P A;  3L0R A;  5CXO A;  3CD6 3;  3SOA A;  4HM8 B;  1FGO A;  3S29 A;  3BND A;  4FMA A;  4CDL A;  4K90 B;  1VQK 3;  1GY6 A;  2BT3 A;  3D3L A;  3EC9 A;  5BXQ A;  3S28 A;  1QAF A;  3BLZ A;  1YJW 3;  1TP6 A;  3LTD A;  4HM2 B;  5FW5 A;  1ULJ B;  1TIJ A;  3G6E 3;  5IG3 A;  2P38 A;  4RNZ A;  1GY7 A;  1QAK A;  2XFT A;  2BMR B;  1E3R A;  2JQ5 A;  5AEU B;  1JKG B;  1ASK A;  2XF3 A;  1IVV A;  3NQZ A;  3DM8 A;  3LOY A;  1IU7 A;  1OHP A;  1K28 A;  2WO0 A;  2XH9 A;  2BNG A;  2F99 A;  1WNH A;  1SJW A;  3I0Y A;  3DGO A;  1Q7Y 4;  1O7G B;  3G71 3;  4XDV A;  2WOH A;  4LEH A;  3CME 3;  3OWS A;  2D1W A;  1V74 A;  4IIA A;  2CWV A;  1JJ2 2;  4N6L A;  5CF2 A;  3CXC 2;  3S67 A;  3UL5 A;  1A67 A;  3MWZ A;  1VQO 3;  3CPW 2;  1W2B 2;  1W7C A;  2IUK A;  4L7K A;  3PCS A;  4K1U A;  3CCU 3;  5AYS C;  3GZY B;  3PXM A;  3T8U A;  4N6T A;  1FA3 A;  1MNL A;  1EA2 A;  1OHO A;  3NM7 A;  1VZZ A;  4LMI A;  3LYG A;  2XRX B;  3FG3 A;  3NXJ A;  5KP3 A;  3U97 A;  4WYK A;  2PNC A;  1GY5 A;  5EQL A;  1W6Y A;  2WOF A;  3OW2 2;  4H3U A;  2CKF B;  3K5T A;  1DMM A;  5D81 A;  4LGQ A;  1OPY A;  2CFL A;  2OTJ 3;  3CCQ 3;  1N9J A;  1NO3 A;  4WWU C;  3JUO A;  5D82 A;  3BNB A;  3LML A;  1D6Z A;  4KZ1 A;  4NRE A;  3FG4 A;  1HU9 A;  4WP5 A;  3LTB A;  3NBB A;  2Q07 A;  3ROB A;  4Q53 A;  4HVN A;  3NBJ A;  4O3V A;  1FUW A;  3CPO A;  3IJE B;  1L5G B;  3UNL A;  1FGR A;  4XBT A;  4KFF A;  3O8Y A;  5CF1 A;  1AVL A;  1UUV B;  2QA4 3;  3CMA 3;  4R1K A;  2GBX B;  1DMQ A;  2D42 A;  1VQ4 3;  3DXO A;  2RGQ A;  5AIH A;  1OF5 A;  3GWR A;  1VQ9 3;  3MG3 A;  5CK6 A;  3I55 3;  2K0M A;  3STD A;  2MC8 A;  2JDI H;  1RJO A;  1KSI A;  3KE7 A;  4HBR A;  3LT9 A;  1OUN A;  4R9L A;  5IEO A;  3V92 A;  4HM7 B;  1UI7 A;  1RRL A;  4U13 A;  2OOV A;  3X3X A;  1M90 4;  2XFS A;  4WHA A;  1VQ6 3;  1E3V A;  3NM2 A;  1SQW A;  1K73 4;  2W9Q A;  1QJG A;  3MHE A;  3N8B A;  2W03 A;  1C7H A;  1F8N A;  3SOY A;  1NDO B;  2XGN A;  4R4K A;  3LTC A;  2OTL 3;  2WGQ A;  1VQL 3;  1M9G A;  2CFD A;  3H51 A;  4NHF A;  1W2Z A;  3KN4 A;  2XR8 B;  4O02 B;  1KD1 4;  2V1L A;  2HMN B;  2CHC A;  4JF8 A;  2PZV A;  4LSO A;  5IF6 A;  3NV0 A;  4N6V 0;  1ISK A;  5HGR A;  1A2V A;  1NB5 I;  1E97 A;  3DGM A;  1YGE A;  3MG2 A;  4GL6 A;  5FGO A;  3FKA A;  3CCV 3;  4N6M A;  3MSO A;  4EBG A;  2A15 A;  5AEW B;  4HKV B;  2FXT A;  2CH9 A;  3SX1 A;  3AMO B;  1NWW A;  2OOV C;  4OUQ A;  3SXX A;  2CW9 A;  4BTX A;  1OGX A;  3EHC A;  3B7C A;  4FMD A;  2BMQ B;  4ORL A;  4CCV A;  1VQ7 3;  1DVD A;  4IT7 A;  3GZR A;  1CEW I;  1TFK A;  1O7N B;  1GD3 A;  3F14 A;  3WA3 A;  1RN7 A;  3SVA A;  3GZX B;  4EC6 A;  3CNX A;  3CC2 3;  5IG4 A;  4O8S A;  4STD A;  1Q40 B;  2BMO B;  1MOL A;  2HMM B;  3T0U A;  3WOF B;  3M8C A;  3RGR A;  1ROV A;  1JB4 A;  3X3Z A;  2HMK B;  2HMJ B;  3G8Z A;  3WDG B;  3PYJ A;  1IT7 A;  2CWU A;  3FF0 A;  3ER7 A;  3PS8 A;  5D83 A;  3SED A;  1Q42 A;  4GB5 A;  3D9R A;  3ECF A;  3JUN A;  3OWY A;  2FGT A;  1JB5 A;  2CWT A;  4R80 A;  4AKY A;  3DGN A;  3NBR A;  2IA7 A;  5AI1 A;  1OF5 B;  3S5C A;  3X41 A;  5AII A;  1W6G A;  2P09 A;  3OXA A;  3MG1 A;  1YIJ 3;  1QVF 2;  2LYX A;  1ROA A;  1Y4K A;  2O3O A;  5JPU A;  3PZW A;  1NJI 4;  1W02 A;  2CC3 A;  4L8P A;  1JV2 B;  4XDW A;  3EBT A;  1FGT A;  1JRQ A;  1IK3 A;  4FCJ A;  2W9P A;  4MEI A;  2STD A;  1U8C B;  4AKZ A;  1GYB A;  1TU5 A;  3FSD A;  1AVK A;  1RRH A;  1TUH A;  4K1V A;  1N5H A;  1WMO A;  1O7M B;  4FR9 A;  1O7P B;  4AEQ A;  2GXF A;  2KRT A;  1YJN 3;  5IG0 A;  3CC4 3;  2C10 A;  3Q90 A;  1STF I;  3OV4 A;  3X42 A;  5LC7 A;  1VQN 3;  1Q86 4;  3NX0 A;  4XM4 A;  2YX9 A;  3JUQ A;  4L8O A;  2YFI B;  3NV0 B;  3DMC A;  2XEP A;  1KC8 4;  3EQQ B;  3A76 A;  1N8Q A;  3B4P A;  2ML6 A;  3Q2P A;  4TX4 A;  2W04 A;  1QMA A;  1N8R 4;  1U5O A;  2W56 B;  2YFJ B;  1OCV A;  1ZX2 A;  2KCD A;  4I4K A;  1K9M 4;  2P0M A;  1KQS 2;  3G4S 3;  3FZW A;  5TGN A;  1UUW B;  1FGM A;  2W2C A;  2YFL B;  3E99 A;  3OWU A;  4FCM A;  4KVH A;  2KXG A;  3J7Y d;  1EG9 B;  3K7C A;  3LT8 A;  3RDE A;  2UX0 A;  1OGZ A;  1UW1 A;  1JKG A;  2WGO A;  4FMB A;  3N9H A;  1VQP 3;  3WOE B;  1YJ9 3;  3HK4 A;  3CCE 3;  1IVU A;  1AV4 A;  3K0Z A;  2OQE A;  4G1M B;  3UL6 A;  1SII A;  5KP4 A;  5JPP A;  3MPH A;  5AYR B;  1M1X B;  1GS3 A;  3VSY A;  1K8A 4;  3GZB A;  2CFG A;  1OH0 A;  4WFO A;  4EV2 A;  4X2H A;  3TDG A;  3V98 A;  5AIF A;  1A2K A;  2ML5 A;  3EF8 A;  4OVM A;  3JUP A;  3WA2 X;  3S27 A;  3I56 3;  3KKG A;  4MMY B;  1VQM 3;  2BO9 B;  3IMA B;  4J9A A;  4MMZ B;  4RBN A;  1WMN A;  1IT8 A;  1IDP A;  1W00 A;  4N6N B;  2QIY A;  2P0X A;  3DY5 A;  1LNH A;  3LXU X;  4RNY A;  1NB3 I;  3VF1 A;  1QVG 2;  1WMP A;  3KII A;  3X40 A;  1LXE A;  4H61 A;  1IVW A;  1JN5 A;  1O7H B;  1Z1S A;  3F7X A;  2IMJ A;  3KSP A;  1Q82 4;  1FGQ A;  3K9M C;  3HI7 A;  2OQE C;  5IG5 A;  1CQS A;  4RZM A;  2R4I A;  1S72 3;  3UB1 A;  4IPB A;  3CC7 3;  3GAX A;  5IER A;  4WYK B;  3FF2 A;  3G0K A;  1AR0 A;  4HM3 B;  2OWP A;  2RFR A;  3KFQ C;  2XGL A;  1CYU A;  1YVB I;  2CG0 A;  4X2O A;  5DRE A;  2BHM A;  3BNE A;  3U1W A;  1IVX A;  2GU3 A;  5CLK A;  1PFP A;  1W01 A;  2M7O A;  3OX9 A;  2Y74 A;  3FLJ A;  3V99 A;  3ALA A;  5LC6 A;  6STD A;  1A90 A;  3B4O A;  1W6C A;  3CU3 A;  1T5Y A;  2Z76 A;  3KZT A;  4HZB B;  3EB8 A;  2CFW A;  1OAC A;  3FGY A;  1GD4 A;  3H3H A;  4N6O B;  4EXR A;  2XSO B;  2RCD A;  1EKM A;  4QWT A;  3NUV A;  2Y73 A;  1DMN A;  3FH1 A;  5EVH A;  5ELU A;  1VQ5 3;  1DVC A;  3F40 A;  1Q81 4;  4O2H A;  4HM4 B;  4XB5 A;  3F7S A;  3EJV A;  4HM0 B;  2W0Q A;  3HII A;  5DRV A;  2C11 A;  5IEP A;  3HIG A;  3DUK A;  2E2U A;  4HM6 B;  3N54 B;  3FG1 A;  4EV5 A;  3B8L A;  5KP1 A;  1ULI B;  2CG1 A;  1TFO A;  1K41 A;  3JUM A;  3LH4 A;  1RKY A;  2HML B;  2B1X B;  2CK3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...