1BUQA

Solution structure of delta-5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone-hemisuccinate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFFANSLKLPLAVELTQEVRAVANEAAFAFTVSFEFQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROTEIN (3-KETOSTEROID ISOMERASE-19-NORTESTOSTERONE-HEMISUCC
publication title Solution structure of Delta 5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone hemisuccinate.
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 21
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1buqA00
2GEYA 1C7HA 2HMKB 3CNMA 3KZTA 1BUQA 3E99A 6STDA 4L8OA 4HZ9B 1OHSA 3WMDA 1O7NB 5D81A 4J9AA 1NU3A 1NWWA 5IERA 4L8PA 5KP3A 4HM7B 4Q53A 3EJVA 1TP6A 1QJGA 3B4PA 4HM0B 3RGRA 3EX9A 4R9KA 3CU3A 2QIYA 3JUQA 2B1XB 3NHXA 1Q40B 4FCMA 3EHCA 3I0YA 3ECFA 2R4IA 3T8NA 2HMLB 1Z1SA 3F7SA 4LEHA 4R9LA 2B24B 3NUVA 2BMOB 2INXA 4XB5A 2K54A 3OWUA 1IDPA 3EQQB 3EN8A 2RFRA 5IG3A 2XSHB 3A76A 3FSDA 1W00A 1CQSA 3DXOA 1EG9B 4LGQA 3MKIA 3RGAA 1HKXA 5IEOA 1GY5A 4OVMA 3NXJA 1OHOA 4HJLB 5CK6A 3GRDA 3JUOA 1STDA 3NBRA 3CPOA 3OX9A 4R1KA 1EA2A 3JUPA 3UNLA 2UX0A 4HM2B 3VSYA 1OUNA 2Z76A 2PZVA 4XDWA 1ZO2A 3GZRA 2F98A 3MYTA 3JUNA 2XSOB 2YFJB 3FZWA 4N3VA 1ULJB 3VGNA 3MSOA 3FF0A 1W01A 2Z77A 3MG1A 3H3HA 5G2GA 4XBTA 2XR8B 4FCJA 5IG5A 3DMCA 4HKVB 8CHOA 5AIGA 2IMJA 5DREA 4HM5B 3MG2A 4J8TA 5AEUB 5CF1A 1W02A 3B8LA 3F7XA 5BVBA 3CNXA 2HMOB 3GZXB 3H51A 3KE7A 1O7PB 2GXFA 3HZPA 4H3UA 1VZZA 2W2CA 5CLKA 3NM2A 3FF2A 2OWPA 2YFIB 3EBTA 3F8HA 3EF8A 1JKGB 1WQLB 3NV0B 2QGUA 3SOAA 3EN1B 4CDLA 1E3RA 3OWYA 4HM1B 5JPPA 7STDA 5STDA 5FW5A 4STDA 1K41A 3M8CA 1OHPA 5KP1A 4GB5A 2CKFB 1OGXA 2XRXB 1O7HB 3FH1A 4RZMA 5TGNA 3OXAA 4HM6B 5AIFA 5D82A 4U13A 3FLJA 1Q40A 1GY7A 4IIAA 1S5AA 3T8UA 4L7KA 1UUVB 1OF5B 1JKGA 1AR0A 3G0KA 4XDVA 3GWRA 4WYKB 3GZBA 3B4OA 1GS3A 5AIHA 3EBYA 3G8ZA 3K7CA 3FGYA 3F8XA 4XM4A 3IPTA 1ULIB 4KVHA 2A15A 1DMQA 5IEPA 1U5OA 1OPYA 3OWSA 1DMMA 1A2KA 2YFLB 3F40A 3LZAA 3SEDA 3K0ZA 5CF2A 4HZBB 4WP5A 2BMRB 3EC9A 3ER7A 4X2HA 1OF5A 4HM8B 1DMNA 5IENA 1O7WB 1O7GB 4WYKA 5HGRA 1JB4A 2I9WA 2BMQB 1JB5A 4LMIA 4HM4B 1JN5B 1OGZA 5EVHA 3F14A 3S5CA 5KP4A 3F9SA 1W6YA 4K1UA 1TUHA 2RGQA 3G16A 4X2OA 3JUMA 3DM8A 4XBYA 2GEXA 1ZX2A 1E97A 2HMNB 2GBXB 4ORLA 3LYGA 1E3VA 1O7MB 3D9RA 2F86B 3DUKA 5DRVA 3KKGA 5IG4A 1QMAA 1Q42A 3DZLA 5AIIA 2GBWB 5AI1A 4K1VA 1JN5A 3SOYA 1UUWB 4HVNA 2RCDA 4MJDA 3STDA 3BB9A 4I4KA 3ROBA 2STDA 1JB2A 1NDOB 3NV0A 5JPUA 3BLZA 2HMJB 3MHEA 3HX8A 1ISKA 5D83A 3OV4A 1OH0A 4WWUC 5CXOA 3FKAA 3HK4A 3B7CA 3GZYB 1GY6A 3MG3A 5IF6A 2BNGA 2CHCA 2Z7AA 4PEJA 2F99A 5AEWB 1OCVA 3UJMA 5IG0A 1SJWA 2JQ5A 3Q90A 5BXQA 1GYBA 1ASKA 2HMMB 4XBXA 3KSPA 4OUQA 4HM3B
chains in the Genus database with same CATH superfamily
1TIJA 2GEYA 1C7HA 2HMKB 3NQYA 3ZFZA 1TJDA 1BNJA 3D79A 3X42A 3CNMA 3KZTA 2CG0A 1NJI4 1BUQA 1VQO3 1NB3I 2KF6A 4IT7A 3E99A 6STDA 4L8OA 4HYZA 1M1K4 1YJN3 1ZS7A 2E2UA 4HZ9B 3BIRA 1BOXA 2RNTA 4OK0A 3U97A 1QVG2 1OHSA 3WMDA 3CCS3 2O9UX 4NPBA 2CFWA 1IVVA 1O7NB 2LQVA 5D81A 3LTAA 4J9AA 2D42A 1I2FA 1NU3A 3S67A 1B21A 2F4YA 3CC23 1T2IA 1NWWA 5IERA 2BU4A 4L8PA 4BU4A 4HM7B 1BSAA 4Q53A 5KP3A 2BHMA 1G0TA 3EJVA 3LTBA 3X3XA 3SVAA 2ML5A 3PCSA 1FUWA 1TP6A 2SBLA 1JRQA 1I2EA 2ZL8A 3N54B 3S28A 2GU1A 3QK9A 1BRNL 1IYYA 2MF7A 1JZDA 1QJGA 3B4PA 2FNQA 4HM0B 3RGRA 3EX9A 1K734 1FW7A 3ZG0A 3NQZA 4KFEA 1T5YA 3CU3A 3QRDA 2QIYA 3BNDA 4R9KA 5ELUA 4EC6A 3JUQA 1IV7A 3V99A 1YJ93 2B1XB 3NHXA 4EBGA 1Q40B 4FCMA 4EXRA 1M1XB 3DGNA 3EHCA 3I0YA 1JBSA 2WGQA 3ECFA 1W2B2 1YGEA 2R4IA 3T8NA 2L1SA 2WO0A 4CPKA 2HMLB 5HOHA 1G02A 2F56A 1Z1SA 3F7SA 1BRJA 3X3YA 1QVF2 4EV2A 1LOWA 3AMOB 4LSOA 1I3FA 4RNYA 1LOXA 1BIRA 1QAKA 1YNVX 4LEHA 1STFI 4R9LA 4N6LA 4TX4A 3CCR3 2ZDJA 2B24B 3NUVA 1BSEA 1WTHA 2BMOB 2W03A 2INXA 4XB5A 2K54A 3OWUA 3CXC2 1IDPA 1US1A 2CX0A 3EN8A 1W5ZA 3EQQB 1VQ73 2RFRA 1EEJA 3DGOA 1RJOA 1A67A 5IG3A 2XSHB 3O8YA 3A76A 3WR2A 1I8VA 1W00A 1CQSA 3FSDA 3DXOA 3HIGA 3X3ZA 9RNTA 1RCLA 1S723 1EG9B 2ML6A 1BNIA 1BNFA 2OOVC 3FG4A 3MKIA 4LGQA 4QWTA 3WOFB 3RGAA 1MWUA 3N9HA 1MNLA 3GSPA 1HKXA 5IEOA 2W9PA 3LT9A 1I0VA 3HIIA 1GY5A 2E2TA 2O3OA 3NBBA 4OVMA 2C4BA 1N9EA 2YX9A 1LXEA 3NXJA 3HOHA 1OHOA 3BU4A 2P09A 4HJLB 5CK6A 4AKZA 3CC73 2Z6BA 1UI8A 3GRDA 1I70A 3WHOA 4EW5A 3JUOA 1YVBI 1STDA 3I563 3SLUA 1DE3A 3G6E3 4LZIA 4NHFA 1FGRA 1GD3A 3LTCA 3LXUX 2CFLA 3NBRA 2CWTA 3CPOA 3OX9A 4R1KA 1EA2A 2BIRA 1YIJ3 2CG1A 1A2PA 1MWSA 5I97A 1N8R4 1RCKA 2KCDA 1W6GA 3LT8A 3JUPA 7RNTA 1GMPA 1GMQA 1YHQ3 3UNLA 1T2HA 2UX0A 4O02B 4HM2B 3VSYA 1TFKA 2RSXA 2IYJA 1OUNA 1IVWA 2IUKA 2Z76A 3SXXA 4ILFA 3X41A 2PZVA 3CCE3 2C10A 4XDWA 3CCL3 3S29A 1TRPA 1ZO2A 2H0IA 1MWTA 2BT3A 3MWZA 3RDEA 3GZRA 3ZG5A 3CCU3 2F98A 1B2SA 1BNEA 1FGTA 3MYTA 1JBRA 1RHLA 2AAEA 3CC43 3JUNA 2XSOB 2YFJB 1QALA 1W4NA 1X1WA 3FZWA 2IUJA 1RKYA 4N3VA 1Q814 4K61A 5EEOA 1ULJB 3VGNA 3MSOA 1VQ53 4FMDA 3PXMA 1IQ8A 3FF0A 1W01A 1DVCA 2Z77A 5GSPA 2RBIA 4AKYA 3MG1A 1DVDA 3CMA3 2L4VA 1TRQA 1RNBA 2GSPA 2R41A 3AGOA 3H3HA 5G2GA 1RGFA 4XBTA 2XR8B 1CEWI 1C54A 1WNHA 1Q7Y4 2J8XB 4FCJA 5BU4A 3S27A 5IG5A 2MC8A 3DMCA 4HOHA 1IQYA 2W56B 1FGQA 5A0OB 1A90A 4HKVB 8CHOA 5AIGA 1LQGC 2CK3H 2IMJA 4N6MA 1I2GA 1VQK3 1K9M4 1BGSA 3FG1A 4KFFA 5DREA 1M904 4HM5B 3MG2A 4J8TA 1Q864 1YVSA 5AEUB 1VQQA 5CF1A 2F5WA 3KN4A 1IQXA 1W02A 2WOFA 3B8LA 1N8QA 4GL6A 3F7XA 4MMXB 1BRHA 3UL5A 1AVKA 1MWRA 1Q7HA 1UCLA 5BVBA 2K3DA 2HMOB 3CNXA 3GZXB 1Y4KA 3H51A 3KE7A 1O7PB 2GXFA 3WODG 5ELJA 3UL6A 2XFTA 1FGOA 1GD4A 2D1WA 4BIRA 3HZPA 4H3UA 3CD63 1VZZA 3Q2PA 3J7Yd 2WOHA 3EE1A 1RRLA 5LC7A 1BAOA 1BSBA 3PZWA 2M7OA 2W2CA 2XH9A 4FMBA 5CLKA 1BRKA 2FGTA 4GHOA 3NM2A 1D6UA 4BTYA 1LOYA 3FF2A 2OWPA 2YFIB 6RNTA 1VQ43 3CCM3 1BVIA 1HYFA 1LNHA 1MGRA 1PFPA 1LRAA 1UW1A 2K0MA 3EBTA 3F8HA 3PGBA 3NBJA 3EF8A 1D6YA 2KF4A 4G1MB 1B2MA 1JKGB 1RGKA 1WQLB 3NV0B 1N9JA 4FR9A 2QGUA 1AVLA 3BNEA 3SOAA 3WDGB 3UB1A 2W56A 1FGMA 2KRTA 2AADA 4NREA 5M1AA 3N8BA 1TU5A 5BIRA 1VQP3 3EN1B 2WGOA 4CDLA 4BTXA 1R4CA 3FG3A 3SX1A 1E3RA 1UCKA 1Q9EA 1BANA 1W7CA 3OWYA 5AYRB 2OTJ3 4HM1B 4DKIA 5JPPA 3PYJA 1K28A 7STDA 1N5HA 4N6V0 4R80A 1RGEA 3LH4A 1VQM3 5STDA 4N6TA 3DGYA 5FW5A 4WHAA 4STDA 1JJ22 1K41A 3M8CA 4MEIA 1UCJA 3CME3 4RNZA 1OHPA 1VQ63 5KP1A 4GB5A 2CKFB 1OGXA 2XRXB 1NO3A 3D5GA 1O7HB 3FH1A 4RZMA 3CCV3 2QA43 5TGNA 1Q824 1I3IA 1X1YA 1FYSA 1B3SA 1X1XA 1BRSA 3DH2A 3HI7A 1U8CB 3OXAA 3Q3FA 4HM6B 1BSDA 4J5GA 1PYLA 5AIFA 3T0UA 1W2ZA 3WA2X 8RNTA 2IY2A 5D82A 1IU7A 1RSNA 4U13A 1NB5I 3CCJ3 1RMSA 3FLJA 6GSPA 1Q40A 3D3LA 1GMRA 1LQMB 1GY7A 1M9GA 4IIAA 5EQLA 3IJEB 4MMYB 4JF8A 1S5AA 1RGAA 1RNTA 3T8UA 4L7KA 5JBSA 1IT7A 1YJW3 1SIHA 1CYVA 1EUIC 1RDSA 1UUVB 2P05A 3AMOA 4RBNA 1OF5B 3NX0A 2OOVA 1X1UA 1JKGA 1KD14 1AR0A 1BNGA 2CWUA 1JV2B 1GSPA 2UUGC 2OTL3 3G0KA 4XDVA 3GWRA 5LC6A 1FUTA 3EB8A 4FMAA 1AY7A 2P38A 3JVCA 4WYKB 2GU3A 2SARA 1YGWA 1AV4A 3GZBA 1B20A 3K63A 3B4OA 1GS3A 3K9MC 1YI23 2V1LA 2OCTA 5AIHA 3EBYA 1ROAA 1VQ93 4CCVA 1B2XA 2LYXA 2FXTA 3URPA 1RN4A 1UGIA 3NM7A 1A2VA 1HZ1A 3G8ZA 1RN7A 1WMPA 3K7CA 1FA3A 3FGYA 3F8XA 4XM4A 3IPTA 1ULIB 4KVHA 4O2HA 1EKMA 2A15A 1WMNA 1YIT3 1ZGXA 1BSCA 1IVXA 1LNIA 2KF5A 1DMQA 4ZM8A 1K8A4 3SYUA 5IEPA 1U5OA 1WMOA 4N6NB 4MMZB 1OPYA 2KAAA 3OW22 3OWSA 1DMMA 3AGNA 2XFSA 1A2KA 3GAXA 2YFLB 1LVNA 1KC84 1LOVA 1V57A 3F40A 3LZAA 2H0HA 3SEDA 2P0MA 3DY5A 4K90B 1FZUA 1SIIA 3K0ZA 1NNVA 1VQN3 5CF2A 1D6ZA 1FUSA 2CIUA 4HZBB 1UUGB 1V58A 1BNRA 4WP5A 2BMRB 3D5IA 3KFQC 4LYLB 3AHWA 1IV9A 1VQL3 3IMAB 1CYUA 3I553 2F5MA 3EC9A 1F8NA 3ER7A 1I0XA 5RNTA 4X2HA 3CPW2 4BL3A 1OF5A 1RGGA 1JZOA 2W9QA 4HM8B 2C11A 1JBTA 4WFOA 1DMNA 1RN1A 2H0GA 4EYCA 5IENA 1IVUA 1UDII 1GOYA 1B2UA 1JNQA 1O7WB 1O7GB 3BNCA 1JB4A 2I9WA 4WYKA 1KSIA 1PY3A 5HGRA 1IK3A 1RTUA 2BMQB 1EQKA 1JB5A 1QAFA 4LMIA 3G4S3 4HM4B 1GOVA 1UGHI 1BU4A 1JN5B 1OGZA 3WOEB 5FGOA 2Y74A 5G1KA 1T3BA 5EVHA 3K5TA 3F14A 4GSPA 1KQS2 3U1WA 1RLSA 4CJNA 4R4KA 1BRGA 3S5CA 1RGLA 1R4YA 1RRHA 5IW9A 4H61A 1UCIA 2KF3A 1KWIA 2PNCA 4N6UA 1BNSA 5KP4A 3A5EA 2P0XA 3F9SA 1W6YA 1DETA 4K1UA 1BRIA 1TUHA 1GOUA 2RGQA 3G16A 4X2OA 3BNBA 4RNTA 4J5KA 3JUMA 3DM8A 3KSED 2GEXA 4XBYA 5M18A 1IT8A 1B2ZA 1RGHA 2ZA4A 2CFGA 1L5GB 4I5QA 1W6CA 1ZX2A 1E97A 2HMNB 3KIIA 2GBXB 4ORLA 3VF1A 3WA3A 3TDGA 3LOYA 3LYGA 1E3VA 2XGLA 1O7MB 3D9RA 1TFOA 2F86B 2Y73A 3DUKA 3CCQ3 5DRVA 3KKGA 3D4AA 5IG4A 2W0QA 1DYUA 1QMAA 2XF3A 3FCSB 4N6OB 1Q42A 1AQZA 1RGCA 2KXGA 3DZLA 2QEX3 5AIIA 2GBWB 1MOLA 7GSPA 3LMLA 1VQ83 5AI1A 2E2VA 4K1VA 2OQEC 4O8SA 1JN5A 1V74A 2ZHXB 2BO9B 4IPBA 3SOYA 4BL2A 1UUWB 1UI7A 4HVNA 2RCDA 4JRFA 4MJDA 2IA7A 1G96A 3V98A 4O3VA 3STDA 3BB9A 4I4KA 3ALAA 3LTDA 3ROBA 5G1LA 2XGNA 2STDA 1JB2A 1NDOB 1ROVA 3NV0A 2CFDA 5JPUA 3KCHA 3L0RA 3BLZA 3X40A 2HMJB 3AHSA 3MHEA 4BTWA 2UGIA 3HX8A 1ISKA 3DGLA 4KZ1A 3PCRA 5D83A 3OV4A 4EV5A 1OH0A 4WWUC 1PU4A 1SQWA 5CXOA 4HBRA 2CC3A 3FKAA 3RNTA 3HK4A 3B7CA 3DGMA 3GZYB 1GY6A 3MG3A 5IF6A 2XEPA 2BNGA 2CHCA 2Z7AA 1TTOA 1HU9A 2CW9A 3MPHA 4PEJA 4AEQA 2F99A 5AEWB 1OCVA 1MGWA 3UJMA 4FCZA 1OACA 1SJWA 2Q07A 1CH0A 5IG0A 3G713 2W04A 2OQEA 3Q1CA 1N5PA 1SPUA 2CWVA 4KFDA 3V92A 2JQ5A 3Q90A 5BXQA 2CFKA 1GYBA 5AYSC 4HAAA 1ASKA 2W6JH 2HMMB 2JDIH 2CH9A 4KT3B 4XBXA 1B27A 3KSPA 2CX1A 3PS8A 4OUQA 1BUJA 1J2BA 4HM3B 2HOHA 4FMCA 5M19A 1SARA
chains in the Genus database with same CATH topology
1TIJA 2GEYA 1C7HA 2HMKB 3NQYA 3X42A 3CNMA 3KZTA 2CG0A 1NJI4 1BUQA 1VQO3 1NB3I 4IT7A 3E99A 6STDA 4L8OA 4HYZA 1M1K4 1YJN3 2E2UA 4HZ9B 4OK0A 3U97A 1QVG2 1OHSA 3WMDA 3CCS3 2O9UX 2CFWA 1IVVA 1O7NB 2LQVA 5D81A 3LTAA 4J9AA 2D42A 1NU3A 3S67A 3CC23 1NWWA 5IERA 4L8PA 4HM7B 5KP3A 4Q53A 2BHMA 3EJVA 3LTBA 3X3XA 3SVAA 2ML5A 3PCSA 1FUWA 1TP6A 2SBLA 1JRQA 2ZL8A 3N54B 3S28A 2GU1A 3QK9A 2MF7A 1QJGA 3B4PA 2FNQA 4HM0B 3RGRA 3EX9A 1K734 3NQZA 4KFEA 1T5YA 3CU3A 3QRDA 2QIYA 3BNDA 4R9KA 5ELUA 4EC6A 3JUQA 1IV7A 3V99A 1YJ93 2B1XB 3NHXA 4EBGA 1Q40B 4FCMA 4EXRA 1M1XB 3DGNA 3EHCA 3I0YA 2WGQA 3ECFA 1W2B2 1YGEA 2R4IA 3T8NA 2WO0A 2HMLB 1Z1SA 3F7SA 3X3YA 1QVF2 4EV2A 3AMOB 4LSOA 4RNYA 1LOXA 1QAKA 4LEHA 4R9LA 4TX4A 1STFI 4N6LA 3CCR3 2ZDJA 2B24B 3NUVA 1WTHA 2BMOB 2W03A 2INXA 4XB5A 2K54A 3OWUA 3CXC2 1IDPA 1US1A 3EQQB 3EN8A 1W5ZA 1VQ73 2RFRA 3DGOA 1RJOA 1A67A 5IG3A 2XSHB 3O8YA 3A76A 3FSDA 1W00A 1CQSA 3DXOA 3HIGA 3X3ZA 1S723 1EG9B 2ML6A 2OOVC 3FG4A 4LGQA 3MKIA 4QWTA 3WOFB 3RGAA 3N9HA 1MNLA 1HKXA 5IEOA 2W9PA 3LT9A 3HIIA 1GY5A 2E2TA 2O3OA 3NBBA 4OVMA 1N9EA 2YX9A 1LXEA 3NXJA 1OHOA 2P09A 4HJLB 5CK6A 4AKZA 3CC73 2Z6BA 1UI8A 3GRDA 3JUOA 1YVBI 1STDA 3I563 3SLUA 3G6E3 4LZIA 4NHFA 1FGRA 1GD3A 3LTCA 3LXUX 2CFLA 3NBRA 2CWTA 3CPOA 3OX9A 4R1KA 1EA2A 1YIJ3 2CG1A 5I97A 1N8R4 2KCDA 1W6GA 3LT8A 3JUPA 1YHQ3 3UNLA 2UX0A 4O02B 4HM2B 3VSYA 1TFKA 2RSXA 1OUNA 1IVWA 2IUKA 2Z76A 3SXXA 3X41A 2PZVA 3CCE3 2C10A 4XDWA 3CCL3 3S29A 1ZO2A 2BT3A 3MWZA 3RDEA 3GZRA 3CCU3 2F98A 1FGTA 3MYTA 3CC43 3JUNA 2XSOB 2YFJB 1QALA 1W4NA 3FZWA 2IUJA 1RKYA 4N3VA 1Q814 4K61A 5EEOA 1ULJB 3VGNA 3MSOA 1VQ53 4FMDA 3PXMA 1IQ8A 3FF0A 1W01A 1DVCA 2Z77A 4AKYA 3MG1A 1DVDA 3CMA3 2L4VA 3H3HA 5G2GA 4XBTA 2XR8B 1CEWI 1WNHA 1Q7Y4 4FCJA 3S27A 5IG5A 2MC8A 3DMCA 1IQYA 2W56B 1FGQA 5A0OB 1A90A 4HKVB 8CHOA 5AIGA 2CK3H 2IMJA 4N6MA 1VQK3 1K9M4 1M904 3FG1A 4KFFA 5DREA 4HM5B 3MG2A 4J8TA 1Q864 5AEUB 5CF1A 3KN4A 1IQXA 1W02A 2WOFA 3B8LA 1N8QA 4GL6A 3F7XA 4MMXB 3UL5A 1AVKA 5BVBA 3CNXA 2HMOB 3GZXB 1Y4KA 3H51A 3KE7A 1O7PB 2GXFA 3WODG 5ELJA 3UL6A 2XFTA 1FGOA 1GD4A 2D1WA 3HZPA 4H3UA 1VZZA 3Q2PA 3J7Yd 2WOHA 3EE1A 1RRLA 5LC7A 3PZWA 2M7OA 2W2CA 2XH9A 4FMBA 5CLKA 2FGTA 3NM2A 1D6UA 4BTYA 3FF2A 2OWPA 2YFIB 1VQ43 1LNHA 1PFPA 1UW1A 2K0MA 3EBTA 3F8HA 3PGBA 3NBJA 3EF8A 1D6YA 4G1MB 1JKGB 1WQLB 3NV0B 1N9JA 4FR9A 2QGUA 1AVLA 3BNEA 3SOAA 3WDGB 3UB1A 2W56A 1FGMA 2KRTA 4NREA 1TU5A 3N8BA 1VQP3 3EN1B 2WGOA 4CDLA 4BTXA 1R4CA 3FG3A 3SX1A 1E3RA 2OTJ3 1W7CA 3OWYA 5AYRB 4HM1B 5JPPA 3PYJA 1K28A 7STDA 1N5HA 4N6V0 4R80A 3LH4A 1VQM3 5STDA 4N6TA 5FW5A 4WHAA 4STDA 1JJ22 1K41A 3M8CA 4MEIA 3CME3 4RNZA 1OHPA 1VQ63 5KP1A 4GB5A 2CKFB 1OGXA 2XRXB 1NO3A 1O7HB 3FH1A 4RZMA 3CCV3 2QA43 5TGNA 1Q824 3HI7A 3OXAA 3CCM3 1U8CB 4HM6B 5AIFA 3T0UA 1W2ZA 3WA2X 5D82A 1IU7A 4U13A 1NB5I 3CCJ3 3FLJA 1Q40A 3D3LA 1M9GA 1GY7A 4IIAA 5EQLA 3IJEB 4MMYB 4JF8A 1S5AA 3T8UA 4L7KA 5JBSA 1IT7A 1YJW3 1SIHA 1CYVA 1UUVB 2P05A 3AMOA 4RBNA 1OF5B 3NX0A 2OOVA 1JKGA 1KD14 1AR0A 2CWUA 1JV2B 2OTL3 3G0KA 4XDVA 3GWRA 5LC6A 4FMAA 3EB8A 2P38A 3JVCA 4WYKB 2GU3A 1AV4A 3GZBA 1YI23 3K63A 3B4OA 1GS3A 3K9MC 2V1LA 2OCTA 5AIHA 3EBYA 1ROAA 1VQ93 4CCVA 2LYXA 2FXTA 3NM7A 1A2VA 3G8ZA 1RN7A 1WMPA 3K7CA 1FA3A 3FGYA 3F8XA 4XM4A 3IPTA 1ULIB 4KVHA 4O2HA 1EKMA 2A15A 1WMNA 1YIT3 1IVXA 1DMQA 4ZM8A 1K8A4 5IEPA 1U5OA 1WMOA 4N6NB 4MMZB 1OPYA 3OW22 3OWSA 1DMMA 2XFSA 1A2KA 3GAXA 2YFLB 1LVNA 1KC84 3F40A 3LZAA 3SEDA 2P0MA 3DY5A 4K90B 1SIIA 3K0ZA 5CF2A 1D6ZA 2CIUA 4HZBB 4WP5A 2BMRB 3KFQC 1IV9A 1VQL3 3IMAB 1CYUA 3I553 3EC9A 3ER7A 1F8NA 3CPW2 4X2HA 1OF5A 2W9QA 4HM8B 2C11A 4WFOA 1DMNA 4EYCA 5IENA 1IVUA 1JNQA 1O7WB 1O7GB 3BNCA 1JB4A 2I9WA 4WYKA 1KSIA 5HGRA 1IK3A 1EQKA 2BMQB 1JB5A 1QAFA 4LMIA 3G4S3 4HM4B 1JN5B 1OGZA 3WOEB 5FGOA 2Y74A 5EVHA 3K5TA 3F14A 1KQS2 3U1WA 4R4KA 3S5CA 1RRHA 5IW9A 4H61A 1KWIA 2PNCA 4N6UA 5KP4A 2P0XA 3F9SA 1W6YA 4K1UA 1TUHA 2RGQA 3G16A 4X2OA 3BNBA 1VQN3 3JUMA 3DM8A 3KSED 2GEXA 4XBYA 1IT8A 1L5GB 2CFGA 1W6CA 1ZX2A 1E97A 2HMNB 3KIIA 2GBXB 4ORLA 3VF1A 3WA3A 3TDGA 3LOYA 3LYGA 1E3VA 2XGLA 1O7MB 3D9RA 1TFOA 2F86B 2Y73A 3DUKA 3CCQ3 5DRVA 3KKGA 5IG4A 2W0QA 1DYUA 1QMAA 2XF3A 3FCSB 4N6OB 1Q42A 2KXGA 3DZLA 2QEX3 5AIIA 2GBWB 1MOLA 1VQ83 3LMLA 5AI1A 2E2VA 4K1VA 2OQEC 4O8SA 1JN5A 1V74A 3SOYA 2BO9B 4IPBA 1UUWB 1UI7A 4HVNA 2RCDA 4JRFA 4MJDA 2IA7A 1G96A 3V98A 4O3VA 3STDA 3BB9A 4I4KA 3ALAA 3LTDA 3ROBA 2XGNA 2STDA 1JB2A 1NDOB 1ROVA 3NV0A 2CFDA 5JPUA 3L0RA 3BLZA 3X40A 2HMJB 3MHEA 4BTWA 3HX8A 1ISKA 3DGLA 4KZ1A 3PCRA 5D83A 3OV4A 4EV5A 1OH0A 4WWUC 1PU4A 1SQWA 5CXOA 4HBRA 2CC3A 3FKAA 3HK4A 3B7CA 3DGMA 3GZYB 1GY6A 3MG3A 5IF6A 2XEPA 2BNGA 2CHCA 2Z7AA 1HU9A 2CW9A 3MPHA 4PEJA 4AEQA 2F99A 5AEWB 1OCVA 3UJMA 4FCZA 1OACA 1SJWA 2Q07A 5IG0A 3G713 3CD63 2W04A 2OQEA 3Q1CA 1N5PA 1SPUA 2CWVA 4KFDA 3V92A 2JQ5A 3Q90A 5BXQA 2CFKA 1GYBA 5AYSC 1ASKA 2W6JH 2HMMB 2JDIH 2CH9A 4XBXA 3PS8A 3KSPA 4OUQA 1J2BA 4HM3B 4FMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GEY A;  1C7H A;  2HMK B;  3CNM A;  3KZT A;  1BUQ A;  3E99 A;  6STD A;  4L8O A;  4HZ9 B;  1OHS A;  3WMD A;  1O7N B;  5D81 A;  4J9A A;  1NU3 A;  1NWW A;  5IER A;  4L8P A;  5KP3 A;  4HM7 B;  4Q53 A;  3EJV A;  1TP6 A;  1QJG A;  3B4P A;  4HM0 B;  3RGR A;  3EX9 A;  4R9K A;  3CU3 A;  2QIY A;  3JUQ A;  2B1X B;  3NHX A;  1Q40 B;  4FCM A;  3EHC A;  3I0Y A;  3ECF A;  2R4I A;  3T8N A;  2HML B;  1Z1S A;  3F7S A;  4LEH A;  4R9L A;  2B24 B;  3NUV A;  2BMO B;  2INX A;  4XB5 A;  2K54 A;  3OWU A;  1IDP A;  3EQQ B;  3EN8 A;  2RFR A;  5IG3 A;  2XSH B;  3A76 A;  3FSD A;  1W00 A;  1CQS A;  3DXO A;  1EG9 B;  4LGQ A;  3MKI A;  3RGA A;  1HKX A;  5IEO A;  1GY5 A;  4OVM A;  3NXJ A;  1OHO A;  4HJL B;  5CK6 A;  3GRD A;  3JUO A;  1STD A;  3NBR A;  3CPO A;  3OX9 A;  4R1K A;  1EA2 A;  3JUP A;  3UNL A;  2UX0 A;  4HM2 B;  3VSY A;  1OUN A;  2Z76 A;  2PZV A;  4XDW A;  1ZO2 A;  3GZR A;  2F98 A;  3MYT A;  3JUN A;  2XSO B;  2YFJ B;  3FZW A;  4N3V A;  1ULJ B;  3VGN A;  3MSO A;  3FF0 A;  1W01 A;  2Z77 A;  3MG1 A;  3H3H A;  5G2G A;  4XBT A;  2XR8 B;  4FCJ A;  5IG5 A;  3DMC A;  4HKV B;  8CHO A;  5AIG A;  2IMJ A;  5DRE A;  4HM5 B;  3MG2 A;  4J8T A;  5AEU B;  5CF1 A;  1W02 A;  3B8L A;  3F7X A;  5BVB A;  3CNX A;  2HMO B;  3GZX B;  3H51 A;  3KE7 A;  1O7P B;  2GXF A;  3HZP A;  4H3U A;  1VZZ A;  2W2C A;  5CLK A;  3NM2 A;  3FF2 A;  2OWP A;  2YFI B;  3EBT A;  3F8H A;  3EF8 A;  1JKG B;  1WQL B;  3NV0 B;  2QGU A;  3SOA A;  3EN1 B;  4CDL A;  1E3R A;  3OWY A;  4HM1 B;  5JPP A;  7STD A;  5STD A;  5FW5 A;  4STD A;  1K41 A;  3M8C A;  1OHP A;  5KP1 A;  4GB5 A;  2CKF B;  1OGX A;  2XRX B;  1O7H B;  3FH1 A;  4RZM A;  5TGN A;  3OXA A;  4HM6 B;  5AIF A;  5D82 A;  4U13 A;  3FLJ A;  1Q40 A;  1GY7 A;  4IIA A;  1S5A A;  3T8U A;  4L7K A;  1UUV B;  1OF5 B;  1JKG A;  1AR0 A;  3G0K A;  4XDV A;  3GWR A;  4WYK B;  3GZB A;  3B4O A;  1GS3 A;  5AIH A;  3EBY A;  3G8Z A;  3K7C A;  3FGY A;  3F8X A;  4XM4 A;  3IPT A;  1ULI B;  4KVH A;  2A15 A;  1DMQ A;  5IEP A;  1U5O A;  1OPY A;  3OWS A;  1DMM A;  1A2K A;  2YFL B;  3F40 A;  3LZA A;  3SED A;  3K0Z A;  5CF2 A;  4HZB B;  4WP5 A;  2BMR B;  3EC9 A;  3ER7 A;  4X2H A;  1OF5 A;  4HM8 B;  1DMN A;  5IEN A;  1O7W B;  1O7G B;  4WYK A;  5HGR A;  1JB4 A;  2I9W A;  2BMQ B;  1JB5 A;  4LMI A;  4HM4 B;  1JN5 B;  1OGZ A;  5EVH A;  3F14 A;  3S5C A;  5KP4 A;  3F9S A;  1W6Y A;  4K1U A;  1TUH A;  2RGQ A;  3G16 A;  4X2O A;  3JUM A;  3DM8 A;  4XBY A;  2GEX A;  1ZX2 A;  1E97 A;  2HMN B;  2GBX B;  4ORL A;  3LYG A;  1E3V A;  1O7M B;  3D9R A;  2F86 B;  3DUK A;  5DRV A;  3KKG A;  5IG4 A;  1QMA A;  1Q42 A;  3DZL A;  5AII A;  2GBW B;  5AI1 A;  4K1V A;  1JN5 A;  3SOY A;  1UUW B;  4HVN A;  2RCD A;  4MJD A;  3STD A;  3BB9 A;  4I4K A;  3ROB A;  2STD A;  1JB2 A;  1NDO B;  3NV0 A;  5JPU A;  3BLZ A;  2HMJ B;  3MHE A;  3HX8 A;  1ISK A;  5D83 A;  3OV4 A;  1OH0 A;  4WWU C;  5CXO A;  3FKA A;  3HK4 A;  3B7C A;  3GZY B;  1GY6 A;  3MG3 A;  5IF6 A;  2BNG A;  2CHC A;  2Z7A A;  4PEJ A;  2F99 A;  5AEW B;  1OCV A;  3UJM A;  5IG0 A;  1SJW A;  2JQ5 A;  3Q90 A;  5BXQ A;  1GYB A;  1ASK A;  2HMM B;  4XBX A;  3KSP A;  4OUQ A;  4HM3 B; 
#chains in the Genus database with same CATH topology
 1TIJ A;  2GEY A;  1C7H A;  2HMK B;  3NQY A;  3ZFZ A;  1TJD A;  1BNJ A;  3D79 A;  3X42 A;  3CNM A;  3KZT A;  2CG0 A;  1NJI 4;  1BUQ A;  1VQO 3;  1NB3 I;  2KF6 A;  4IT7 A;  3E99 A;  6STD A;  4L8O A;  4HYZ A;  1M1K 4;  1YJN 3;  1ZS7 A;  2E2U A;  4HZ9 B;  3BIR A;  1BOX A;  2RNT A;  4OK0 A;  3U97 A;  1QVG 2;  1OHS A;  3WMD A;  3CCS 3;  2O9U X;  4NPB A;  2CFW A;  1IVV A;  1O7N B;  2LQV A;  5D81 A;  3LTA A;  4J9A A;  2D42 A;  1I2F A;  1NU3 A;  3S67 A;  1B21 A;  2F4Y A;  3CC2 3;  1T2I A;  1NWW A;  5IER A;  2BU4 A;  4L8P A;  4BU4 A;  4HM7 B;  1BSA A;  4Q53 A;  5KP3 A;  2BHM A;  1G0T A;  3EJV A;  3LTB A;  3X3X A;  3SVA A;  2ML5 A;  3PCS A;  1FUW A;  1TP6 A;  2SBL A;  1JRQ A;  1I2E A;  2ZL8 A;  3N54 B;  3S28 A;  2GU1 A;  3QK9 A;  1BRN L;  1IYY A;  2MF7 A;  1JZD A;  1QJG A;  3B4P A;  2FNQ A;  4HM0 B;  3RGR A;  3EX9 A;  1K73 4;  1FW7 A;  3ZG0 A;  3NQZ A;  4KFE A;  1T5Y A;  3CU3 A;  3QRD A;  2QIY A;  3BND A;  4R9K A;  5ELU A;  4EC6 A;  3JUQ A;  1IV7 A;  3V99 A;  1YJ9 3;  2B1X B;  3NHX A;  4EBG A;  1Q40 B;  4FCM A;  4EXR A;  1M1X B;  3DGN A;  3EHC A;  3I0Y A;  1JBS A;  2WGQ A;  3ECF A;  1W2B 2;  1YGE A;  2R4I A;  3T8N A;  2L1S A;  2WO0 A;  4CPK A;  2HML B;  5HOH A;  1G02 A;  2F56 A;  1Z1S A;  3F7S A;  1BRJ A;  3X3Y A;  1QVF 2;  4EV2 A;  1LOW A;  3AMO B;  4LSO A;  1I3F A;  4RNY A;  1LOX A;  1BIR A;  1QAK A;  1YNV X;  4LEH A;  1STF I;  4R9L A;  4N6L A;  4TX4 A;  3CCR 3;  2ZDJ A;  2B24 B;  3NUV A;  1BSE A;  1WTH A;  2BMO B;  2W03 A;  2INX A;  4XB5 A;  2K54 A;  3OWU A;  3CXC 2;  1IDP A;  1US1 A;  2CX0 A;  3EN8 A;  1W5Z A;  3EQQ B;  1VQ7 3;  2RFR A;  1EEJ A;  3DGO A;  1RJO A;  1A67 A;  5IG3 A;  2XSH B;  3O8Y A;  3A76 A;  3WR2 A;  1I8V A;  1W00 A;  1CQS A;  3FSD A;  3DXO A;  3HIG A;  3X3Z A;  9RNT A;  1RCL A;  1S72 3;  1EG9 B;  2ML6 A;  1BNI A;  1BNF A;  2OOV C;  3FG4 A;  3MKI A;  4LGQ A;  4QWT A;  3WOF B;  3RGA A;  1MWU A;  3N9H A;  1MNL A;  3GSP A;  1HKX A;  5IEO A;  2W9P A;  3LT9 A;  1I0V A;  3HII A;  1GY5 A;  2E2T A;  2O3O A;  3NBB A;  4OVM A;  2C4B A;  1N9E A;  2YX9 A;  1LXE A;  3NXJ A;  3HOH A;  1OHO A;  3BU4 A;  2P09 A;  4HJL B;  5CK6 A;  4AKZ A;  3CC7 3;  2Z6B A;  1UI8 A;  3GRD A;  1I70 A;  3WHO A;  4EW5 A;  3JUO A;  1YVB I;  1STD A;  3I56 3;  3SLU A;  1DE3 A;  3G6E 3;  4LZI A;  4NHF A;  1FGR A;  1GD3 A;  3LTC A;  3LXU X;  2CFL A;  3NBR A;  2CWT A;  3CPO A;  3OX9 A;  4R1K A;  1EA2 A;  2BIR A;  1YIJ 3;  2CG1 A;  1A2P A;  1MWS A;  5I97 A;  1N8R 4;  1RCK A;  2KCD A;  1W6G A;  3LT8 A;  3JUP A;  7RNT A;  1GMP A;  1GMQ A;  1YHQ 3;  3UNL A;  1T2H A;  2UX0 A;  4O02 B;  4HM2 B;  3VSY A;  1TFK A;  2RSX A;  2IYJ A;  1OUN A;  1IVW A;  2IUK A;  2Z76 A;  3SXX A;  4ILF A;  3X41 A;  2PZV A;  3CCE 3;  2C10 A;  4XDW A;  3CCL 3;  3S29 A;  1TRP A;  1ZO2 A;  2H0I A;  1MWT A;  2BT3 A;  3MWZ A;  3RDE A;  3GZR A;  3ZG5 A;  3CCU 3;  2F98 A;  1B2S A;  1BNE A;  1FGT A;  3MYT A;  1JBR A;  1RHL A;  2AAE A;  3CC4 3;  3JUN A;  2XSO B;  2YFJ B;  1QAL A;  1W4N A;  1X1W A;  3FZW A;  2IUJ A;  1RKY A;  4N3V A;  1Q81 4;  4K61 A;  5EEO A;  1ULJ B;  3VGN A;  3MSO A;  1VQ5 3;  4FMD A;  3PXM A;  1IQ8 A;  3FF0 A;  1W01 A;  1DVC A;  2Z77 A;  5GSP A;  2RBI A;  4AKY A;  3MG1 A;  1DVD A;  3CMA 3;  2L4V A;  1TRQ A;  1RNB A;  2GSP A;  2R41 A;  3AGO A;  3H3H A;  5G2G A;  1RGF A;  4XBT A;  2XR8 B;  1CEW I;  1C54 A;  1WNH A;  1Q7Y 4;  2J8X B;  4FCJ A;  5BU4 A;  3S27 A;  5IG5 A;  2MC8 A;  3DMC A;  4HOH A;  1IQY A;  2W56 B;  1FGQ A;  5A0O B;  1A90 A;  4HKV B;  8CHO A;  5AIG A;  1LQG C;  2CK3 H;  2IMJ A;  4N6M A;  1I2G A;  1VQK 3;  1K9M 4;  1BGS A;  3FG1 A;  4KFF A;  5DRE A;  1M90 4;  4HM5 B;  3MG2 A;  4J8T A;  1Q86 4;  1YVS A;  5AEU B;  1VQQ A;  5CF1 A;  2F5W A;  3KN4 A;  1IQX A;  1W02 A;  2WOF A;  3B8L A;  1N8Q A;  4GL6 A;  3F7X A;  4MMX B;  1BRH A;  3UL5 A;  1AVK A;  1MWR A;  1Q7H A;  1UCL A;  5BVB A;  2K3D A;  2HMO B;  3CNX A;  3GZX B;  1Y4K A;  3H51 A;  3KE7 A;  1O7P B;  2GXF A;  3WOD G;  5ELJ A;  3UL6 A;  2XFT A;  1FGO A;  1GD4 A;  2D1W A;  4BIR A;  3HZP A;  4H3U A;  3CD6 3;  1VZZ A;  3Q2P A;  3J7Y d;  2WOH A;  3EE1 A;  1RRL A;  5LC7 A;  1BAO A;  1BSB A;  3PZW A;  2M7O A;  2W2C A;  2XH9 A;  4FMB A;  5CLK A;  1BRK A;  2FGT A;  4GHO A;  3NM2 A;  1D6U A;  4BTY A;  1LOY A;  3FF2 A;  2OWP A;  2YFI B;  6RNT A;  1VQ4 3;  3CCM 3;  1BVI A;  1HYF A;  1LNH A;  1MGR A;  1PFP A;  1LRA A;  1UW1 A;  2K0M A;  3EBT A;  3F8H A;  3PGB A;  3NBJ A;  3EF8 A;  1D6Y A;  2KF4 A;  4G1M B;  1B2M A;  1JKG B;  1RGK A;  1WQL B;  3NV0 B;  1N9J A;  4FR9 A;  2QGU A;  1AVL A;  3BNE A;  3SOA A;  3WDG B;  3UB1 A;  2W56 A;  1FGM A;  2KRT A;  2AAD A;  4NRE A;  5M1A A;  3N8B A;  1TU5 A;  5BIR A;  1VQP 3;  3EN1 B;  2WGO A;  4CDL A;  4BTX A;  1R4C A;  3FG3 A;  3SX1 A;  1E3R A;  1UCK A;  1Q9E A;  1BAN A;  1W7C A;  3OWY A;  5AYR B;  2OTJ 3;  4HM1 B;  4DKI A;  5JPP A;  3PYJ A;  1K28 A;  7STD A;  1N5H A;  4N6V 0;  4R80 A;  1RGE A;  3LH4 A;  1VQM 3;  5STD A;  4N6T A;  3DGY A;  5FW5 A;  4WHA A;  4STD A;  1JJ2 2;  1K41 A;  3M8C A;  4MEI A;  1UCJ A;  3CME 3;  4RNZ A;  1OHP A;  1VQ6 3;  5KP1 A;  4GB5 A;  2CKF B;  1OGX A;  2XRX B;  1NO3 A;  3D5G A;  1O7H B;  3FH1 A;  4RZM A;  3CCV 3;  2QA4 3;  5TGN A;  1Q82 4;  1I3I A;  1X1Y A;  1FYS A;  1B3S A;  1X1X A;  1BRS A;  3DH2 A;  3HI7 A;  1U8C B;  3OXA A;  3Q3F A;  4HM6 B;  1BSD A;  4J5G A;  1PYL A;  5AIF A;  3T0U A;  1W2Z A;  3WA2 X;  8RNT A;  2IY2 A;  5D82 A;  1IU7 A;  1RSN A;  4U13 A;  1NB5 I;  3CCJ 3;  1RMS A;  3FLJ A;  6GSP A;  1Q40 A;  3D3L A;  1GMR A;  1LQM B;  1GY7 A;  1M9G A;  4IIA A;  5EQL A;  3IJE B;  4MMY B;  4JF8 A;  1S5A A;  1RGA A;  1RNT A;  3T8U A;  4L7K A;  5JBS A;  1IT7 A;  1YJW 3;  1SIH A;  1CYV A;  1EUI C;  1RDS A;  1UUV B;  2P05 A;  3AMO A;  4RBN A;  1OF5 B;  3NX0 A;  2OOV A;  1X1U A;  1JKG A;  1KD1 4;  1AR0 A;  1BNG A;  2CWU A;  1JV2 B;  1GSP A;  2UUG C;  2OTL 3;  3G0K A;  4XDV A;  3GWR A;  5LC6 A;  1FUT A;  3EB8 A;  4FMA A;  1AY7 A;  2P38 A;  3JVC A;  4WYK B;  2GU3 A;  2SAR A;  1YGW A;  1AV4 A;  3GZB A;  1B20 A;  3K63 A;  3B4O A;  1GS3 A;  3K9M C;  1YI2 3;  2V1L A;  2OCT A;  5AIH A;  3EBY A;  1ROA A;  1VQ9 3;  4CCV A;  1B2X A;  2LYX A;  2FXT A;  3URP A;  1RN4 A;  1UGI A;  3NM7 A;  1A2V A;  1HZ1 A;  3G8Z A;  1RN7 A;  1WMP A;  3K7C A;  1FA3 A;  3FGY A;  3F8X A;  4XM4 A;  3IPT A;  1ULI B;  4KVH A;  4O2H A;  1EKM A;  2A15 A;  1WMN A;  1YIT 3;  1ZGX A;  1BSC A;  1IVX A;  1LNI A;  2KF5 A;  1DMQ A;  4ZM8 A;  1K8A 4;  3SYU A;  5IEP A;  1U5O A;  1WMO A;  4N6N B;  4MMZ B;  1OPY A;  2KAA A;  3OW2 2;  3OWS A;  1DMM A;  3AGN A;  2XFS A;  1A2K A;  3GAX A;  2YFL B;  1LVN A;  1KC8 4;  1LOV A;  1V57 A;  3F40 A;  3LZA A;  2H0H A;  3SED A;  2P0M A;  3DY5 A;  4K90 B;  1FZU A;  1SII A;  3K0Z A;  1NNV A;  1VQN 3;  5CF2 A;  1D6Z A;  1FUS A;  2CIU A;  4HZB B;  1UUG B;  1V58 A;  1BNR A;  4WP5 A;  2BMR B;  3D5I A;  3KFQ C;  4LYL B;  3AHW A;  1IV9 A;  1VQL 3;  3IMA B;  1CYU A;  3I55 3;  2F5M A;  3EC9 A;  1F8N A;  3ER7 A;  1I0X A;  5RNT A;  4X2H A;  3CPW 2;  4BL3 A;  1OF5 A;  1RGG A;  1JZO A;  2W9Q A;  4HM8 B;  2C11 A;  1JBT A;  4WFO A;  1DMN A;  1RN1 A;  2H0G A;  4EYC A;  5IEN A;  1IVU A;  1UDI I;  1GOY A;  1B2U A;  1JNQ A;  1O7W B;  1O7G B;  3BNC A;  1JB4 A;  2I9W A;  4WYK A;  1KSI A;  1PY3 A;  5HGR A;  1IK3 A;  1RTU A;  2BMQ B;  1EQK A;  1JB5 A;  1QAF A;  4LMI A;  3G4S 3;  4HM4 B;  1GOV A;  1UGH I;  1BU4 A;  1JN5 B;  1OGZ A;  3WOE B;  5FGO A;  2Y74 A;  5G1K A;  1T3B A;  5EVH A;  3K5T A;  3F14 A;  4GSP A;  1KQS 2;  3U1W A;  1RLS A;  4CJN A;  4R4K A;  1BRG A;  3S5C A;  1RGL A;  1R4Y A;  1RRH A;  5IW9 A;  4H61 A;  1UCI A;  2KF3 A;  1KWI A;  2PNC A;  4N6U A;  1BNS A;  5KP4 A;  3A5E A;  2P0X A;  3F9S A;  1W6Y A;  1DET A;  4K1U A;  1BRI A;  1TUH A;  1GOU A;  2RGQ A;  3G16 A;  4X2O A;  3BNB A;  4RNT A;  4J5K A;  3JUM A;  3DM8 A;  3KSE D;  2GEX A;  4XBY A;  5M18 A;  1IT8 A;  1B2Z A;  1RGH A;  2ZA4 A;  2CFG A;  1L5G B;  4I5Q A;  1W6C A;  1ZX2 A;  1E97 A;  2HMN B;  3KII A;  2GBX B;  4ORL A;  3VF1 A;  3WA3 A;  3TDG A;  3LOY A;  3LYG A;  1E3V A;  2XGL A;  1O7M B;  3D9R A;  1TFO A;  2F86 B;  2Y73 A;  3DUK A;  3CCQ 3;  5DRV A;  3KKG A;  3D4A A;  5IG4 A;  2W0Q A;  1DYU A;  1QMA A;  2XF3 A;  3FCS B;  4N6O B;  1Q42 A;  1AQZ A;  1RGC A;  2KXG A;  3DZL A;  2QEX 3;  5AII A;  2GBW B;  1MOL A;  7GSP A;  3LML A;  1VQ8 3;  5AI1 A;  2E2V A;  4K1V A;  2OQE C;  4O8S A;  1JN5 A;  1V74 A;  2ZHX B;  2BO9 B;  4IPB A;  3SOY A;  4BL2 A;  1UUW B;  1UI7 A;  4HVN A;  2RCD A;  4JRF A;  4MJD A;  2IA7 A;  1G96 A;  3V98 A;  4O3V A;  3STD A;  3BB9 A;  4I4K A;  3ALA A;  3LTD A;  3ROB A;  5G1L A;  2XGN A;  2STD A;  1JB2 A;  1NDO B;  1ROV A;  3NV0 A;  2CFD A;  5JPU A;  3KCH A;  3L0R A;  3BLZ A;  3X40 A;  2HMJ B;  3AHS A;  3MHE A;  4BTW A;  2UGI A;  3HX8 A;  1ISK A;  3DGL A;  4KZ1 A;  3PCR A;  5D83 A;  3OV4 A;  4EV5 A;  1OH0 A;  4WWU C;  1PU4 A;  1SQW A;  5CXO A;  4HBR A;  2CC3 A;  3FKA A;  3RNT A;  3HK4 A;  3B7C A;  3DGM A;  3GZY B;  1GY6 A;  3MG3 A;  5IF6 A;  2XEP A;  2BNG A;  2CHC A;  2Z7A A;  1TTO A;  1HU9 A;  2CW9 A;  3MPH A;  4PEJ A;  4AEQ A;  2F99 A;  5AEW B;  1OCV A;  1MGW A;  3UJM A;  4FCZ A;  1OAC A;  1SJW A;  2Q07 A;  1CH0 A;  5IG0 A;  3G71 3;  2W04 A;  2OQE A;  3Q1C A;  1N5P A;  1SPU A;  2CWV A;  4KFD A;  3V92 A;  2JQ5 A;  3Q90 A;  5BXQ A;  2CFK A;  1GYB A;  5AYS C;  4HAA A;  1ASK A;  2W6J H;  2HMM B;  2JDI H;  2CH9 A;  4KT3 B;  4XBX A;  1B27 A;  3KSP A;  2CX1 A;  3PS8 A;  4OUQ A;  1BUJ A;  1J2B A;  4HM3 B;  2HOH A;  4FMC A;  5M19 A;  1SAR A; 
#chains in the Genus database with same CATH homology
 1TIJ A;  2GEY A;  1C7H A;  2HMK B;  3NQY A;  3X42 A;  3CNM A;  3KZT A;  2CG0 A;  1NJI 4;  1BUQ A;  1VQO 3;  1NB3 I;  4IT7 A;  3E99 A;  6STD A;  4L8O A;  4HYZ A;  1M1K 4;  1YJN 3;  2E2U A;  4HZ9 B;  4OK0 A;  3U97 A;  1QVG 2;  1OHS A;  3WMD A;  3CCS 3;  2O9U X;  2CFW A;  1IVV A;  1O7N B;  2LQV A;  5D81 A;  3LTA A;  4J9A A;  2D42 A;  1NU3 A;  3S67 A;  3CC2 3;  1NWW A;  5IER A;  4L8P A;  4HM7 B;  5KP3 A;  4Q53 A;  2BHM A;  3EJV A;  3LTB A;  3X3X A;  3SVA A;  2ML5 A;  3PCS A;  1FUW A;  1TP6 A;  2SBL A;  1JRQ A;  2ZL8 A;  3N54 B;  3S28 A;  2GU1 A;  3QK9 A;  2MF7 A;  1QJG A;  3B4P A;  2FNQ A;  4HM0 B;  3RGR A;  3EX9 A;  1K73 4;  3NQZ A;  4KFE A;  1T5Y A;  3CU3 A;  3QRD A;  2QIY A;  3BND A;  4R9K A;  5ELU A;  4EC6 A;  3JUQ A;  1IV7 A;  3V99 A;  1YJ9 3;  2B1X B;  3NHX A;  4EBG A;  1Q40 B;  4FCM A;  4EXR A;  1M1X B;  3DGN A;  3EHC A;  3I0Y A;  2WGQ A;  3ECF A;  1W2B 2;  1YGE A;  2R4I A;  3T8N A;  2WO0 A;  2HML B;  1Z1S A;  3F7S A;  3X3Y A;  1QVF 2;  4EV2 A;  3AMO B;  4LSO A;  4RNY A;  1LOX A;  1QAK A;  4LEH A;  4R9L A;  4TX4 A;  1STF I;  4N6L A;  3CCR 3;  2ZDJ A;  2B24 B;  3NUV A;  1WTH A;  2BMO B;  2W03 A;  2INX A;  4XB5 A;  2K54 A;  3OWU A;  3CXC 2;  1IDP A;  1US1 A;  3EQQ B;  3EN8 A;  1W5Z A;  1VQ7 3;  2RFR A;  3DGO A;  1RJO A;  1A67 A;  5IG3 A;  2XSH B;  3O8Y A;  3A76 A;  3FSD A;  1W00 A;  1CQS A;  3DXO A;  3HIG A;  3X3Z A;  1S72 3;  1EG9 B;  2ML6 A;  2OOV C;  3FG4 A;  4LGQ A;  3MKI A;  4QWT A;  3WOF B;  3RGA A;  3N9H A;  1MNL A;  1HKX A;  5IEO A;  2W9P A;  3LT9 A;  3HII A;  1GY5 A;  2E2T A;  2O3O A;  3NBB A;  4OVM A;  1N9E A;  2YX9 A;  1LXE A;  3NXJ A;  1OHO A;  2P09 A;  4HJL B;  5CK6 A;  4AKZ A;  3CC7 3;  2Z6B A;  1UI8 A;  3GRD A;  3JUO A;  1YVB I;  1STD A;  3I56 3;  3SLU A;  3G6E 3;  4LZI A;  4NHF A;  1FGR A;  1GD3 A;  3LTC A;  3LXU X;  2CFL A;  3NBR A;  2CWT A;  3CPO A;  3OX9 A;  4R1K A;  1EA2 A;  1YIJ 3;  2CG1 A;  5I97 A;  1N8R 4;  2KCD A;  1W6G A;  3LT8 A;  3JUP A;  1YHQ 3;  3UNL A;  2UX0 A;  4O02 B;  4HM2 B;  3VSY A;  1TFK A;  2RSX A;  1OUN A;  1IVW A;  2IUK A;  2Z76 A;  3SXX A;  3X41 A;  2PZV A;  3CCE 3;  2C10 A;  4XDW A;  3CCL 3;  3S29 A;  1ZO2 A;  2BT3 A;  3MWZ A;  3RDE A;  3GZR A;  3CCU 3;  2F98 A;  1FGT A;  3MYT A;  3CC4 3;  3JUN A;  2XSO B;  2YFJ B;  1QAL A;  1W4N A;  3FZW A;  2IUJ A;  1RKY A;  4N3V A;  1Q81 4;  4K61 A;  5EEO A;  1ULJ B;  3VGN A;  3MSO A;  1VQ5 3;  4FMD A;  3PXM A;  1IQ8 A;  3FF0 A;  1W01 A;  1DVC A;  2Z77 A;  4AKY A;  3MG1 A;  1DVD A;  3CMA 3;  2L4V A;  3H3H A;  5G2G A;  4XBT A;  2XR8 B;  1CEW I;  1WNH A;  1Q7Y 4;  4FCJ A;  3S27 A;  5IG5 A;  2MC8 A;  3DMC A;  1IQY A;  2W56 B;  1FGQ A;  5A0O B;  1A90 A;  4HKV B;  8CHO A;  5AIG A;  2CK3 H;  2IMJ A;  4N6M A;  1VQK 3;  1K9M 4;  1M90 4;  3FG1 A;  4KFF A;  5DRE A;  4HM5 B;  3MG2 A;  4J8T A;  1Q86 4;  5AEU B;  5CF1 A;  3KN4 A;  1IQX A;  1W02 A;  2WOF A;  3B8L A;  1N8Q A;  4GL6 A;  3F7X A;  4MMX B;  3UL5 A;  1AVK A;  5BVB A;  3CNX A;  2HMO B;  3GZX B;  1Y4K A;  3H51 A;  3KE7 A;  1O7P B;  2GXF A;  3WOD G;  5ELJ A;  3UL6 A;  2XFT A;  1FGO A;  1GD4 A;  2D1W A;  3HZP A;  4H3U A;  1VZZ A;  3Q2P A;  3J7Y d;  2WOH A;  3EE1 A;  1RRL A;  5LC7 A;  3PZW A;  2M7O A;  2W2C A;  2XH9 A;  4FMB A;  5CLK A;  2FGT A;  3NM2 A;  1D6U A;  4BTY A;  3FF2 A;  2OWP A;  2YFI B;  1VQ4 3;  1LNH A;  1PFP A;  1UW1 A;  2K0M A;  3EBT A;  3F8H A;  3PGB A;  3NBJ A;  3EF8 A;  1D6Y A;  4G1M B;  1JKG B;  1WQL B;  3NV0 B;  1N9J A;  4FR9 A;  2QGU A;  1AVL A;  3BNE A;  3SOA A;  3WDG B;  3UB1 A;  2W56 A;  1FGM A;  2KRT A;  4NRE A;  1TU5 A;  3N8B A;  1VQP 3;  3EN1 B;  2WGO A;  4CDL A;  4BTX A;  1R4C A;  3FG3 A;  3SX1 A;  1E3R A;  2OTJ 3;  1W7C A;  3OWY A;  5AYR B;  4HM1 B;  5JPP A;  3PYJ A;  1K28 A;  7STD A;  1N5H A;  4N6V 0;  4R80 A;  3LH4 A;  1VQM 3;  5STD A;  4N6T A;  5FW5 A;  4WHA A;  4STD A;  1JJ2 2;  1K41 A;  3M8C A;  4MEI A;  3CME 3;  4RNZ A;  1OHP A;  1VQ6 3;  5KP1 A;  4GB5 A;  2CKF B;  1OGX A;  2XRX B;  1NO3 A;  1O7H B;  3FH1 A;  4RZM A;  3CCV 3;  2QA4 3;  5TGN A;  1Q82 4;  3HI7 A;  3OXA A;  3CCM 3;  1U8C B;  4HM6 B;  5AIF A;  3T0U A;  1W2Z A;  3WA2 X;  5D82 A;  1IU7 A;  4U13 A;  1NB5 I;  3CCJ 3;  3FLJ A;  1Q40 A;  3D3L A;  1M9G A;  1GY7 A;  4IIA A;  5EQL A;  3IJE B;  4MMY B;  4JF8 A;  1S5A A;  3T8U A;  4L7K A;  5JBS A;  1IT7 A;  1YJW 3;  1SIH A;  1CYV A;  1UUV B;  2P05 A;  3AMO A;  4RBN A;  1OF5 B;  3NX0 A;  2OOV A;  1JKG A;  1KD1 4;  1AR0 A;  2CWU A;  1JV2 B;  2OTL 3;  3G0K A;  4XDV A;  3GWR A;  5LC6 A;  4FMA A;  3EB8 A;  2P38 A;  3JVC A;  4WYK B;  2GU3 A;  1AV4 A;  3GZB A;  1YI2 3;  3K63 A;  3B4O A;  1GS3 A;  3K9M C;  2V1L A;  2OCT A;  5AIH A;  3EBY A;  1ROA A;  1VQ9 3;  4CCV A;  2LYX A;  2FXT A;  3NM7 A;  1A2V A;  3G8Z A;  1RN7 A;  1WMP A;  3K7C A;  1FA3 A;  3FGY A;  3F8X A;  4XM4 A;  3IPT A;  1ULI B;  4KVH A;  4O2H A;  1EKM A;  2A15 A;  1WMN A;  1YIT 3;  1IVX A;  1DMQ A;  4ZM8 A;  1K8A 4;  5IEP A;  1U5O A;  1WMO A;  4N6N B;  4MMZ B;  1OPY A;  3OW2 2;  3OWS A;  1DMM A;  2XFS A;  1A2K A;  3GAX A;  2YFL B;  1LVN A;  1KC8 4;  3F40 A;  3LZA A;  3SED A;  2P0M A;  3DY5 A;  4K90 B;  1SII A;  3K0Z A;  5CF2 A;  1D6Z A;  2CIU A;  4HZB B;  4WP5 A;  2BMR B;  3KFQ C;  1IV9 A;  1VQL 3;  3IMA B;  1CYU A;  3I55 3;  3EC9 A;  3ER7 A;  1F8N A;  3CPW 2;  4X2H A;  1OF5 A;  2W9Q A;  4HM8 B;  2C11 A;  4WFO A;  1DMN A;  4EYC A;  5IEN A;  1IVU A;  1JNQ A;  1O7W B;  1O7G B;  3BNC A;  1JB4 A;  2I9W A;  4WYK A;  1KSI A;  5HGR A;  1IK3 A;  1EQK A;  2BMQ B;  1JB5 A;  1QAF A;  4LMI A;  3G4S 3;  4HM4 B;  1JN5 B;  1OGZ A;  3WOE B;  5FGO A;  2Y74 A;  5EVH A;  3K5T A;  3F14 A;  1KQS 2;  3U1W A;  4R4K A;  3S5C A;  1RRH A;  5IW9 A;  4H61 A;  1KWI A;  2PNC A;  4N6U A;  5KP4 A;  2P0X A;  3F9S A;  1W6Y A;  4K1U A;  1TUH A;  2RGQ A;  3G16 A;  4X2O A;  3BNB A;  1VQN 3;  3JUM A;  3DM8 A;  3KSE D;  2GEX A;  4XBY A;  1IT8 A;  1L5G B;  2CFG A;  1W6C A;  1ZX2 A;  1E97 A;  2HMN B;  3KII A;  2GBX B;  4ORL A;  3VF1 A;  3WA3 A;  3TDG A;  3LOY A;  3LYG A;  1E3V A;  2XGL A;  1O7M B;  3D9R A;  1TFO A;  2F86 B;  2Y73 A;  3DUK A;  3CCQ 3;  5DRV A;  3KKG A;  5IG4 A;  2W0Q A;  1DYU A;  1QMA A;  2XF3 A;  3FCS B;  4N6O B;  1Q42 A;  2KXG A;  3DZL A;  2QEX 3;  5AII A;  2GBW B;  1MOL A;  1VQ8 3;  3LML A;  5AI1 A;  2E2V A;  4K1V A;  2OQE C;  4O8S A;  1JN5 A;  1V74 A;  3SOY A;  2BO9 B;  4IPB A;  1UUW B;  1UI7 A;  4HVN A;  2RCD A;  4JRF A;  4MJD A;  2IA7 A;  1G96 A;  3V98 A;  4O3V A;  3STD A;  3BB9 A;  4I4K A;  3ALA A;  3LTD A;  3ROB A;  2XGN A;  2STD A;  1JB2 A;  1NDO B;  1ROV A;  3NV0 A;  2CFD A;  5JPU A;  3L0R A;  3BLZ A;  3X40 A;  2HMJ B;  3MHE A;  4BTW A;  3HX8 A;  1ISK A;  3DGL A;  4KZ1 A;  3PCR A;  5D83 A;  3OV4 A;  4EV5 A;  1OH0 A;  4WWU C;  1PU4 A;  1SQW A;  5CXO A;  4HBR A;  2CC3 A;  3FKA A;  3HK4 A;  3B7C A;  3DGM A;  3GZY B;  1GY6 A;  3MG3 A;  5IF6 A;  2XEP A;  2BNG A;  2CHC A;  2Z7A A;  1HU9 A;  2CW9 A;  3MPH A;  4PEJ A;  4AEQ A;  2F99 A;  5AEW B;  1OCV A;  3UJM A;  4FCZ A;  1OAC A;  1SJW A;  2Q07 A;  5IG0 A;  3G71 3;  3CD6 3;  2W04 A;  2OQE A;  3Q1C A;  1N5P A;  1SPU A;  2CWV A;  4KFD A;  3V92 A;  2JQ5 A;  3Q90 A;  5BXQ A;  2CFK A;  1GYB A;  5AYS C;  1ASK A;  2W6J H;  2HMM B;  2JDI H;  2CH9 A;  4XBX A;  3PS8 A;  3KSP A;  4OUQ A;  1J2B A;  4HM3 B;  4FMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...