1BUQA

Solution structure of delta-5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone-hemisuccinate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFFANSLKLPLAVELTQEVRAVANEAAFAFTVSFEFQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Delta 5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone hemisuccinate.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
molecule keywords PROTEIN (3-KETOSTEROID ISOMERASE-19-NORTESTOSTERONE-HEMISUCC
total genus 21
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1buqA00
2Z76A 3UJMA 5CF1A 1BUQA 3MYTA 1Z1SA 1O7PB 1TP6A 3F40A 3OXAA 4HVNA 2QGUA 1JB5A 2XRXB 3DZLA 4R1KA 3EQQB 1Q40A 2BNGA 2F99A 5AI1A 3B4PA 4XDWA 5IEOA 1OCVA 2YFJB 3MHEA 3NM2A 3NHXA 1GY5A 4L8PA 2IMJA 4MJDA 4PEJA 4XB5A 1O7GB 1OHPA 3SEDA 2CKFB 4WP5A 3HX8A 2GEXA 4WWUC 5IEPA 2R4IA 2A15A 2YFIB 3F8HA 3G0KA 3G8ZA 1Q40B 5D81A 5TGNA 4X2HA 3OWSA 5IG5A 3FLJA 1GY6A 3H3HA 2QIYA 3EF8A 1EA2A 1OF5B 3EN8A 4R9KA 3FZWA 3VSYA 3EJVA 5AIIA 5KP1A 5KP4A 1SJWA 2YFLB 3FSDA 3OWYA 3D9RA 4STDA 4J9AA 4Q53A 3SOYA 1JN5A 3EN1B 4IIAA 2XSHB 4OUQA 6STDA 3F7XA 1E97A 3FF0A 3JUNA 3JUMA 4HJLB 5AIFA 3CPOA 5AEWB 3MKIA 3JUOA 3MSOA 3F9SA 2Z7AA 3F14A 3K7CA 3M8CA 4L8OA 3EHCA 3FGYA 1OGXA 4HZ9B 3GWRA 1JN5B 4XBYA 2GBXB 1QMAA 3MG2A 1O7MB 3B7CA 1ULJB 4FCMA 3I0YA 1OH0A 3SOAA 1C7HA 1QJGA 3ECFA 5FW5A 3F8XA 1OPYA 5D83A 1OUNA 5EVHA 3JUQA 4HZBB 4XM4A 5IG0A 1AR0A 2F98A 2RCDA 1OGZA 1STDA 1GYBA 2K54A 2UX0A 5CLKA 4CDLA 5CF2A 1ISKA 3BB9A 3UNLA 1W01A 4XDVA 3NBRA 4XBXA 1OF5A 4OVMA 5CXOA 3CU3A 4L7KA 1JKGB 3KKGA 4HM7B 3HZPA 2HMOB 1ULIB 2HMNB 3OX9A 2RGQA 3FH1A 3GZXB 4ORLA 2JQ5A 2OWPA 5DRVA 3Q90A 5KP3A 1GY7A 3GZRA 8CHOA 3A76A 1UUVB 2XSOB 4FCJA 1ASKA 4XBTA 3NV0A 2STDA 4H3UA 3VGNA 4GB5A 1A2KA 2Z77A 2GBWB 2HMJB 1E3VA 3LYGA 1JKGA 3GZYB 5JPUA 4HKVB 2PZVA 3NUVA 1U5OA 3CNXA 5IF6A 1DMMA 3KE7A 3KZTA 3B4OA 2BMQB 4J8TA 3S5CA 1W00A 3WMDA 1K41A 1ZO2A 3EBYA 3NV0B 3DMCA 2B1XB 2GXFA 1W6YA 4LGQA 2B24B 2GEYA 4WYKA 3EC9A 3EX9A 5G2GA 4HM0B 4HM1B 1OHOA 1JB2A 5DREA 3FF2A 2RFRA 1S5AA 1TUHA 3G16A 3GRDA 2I9WA 1ZX2A 1O7HB 2W2CA 3DM8A 3DXOA 1HKXA 1O7NB 2BMOB 1E3RA 3ER7A 4HM4B 1GS3A 3BLZA 5JPPA 4HM5B 3K0ZA 1IDPA 2XR8B 4HM2B 3ROBA 3T8UA 1NDOB 4HM3B 5HGRA 2BMRB 4RZMA 4X2OA 4HM8B 5BXQA 1OHSA 3T8NA 5IERA 4U13A 3EBTA 5IG3A 5CK6A 5IG4A 5AEUB 5AIGA 3HK4A 1Q42A 3LZAA 2HMKB 4R9LA 1EG9B 3DUKA 3OWUA 1O7WB 4K1VA 1CQSA 1DMNA 1VZZA 2HMLB 4LMIA 5AIHA 5STDA 3STDA 7STDA 3MG1A 3OV4A 1JB4A 3GZBA 3H51A 2F86B 3RGAA 2CHCA 1NWWA 4KVHA 1W02A 3IPTA 4LEHA 3NXJA 3RGRA 2INXA 3CNMA 2HMMB 3FKAA 5D82A 3B8LA 1WQLB 3JUPA 5BVBA 4N3VA 4I4KA 4WYKB 3KSPA 3E99A 3F7SA 1DMQA 1NU3A 1UUWB 4HM6B 5IENA 3MG3A 4K1UA
chains in the Genus database with same CATH superfamily
2Z76A 3CCV3 2K0MA 1BUQA 2F4YA 1Z1SA 1FUSA 1TP6A 2KRTA 1ZS7A 2QGUA 4IT7A 4BU4A 4BL3A 5ELUA 5ELJA 3EQQB 1K8A4 1Q40A 1VQL3 4XDWA 2YFJB 5LC6A 4L8PA 1US1A 2HOHA 3SLUA 4MMZB 2CKFB 1N5HA 3BNDA 4WWUC 3TDGA 3DY5A 3HIIA 2YFIB 3F8HA 2XFSA 3NBJA 1Q40B 3DGYA 1RGFA 3NQYA 3WHOA 1GY6A 1WMPA 2QIYA 2ZDJA 3H3HA 3EN8A 5RNTA 1OACA 3EJVA 1BNIA 2CWVA 2KCDA 3OWYA 1LOXA 3SOYA 3CCQ3 4STDA 1UCLA 3U97A 4NPBA 1PFPA 2W0QA 2XSHB 1FYSA 1BNSA 4OUQA 1N9EA 3T0UA 1UI7A 2BO9B 3CC73 3JUNA 3JUMA 5AEWB 2ML5A 2BHMA 1PY3A 1RCKA 3AGOA 3F14A 2K3DA 1BNRA 2GBXB 1T5YA 4TX4A 3CPW2 3I0YA 1C7HA 1YGWA 3ECFA 1LQGC 4LZIA 1RN4A 1OPYA 1UCIA 3S29A 3FG4A 1AR0A 2F98A 2UX0A 1IV9A 1IT7A 2K54A 5CF2A 3AHSA 3BB9A 3LTBA 4XDVA 1OF5A 4G1MB 4L7KA 1NO3A 2CWUA 3Q3FA 2RGQA 3FH1A 1FZUA 4ORLA 1MGRA 3UL5A 3GZRA 1MNLA 3A76A 2XSOB 3KIIA 4FCJA 1ASKA 3WDGB 4HAAA 3NV0A 2STDA 3EE1A 3VGNA 1C54A 1A2KA 1SIHA 2Z77A 2HMJB 1FGOA 3LYGA 5BIRA 1JKGA 3S27A 1FUTA 3UL6A 1W2B2 1JRQA 1U5OA 3CNXA 3NM7A 4RBNA 1B2XA 4J8TA 2KF5A 3S5CA 1VQK3 3EBYA 3NV0B 2CFGA 1K734 1KWIA 1JZOA 3DH2A 1CYUA 2JDIH 2RSXA 2GXFA 3Q2PA 1UDII 2B24B 2UGIA 1J2BA 4HM1B 4BIRA 3G16A 4N6OB 2GSPA 4BTYA 1B27A 2W2CA 1LNIA 3D3LA 4KVHA 1GS3A 1GSPA 1TIJA 3U1WA 2E2TA 1QALA 4RZMA 3FG1A 3PYJA 4N6LA 3EBTA 1UCJA 5AEUB 1Q42A 1TJDA 3OWUA 2E2UA 4K1VA 1O7WB 1EQKA 1UGIA 3DGMA 1VZZA 4K90B 3WA3A 2Q07A 4J5KA 2BU4A 3MG1A 2XEPA 1I2FA 3GZBA 1QAFA 1RGKA 4JRFA 3V99A 2INXA 3CNMA 1B20A 2FXTA 4GSPA 1I3IA 4WYKB 3E99A 1NU3A 2BT3A 2CX1A 1QVF2 1D6ZA 1AY7A 3MYTA 4NHFA 1YJ93 3CC43 1TTOA 1NNVA 4BTWA 3NQZA 2F99A 4MMYB 1B2MA 2V1LA 1OCVA 3NM2A 2ZA4A 3D4AA 5IEOA 1GY5A 2CW9A 3JVCA 2C4BA 4XB5A 1VQ63 1O7GB 1WNHA 1IQXA 1BOXA 4WP5A 1S723 3QK9A 1IV7A 1LOYA 2A15A 4WFOA 3G0KA 5D81A 1VQ53 3G8ZA 4CJNA 4EYCA 4MEIA 1IK3A 3EF8A 1EA2A 2MF7A 4R9KA 4EV5A 1W2ZA 2CFWA 5AIIA 4CPKA 2GU3A 1Q814 5M18A 1MOLA 1IVWA 4J9AA 2CFLA 3X41A 4KFEA 1E97A 3ZG0A 1RMSA 5AIFA 1VQ43 3CPOA 4O3VA 1RNBA 2XFTA 1GMPA 2XH9A 1I3FA 3F9SA 1DETA 3JUOA 3MSOA 5A0OB 3K7CA 3M8CA 3PCRA 3MPHA 3EHCA 3LT9A 1A2PA 2OOVC 1YJW3 1RN7A 5G1LA 1QMAA 4MMXB 3BU4A 1O7MB 3RNTA 1RNTA 3PXMA 3CME3 1BRSA 1QJGA 2M7OA 5IW9A 3JUQA 4HZBB 1WMOA 3S28A 1G02A 4XM4A 5IG0A 1STDA 4CDLA 2ZL8A 4K61A 1X1XA 1BNJA 1ISKA 3UNLA 1W01A 3NBBA 4OVMA 1LXEA 3SVAA 4AEQA 3KCHA 1VQ93 1ROAA 1BGSA 4R4KA 5DRVA 5IF6A 1T3BA 2JQ5A 2OWPA 1VQO3 4I5QA 1BRKA 1GY7A 4HBRA 5EEOA 5BU4A 1TRPA 1BSDA 1GOUA 1RGAA 2OQEA 1LRAA 2GBWB 5HOHA 1VQ73 2OCTA 1FA3A 2KXGA 4O8SA 3ALAA 2CX0A 5JPUA 4AKYA 2F5MA 2QEX3 3OW22 3RDEA 3A5EA 2AADA 1W00A 1DE3A 3PZWA 3WMDA 3G6E3 3L0RA 3X40A 3ZFZA 1BRNL 1IU7A 4HOHA 2WGQA 1YVBI 2UUGC 2Z6BA 4BL2A 2GEYA 5G2GA 2CG1A 4BTXA 1SPUA 1JB2A 4FMAA 3GRDA 2RFRA 3QRDA 3CCL3 1VQP3 2I9WA 3ER7A 3K5TA 4HM4B 3BLZA 5JPPA 4GHOA 4HM2B 4R80A 3ROBA 1ROVA 3T8UA 3X42A 5HGRA 1AV4A 5BXQA 1OHSA 4U13A 2RBIA 1RGEA 1RN1A 2CK3H 4RNZA 3HK4A 1YIT3 1EG9B 3VF1A 1IT8A 1MWRA 1BSBA 1RGGA 1YVSA 1BU4A 2RNTA 3I563 1KC84 1NJI4 3CD63 1AVKA 1IVXA 1FGTA 3X3YA 3LXUX 3OV4A 1N8QA 1JB4A 1GOYA 1W6CA 3H51A 1AVLA 2CHCA 2FGTA 4LEHA 1VQM3 3SYUA 1T2IA 1UW1A 1HZ1A 2R41A 3GSPA 3PGBA 3X3ZA 3D79A 3FKAA 1V74A 2H0GA 3KSPA 4HM7B 3SOAA 4HM6B 1EUIC 3MG3A 1IVUA 2P0MA 3EB8A 1A67A 2W9QA 3F40A 3OXAA 1JJ22 3DZLA 1EKMA 2OTL3 1BRHA 1HU9A 1Q824 3SXXA 2KF4A 5AYRB 4PEJA 1N5PA 2IMJA 3J7Yd 1YGEA 3ZG5A 1OHPA 4CCVA 4HYZA 1W7CA 1CEWI 3CMA3 3AHWA 2GEXA 5IEPA 3WOEB 1BVIA 5TGNA 4J5GA 4X2HA 6RNTA 3D5GA 2W6JH 3K9MC 3Q1CA 3FLJA 5LC7A 1I8VA 3CCS3 1Q864 1OF5B 5AYSC 2P0XA 3VSYA 3FZWA 1RGHA 1RGLA 5M19A 3FSDA 1JNQA 1R4CA 3SX1A 1KD14 1M1XB 1A90A 3WODG 3EN1B 3GAXA 4IIAA 4WHAA 6STDA 3F7XA 1M9GA 1UUGB 4HJLB 4KT3B 1IVVA 3NX0A 1D6UA 4DKIA 2Z7AA 4L8OA 6GSPA 1BNGA 1DVCA 2E2VA 3CCM3 1BSAA 3KN4A 2O9UX 2J8XB 3B7CA 1OH0A 2WO0A 5GSPA 5M1AA 3G4S3 3LMLA 5FW5A 1Q7HA 3F8XA 1PU4A 2CIUA 2H0IA 1Q7Y4 1MWTA 2RCDA 5CLKA 1AQZA 1GYBA 3K63A 1LOWA 2W9PA 1RHLA 1X1UA 3NBRA 4XBXA 3BNCA 4N6TA 1B2ZA 5JBSA 1B3SA 1JKGB 1ULIB 2ZHXB 3OX9A 1BAOA 1JV2B 1R4YA 2Y73A 1BRJA 1BIRA 3D5IA 1I0XA 3LT8A 5KP3A 8CHOA 1UUVB 4EC6A 1M904 4XBTA 1RCLA 3DGOA 4GB5A 2IUKA 2P05A 2YX9A 1E3VA 1K9M4 2PZVA 1BANA 5EQLA 3KE7A 3KZTA 3CCJ3 3CCR3 4O2HA 4RNYA 1TU5A 1LNHA 4N6UA 3URPA 1BRIA 2B1XB 2CFKA 4WYKA 3EX9A 4HM0B 1I2EA 1OHOA 5DREA 3FF2A 1TUHA 1TRQA 4AKZA 4XBYA 1ZX2A 1O7HB 1GD4A 1N9JA 3DM8A 4EBGA 1E3RA 1VQ83 1G0TA 3K0ZA 3MWZA 2XR8B 2CC3A 2SBLA 1UGHI 2KF3A 3HIGA 4HM5B 4HM3B 2H0HA 4KFFA 5IG4A 3T8NA 1MWSA 3BNEA 1FGQA 5CK6A 3X3XA 2WOFA 2HMKB 4FCZA 1W6GA 4LYLB 1RLSA 2LQVA 3I553 4LMIA 5STDA 7STDA 1EEJA 1NB5I 1B2SA 1RGCA 3AMOB 3CC23 1VQQA 1NWWA 1FGRA 1IYYA 3RGRA 2XGLA 4N6V0 1PYLA 2D42A 5D82A 3B8LA 1KQS2 3JUPA 5BVBA 4I4KA 1DVDA 2F5WA 1RRHA 3F7SA 1DMQA 4EV2A 2OTJ3 3AMOA 2AAEA 4K1UA 3UJMA 5CF1A 1RKYA 1A2VA 4FR9A 1O7PB 1JBSA 3KSED 4HVNA 1JB5A 2XRXB 1CH0A 2QA43 4R1KA 1RJOA 2FNQA 1TFOA 2BNGA 2LYXA 5AI1A 3B4PA 1SQWA 3MHEA 2IY2A 3HOHA 3NHXA 4MJDA 1JBTA 2W04A 2C11A 4FMCA 3HX8A 2MC8A 1IQYA 2R4IA 3V98A 3IJEB 1V57A 1BSEA 2L4VA 2P09A 5IG5A 1LOVA 3FG3A 3OWSA 1UCKA 1WTHA 1LVNA 3DGLA 4JF8A 5KP1A 1BSCA 1WMNA 1I70A 5KP4A 1SJWA 2YFLB 2KF6A 5I97A 3D9RA 4Q53A 2Y74A 1JN5A 1LQMB 1U8CB 3FF0A 1I0VA 1L5GB 2WGOA 3MKIA 1M1K4 1BNFA 3KFQC 4H61A 3FGYA 2CFDA 1OGXA 4HZ9B 3GWRA 1JN5B 4GL6A 5G1KA 1B2UA 3N9HA 3MG2A 1ULJB 4FCMA 3WA2X 3CCU3 3AGNA 1KSIA 4LSOA 2F56A 5D83A 1OUNA 2IA7A 5EVHA 3CCE3 1VQN3 1YI23 3LTCA 2CWTA 1I2GA 1RTUA 1G96A 1OGZA 4KZ1A 1GD3A 3S67A 2OOVA 3PCSA 4FMBA 4OK0A 5CXOA 3CU3A 3KKGA 3HZPA 1D6YA 2HMOB 2HMNB 3LTAA 3LOYA 1STFI 3N8BA 4N6NB 1CYVA 2PNCA 2W56B 3GZXB 5IG3A 1SIIA 1FGMA 4N6MA 3Q90A 1YIJ3 2O3OA 7GSPA 3LH4A 4H3UA 1QVG2 1W5ZA 2BIRA 9RNTA 4FMDA 1FUWA 8RNTA 2P38A 3FCSB 3GZYB 4IPBA 4HKVB 3NUVA 2W56A 4RNTA 2CG0A 1YJN3 1DMMA 3V92A 1MWUA 3B4OA 2BMQB 1N8R4 1BUJA 1K41A 1X1WA 1ZO2A 1YHQ3 3LTDA 3PS8A 3DMCA 4QWTA 1RSNA 1B21A 1NB3I 4LGQA 1W6YA 2XGNA 3EC9A 2OQEC 1YNVX 2IUJA 1W4NA 1S5AA 3SEDA 3DXOA 1MGWA 1RDSA 2KAAA 1HKXA 1O7NB 2BMOB 3IMAB 2SARA 4O02B 1TFKA 3WR2A 1Q9EA 1IDPA 1JBRA 1NDOB 5IERA 3O8YA 2BMRB 2WOHA 4X2OA 1GMRA 4HM8B 1FW7A 3DGNA 2ML6A 5AIGA 1F8NA 1HYFA 1K28A 3LZAA 1RRLA 4R9LA 1GMQA 3BNBA 3DUKA 1CQSA 4NREA 1DMNA 1BNEA 1UI8A 2CH9A 2HMLB 3N54B 5AIHA 3STDA 3HI7A 3WOFB 4EXRA 1GOVA 2C10A 3CXC2 5FGOA 4EW5A 2L1SA 2GU1A 2F86B 1V58A 1Y4KA 2W03A 1IQ8A 2XF3A 3RGAA 1W02A 3UB1A 1T2HA 1DYUA 3G713 3NXJA 2IYJA 4ZM8A 1BRGA 1JZDA 2HMMB 1QAKA 4ILFA 1WQLB 3BIRA 2D1WA 4N3VA 4KFDA 3IPTA 1ZGXA 1UUWB 1X1YA 5IENA 7RNTA 1SARA
chains in the Genus database with same CATH topology
2Z76A 3CCV3 2K0MA 1BUQA 1Z1SA 1TP6A 2KRTA 2QGUA 4IT7A 1K8A4 5ELUA 5ELJA 3EQQB 1Q40A 1VQL3 4XDWA 2YFJB 5LC6A 4L8PA 1US1A 3SLUA 4MMZB 2CKFB 1N5HA 3BNDA 4WWUC 3TDGA 3DY5A 3HIIA 2YFIB 3F8HA 2XFSA 3NBJA 1Q40B 3NQYA 1GY6A 1WMPA 2QIYA 2ZDJA 3H3HA 3EN8A 1OACA 3EJVA 2CWVA 2KCDA 3OWYA 1LOXA 3SOYA 3CCQ3 4STDA 3U97A 1PFPA 2W0QA 2XSHB 4OUQA 1N9EA 3T0UA 1UI7A 2BO9B 3CC73 3JUNA 3JUMA 5AEWB 2ML5A 2BHMA 3F14A 2GBXB 1T5YA 4TX4A 3CPW2 3I0YA 1C7HA 3ECFA 4LZIA 1OPYA 3S29A 3FG4A 1AR0A 2F98A 2UX0A 1IV9A 1IT7A 2K54A 5CF2A 3BB9A 3LTBA 4XDVA 1OF5A 4G1MB 4L7KA 1NO3A 2CWUA 2RGQA 3FH1A 4ORLA 3UL5A 3GZRA 1MNLA 3A76A 2XSOB 3KIIA 4FCJA 1ASKA 3WDGB 3NV0A 2STDA 3EE1A 3VGNA 1A2KA 1SIHA 2Z77A 2HMJB 1FGOA 3LYGA 1JKGA 3S27A 1W2B2 3UL6A 1JRQA 1U5OA 3CNXA 3NM7A 4RBNA 4J8TA 3S5CA 3EBYA 3NV0B 2CFGA 1K734 1KWIA 1CYUA 2RSXA 2JDIH 2GXFA 3Q2PA 2B24B 1J2BA 4HM1B 3G16A 4N6OB 4BTYA 2W2CA 3D3LA 4KVHA 1GS3A 1TIJA 3U1WA 2E2TA 1QALA 4RZMA 3FG1A 3PYJA 4N6LA 3EBTA 5AEUB 1Q42A 3OWUA 2E2UA 4K1VA 1O7WB 1EQKA 3DGMA 1VZZA 4K90B 3WA3A 2Q07A 3MG1A 2XEPA 3GZBA 1QAFA 4JRFA 3V99A 2INXA 3CNMA 2FXTA 4WYKB 3E99A 1NU3A 2BT3A 1QVF2 1D6ZA 3MYTA 4NHFA 1YJ93 3CC43 4BTWA 3NQZA 2F99A 4MMYB 2V1LA 1OCVA 3NM2A 5IEOA 1GY5A 2CW9A 3JVCA 4XB5A 1VQ63 1O7GB 1WNHA 1IQXA 4WP5A 1S723 3QK9A 1IV7A 2A15A 4WFOA 3G0KA 5D81A 1VQ53 3G8ZA 4EYCA 4MEIA 1IK3A 3EF8A 1EA2A 2MF7A 4R9KA 4EV5A 1W2ZA 2CFWA 5AIIA 1Q814 2GU3A 1MOLA 1IVWA 4J9AA 2CFLA 3X41A 4KFEA 1E97A 5AIFA 1VQ43 3CPOA 4O3VA 2XFTA 3JUOA 2XH9A 3MSOA 3F9SA 5A0OB 3K7CA 3M8CA 3PCRA 3MPHA 3EHCA 3LT9A 2OOVC 1YJW3 1RN7A 1QMAA 4MMXB 1O7MB 3PXMA 3CME3 1QJGA 2M7OA 5IW9A 3JUQA 4HZBB 1WMOA 3S28A 4XM4A 5IG0A 1STDA 4CDLA 2ZL8A 4K61A 1ISKA 3UNLA 1W01A 3NBBA 4OVMA 1LXEA 3SVAA 4AEQA 1VQ93 1ROAA 4R4KA 5DRVA 5IF6A 2JQ5A 2OWPA 1GY7A 4HBRA 5EEOA 2OQEA 2GBWB 1VQ73 2OCTA 1FA3A 2KXGA 4O8SA 3ALAA 5JPUA 2QEX3 4AKYA 3OW22 3RDEA 1W00A 3PZWA 3WMDA 3G6E3 3L0RA 3X40A 1IU7A 2WGQA 1YVBI 2Z6BA 2GEYA 5G2GA 2CG1A 4BTXA 1SPUA 1JB2A 4FMAA 3GRDA 2RFRA 3QRDA 3CCL3 1VQP3 2I9WA 3ER7A 3K5TA 4HM4B 3BLZA 5JPPA 4HM2B 4R80A 3ROBA 1ROVA 3T8UA 3X42A 5HGRA 1AV4A 5BXQA 1OHSA 4U13A 2CK3H 4RNZA 3HK4A 1YIT3 1EG9B 3VF1A 1IT8A 3I563 1KC84 1NJI4 3CD63 1AVKA 1IVXA 1FGTA 3X3YA 3LXUX 3OV4A 1N8QA 1JB4A 1W6CA 3H51A 1AVLA 2CHCA 2FGTA 4LEHA 1VQM3 1UW1A 3X3ZA 3PGBA 3FKAA 1V74A 3KSPA 4HM7B 3SOAA 4HM6B 3MG3A 3EB8A 2P0MA 1IVUA 1A67A 2W9QA 3F40A 3OXAA 1JJ22 3DZLA 1EKMA 2OTL3 1HU9A 1Q824 3SXXA 5AYRB 4PEJA 1N5PA 2IMJA 3J7Yd 1YGEA 1OHPA 4CCVA 4HYZA 1W7CA 1CEWI 3CMA3 2GEXA 5IEPA 3WOEB 5TGNA 4X2HA 3CCS3 3Q1CA 2W6JH 3K9MC 5LC7A 3FLJA 1Q864 1OF5B 5AYSC 2P0XA 3VSYA 3FZWA 3FSDA 1JNQA 1R4CA 3SX1A 1KD14 1M1XB 1A90A 3WODG 3EN1B 3GAXA 4IIAA 4WHAA 6STDA 3F7XA 1M9GA 4HJLB 1IVVA 3NX0A 1D6UA 2Z7AA 4L8OA 1DVCA 2E2VA 3CCM3 3KN4A 2O9UX 3B7CA 1OH0A 2WO0A 3G4S3 3LMLA 5FW5A 3F8XA 1PU4A 2CIUA 1Q7Y4 2RCDA 5CLKA 1GYBA 3K63A 2W9PA 3NBRA 4XBXA 3BNCA 4N6TA 5JBSA 1JKGB 1ULIB 3OX9A 1JV2B 3LT8A 2Y73A 5KP3A 8CHOA 1UUVB 4EC6A 1M904 4XBTA 3DGOA 4GB5A 2IUKA 2P05A 2YX9A 1E3VA 1K9M4 2PZVA 5EQLA 3KE7A 3KZTA 3CCJ3 3CCR3 4O2HA 4RNYA 1TU5A 1LNHA 4N6UA 2B1XB 4WYKA 2CFKA 3EX9A 4HM0B 5DREA 1OHOA 3FF2A 1TUHA 4AKZA 4XBYA 1ZX2A 1O7HB 1GD4A 1N9JA 3DM8A 4EBGA 1E3RA 1VQ83 3MWZA 3K0ZA 4HM5B 2XR8B 2CC3A 2SBLA 3HIGA 4HM3B 4KFFA 5IG4A 3T8NA 3BNEA 1FGQA 5CK6A 3X3XA 2WOFA 2HMKB 4FCZA 1W6GA 3I553 2LQVA 4LMIA 5STDA 7STDA 1NB5I 3AMOB 3CC23 1NWWA 1FGRA 3RGRA 2XGLA 4N6V0 2D42A 5D82A 3B8LA 1KQS2 3JUPA 5BVBA 4I4KA 1DVDA 1RRHA 3F7SA 1DMQA 4EV2A 2OTJ3 3AMOA 4K1UA 3UJMA 5CF1A 1RKYA 1A2VA 4FR9A 1O7PB 3KSED 4HVNA 1JB5A 2XRXB 2QA43 4R1KA 1RJOA 2FNQA 1TFOA 2BNGA 2LYXA 5AI1A 3B4PA 1SQWA 3MHEA 4MJDA 3NHXA 2W04A 2C11A 4FMCA 3HX8A 2MC8A 1IQYA 2R4IA 3V98A 3IJEB 1VQK3 2L4VA 2P09A 5IG5A 3FG3A 3OWSA 1WTHA 1LVNA 3DGLA 4JF8A 5KP1A 1WMNA 5KP4A 1SJWA 2YFLB 5I97A 3D9RA 4Q53A 2Y74A 1JN5A 1U8CB 3FF0A 1L5GB 2WGOA 3MKIA 1M1K4 4H61A 3KFQC 3FGYA 2CFDA 1OGXA 4HZ9B 3GWRA 1JN5B 4GL6A 3N9HA 3MG2A 1ULJB 4FCMA 3WA2X 3CCU3 1KSIA 4LSOA 3CCE3 5D83A 1OUNA 2IA7A 5EVHA 1VQN3 1YI23 3LTCA 2CWTA 1G96A 1OGZA 4KZ1A 1GD3A 3S67A 2OOVA 3PCSA 4FMBA 4OK0A 5CXOA 3CU3A 3KKGA 3HZPA 1D6YA 2HMOB 2HMNB 3LTAA 3LOYA 1STFI 3N8BA 4N6NB 1CYVA 2PNCA 2W56B 3GZXB 5IG3A 1SIIA 1FGMA 4N6MA 3Q90A 1YIJ3 2O3OA 3LH4A 4H3UA 1QVG2 1W5ZA 4FMDA 1FUWA 2P38A 3FCSB 3GZYB 4IPBA 4HKVB 3NUVA 2W56A 1YJN3 2CG0A 1DMMA 3V92A 3B4OA 2BMQB 1N8R4 1K41A 1ZO2A 1YHQ3 3LTDA 3PS8A 3DMCA 4QWTA 1NB3I 4LGQA 1W6YA 2XGNA 3EC9A 2OQEC 2IUJA 1W4NA 1S5AA 3SEDA 3DXOA 1VQO3 1HKXA 1O7NB 2BMOB 3IMAB 4O02B 1TFKA 1IDPA 1NDOB 5IERA 3O8YA 2BMRB 2WOHA 4X2OA 4HM8B 3DGNA 2ML6A 5AIGA 1F8NA 1K28A 3LZAA 1RRLA 4R9LA 3DUKA 3BNBA 1CQSA 4NREA 1DMNA 2HMLB 1UI8A 2CH9A 5AIHA 3N54B 3STDA 3HI7A 3WOFB 4EXRA 3CXC2 2C10A 5FGOA 2GU1A 2F86B 1Y4KA 2W03A 2XF3A 1IQ8A 3RGAA 1W02A 3UB1A 3G713 1DYUA 3NXJA 4ZM8A 2HMMB 1QAKA 1WQLB 2D1WA 4N3VA 4KFDA 3IPTA 1UUWB 5IENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z76 A;  3UJM A;  5CF1 A;  1BUQ A;  3MYT A;  1Z1S A;  1O7P B;  1TP6 A;  3F40 A;  3OXA A;  4HVN A;  2QGU A;  1JB5 A;  2XRX B;  3DZL A;  4R1K A;  3EQQ B;  1Q40 A;  2BNG A;  2F99 A;  5AI1 A;  3B4P A;  4XDW A;  5IEO A;  1OCV A;  2YFJ B;  3MHE A;  3NM2 A;  3NHX A;  1GY5 A;  4L8P A;  2IMJ A;  4MJD A;  4PEJ A;  4XB5 A;  1O7G B;  1OHP A;  3SED A;  2CKF B;  4WP5 A;  3HX8 A;  2GEX A;  4WWU C;  5IEP A;  2R4I A;  2A15 A;  2YFI B;  3F8H A;  3G0K A;  3G8Z A;  1Q40 B;  5D81 A;  5TGN A;  4X2H A;  3OWS A;  5IG5 A;  3FLJ A;  1GY6 A;  3H3H A;  2QIY A;  3EF8 A;  1EA2 A;  1OF5 B;  3EN8 A;  4R9K A;  3FZW A;  3VSY A;  3EJV A;  5AII A;  5KP1 A;  5KP4 A;  1SJW A;  2YFL B;  3FSD A;  3OWY A;  3D9R A;  4STD A;  4J9A A;  4Q53 A;  3SOY A;  1JN5 A;  3EN1 B;  4IIA A;  2XSH B;  4OUQ A;  6STD A;  3F7X A;  1E97 A;  3FF0 A;  3JUN A;  3JUM A;  4HJL B;  5AIF A;  3CPO A;  5AEW B;  3MKI A;  3JUO A;  3MSO A;  3F9S A;  2Z7A A;  3F14 A;  3K7C A;  3M8C A;  4L8O A;  3EHC A;  3FGY A;  1OGX A;  4HZ9 B;  3GWR A;  1JN5 B;  4XBY A;  2GBX B;  1QMA A;  3MG2 A;  1O7M B;  3B7C A;  1ULJ B;  4FCM A;  3I0Y A;  1OH0 A;  3SOA A;  1C7H A;  1QJG A;  3ECF A;  5FW5 A;  3F8X A;  1OPY A;  5D83 A;  1OUN A;  5EVH A;  3JUQ A;  4HZB B;  4XM4 A;  5IG0 A;  1AR0 A;  2F98 A;  2RCD A;  1OGZ A;  1STD A;  1GYB A;  2K54 A;  2UX0 A;  5CLK A;  4CDL A;  5CF2 A;  1ISK A;  3BB9 A;  3UNL A;  1W01 A;  4XDV A;  3NBR A;  4XBX A;  1OF5 A;  4OVM A;  5CXO A;  3CU3 A;  4L7K A;  1JKG B;  3KKG A;  4HM7 B;  3HZP A;  2HMO B;  1ULI B;  2HMN B;  3OX9 A;  2RGQ A;  3FH1 A;  3GZX B;  4ORL A;  2JQ5 A;  2OWP A;  5DRV A;  3Q90 A;  5KP3 A;  1GY7 A;  3GZR A;  8CHO A;  3A76 A;  1UUV B;  2XSO B;  4FCJ A;  1ASK A;  4XBT A;  3NV0 A;  2STD A;  4H3U A;  3VGN A;  4GB5 A;  1A2K A;  2Z77 A;  2GBW B;  2HMJ B;  1E3V A;  3LYG A;  1JKG A;  3GZY B;  5JPU A;  4HKV B;  2PZV A;  3NUV A;  1U5O A;  3CNX A;  5IF6 A;  1DMM A;  3KE7 A;  3KZT A;  3B4O A;  2BMQ B;  4J8T A;  3S5C A;  1W00 A;  3WMD A;  1K41 A;  1ZO2 A;  3EBY A;  3NV0 B;  3DMC A;  2B1X B;  2GXF A;  1W6Y A;  4LGQ A;  2B24 B;  2GEY A;  4WYK A;  3EC9 A;  3EX9 A;  5G2G A;  4HM0 B;  4HM1 B;  1OHO A;  1JB2 A;  5DRE A;  3FF2 A;  2RFR A;  1S5A A;  1TUH A;  3G16 A;  3GRD A;  2I9W A;  1ZX2 A;  1O7H B;  2W2C A;  3DM8 A;  3DXO A;  1HKX A;  1O7N B;  2BMO B;  1E3R A;  3ER7 A;  4HM4 B;  1GS3 A;  3BLZ A;  5JPP A;  4HM5 B;  3K0Z A;  1IDP A;  2XR8 B;  4HM2 B;  3ROB A;  3T8U A;  1NDO B;  4HM3 B;  5HGR A;  2BMR B;  4RZM A;  4X2O A;  4HM8 B;  5BXQ A;  1OHS A;  3T8N A;  5IER A;  4U13 A;  3EBT A;  5IG3 A;  5CK6 A;  5IG4 A;  5AEU B;  5AIG A;  3HK4 A;  1Q42 A;  3LZA A;  2HMK B;  4R9L A;  1EG9 B;  3DUK A;  3OWU A;  1O7W B;  4K1V A;  1CQS A;  1DMN A;  1VZZ A;  2HML B;  4LMI A;  5AIH A;  5STD A;  3STD A;  7STD A;  3MG1 A;  3OV4 A;  1JB4 A;  3GZB A;  3H51 A;  2F86 B;  3RGA A;  2CHC A;  1NWW A;  4KVH A;  1W02 A;  3IPT A;  4LEH A;  3NXJ A;  3RGR A;  2INX A;  3CNM A;  2HMM B;  3FKA A;  5D82 A;  3B8L A;  1WQL B;  3JUP A;  5BVB A;  4N3V A;  4I4K A;  4WYK B;  3KSP A;  3E99 A;  3F7S A;  1DMQ A;  1NU3 A;  1UUW B;  4HM6 B;  5IEN A;  3MG3 A;  4K1U A; 
#chains in the Genus database with same CATH topology
 2Z76 A;  3CCV 3;  2K0M A;  1BUQ A;  2F4Y A;  1Z1S A;  1FUS A;  1TP6 A;  2KRT A;  1ZS7 A;  2QGU A;  4IT7 A;  4BU4 A;  4BL3 A;  5ELU A;  5ELJ A;  3EQQ B;  1K8A 4;  1Q40 A;  1VQL 3;  4XDW A;  2YFJ B;  5LC6 A;  4L8P A;  1US1 A;  2HOH A;  3SLU A;  4MMZ B;  2CKF B;  1N5H A;  3BND A;  4WWU C;  3TDG A;  3DY5 A;  3HII A;  2YFI B;  3F8H A;  2XFS A;  3NBJ A;  1Q40 B;  3DGY A;  1RGF A;  3NQY A;  3WHO A;  1GY6 A;  1WMP A;  2QIY A;  2ZDJ A;  3H3H A;  3EN8 A;  5RNT A;  1OAC A;  3EJV A;  1BNI A;  2CWV A;  2KCD A;  3OWY A;  1LOX A;  3SOY A;  3CCQ 3;  4STD A;  1UCL A;  3U97 A;  4NPB A;  1PFP A;  2W0Q A;  2XSH B;  1FYS A;  1BNS A;  4OUQ A;  1N9E A;  3T0U A;  1UI7 A;  2BO9 B;  3CC7 3;  3JUN A;  3JUM A;  5AEW B;  2ML5 A;  2BHM A;  1PY3 A;  1RCK A;  3AGO A;  3F14 A;  2K3D A;  1BNR A;  2GBX B;  1T5Y A;  4TX4 A;  3CPW 2;  3I0Y A;  1C7H A;  1YGW A;  3ECF A;  1LQG C;  4LZI A;  1RN4 A;  1OPY A;  1UCI A;  3S29 A;  3FG4 A;  1AR0 A;  2F98 A;  2UX0 A;  1IV9 A;  1IT7 A;  2K54 A;  5CF2 A;  3AHS A;  3BB9 A;  3LTB A;  4XDV A;  1OF5 A;  4G1M B;  4L7K A;  1NO3 A;  2CWU A;  3Q3F A;  2RGQ A;  3FH1 A;  1FZU A;  4ORL A;  1MGR A;  3UL5 A;  3GZR A;  1MNL A;  3A76 A;  2XSO B;  3KII A;  4FCJ A;  1ASK A;  3WDG B;  4HAA A;  3NV0 A;  2STD A;  3EE1 A;  3VGN A;  1C54 A;  1A2K A;  1SIH A;  2Z77 A;  2HMJ B;  1FGO A;  3LYG A;  5BIR A;  1JKG A;  3S27 A;  1FUT A;  3UL6 A;  1W2B 2;  1JRQ A;  1U5O A;  3CNX A;  3NM7 A;  4RBN A;  1B2X A;  4J8T A;  2KF5 A;  3S5C A;  1VQK 3;  3EBY A;  3NV0 B;  2CFG A;  1K73 4;  1KWI A;  1JZO A;  3DH2 A;  1CYU A;  2JDI H;  2RSX A;  2GXF A;  3Q2P A;  1UDI I;  2B24 B;  2UGI A;  1J2B A;  4HM1 B;  4BIR A;  3G16 A;  4N6O B;  2GSP A;  4BTY A;  1B27 A;  2W2C A;  1LNI A;  3D3L A;  4KVH A;  1GS3 A;  1GSP A;  1TIJ A;  3U1W A;  2E2T A;  1QAL A;  4RZM A;  3FG1 A;  3PYJ A;  4N6L A;  3EBT A;  1UCJ A;  5AEU B;  1Q42 A;  1TJD A;  3OWU A;  2E2U A;  4K1V A;  1O7W B;  1EQK A;  1UGI A;  3DGM A;  1VZZ A;  4K90 B;  3WA3 A;  2Q07 A;  4J5K A;  2BU4 A;  3MG1 A;  2XEP A;  1I2F A;  3GZB A;  1QAF A;  1RGK A;  4JRF A;  3V99 A;  2INX A;  3CNM A;  1B20 A;  2FXT A;  4GSP A;  1I3I A;  4WYK B;  3E99 A;  1NU3 A;  2BT3 A;  2CX1 A;  1QVF 2;  1D6Z A;  1AY7 A;  3MYT A;  4NHF A;  1YJ9 3;  3CC4 3;  1TTO A;  1NNV A;  4BTW A;  3NQZ A;  2F99 A;  4MMY B;  1B2M A;  2V1L A;  1OCV A;  3NM2 A;  2ZA4 A;  3D4A A;  5IEO A;  1GY5 A;  2CW9 A;  3JVC A;  2C4B A;  4XB5 A;  1VQ6 3;  1O7G B;  1WNH A;  1IQX A;  1BOX A;  4WP5 A;  1S72 3;  3QK9 A;  1IV7 A;  1LOY A;  2A15 A;  4WFO A;  3G0K A;  5D81 A;  1VQ5 3;  3G8Z A;  4CJN A;  4EYC A;  4MEI A;  1IK3 A;  3EF8 A;  1EA2 A;  2MF7 A;  4R9K A;  4EV5 A;  1W2Z A;  2CFW A;  5AII A;  4CPK A;  2GU3 A;  1Q81 4;  5M18 A;  1MOL A;  1IVW A;  4J9A A;  2CFL A;  3X41 A;  4KFE A;  1E97 A;  3ZG0 A;  1RMS A;  5AIF A;  1VQ4 3;  3CPO A;  4O3V A;  1RNB A;  2XFT A;  1GMP A;  2XH9 A;  1I3F A;  3F9S A;  1DET A;  3JUO A;  3MSO A;  5A0O B;  3K7C A;  3M8C A;  3PCR A;  3MPH A;  3EHC A;  3LT9 A;  1A2P A;  2OOV C;  1YJW 3;  1RN7 A;  5G1L A;  1QMA A;  4MMX B;  3BU4 A;  1O7M B;  3RNT A;  1RNT A;  3PXM A;  3CME 3;  1BRS A;  1QJG A;  2M7O A;  5IW9 A;  3JUQ A;  4HZB B;  1WMO A;  3S28 A;  1G02 A;  4XM4 A;  5IG0 A;  1STD A;  4CDL A;  2ZL8 A;  4K61 A;  1X1X A;  1BNJ A;  1ISK A;  3UNL A;  1W01 A;  3NBB A;  4OVM A;  1LXE A;  3SVA A;  4AEQ A;  3KCH A;  1VQ9 3;  1ROA A;  1BGS A;  4R4K A;  5DRV A;  5IF6 A;  1T3B A;  2JQ5 A;  2OWP A;  1VQO 3;  4I5Q A;  1BRK A;  1GY7 A;  4HBR A;  5EEO A;  5BU4 A;  1TRP A;  1BSD A;  1GOU A;  1RGA A;  2OQE A;  1LRA A;  2GBW B;  5HOH A;  1VQ7 3;  2OCT A;  1FA3 A;  2KXG A;  4O8S A;  3ALA A;  2CX0 A;  5JPU A;  4AKY A;  2F5M A;  2QEX 3;  3OW2 2;  3RDE A;  3A5E A;  2AAD A;  1W00 A;  1DE3 A;  3PZW A;  3WMD A;  3G6E 3;  3L0R A;  3X40 A;  3ZFZ A;  1BRN L;  1IU7 A;  4HOH A;  2WGQ A;  1YVB I;  2UUG C;  2Z6B A;  4BL2 A;  2GEY A;  5G2G A;  2CG1 A;  4BTX A;  1SPU A;  1JB2 A;  4FMA A;  3GRD A;  2RFR A;  3QRD A;  3CCL 3;  1VQP 3;  2I9W A;  3ER7 A;  3K5T A;  4HM4 B;  3BLZ A;  5JPP A;  4GHO A;  4HM2 B;  4R80 A;  3ROB A;  1ROV A;  3T8U A;  3X42 A;  5HGR A;  1AV4 A;  5BXQ A;  1OHS A;  4U13 A;  2RBI A;  1RGE A;  1RN1 A;  2CK3 H;  4RNZ A;  3HK4 A;  1YIT 3;  1EG9 B;  3VF1 A;  1IT8 A;  1MWR A;  1BSB A;  1RGG A;  1YVS A;  1BU4 A;  2RNT A;  3I56 3;  1KC8 4;  1NJI 4;  3CD6 3;  1AVK A;  1IVX A;  1FGT A;  3X3Y A;  3LXU X;  3OV4 A;  1N8Q A;  1JB4 A;  1GOY A;  1W6C A;  3H51 A;  1AVL A;  2CHC A;  2FGT A;  4LEH A;  1VQM 3;  3SYU A;  1T2I A;  1UW1 A;  1HZ1 A;  2R41 A;  3GSP A;  3PGB A;  3X3Z A;  3D79 A;  3FKA A;  1V74 A;  2H0G A;  3KSP A;  4HM7 B;  3SOA A;  4HM6 B;  1EUI C;  3MG3 A;  1IVU A;  2P0M A;  3EB8 A;  1A67 A;  2W9Q A;  3F40 A;  3OXA A;  1JJ2 2;  3DZL A;  1EKM A;  2OTL 3;  1BRH A;  1HU9 A;  1Q82 4;  3SXX A;  2KF4 A;  5AYR B;  4PEJ A;  1N5P A;  2IMJ A;  3J7Y d;  1YGE A;  3ZG5 A;  1OHP A;  4CCV A;  4HYZ A;  1W7C A;  1CEW I;  3CMA 3;  3AHW A;  2GEX A;  5IEP A;  3WOE B;  1BVI A;  5TGN A;  4J5G A;  4X2H A;  6RNT A;  3D5G A;  2W6J H;  3K9M C;  3Q1C A;  3FLJ A;  5LC7 A;  1I8V A;  3CCS 3;  1Q86 4;  1OF5 B;  5AYS C;  2P0X A;  3VSY A;  3FZW A;  1RGH A;  1RGL A;  5M19 A;  3FSD A;  1JNQ A;  1R4C A;  3SX1 A;  1KD1 4;  1M1X B;  1A90 A;  3WOD G;  3EN1 B;  3GAX A;  4IIA A;  4WHA A;  6STD A;  3F7X A;  1M9G A;  1UUG B;  4HJL B;  4KT3 B;  1IVV A;  3NX0 A;  1D6U A;  4DKI A;  2Z7A A;  4L8O A;  6GSP A;  1BNG A;  1DVC A;  2E2V A;  3CCM 3;  1BSA A;  3KN4 A;  2O9U X;  2J8X B;  3B7C A;  1OH0 A;  2WO0 A;  5GSP A;  5M1A A;  3G4S 3;  3LML A;  5FW5 A;  1Q7H A;  3F8X A;  1PU4 A;  2CIU A;  2H0I A;  1Q7Y 4;  1MWT A;  2RCD A;  5CLK A;  1AQZ A;  1GYB A;  3K63 A;  1LOW A;  2W9P A;  1RHL A;  1X1U A;  3NBR A;  4XBX A;  3BNC A;  4N6T A;  1B2Z A;  5JBS A;  1B3S A;  1JKG B;  1ULI B;  2ZHX B;  3OX9 A;  1BAO A;  1JV2 B;  1R4Y A;  2Y73 A;  1BRJ A;  1BIR A;  3D5I A;  1I0X A;  3LT8 A;  5KP3 A;  8CHO A;  1UUV B;  4EC6 A;  1M90 4;  4XBT A;  1RCL A;  3DGO A;  4GB5 A;  2IUK A;  2P05 A;  2YX9 A;  1E3V A;  1K9M 4;  2PZV A;  1BAN A;  5EQL A;  3KE7 A;  3KZT A;  3CCJ 3;  3CCR 3;  4O2H A;  4RNY A;  1TU5 A;  1LNH A;  4N6U A;  3URP A;  1BRI A;  2B1X B;  2CFK A;  4WYK A;  3EX9 A;  4HM0 B;  1I2E A;  1OHO A;  5DRE A;  3FF2 A;  1TUH A;  1TRQ A;  4AKZ A;  4XBY A;  1ZX2 A;  1O7H B;  1GD4 A;  1N9J A;  3DM8 A;  4EBG A;  1E3R A;  1VQ8 3;  1G0T A;  3K0Z A;  3MWZ A;  2XR8 B;  2CC3 A;  2SBL A;  1UGH I;  2KF3 A;  3HIG A;  4HM5 B;  4HM3 B;  2H0H A;  4KFF A;  5IG4 A;  3T8N A;  1MWS A;  3BNE A;  1FGQ A;  5CK6 A;  3X3X A;  2WOF A;  2HMK B;  4FCZ A;  1W6G A;  4LYL B;  1RLS A;  2LQV A;  3I55 3;  4LMI A;  5STD A;  7STD A;  1EEJ A;  1NB5 I;  1B2S A;  1RGC A;  3AMO B;  3CC2 3;  1VQQ A;  1NWW A;  1FGR A;  1IYY A;  3RGR A;  2XGL A;  4N6V 0;  1PYL A;  2D42 A;  5D82 A;  3B8L A;  1KQS 2;  3JUP A;  5BVB A;  4I4K A;  1DVD A;  2F5W A;  1RRH A;  3F7S A;  1DMQ A;  4EV2 A;  2OTJ 3;  3AMO A;  2AAE A;  4K1U A;  3UJM A;  5CF1 A;  1RKY A;  1A2V A;  4FR9 A;  1O7P B;  1JBS A;  3KSE D;  4HVN A;  1JB5 A;  2XRX B;  1CH0 A;  2QA4 3;  4R1K A;  1RJO A;  2FNQ A;  1TFO A;  2BNG A;  2LYX A;  5AI1 A;  3B4P A;  1SQW A;  3MHE A;  2IY2 A;  3HOH A;  3NHX A;  4MJD A;  1JBT A;  2W04 A;  2C11 A;  4FMC A;  3HX8 A;  2MC8 A;  1IQY A;  2R4I A;  3V98 A;  3IJE B;  1V57 A;  1BSE A;  2L4V A;  2P09 A;  5IG5 A;  1LOV A;  3FG3 A;  3OWS A;  1UCK A;  1WTH A;  1LVN A;  3DGL A;  4JF8 A;  5KP1 A;  1BSC A;  1WMN A;  1I70 A;  5KP4 A;  1SJW A;  2YFL B;  2KF6 A;  5I97 A;  3D9R A;  4Q53 A;  2Y74 A;  1JN5 A;  1LQM B;  1U8C B;  3FF0 A;  1I0V A;  1L5G B;  2WGO A;  3MKI A;  1M1K 4;  1BNF A;  3KFQ C;  4H61 A;  3FGY A;  2CFD A;  1OGX A;  4HZ9 B;  3GWR A;  1JN5 B;  4GL6 A;  5G1K A;  1B2U A;  3N9H A;  3MG2 A;  1ULJ B;  4FCM A;  3WA2 X;  3CCU 3;  3AGN A;  1KSI A;  4LSO A;  2F56 A;  5D83 A;  1OUN A;  2IA7 A;  5EVH A;  3CCE 3;  1VQN 3;  1YI2 3;  3LTC A;  2CWT A;  1I2G A;  1RTU A;  1G96 A;  1OGZ A;  4KZ1 A;  1GD3 A;  3S67 A;  2OOV A;  3PCS A;  4FMB A;  4OK0 A;  5CXO A;  3CU3 A;  3KKG A;  3HZP A;  1D6Y A;  2HMO B;  2HMN B;  3LTA A;  3LOY A;  1STF I;  3N8B A;  4N6N B;  1CYV A;  2PNC A;  2W56 B;  3GZX B;  5IG3 A;  1SII A;  1FGM A;  4N6M A;  3Q90 A;  1YIJ 3;  2O3O A;  7GSP A;  3LH4 A;  4H3U A;  1QVG 2;  1W5Z A;  2BIR A;  9RNT A;  4FMD A;  1FUW A;  8RNT A;  2P38 A;  3FCS B;  3GZY B;  4IPB A;  4HKV B;  3NUV A;  2W56 A;  4RNT A;  2CG0 A;  1YJN 3;  1DMM A;  3V92 A;  1MWU A;  3B4O A;  2BMQ B;  1N8R 4;  1BUJ A;  1K41 A;  1X1W A;  1ZO2 A;  1YHQ 3;  3LTD A;  3PS8 A;  3DMC A;  4QWT A;  1RSN A;  1B21 A;  1NB3 I;  4LGQ A;  1W6Y A;  2XGN A;  3EC9 A;  2OQE C;  1YNV X;  2IUJ A;  1W4N A;  1S5A A;  3SED A;  3DXO A;  1MGW A;  1RDS A;  2KAA A;  1HKX A;  1O7N B;  2BMO B;  3IMA B;  2SAR A;  4O02 B;  1TFK A;  3WR2 A;  1Q9E A;  1IDP A;  1JBR A;  1NDO B;  5IER A;  3O8Y A;  2BMR B;  2WOH A;  4X2O A;  1GMR A;  4HM8 B;  1FW7 A;  3DGN A;  2ML6 A;  5AIG A;  1F8N A;  1HYF A;  1K28 A;  3LZA A;  1RRL A;  4R9L A;  1GMQ A;  3BNB A;  3DUK A;  1CQS A;  4NRE A;  1DMN A;  1BNE A;  1UI8 A;  2CH9 A;  2HML B;  3N54 B;  5AIH A;  3STD A;  3HI7 A;  3WOF B;  4EXR A;  1GOV A;  2C10 A;  3CXC 2;  5FGO A;  4EW5 A;  2L1S A;  2GU1 A;  2F86 B;  1V58 A;  1Y4K A;  2W03 A;  1IQ8 A;  2XF3 A;  3RGA A;  1W02 A;  3UB1 A;  1T2H A;  1DYU A;  3G71 3;  3NXJ A;  2IYJ A;  4ZM8 A;  1BRG A;  1JZD A;  2HMM B;  1QAK A;  4ILF A;  1WQL B;  3BIR A;  2D1W A;  4N3V A;  4KFD A;  3IPT A;  1ZGX A;  1UUW B;  1X1Y A;  5IEN A;  7RNT A;  1SAR A; 
#chains in the Genus database with same CATH homology
 2Z76 A;  3CCV 3;  2K0M A;  1BUQ A;  1Z1S A;  1TP6 A;  2KRT A;  2QGU A;  4IT7 A;  1K8A 4;  5ELU A;  5ELJ A;  3EQQ B;  1Q40 A;  1VQL 3;  4XDW A;  2YFJ B;  5LC6 A;  4L8P A;  1US1 A;  3SLU A;  4MMZ B;  2CKF B;  1N5H A;  3BND A;  4WWU C;  3TDG A;  3DY5 A;  3HII A;  2YFI B;  3F8H A;  2XFS A;  3NBJ A;  1Q40 B;  3NQY A;  1GY6 A;  1WMP A;  2QIY A;  2ZDJ A;  3H3H A;  3EN8 A;  1OAC A;  3EJV A;  2CWV A;  2KCD A;  3OWY A;  1LOX A;  3SOY A;  3CCQ 3;  4STD A;  3U97 A;  1PFP A;  2W0Q A;  2XSH B;  4OUQ A;  1N9E A;  3T0U A;  1UI7 A;  2BO9 B;  3CC7 3;  3JUN A;  3JUM A;  5AEW B;  2ML5 A;  2BHM A;  3F14 A;  2GBX B;  1T5Y A;  4TX4 A;  3CPW 2;  3I0Y A;  1C7H A;  3ECF A;  4LZI A;  1OPY A;  3S29 A;  3FG4 A;  1AR0 A;  2F98 A;  2UX0 A;  1IV9 A;  1IT7 A;  2K54 A;  5CF2 A;  3BB9 A;  3LTB A;  4XDV A;  1OF5 A;  4G1M B;  4L7K A;  1NO3 A;  2CWU A;  2RGQ A;  3FH1 A;  4ORL A;  3UL5 A;  3GZR A;  1MNL A;  3A76 A;  2XSO B;  3KII A;  4FCJ A;  1ASK A;  3WDG B;  3NV0 A;  2STD A;  3EE1 A;  3VGN A;  1A2K A;  1SIH A;  2Z77 A;  2HMJ B;  1FGO A;  3LYG A;  1JKG A;  3S27 A;  1W2B 2;  3UL6 A;  1JRQ A;  1U5O A;  3CNX A;  3NM7 A;  4RBN A;  4J8T A;  3S5C A;  3EBY A;  3NV0 B;  2CFG A;  1K73 4;  1KWI A;  1CYU A;  2RSX A;  2JDI H;  2GXF A;  3Q2P A;  2B24 B;  1J2B A;  4HM1 B;  3G16 A;  4N6O B;  4BTY A;  2W2C A;  3D3L A;  4KVH A;  1GS3 A;  1TIJ A;  3U1W A;  2E2T A;  1QAL A;  4RZM A;  3FG1 A;  3PYJ A;  4N6L A;  3EBT A;  5AEU B;  1Q42 A;  3OWU A;  2E2U A;  4K1V A;  1O7W B;  1EQK A;  3DGM A;  1VZZ A;  4K90 B;  3WA3 A;  2Q07 A;  3MG1 A;  2XEP A;  3GZB A;  1QAF A;  4JRF A;  3V99 A;  2INX A;  3CNM A;  2FXT A;  4WYK B;  3E99 A;  1NU3 A;  2BT3 A;  1QVF 2;  1D6Z A;  3MYT A;  4NHF A;  1YJ9 3;  3CC4 3;  4BTW A;  3NQZ A;  2F99 A;  4MMY B;  2V1L A;  1OCV A;  3NM2 A;  5IEO A;  1GY5 A;  2CW9 A;  3JVC A;  4XB5 A;  1VQ6 3;  1O7G B;  1WNH A;  1IQX A;  4WP5 A;  1S72 3;  3QK9 A;  1IV7 A;  2A15 A;  4WFO A;  3G0K A;  5D81 A;  1VQ5 3;  3G8Z A;  4EYC A;  4MEI A;  1IK3 A;  3EF8 A;  1EA2 A;  2MF7 A;  4R9K A;  4EV5 A;  1W2Z A;  2CFW A;  5AII A;  1Q81 4;  2GU3 A;  1MOL A;  1IVW A;  4J9A A;  2CFL A;  3X41 A;  4KFE A;  1E97 A;  5AIF A;  1VQ4 3;  3CPO A;  4O3V A;  2XFT A;  3JUO A;  2XH9 A;  3MSO A;  3F9S A;  5A0O B;  3K7C A;  3M8C A;  3PCR A;  3MPH A;  3EHC A;  3LT9 A;  2OOV C;  1YJW 3;  1RN7 A;  1QMA A;  4MMX B;  1O7M B;  3PXM A;  3CME 3;  1QJG A;  2M7O A;  5IW9 A;  3JUQ A;  4HZB B;  1WMO A;  3S28 A;  4XM4 A;  5IG0 A;  1STD A;  4CDL A;  2ZL8 A;  4K61 A;  1ISK A;  3UNL A;  1W01 A;  3NBB A;  4OVM A;  1LXE A;  3SVA A;  4AEQ A;  1VQ9 3;  1ROA A;  4R4K A;  5DRV A;  5IF6 A;  2JQ5 A;  2OWP A;  1GY7 A;  4HBR A;  5EEO A;  2OQE A;  2GBW B;  1VQ7 3;  2OCT A;  1FA3 A;  2KXG A;  4O8S A;  3ALA A;  5JPU A;  2QEX 3;  4AKY A;  3OW2 2;  3RDE A;  1W00 A;  3PZW A;  3WMD A;  3G6E 3;  3L0R A;  3X40 A;  1IU7 A;  2WGQ A;  1YVB I;  2Z6B A;  2GEY A;  5G2G A;  2CG1 A;  4BTX A;  1SPU A;  1JB2 A;  4FMA A;  3GRD A;  2RFR A;  3QRD A;  3CCL 3;  1VQP 3;  2I9W A;  3ER7 A;  3K5T A;  4HM4 B;  3BLZ A;  5JPP A;  4HM2 B;  4R80 A;  3ROB A;  1ROV A;  3T8U A;  3X42 A;  5HGR A;  1AV4 A;  5BXQ A;  1OHS A;  4U13 A;  2CK3 H;  4RNZ A;  3HK4 A;  1YIT 3;  1EG9 B;  3VF1 A;  1IT8 A;  3I56 3;  1KC8 4;  1NJI 4;  3CD6 3;  1AVK A;  1IVX A;  1FGT A;  3X3Y A;  3LXU X;  3OV4 A;  1N8Q A;  1JB4 A;  1W6C A;  3H51 A;  1AVL A;  2CHC A;  2FGT A;  4LEH A;  1VQM 3;  1UW1 A;  3X3Z A;  3PGB A;  3FKA A;  1V74 A;  3KSP A;  4HM7 B;  3SOA A;  4HM6 B;  3MG3 A;  3EB8 A;  2P0M A;  1IVU A;  1A67 A;  2W9Q A;  3F40 A;  3OXA A;  1JJ2 2;  3DZL A;  1EKM A;  2OTL 3;  1HU9 A;  1Q82 4;  3SXX A;  5AYR B;  4PEJ A;  1N5P A;  2IMJ A;  3J7Y d;  1YGE A;  1OHP A;  4CCV A;  4HYZ A;  1W7C A;  1CEW I;  3CMA 3;  2GEX A;  5IEP A;  3WOE B;  5TGN A;  4X2H A;  3CCS 3;  3Q1C A;  2W6J H;  3K9M C;  5LC7 A;  3FLJ A;  1Q86 4;  1OF5 B;  5AYS C;  2P0X A;  3VSY A;  3FZW A;  3FSD A;  1JNQ A;  1R4C A;  3SX1 A;  1KD1 4;  1M1X B;  1A90 A;  3WOD G;  3EN1 B;  3GAX A;  4IIA A;  4WHA A;  6STD A;  3F7X A;  1M9G A;  4HJL B;  1IVV A;  3NX0 A;  1D6U A;  2Z7A A;  4L8O A;  1DVC A;  2E2V A;  3CCM 3;  3KN4 A;  2O9U X;  3B7C A;  1OH0 A;  2WO0 A;  3G4S 3;  3LML A;  5FW5 A;  3F8X A;  1PU4 A;  2CIU A;  1Q7Y 4;  2RCD A;  5CLK A;  1GYB A;  3K63 A;  2W9P A;  3NBR A;  4XBX A;  3BNC A;  4N6T A;  5JBS A;  1JKG B;  1ULI B;  3OX9 A;  1JV2 B;  3LT8 A;  2Y73 A;  5KP3 A;  8CHO A;  1UUV B;  4EC6 A;  1M90 4;  4XBT A;  3DGO A;  4GB5 A;  2IUK A;  2P05 A;  2YX9 A;  1E3V A;  1K9M 4;  2PZV A;  5EQL A;  3KE7 A;  3KZT A;  3CCJ 3;  3CCR 3;  4O2H A;  4RNY A;  1TU5 A;  1LNH A;  4N6U A;  2B1X B;  4WYK A;  2CFK A;  3EX9 A;  4HM0 B;  5DRE A;  1OHO A;  3FF2 A;  1TUH A;  4AKZ A;  4XBY A;  1ZX2 A;  1O7H B;  1GD4 A;  1N9J A;  3DM8 A;  4EBG A;  1E3R A;  1VQ8 3;  3MWZ A;  3K0Z A;  4HM5 B;  2XR8 B;  2CC3 A;  2SBL A;  3HIG A;  4HM3 B;  4KFF A;  5IG4 A;  3T8N A;  3BNE A;  1FGQ A;  5CK6 A;  3X3X A;  2WOF A;  2HMK B;  4FCZ A;  1W6G A;  3I55 3;  2LQV A;  4LMI A;  5STD A;  7STD A;  1NB5 I;  3AMO B;  3CC2 3;  1NWW A;  1FGR A;  3RGR A;  2XGL A;  4N6V 0;  2D42 A;  5D82 A;  3B8L A;  1KQS 2;  3JUP A;  5BVB A;  4I4K A;  1DVD A;  1RRH A;  3F7S A;  1DMQ A;  4EV2 A;  2OTJ 3;  3AMO A;  4K1U A;  3UJM A;  5CF1 A;  1RKY A;  1A2V A;  4FR9 A;  1O7P B;  3KSE D;  4HVN A;  1JB5 A;  2XRX B;  2QA4 3;  4R1K A;  1RJO A;  2FNQ A;  1TFO A;  2BNG A;  2LYX A;  5AI1 A;  3B4P A;  1SQW A;  3MHE A;  4MJD A;  3NHX A;  2W04 A;  2C11 A;  4FMC A;  3HX8 A;  2MC8 A;  1IQY A;  2R4I A;  3V98 A;  3IJE B;  1VQK 3;  2L4V A;  2P09 A;  5IG5 A;  3FG3 A;  3OWS A;  1WTH A;  1LVN A;  3DGL A;  4JF8 A;  5KP1 A;  1WMN A;  5KP4 A;  1SJW A;  2YFL B;  5I97 A;  3D9R A;  4Q53 A;  2Y74 A;  1JN5 A;  1U8C B;  3FF0 A;  1L5G B;  2WGO A;  3MKI A;  1M1K 4;  4H61 A;  3KFQ C;  3FGY A;  2CFD A;  1OGX A;  4HZ9 B;  3GWR A;  1JN5 B;  4GL6 A;  3N9H A;  3MG2 A;  1ULJ B;  4FCM A;  3WA2 X;  3CCU 3;  1KSI A;  4LSO A;  3CCE 3;  5D83 A;  1OUN A;  2IA7 A;  5EVH A;  1VQN 3;  1YI2 3;  3LTC A;  2CWT A;  1G96 A;  1OGZ A;  4KZ1 A;  1GD3 A;  3S67 A;  2OOV A;  3PCS A;  4FMB A;  4OK0 A;  5CXO A;  3CU3 A;  3KKG A;  3HZP A;  1D6Y A;  2HMO B;  2HMN B;  3LTA A;  3LOY A;  1STF I;  3N8B A;  4N6N B;  1CYV A;  2PNC A;  2W56 B;  3GZX B;  5IG3 A;  1SII A;  1FGM A;  4N6M A;  3Q90 A;  1YIJ 3;  2O3O A;  3LH4 A;  4H3U A;  1QVG 2;  1W5Z A;  4FMD A;  1FUW A;  2P38 A;  3FCS B;  3GZY B;  4IPB A;  4HKV B;  3NUV A;  2W56 A;  1YJN 3;  2CG0 A;  1DMM A;  3V92 A;  3B4O A;  2BMQ B;  1N8R 4;  1K41 A;  1ZO2 A;  1YHQ 3;  3LTD A;  3PS8 A;  3DMC A;  4QWT A;  1NB3 I;  4LGQ A;  1W6Y A;  2XGN A;  3EC9 A;  2OQE C;  2IUJ A;  1W4N A;  1S5A A;  3SED A;  3DXO A;  1VQO 3;  1HKX A;  1O7N B;  2BMO B;  3IMA B;  4O02 B;  1TFK A;  1IDP A;  1NDO B;  5IER A;  3O8Y A;  2BMR B;  2WOH A;  4X2O A;  4HM8 B;  3DGN A;  2ML6 A;  5AIG A;  1F8N A;  1K28 A;  3LZA A;  1RRL A;  4R9L A;  3DUK A;  3BNB A;  1CQS A;  4NRE A;  1DMN A;  2HML B;  1UI8 A;  2CH9 A;  5AIH A;  3N54 B;  3STD A;  3HI7 A;  3WOF B;  4EXR A;  3CXC 2;  2C10 A;  5FGO A;  2GU1 A;  2F86 B;  1Y4K A;  2W03 A;  2XF3 A;  1IQ8 A;  3RGA A;  1W02 A;  3UB1 A;  3G71 3;  1DYU A;  3NXJ A;  4ZM8 A;  2HMM B;  1QAK A;  1WQL B;  2D1W A;  4N3V A;  4KFD A;  3IPT A;  1UUW B;  5IEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...