1BUQA

Solution structure of delta-5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone-hemisuccinate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFFANSLKLPLAVELTQEVRAVANEAAFAFTVSFEFQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (3-KETOSTEROID ISOMERASE-19-NORTESTOSTERONE-HEMISUCC
publication title Solution structure of Delta 5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone hemisuccinate.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 21
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1buqA00
4XBXA 5D81A 4PEJA 1W00A 3T8NA 5CF1A 3G8ZA 3HZPA 3G16A 1ASKA 4R9LA 1OHPA 5AEWB 1ZO2A 4J9AA 3H51A 4XBTA 1NU3A 4X2HA 5BXQA 1JN5B 2YFJB 5FW5A 2CKFB 3SOYA 5IG5A 4L7KA 8CHOA 3FLJA 1ISKA 1VZZA 3DXOA 5AEUB 1O7MB 5TGNA 4WP5A 3CNXA 4HZ9B 5KP3A 7STDA 2HMNB 3F7SA 2INXA 1Q40B 2B24B 5JPPA 1NWWA 4IIAA 3EHCA 4KVHA 3DUKA 1U5OA 4N3VA 3FF0A 3OWUA 1O7NB 1TUHA 4STDA 3DM8A 1E3RA 1DMNA 4R9KA 3CNMA 2GEYA 1S5AA 3OXAA 1BUQA 2BMOB 4Q53A 1JB2A 5STDA 1JKGB 5BVBA 4L8OA 2YFIB 4J8TA 2F86B 1IDPA 3ER7A 1GY5A 4XBYA 1ULJB 1UUWB 3SEDA 3LYGA 2W2CA 3MG3A 2BMRB 1K41A 1CQSA 2HMKB 4HVNA 4L8PA 3VGNA 4HM2B 5KP1A 1O7PB 1DMMA 1HKXA 3F7XA 2B1XB 4U13A 2HMOB 5CF2A 1EG9B 2XSOB 5DREA 3E99A 2BNGA 3JUOA 4HM6B 3FZWA 2GBXB 4CDLA 1Z1SA 1Q40A 2QGUA 3EBTA 2QIYA 3FF2A 1QMAA 1E97A 3F8XA 3B4PA 3FSDA 4WYKB 3MSOA 5DRVA 1W02A 2Z77A 5IERA 3EBYA 3D9RA 3G0KA 3WMDA 3NV0B 5AIIA 5AIHA 1OPYA 3FGYA 3KE7A 1STDA 3BB9A 2PZVA 3H3HA 3OV4A 1C7HA 3K7CA 2XSHB 4H3UA 4LEHA 6STDA 3F14A 3EJVA 1ZX2A 4HM1B 3RGAA 3S5CA 5AIFA 5AIGA 3KKGA 4LGQA 2F99A 3GZBA 5IG0A 3IPTA 3MHEA 1GY6A 1A2KA 3STDA 1GY7A 2HMJB 1OHOA 4K1UA 2RGQA 3I0YA 4XB5A 1O7GB 1TP6A 4HM4B 1E3VA 5JPUA 3OWSA 1AR0A 2IMJA 3EC9A 1SJWA 4K1VA 1OUNA 1JN5A 3NV0A 2GXFA 4LMIA 2STDA 3Q90A 3GZYB 5HGRA 1OF5B 1O7WB 3MG1A 5D83A 3UJMA 3EN1B 2GEXA 3JUNA 4GB5A 5G2GA 2Z76A 1NDOB 3EQQB 2BMQB 4HM0B 5CK6A 3M8CA 1QJGA 3EX9A 1ULIB 3DMCA 2F98A 3DZLA 4RZMA 1OGZA 3NXJA 3KZTA 1Q42A 1OGXA 3F9SA 3GRDA 4MJDA 5IEOA 3HX8A 3CPOA 4XDVA 3T8UA 1UUVB 1JB5A 4I4KA 1GYBA 3MYTA 2GBWB 1JKGA 3F8HA 1O7HB 4R1KA 3B7CA 4HM7B 3BLZA 2HMMB 3RGRA 5IEPA 3B8LA 4HZBB 3GWRA 5CLKA 3OX9A 5IENA 3NUVA 1OHSA 4HM8B 5AI1A 1OF5A 5D82A 2RCDA 1WQLB 4X2OA 4XM4A 3JUPA 5KP4A 3A76A 2I9WA 3KSPA 3HK4A 1W01A 3SOAA 2UX0A 3VSYA 1DMQA 4OVMA 2OWPA 5IG4A 5CXOA 4FCJA 2R4IA 4FCMA 3LZAA 2JQ5A 2Z7AA 4WYKA 1OCVA 4WWUC 3OWYA 3FKAA 5IG3A 1EA2A 2K54A 3NHXA 4HKVB 4XDWA 2XR8B 3B4OA 3CU3A 2CHCA 4OUQA 3GZXB 4HM3B 3EF8A 1OH0A 3MG2A 3JUMA 1GS3A 2HMLB 2XRXB 3GZRA 2A15A 2RFRA 3ECFA 3ROBA 3K0ZA 3NM2A 4HJLB 3NBRA 4HM5B 1W6YA 5EVHA 3UNLA 2YFLB 1JB4A 3JUQA 3F40A 3EN8A 5IF6A 3MKIA 3FH1A 4ORLA
chains in the Genus database with same CATH superfamily
2J8XB 4XBXA 2WOFA 4G1MB 1JRQA 5A0OB 2LYXA 4PEJA 5D81A 1K8A4 1B21A 2FXTA 1F8NA 1W00A 2KF4A 4H61A 1BSDA 1IT8A 3GAXA 3T8NA 3WODG 5CF1A 3CCQ3 3BNCA 3G8ZA 3NQZA 4N6TA 5LC7A 3HZPA 3G16A 3PCRA 1YVBI 1B2ZA 2XF3A 1IK3A 1FUTA 1ASKA 4N6UA 4R9LA 1RGEA 1OHPA 1RRLA 1JBTA 1I2GA 5AEWB 1MWTA 1KC84 1ZO2A 2L1SA 2P05A 1VQQA 1UUGB 1FZUA 1EKMA 1UGIA 4J9AA 3CME3 2F4YA 2C4BA 3Q2PA 3CC73 1FA3A 3H51A 2H0IA 2L4VA 4XBTA 1NU3A 1BANA 4X2HA 1JN5B 5BXQA 1K28A 1X1WA 2YFJB 4J5GA 1BNFA 3D79A 5FW5A 4QWTA 2CH9A 1K734 3UL5A 3PGBA 3S67A 1Y4KA 1QAKA 2RBIA 2CKFB 2E2VA 3SOYA 4ILFA 5IG5A 1BNGA 4L7KA 4HOHA 4N6LA 1FGRA 3FLJA 8CHOA 1ISKA 1VZZA 2KXGA 1B20A 5BU4A 3DXOA 5AEUB 3J7Yd 1AV4A 1O7MB 1MGRA 3FG1A 4WP5A 5ELUA 5TGNA 3CNXA 4HZ9B 3Q3FA 1RKYA 1DVCA 5IW9A 5KP3A 5M19A 1JV2B 7STDA 3OW22 3G713 2HMNB 3BNEA 4EV2A 1B2MA 1YIJ3 1M904 3F7SA 3HOHA 4EW5A 1LRAA 1T3BA 2INXA 2W9PA 1Q40B 2W56B 2BIRA 2IUJA 2B24B 5JPPA 1NWWA 1TRPA 1T2IA 3X3XA 4IIAA 3FG3A 3PCSA 1I3FA 3BIRA 3EHCA 4EV5A 1N8QA 2E2TA 3LTCA 5BIRA 1RTUA 6RNTA 1RCLA 4KVHA 1YGEA 1N5PA 4BL2A 3DUKA 1U5OA 4N3VA 3NBBA 2CFLA 2XGLA 3FF0A 3OWUA 1O7NB 2CFGA 1I3IA 1TUHA 4STDA 3DM8A 1E3RA 1VQ83 1DMNA 1BRGA 1YI23 3NBJA 4R9KA 2XFTA 3CNMA 2GEYA 4TX4A 1YJ93 1S5AA 4LZIA 1IV7A 1EEJA 3AHWA 1L5GB 1BIRA 2CWVA 2JDIH 1RNBA 1B2SA 2P0MA 3OXAA 3WA2X 1Q864 2BHMA 1BSAA 1YNVX 1BUQA 1KQS2 1UGHI 2BMOB 2CG1A 2RSXA 3ZFZA 2SBLA 4Q53A 1J2BA 1JB2A 5STDA 1WMOA 1JKGB 2OQEA 3D4AA 3L0RA 1R4CA 2M7OA 5BVBA 4L8OA 4N6MA 2YFIB 4BTWA 4J8TA 1A67A 2F86B 4CCVA 1IDPA 3ER7A 1GY5A 1VQM3 4XBYA 3CC23 1ULJB 1X1XA 3EB8A 1UUWB 2W2CA 3LYGA 3SEDA 4AKZA 3CCV3 1GOVA 1DETA 5I97A 1C54A 3KN4A 2O9UX 3MG3A 2BMRB 1K41A 1V57A 1CQSA 2CWTA 3WOFB 3SLUA 3AMOB 1JZOA 2HMKB 1UCLA 4HVNA 4L8PA 1MWSA 3VGNA 4HM2B 3D5GA 1A2VA 1RGLA 4MMYB 5KP1A 1SIHA 5FGOA 4HAAA 2CFKA 1O7PB 4FMDA 1DMMA 1RMSA 1HKXA 1GD4A 1MWUA 3F7XA 3LTAA 3PYJA 2B1XB 1VQP3 4U13A 2HMOB 5CF2A 1IQ8A 1IVVA 2ZHXB 1RCKA 1EG9B 1BVIA 2XSOB 1BRSA 4IPBA 5DREA 3RNTA 1ZS7A 3S27A 4O2HA 1B3SA 3LTBA 2WO0A 4MMXB 1Q814 1PY3A 3E99A 1CH0A 2BNGA 3JUOA 4HM6B 2XEPA 3FZWA 2GBXB 1KSIA 1BRKA 1JBRA 2CFWA 1FYSA 1BSEA 1STFI 4CDLA 4HYZA 5HOHA 1NB5I 3CCR3 1Z1SA 1Q40A 1RLSA 1RNTA 1TFOA 2W56A 2QGUA 4N6OB 1MGWA 3EBTA 2QIYA 4NHFA 1W2B2 1BRJA 1YJN3 3FF2A 1U8CB 3CXC2 2FGTA 3PXMA 1QMAA 1E97A 3F8XA 3B4PA 3FSDA 4XDVA 3ZG0A 4WYKB 3MSOA 5DRVA 1W02A 3X41A 2SARA 2K0MA 1FGMA 2XFSA 4R80A 2Z77A 4WFOA 4RNZA 5IERA 3EBYA 2AADA 1V58A 3D9RA 1BOXA 3SX1A 1PFPA 3LOYA 4JF8A 3G0KA 4N6NB 3WMDA 2V1LA 1G02A 3NV0B 3S28A 1A90A 5AIIA 1LOWA 1JJ22 4IT7A 3SXXA 5AIHA 1BSBA 1OPYA 3FGYA 3KE7A 1UI7A 1V74A 1RSNA 2UUGC 1TTOA 3MPHA 4RNTA 3HIGA 4EBGA 1STDA 1N8R4 1BRHA 2IA7A 1IT7A 2PZVA 3BB9A 3H3HA 1LOYA 3OV4A 1C7HA 3K7CA 2IYJA 2XSHB 4H3UA 4EYCA 4LEHA 1QVF2 2Q07A 2FNQA 3NM7A 3RDEA 1BAOA 6STDA 3F14A 1QAFA 3EJVA 3NQYA 1ZX2A 4HM1B 3RGAA 3S5CA 5AIFA 1BNEA 1N5HA 3CCE3 3G4S3 1LNIA 1VQ63 5AIGA 3URPA 2P0XA 1MNLA 1HU9A 3AMOA 3V92A 3KKGA 3NX0A 3N54B 2WGOA 2YX9A 4LGQA 3Q1CA 2F99A 3GZBA 2OCTA 1BU4A 4RBNA 2KRTA 3LXUX 2OQEC 4LYLB 5IG0A 5LC6A 3D5IA 1MOLA 3EE1A 3UL6A 3IPTA 1RN4A 1BRIA 1RHLA 3HIIA 1GSPA 3MHEA 1ROVA 3FG4A 4FMAA 1BRNL 2W0QA 1GY6A 1A2KA 3DY5A 4DKIA 3STDA 1GY7A 2OOVC 2Z6BA 3KIIA 2HMJB 1IV9A 1OHOA 3DGLA 1MWRA 1WTHA 3WR2A 1VQN3 2BU4A 4K1UA 2RGQA 3I0YA 1EQKA 4XB5A 1O7GB 5JBSA 1DYUA 1N9JA 4J5KA 1TP6A 2K3DA 4HM4B 1ZGXA 1I70A 1WNHA 2C10A 1E3VA 3CMA3 4AEQA 1FGQA 1I8VA 2ZL8A 3OWSA 2IUKA 5JPUA 1AR0A 5AYRB 2WOHA 3WOEB 1TIJA 2IMJA 1HZ1A 4FR9A 4K90B 3EC9A 4O3VA 1BUJA 2CK3H 1SJWA 1UW1A 2CWUA 1IU7A 1Q9EA 1SIIA 1OUNA 1JN5A 3NV0A 1TRQA 4K1VA 2R41A 3CC43 2GXFA 4LMIA 1WMNA 1YVSA 1IVXA 2OOVA 3PZWA 1GOUA 2STDA 3Q90A 3GZYB 5HGRA 1OF5B 1O7WB 3MG1A 2W04A 1RGKA 4LSOA 5D83A 3EN1B 3UJMA 1FGTA 1KWIA 5M1AA 2GEXA 3DH2A 3JUNA 3KSED 4GB5A 5G2GA 1SQWA 2Z76A 1NDOB 5M18A 2Y73A 8RNTA 2KCDA 5GSPA 1NNVA 3BU4A 3EQQB 2GU1A 3A5EA 3IMAB 9RNTA 2BMQB 2CFDA 4HM0B 3QK9A 5CK6A 1B27A 2CX1A 1GD3A 2MC8A 1RGFA 3M8CA 1YIT3 3LT8A 4KFEA 2OTL3 1UCIA 4N6V0 1QJGA 3U1WA 3EX9A 1ULIB 3LMLA 2PNCA 3DMCA 1PYLA 2CIUA 2XH9A 5G1LA 3X40A 1S723 1AQZA 3CCU3 1UCKA 1BGSA 2F98A 3DZLA 1GMRA 4RZMA 1IQXA 1OGZA 2F5WA 1K9M4 1FW7A 1DVDA 3NXJA 3KZTA 1Q42A 3K9MC 2ZA4A 4BIRA 3PS8A 1W6GA 1LXEA 2D42A 2BO9B 3WHOA 4MMZB 4FCZA 2OTJ3 1IQYA 1WMPA 3LTDA 3CCJ3 4NREA 1JZDA 5AYSC 1PU4A 1OGXA 3CCM3 1VQL3 3F9SA 1GMQA 2GSPA 1RGGA 1RDSA 3GRDA 1UDII 1OACA 5ELJA 4MJDA 5IEOA 3WDGB 3HX8A 2XGNA 1W6CA 1CYVA 1LOVA 3CPOA 1UUVB 1JB5A 4KFDA 4I4KA 4O8SA 4WHAA 3SVAA 3T8UA 2GU3A 3GSPA 1GYBA 1SARA 1VQ43 1I2EA 2KF5A 3BNDA 3CD63 1B2XA 1IYYA 3MYTA 2GBWB 4GL6A 4GHOA 1A2PA 1JKGA 1RJOA 1YGWA 3F8HA 4BU4A 3X3YA 4EC6A 1O7HB 1HYFA 4R1KA 3B7CA 4HM7B 3WA3A 4KT3B 1I0XA 6GSPA 3BLZA 2HMMB 5EQLA 1Q824 3RGRA 1TFKA 5G1KA 5IEPA 1ROAA 4K61A 4KZ1A 2ML6A 2BT3A 2ZDJA 3B8LA 1JNQA 4HZBB 3GWRA 1CYUA 5CLKA 4CJNA 1VQK3 3UB1A 3N9HA 2IY2A 3OX9A 1R4YA 1I2FA 2CX0A 1UI8A 5IENA 1KD14 3NUVA 1LQMB 1I0VA 1OHSA 4HM8B 1RGAA 5AI1A 1D6ZA 4OK0A 1OF5A 3MWZA 3CCL3 4ZM8A 5D82A 2RCDA 1W5ZA 1WQLB 3U97A 4X2OA 1CEWI 1US1A 4XM4A 3JUPA 3V98A 5KP4A 2W03A 3A76A 1JBSA 3V99A 1VQ73 1M9GA 2CW9A 2I9WA 3KSPA 4AKYA 1X1YA 1M1XB 3JVCA 2UGIA 3HK4A 1LNHA 3O8YA 4CPKA 1X1UA 3BNBA 3DGMA 5RNTA 2P09A 1W01A 3HI7A 3VF1A 1AVLA 3SOAA 2UX0A 1RGCA 2CG0A 3VSYA 1IVWA 1DMQA 3CPW2 1VQ93 1D6UA 3DGNA 4R4KA 1UCJA 4OVMA 2F56A 3AGOA 1BNRA 4NPBA 2OWPA 5IG4A 1RGHA 1YJW3 5CXOA 4BL3A 1G0TA 3DGYA 2KAAA 3QRDA 4FCJA 3K5TA 2R4IA 3ALAA 1TU5A 1Q7Y4 3KCHA 1Q7HA 3DGOA 3LZAA 4FCMA 3FCSB 2CC3A 2JQ5A 2Z7AA 3SYUA 4WYKA 1OCVA 1BNJA 1AVKA 4HBRA 3OWYA 1T5YA 3FKAA 4WWUC 3T0UA 1NO3A 3LT9A 4O02B 5IG3A 1EA2A 2RNTA 2WGQA 2K54A 2HOHA 1BNIA 3NHXA 4HKVB 4XDWA 1B2UA 3D3LA 1FGOA 2XR8B 1N9EA 2P38A 3B4OA 1D6YA 1LQGC 3CU3A 1RN7A 1QALA 2CHCA 2QEX3 4OUQA 3AHSA 1DE3A 3GZXB 4HM3B 1VQO3 3EF8A 1BNSA 1GOYA 1T2HA 1IVUA 1LOXA 1RN1A 2Y74A 1OH0A 3MG2A 3JUMA 1GS3A 1G96A 2O3OA 1AY7A 2HMLB 4EXRA 7RNTA 1QVG2 2XRXB 1VQ53 3LH4A 2H0HA 3GZRA 1M1K4 1BSCA 3AGNA 2A15A 1EUIC 1LVNA 4BTYA 3S29A 2RFRA 3ECFA 4FMCA 3ROBA 1RRHA 2W6JH 3CCS3 3K0ZA 3KFQC 3NM2A 4HJLB 2E2UA 2MF7A 4RNYA 4ORLA 3NBRA 4HM5B 3IJEB 1FUWA 1W6YA 2QA43 1TJDA 3X3ZA 3I563 3X42A 5EVHA 3UNLA 1GMPA 3ZG5A 3N8BA 4MEIA 1YHQ3 2W9QA 5EEOA 3I553 1NB3I 2LQVA 1FUSA 2YFLB 1W2ZA 4I5QA 1JB4A 1NJI4 2C11A 3JUQA 2KF3A 2D1WA 7GSPA 3F40A 3EN8A 4JRFA 4BTXA 4GSPA 2AAEA 5IF6A 3MKIA 1W7CA 3FH1A 4KFFA 4FMBA 3TDGA 2H0GA 1W4NA 2ML5A 2KF6A 3G6E3 1SPUA 2F5MA 3K63A
chains in the Genus database with same CATH topology
4XBXA 2WOFA 4G1MB 1JRQA 5A0OB 2LYXA 4PEJA 5D81A 1K8A4 2FXTA 1F8NA 1W00A 4H61A 3T8NA 3WODG 1IT8A 3GAXA 5CF1A 3CCQ3 3BNCA 3G8ZA 3NQZA 4N6TA 5LC7A 3HZPA 3G16A 3PCRA 1YVBI 2XF3A 1IK3A 1ASKA 4N6UA 4R9LA 1OHPA 1RRLA 5AEWB 1KC84 1ZO2A 2P05A 1EKMA 4J9AA 3CME3 3Q2PA 3CC73 1FA3A 3H51A 2L4VA 4XBTA 1NU3A 4X2HA 5BXQA 1JN5B 1K28A 2YFJB 5FW5A 4QWTA 2CH9A 1K734 3UL5A 3PGBA 3S67A 1Y4KA 1QAKA 2CKFB 2E2VA 3SOYA 5IG5A 4L7KA 4N6LA 1FGRA 3FLJA 8CHOA 1ISKA 1VZZA 2KXGA 3DXOA 5AEUB 3J7Yd 1AV4A 1O7MB 3FG1A 5TGNA 4WP5A 5ELUA 3CNXA 4HZ9B 1RKYA 1DVCA 5IW9A 5KP3A 1JV2B 7STDA 3OW22 3G713 2HMNB 3BNEA 4EV2A 1YIJ3 1M904 3F7SA 2INXA 2W9PA 1Q40B 2W56B 2IUJA 2B24B 5JPPA 1NWWA 3X3XA 4IIAA 3FG3A 3PCSA 3EHCA 4EV5A 1N8QA 2E2TA 3LTCA 4KVHA 1YGEA 1N5PA 3DUKA 1U5OA 4N3VA 3NBBA 2CFLA 2XGLA 3FF0A 3OWUA 1O7NB 2CFGA 1TUHA 4STDA 3DM8A 1E3RA 1VQ83 1DMNA 1YI23 3NBJA 4R9KA 2XFTA 3CNMA 2GEYA 4TX4A 1YJ93 1S5AA 4LZIA 1IV7A 1L5GB 2CWVA 2JDIH 2P0MA 3OXAA 3WA2X 1Q864 2BHMA 1BUQA 1KQS2 2BMOB 2CG1A 2RSXA 2SBLA 4Q53A 1J2BA 1JB2A 5STDA 1WMOA 1JKGB 2OQEA 3L0RA 1R4CA 2M7OA 5BVBA 4N6MA 2YFIB 4BTWA 4J8TA 1A67A 2F86B 4CCVA 1IDPA 3ER7A 1GY5A 1VQM3 4XBYA 1ULJB 3EB8A 1UUWB 2W2CA 3LYGA 3SEDA 4AKZA 3CCV3 5I97A 3KN4A 2O9UX 3MG3A 2BMRB 1K41A 1CQSA 2CWTA 3WOFB 3SLUA 3AMOB 2HMKB 4HVNA 4L8PA 3VGNA 4HM2B 5KP1A 1A2VA 4MMYB 1SIHA 5FGOA 2CFKA 1O7PB 4FMDA 1DMMA 1HKXA 1GD4A 3F7XA 3LTAA 3PYJA 2B1XB 1VQP3 4U13A 2HMOB 5CF2A 1IQ8A 1IVVA 1EG9B 2XSOB 4IPBA 5DREA 3S27A 4O2HA 3LTBA 2WO0A 4MMXB 1Q814 3E99A 2BNGA 3JUOA 4HM6B 2XEPA 3FZWA 2GBXB 1KSIA 2CFWA 1STFI 4CDLA 1NB5I 4HYZA 3CCR3 1Z1SA 1Q40A 2W56A 1TFOA 2QGUA 4N6OB 3EBTA 2QIYA 4NHFA 1W2B2 1YJN3 3FF2A 1U8CB 3CXC2 2FGTA 3PXMA 1QMAA 1E97A 3F8XA 3B4PA 3FSDA 4WYKB 3MSOA 5DRVA 1W02A 3X41A 2K0MA 1FGMA 2XFSA 4R80A 2Z77A 4WFOA 4RNZA 5IERA 3EBYA 3D9RA 3SX1A 1PFPA 3LOYA 4JF8A 3G0KA 4N6NB 3WMDA 2V1LA 3NV0B 3S28A 1A90A 5AIIA 1JJ22 4IT7A 3SXXA 5AIHA 1OPYA 3FGYA 3KE7A 1UI7A 1V74A 3MPHA 3HIGA 4EBGA 1STDA 1N8R4 2IA7A 1IT7A 2PZVA 3BB9A 3H3HA 3OV4A 1C7HA 3K7CA 2XSHB 4H3UA 4EYCA 4LEHA 1QVF2 2Q07A 2FNQA 3NM7A 3RDEA 6STDA 3F14A 1QAFA 3EJVA 3NQYA 1ZX2A 4HM1B 3RGAA 3S5CA 5AIFA 1N5HA 3CCE3 3G4S3 1VQ63 5AIGA 2P0XA 1MNLA 1HU9A 3AMOA 3V92A 3KKGA 3NX0A 3N54B 2WGOA 2YX9A 4LGQA 3Q1CA 2F99A 3GZBA 2OCTA 4RBNA 2KRTA 3LXUX 2OQEC 5IG0A 5LC6A 1MOLA 3EE1A 3UL6A 3IPTA 3HIIA 3MHEA 1ROVA 3FG4A 4FMAA 2W0QA 1GY6A 1A2KA 3DY5A 3STDA 1GY7A 2OOVC 2Z6BA 3KIIA 2HMJB 1IV9A 1OHOA 3DGLA 1VQN3 1WTHA 4K1UA 2RGQA 3I0YA 1EQKA 4XB5A 1O7GB 5JBSA 1DYUA 1N9JA 1TP6A 4HM4B 1WNHA 2C10A 1E3VA 3CMA3 4AEQA 1FGQA 2ZL8A 5JPUA 3OWSA 2IUKA 1AR0A 5AYRB 2WOHA 3WOEB 1TIJA 2IMJA 4FR9A 4K90B 3EC9A 4O3VA 2CK3H 1SJWA 1UW1A 2CWUA 1IU7A 1SIIA 4K1VA 1OUNA 1JN5A 3NV0A 3CC43 2GXFA 4LMIA 1WMNA 1IVXA 2OOVA 3PZWA 2STDA 3Q90A 3GZYB 5HGRA 1OF5B 1O7WB 3MG1A 2W04A 4LSOA 5D83A 3EN1B 3UJMA 1FGTA 1KWIA 2GEXA 3JUNA 3KSED 4GB5A 5G2GA 1SQWA 2Z76A 1NDOB 2Y73A 2KCDA 3EQQB 2GU1A 3IMAB 2BMQB 2CFDA 4HM0B 3QK9A 5CK6A 2MC8A 1YIT3 1GD3A 3M8CA 3LT8A 4KFEA 2OTL3 3U1WA 4N6V0 1QJGA 3EX9A 1ULIB 3LMLA 2PNCA 3DMCA 3X40A 2CIUA 2XH9A 1S723 3CCU3 2F98A 3DZLA 4RZMA 1IQXA 1OGZA 1K9M4 1DVDA 3NXJA 3KZTA 1Q42A 3K9MC 3PS8A 1W6GA 1LXEA 2D42A 2BO9B 4MMZB 4FCZA 2OTJ3 1IQYA 1WMPA 3LTDA 3CCJ3 4NREA 5AYSC 1PU4A 1OGXA 3CCM3 1VQL3 3F9SA 3GRDA 1OACA 5ELJA 4MJDA 5IEOA 3WDGB 3HX8A 2XGNA 1W6CA 1CYVA 3CPOA 4KFDA 1UUVB 1JB5A 4O8SA 4I4KA 4XDVA 4WHAA 3SVAA 3T8UA 2GU3A 1GYBA 1VQ43 3BNDA 3CD63 3MYTA 2GBWB 4GL6A 1JKGA 1RJOA 3F8HA 4EC6A 3X3YA 1O7HB 4R1KA 3B7CA 4HM7B 3WA3A 3BLZA 2HMMB 5EQLA 1Q824 3RGRA 1TFKA 5IEPA 1ROAA 4K61A 4KZ1A 2ML6A 2BT3A 2ZDJA 3B8LA 1JNQA 4HZBB 3GWRA 1CYUA 5CLKA 1VQK3 3UB1A 3N9HA 3OX9A 1KD14 1UI8A 5IENA 3NUVA 1OHSA 4HM8B 5AI1A 1D6ZA 4OK0A 1OF5A 3MWZA 3CCL3 4ZM8A 5D82A 2RCDA 1W5ZA 1WQLB 3U97A 4X2OA 1CEWI 1US1A 4XM4A 3JUPA 3V98A 5KP4A 2W03A 3A76A 3V99A 1VQ73 1M9GA 2CW9A 2I9WA 3KSPA 4AKYA 1M1XB 3JVCA 3HK4A 1LNHA 3O8YA 3BNBA 3DGMA 2P09A 1W01A 3HI7A 3VF1A 1AVLA 3SOAA 2UX0A 2CG0A 3VSYA 1IVWA 1DMQA 3CPW2 1VQ93 1D6UA 3DGNA 4R4KA 4OVMA 2OWPA 5IG4A 1YJW3 5CXOA 4FCJA 3QRDA 1TU5A 3K5TA 2R4IA 3ALAA 1Q7Y4 4FCMA 3DGOA 3LZAA 3FCSB 2CC3A 2JQ5A 2Z7AA 4WYKA 1OCVA 1AVKA 4HBRA 3OWYA 1T5YA 3FKAA 4WWUC 3T0UA 1NO3A 3LT9A 4O02B 5IG3A 1EA2A 2WGQA 2K54A 3NHXA 4HKVB 4XDWA 3D3LA 1FGOA 2XR8B 1N9EA 2P38A 3B4OA 1D6YA 3CU3A 1RN7A 1QALA 2CHCA 2QEX3 4OUQA 3GZXB 4HM3B 1VQO3 3EF8A 1IVUA 1LOXA 2Y74A 1OH0A 3MG2A 3JUMA 1GS3A 1G96A 2O3OA 4EXRA 2HMLB 1QVG2 1VQ53 2XRXB 3LH4A 3GZRA 1M1K4 2A15A 1LVNA 4BTYA 3S29A 2RFRA 3ECFA 4FMCA 3ROBA 1RRHA 2W6JH 3CCS3 3K0ZA 3KFQC 3NM2A 4HJLB 2E2UA 2MF7A 4RNYA 4ORLA 3NBRA 4HM5B 3IJEB 1FUWA 1W6YA 2QA43 3X3ZA 3I563 3X42A 5EVHA 3UNLA 3N8BA 4MEIA 1YHQ3 2W9QA 5EEOA 3I553 1NB3I 2LQVA 2YFLB 1W2ZA 1JB4A 1NJI4 2C11A 3JUQA 2D1WA 3F40A 3EN8A 4JRFA 4BTXA 5IF6A 3MKIA 1W7CA 3FH1A 4KFFA 4FMBA 3TDGA 1W4NA 2ML5A 4L8OA 3G6E3 1SPUA 3CC23 3K63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBX A;  5D81 A;  4PEJ A;  1W00 A;  3T8N A;  5CF1 A;  3G8Z A;  3HZP A;  3G16 A;  1ASK A;  4R9L A;  1OHP A;  5AEW B;  1ZO2 A;  4J9A A;  3H51 A;  4XBT A;  1NU3 A;  4X2H A;  5BXQ A;  1JN5 B;  2YFJ B;  5FW5 A;  2CKF B;  3SOY A;  5IG5 A;  4L7K A;  8CHO A;  3FLJ A;  1ISK A;  1VZZ A;  3DXO A;  5AEU B;  1O7M B;  5TGN A;  4WP5 A;  3CNX A;  4HZ9 B;  5KP3 A;  7STD A;  2HMN B;  3F7S A;  2INX A;  1Q40 B;  2B24 B;  5JPP A;  1NWW A;  4IIA A;  3EHC A;  4KVH A;  3DUK A;  1U5O A;  4N3V A;  3FF0 A;  3OWU A;  1O7N B;  1TUH A;  4STD A;  3DM8 A;  1E3R A;  1DMN A;  4R9K A;  3CNM A;  2GEY A;  1S5A A;  3OXA A;  1BUQ A;  2BMO B;  4Q53 A;  1JB2 A;  5STD A;  1JKG B;  5BVB A;  4L8O A;  2YFI B;  4J8T A;  2F86 B;  1IDP A;  3ER7 A;  1GY5 A;  4XBY A;  1ULJ B;  1UUW B;  3SED A;  3LYG A;  2W2C A;  3MG3 A;  2BMR B;  1K41 A;  1CQS A;  2HMK B;  4HVN A;  4L8P A;  3VGN A;  4HM2 B;  5KP1 A;  1O7P B;  1DMM A;  1HKX A;  3F7X A;  2B1X B;  4U13 A;  2HMO B;  5CF2 A;  1EG9 B;  2XSO B;  5DRE A;  3E99 A;  2BNG A;  3JUO A;  4HM6 B;  3FZW A;  2GBX B;  4CDL A;  1Z1S A;  1Q40 A;  2QGU A;  3EBT A;  2QIY A;  3FF2 A;  1QMA A;  1E97 A;  3F8X A;  3B4P A;  3FSD A;  4WYK B;  3MSO A;  5DRV A;  1W02 A;  2Z77 A;  5IER A;  3EBY A;  3D9R A;  3G0K A;  3WMD A;  3NV0 B;  5AII A;  5AIH A;  1OPY A;  3FGY A;  3KE7 A;  1STD A;  3BB9 A;  2PZV A;  3H3H A;  3OV4 A;  1C7H A;  3K7C A;  2XSH B;  4H3U A;  4LEH A;  6STD A;  3F14 A;  3EJV A;  1ZX2 A;  4HM1 B;  3RGA A;  3S5C A;  5AIF A;  5AIG A;  3KKG A;  4LGQ A;  2F99 A;  3GZB A;  5IG0 A;  3IPT A;  3MHE A;  1GY6 A;  1A2K A;  3STD A;  1GY7 A;  2HMJ B;  1OHO A;  4K1U A;  2RGQ A;  3I0Y A;  4XB5 A;  1O7G B;  1TP6 A;  4HM4 B;  1E3V A;  5JPU A;  3OWS A;  1AR0 A;  2IMJ A;  3EC9 A;  1SJW A;  4K1V A;  1OUN A;  1JN5 A;  3NV0 A;  2GXF A;  4LMI A;  2STD A;  3Q90 A;  3GZY B;  5HGR A;  1OF5 B;  1O7W B;  3MG1 A;  5D83 A;  3UJM A;  3EN1 B;  2GEX A;  3JUN A;  4GB5 A;  5G2G A;  2Z76 A;  1NDO B;  3EQQ B;  2BMQ B;  4HM0 B;  5CK6 A;  3M8C A;  1QJG A;  3EX9 A;  1ULI B;  3DMC A;  2F98 A;  3DZL A;  4RZM A;  1OGZ A;  3NXJ A;  3KZT A;  1Q42 A;  1OGX A;  3F9S A;  3GRD A;  4MJD A;  5IEO A;  3HX8 A;  3CPO A;  4XDV A;  3T8U A;  1UUV B;  1JB5 A;  4I4K A;  1GYB A;  3MYT A;  2GBW B;  1JKG A;  3F8H A;  1O7H B;  4R1K A;  3B7C A;  4HM7 B;  3BLZ A;  2HMM B;  3RGR A;  5IEP A;  3B8L A;  4HZB B;  3GWR A;  5CLK A;  3OX9 A;  5IEN A;  3NUV A;  1OHS A;  4HM8 B;  5AI1 A;  1OF5 A;  5D82 A;  2RCD A;  1WQL B;  4X2O A;  4XM4 A;  3JUP A;  5KP4 A;  3A76 A;  2I9W A;  3KSP A;  3HK4 A;  1W01 A;  3SOA A;  2UX0 A;  3VSY A;  1DMQ A;  4OVM A;  2OWP A;  5IG4 A;  5CXO A;  4FCJ A;  2R4I A;  4FCM A;  3LZA A;  2JQ5 A;  2Z7A A;  4WYK A;  1OCV A;  4WWU C;  3OWY A;  3FKA A;  5IG3 A;  1EA2 A;  2K54 A;  3NHX A;  4HKV B;  4XDW A;  2XR8 B;  3B4O A;  3CU3 A;  2CHC A;  4OUQ A;  3GZX B;  4HM3 B;  3EF8 A;  1OH0 A;  3MG2 A;  3JUM A;  1GS3 A;  2HML B;  2XRX B;  3GZR A;  2A15 A;  2RFR A;  3ECF A;  3ROB A;  3K0Z A;  3NM2 A;  4HJL B;  3NBR A;  4HM5 B;  1W6Y A;  5EVH A;  3UNL A;  2YFL B;  1JB4 A;  3JUQ A;  3F40 A;  3EN8 A;  5IF6 A;  3MKI A;  3FH1 A;  4ORL A; 
#chains in the Genus database with same CATH topology
 2J8X B;  4XBX A;  2WOF A;  4G1M B;  1JRQ A;  5A0O B;  2LYX A;  4PEJ A;  5D81 A;  1K8A 4;  1B21 A;  2FXT A;  1F8N A;  1W00 A;  2KF4 A;  4H61 A;  1BSD A;  1IT8 A;  3GAX A;  3T8N A;  3WOD G;  5CF1 A;  3CCQ 3;  3BNC A;  3G8Z A;  3NQZ A;  4N6T A;  5LC7 A;  3HZP A;  3G16 A;  3PCR A;  1YVB I;  1B2Z A;  2XF3 A;  1IK3 A;  1FUT A;  1ASK A;  4N6U A;  4R9L A;  1RGE A;  1OHP A;  1RRL A;  1JBT A;  1I2G A;  5AEW B;  1MWT A;  1KC8 4;  1ZO2 A;  2L1S A;  2P05 A;  1VQQ A;  1UUG B;  1FZU A;  1EKM A;  1UGI A;  4J9A A;  3CME 3;  2F4Y A;  2C4B A;  3Q2P A;  3CC7 3;  1FA3 A;  3H51 A;  2H0I A;  2L4V A;  4XBT A;  1NU3 A;  1BAN A;  4X2H A;  1JN5 B;  5BXQ A;  1K28 A;  1X1W A;  2YFJ B;  4J5G A;  1BNF A;  3D79 A;  5FW5 A;  4QWT A;  2CH9 A;  1K73 4;  3UL5 A;  3PGB A;  3S67 A;  1Y4K A;  1QAK A;  2RBI A;  2CKF B;  2E2V A;  3SOY A;  4ILF A;  5IG5 A;  1BNG A;  4L7K A;  4HOH A;  4N6L A;  1FGR A;  3FLJ A;  8CHO A;  1ISK A;  1VZZ A;  2KXG A;  1B20 A;  5BU4 A;  3DXO A;  5AEU B;  3J7Y d;  1AV4 A;  1O7M B;  1MGR A;  3FG1 A;  4WP5 A;  5ELU A;  5TGN A;  3CNX A;  4HZ9 B;  3Q3F A;  1RKY A;  1DVC A;  5IW9 A;  5KP3 A;  5M19 A;  1JV2 B;  7STD A;  3OW2 2;  3G71 3;  2HMN B;  3BNE A;  4EV2 A;  1B2M A;  1YIJ 3;  1M90 4;  3F7S A;  3HOH A;  4EW5 A;  1LRA A;  1T3B A;  2INX A;  2W9P A;  1Q40 B;  2W56 B;  2BIR A;  2IUJ A;  2B24 B;  5JPP A;  1NWW A;  1TRP A;  1T2I A;  3X3X A;  4IIA A;  3FG3 A;  3PCS A;  1I3F A;  3BIR A;  3EHC A;  4EV5 A;  1N8Q A;  2E2T A;  3LTC A;  5BIR A;  1RTU A;  6RNT A;  1RCL A;  4KVH A;  1YGE A;  1N5P A;  4BL2 A;  3DUK A;  1U5O A;  4N3V A;  3NBB A;  2CFL A;  2XGL A;  3FF0 A;  3OWU A;  1O7N B;  2CFG A;  1I3I A;  1TUH A;  4STD A;  3DM8 A;  1E3R A;  1VQ8 3;  1DMN A;  1BRG A;  1YI2 3;  3NBJ A;  4R9K A;  2XFT A;  3CNM A;  2GEY A;  4TX4 A;  1YJ9 3;  1S5A A;  4LZI A;  1IV7 A;  1EEJ A;  3AHW A;  1L5G B;  1BIR A;  2CWV A;  2JDI H;  1RNB A;  1B2S A;  2P0M A;  3OXA A;  3WA2 X;  1Q86 4;  2BHM A;  1BSA A;  1YNV X;  1BUQ A;  1KQS 2;  1UGH I;  2BMO B;  2CG1 A;  2RSX A;  3ZFZ A;  2SBL A;  4Q53 A;  1J2B A;  1JB2 A;  5STD A;  1WMO A;  1JKG B;  2OQE A;  3D4A A;  3L0R A;  1R4C A;  2M7O A;  5BVB A;  4L8O A;  4N6M A;  2YFI B;  4BTW A;  4J8T A;  1A67 A;  2F86 B;  4CCV A;  1IDP A;  3ER7 A;  1GY5 A;  1VQM 3;  4XBY A;  3CC2 3;  1ULJ B;  1X1X A;  3EB8 A;  1UUW B;  2W2C A;  3LYG A;  3SED A;  4AKZ A;  3CCV 3;  1GOV A;  1DET A;  5I97 A;  1C54 A;  3KN4 A;  2O9U X;  3MG3 A;  2BMR B;  1K41 A;  1V57 A;  1CQS A;  2CWT A;  3WOF B;  3SLU A;  3AMO B;  1JZO A;  2HMK B;  1UCL A;  4HVN A;  4L8P A;  1MWS A;  3VGN A;  4HM2 B;  3D5G A;  1A2V A;  1RGL A;  4MMY B;  5KP1 A;  1SIH A;  5FGO A;  4HAA A;  2CFK A;  1O7P B;  4FMD A;  1DMM A;  1RMS A;  1HKX A;  1GD4 A;  1MWU A;  3F7X A;  3LTA A;  3PYJ A;  2B1X B;  1VQP 3;  4U13 A;  2HMO B;  5CF2 A;  1IQ8 A;  1IVV A;  2ZHX B;  1RCK A;  1EG9 B;  1BVI A;  2XSO B;  1BRS A;  4IPB A;  5DRE A;  3RNT A;  1ZS7 A;  3S27 A;  4O2H A;  1B3S A;  3LTB A;  2WO0 A;  4MMX B;  1Q81 4;  1PY3 A;  3E99 A;  1CH0 A;  2BNG A;  3JUO A;  4HM6 B;  2XEP A;  3FZW A;  2GBX B;  1KSI A;  1BRK A;  1JBR A;  2CFW A;  1FYS A;  1BSE A;  1STF I;  4CDL A;  4HYZ A;  5HOH A;  1NB5 I;  3CCR 3;  1Z1S A;  1Q40 A;  1RLS A;  1RNT A;  1TFO A;  2W56 A;  2QGU A;  4N6O B;  1MGW A;  3EBT A;  2QIY A;  4NHF A;  1W2B 2;  1BRJ A;  1YJN 3;  3FF2 A;  1U8C B;  3CXC 2;  2FGT A;  3PXM A;  1QMA A;  1E97 A;  3F8X A;  3B4P A;  3FSD A;  4XDV A;  3ZG0 A;  4WYK B;  3MSO A;  5DRV A;  1W02 A;  3X41 A;  2SAR A;  2K0M A;  1FGM A;  2XFS A;  4R80 A;  2Z77 A;  4WFO A;  4RNZ A;  5IER A;  3EBY A;  2AAD A;  1V58 A;  3D9R A;  1BOX A;  3SX1 A;  1PFP A;  3LOY A;  4JF8 A;  3G0K A;  4N6N B;  3WMD A;  2V1L A;  1G02 A;  3NV0 B;  3S28 A;  1A90 A;  5AII A;  1LOW A;  1JJ2 2;  4IT7 A;  3SXX A;  5AIH A;  1BSB A;  1OPY A;  3FGY A;  3KE7 A;  1UI7 A;  1V74 A;  1RSN A;  2UUG C;  1TTO A;  3MPH A;  4RNT A;  3HIG A;  4EBG A;  1STD A;  1N8R 4;  1BRH A;  2IA7 A;  1IT7 A;  2PZV A;  3BB9 A;  3H3H A;  1LOY A;  3OV4 A;  1C7H A;  3K7C A;  2IYJ A;  2XSH B;  4H3U A;  4EYC A;  4LEH A;  1QVF 2;  2Q07 A;  2FNQ A;  3NM7 A;  3RDE A;  1BAO A;  6STD A;  3F14 A;  1QAF A;  3EJV A;  3NQY A;  1ZX2 A;  4HM1 B;  3RGA A;  3S5C A;  5AIF A;  1BNE A;  1N5H A;  3CCE 3;  3G4S 3;  1LNI A;  1VQ6 3;  5AIG A;  3URP A;  2P0X A;  1MNL A;  1HU9 A;  3AMO A;  3V92 A;  3KKG A;  3NX0 A;  3N54 B;  2WGO A;  2YX9 A;  4LGQ A;  3Q1C A;  2F99 A;  3GZB A;  2OCT A;  1BU4 A;  4RBN A;  2KRT A;  3LXU X;  2OQE C;  4LYL B;  5IG0 A;  5LC6 A;  3D5I A;  1MOL A;  3EE1 A;  3UL6 A;  3IPT A;  1RN4 A;  1BRI A;  1RHL A;  3HII A;  1GSP A;  3MHE A;  1ROV A;  3FG4 A;  4FMA A;  1BRN L;  2W0Q A;  1GY6 A;  1A2K A;  3DY5 A;  4DKI A;  3STD A;  1GY7 A;  2OOV C;  2Z6B A;  3KII A;  2HMJ B;  1IV9 A;  1OHO A;  3DGL A;  1MWR A;  1WTH A;  3WR2 A;  1VQN 3;  2BU4 A;  4K1U A;  2RGQ A;  3I0Y A;  1EQK A;  4XB5 A;  1O7G B;  5JBS A;  1DYU A;  1N9J A;  4J5K A;  1TP6 A;  2K3D A;  4HM4 B;  1ZGX A;  1I70 A;  1WNH A;  2C10 A;  1E3V A;  3CMA 3;  4AEQ A;  1FGQ A;  1I8V A;  2ZL8 A;  3OWS A;  2IUK A;  5JPU A;  1AR0 A;  5AYR B;  2WOH A;  3WOE B;  1TIJ A;  2IMJ A;  1HZ1 A;  4FR9 A;  4K90 B;  3EC9 A;  4O3V A;  1BUJ A;  2CK3 H;  1SJW A;  1UW1 A;  2CWU A;  1IU7 A;  1Q9E A;  1SII A;  1OUN A;  1JN5 A;  3NV0 A;  1TRQ A;  4K1V A;  2R41 A;  3CC4 3;  2GXF A;  4LMI A;  1WMN A;  1YVS A;  1IVX A;  2OOV A;  3PZW A;  1GOU A;  2STD A;  3Q90 A;  3GZY B;  5HGR A;  1OF5 B;  1O7W B;  3MG1 A;  2W04 A;  1RGK A;  4LSO A;  5D83 A;  3EN1 B;  3UJM A;  1FGT A;  1KWI A;  5M1A A;  2GEX A;  3DH2 A;  3JUN A;  3KSE D;  4GB5 A;  5G2G A;  1SQW A;  2Z76 A;  1NDO B;  5M18 A;  2Y73 A;  8RNT A;  2KCD A;  5GSP A;  1NNV A;  3BU4 A;  3EQQ B;  2GU1 A;  3A5E A;  3IMA B;  9RNT A;  2BMQ B;  2CFD A;  4HM0 B;  3QK9 A;  5CK6 A;  1B27 A;  2CX1 A;  1GD3 A;  2MC8 A;  1RGF A;  3M8C A;  1YIT 3;  3LT8 A;  4KFE A;  2OTL 3;  1UCI A;  4N6V 0;  1QJG A;  3U1W A;  3EX9 A;  1ULI B;  3LML A;  2PNC A;  3DMC A;  1PYL A;  2CIU A;  2XH9 A;  5G1L A;  3X40 A;  1S72 3;  1AQZ A;  3CCU 3;  1UCK A;  1BGS A;  2F98 A;  3DZL A;  1GMR A;  4RZM A;  1IQX A;  1OGZ A;  2F5W A;  1K9M 4;  1FW7 A;  1DVD A;  3NXJ A;  3KZT A;  1Q42 A;  3K9M C;  2ZA4 A;  4BIR A;  3PS8 A;  1W6G A;  1LXE A;  2D42 A;  2BO9 B;  3WHO A;  4MMZ B;  4FCZ A;  2OTJ 3;  1IQY A;  1WMP A;  3LTD A;  3CCJ 3;  4NRE A;  1JZD A;  5AYS C;  1PU4 A;  1OGX A;  3CCM 3;  1VQL 3;  3F9S A;  1GMQ A;  2GSP A;  1RGG A;  1RDS A;  3GRD A;  1UDI I;  1OAC A;  5ELJ A;  4MJD A;  5IEO A;  3WDG B;  3HX8 A;  2XGN A;  1W6C A;  1CYV A;  1LOV A;  3CPO A;  1UUV B;  1JB5 A;  4KFD A;  4I4K A;  4O8S A;  4WHA A;  3SVA A;  3T8U A;  2GU3 A;  3GSP A;  1GYB A;  1SAR A;  1VQ4 3;  1I2E A;  2KF5 A;  3BND A;  3CD6 3;  1B2X A;  1IYY A;  3MYT A;  2GBW B;  4GL6 A;  4GHO A;  1A2P A;  1JKG A;  1RJO A;  1YGW A;  3F8H A;  4BU4 A;  3X3Y A;  4EC6 A;  1O7H B;  1HYF A;  4R1K A;  3B7C A;  4HM7 B;  3WA3 A;  4KT3 B;  1I0X A;  6GSP A;  3BLZ A;  2HMM B;  5EQL A;  1Q82 4;  3RGR A;  1TFK A;  5G1K A;  5IEP A;  1ROA A;  4K61 A;  4KZ1 A;  2ML6 A;  2BT3 A;  2ZDJ A;  3B8L A;  1JNQ A;  4HZB B;  3GWR A;  1CYU A;  5CLK A;  4CJN A;  1VQK 3;  3UB1 A;  3N9H A;  2IY2 A;  3OX9 A;  1R4Y A;  1I2F A;  2CX0 A;  1UI8 A;  5IEN A;  1KD1 4;  3NUV A;  1LQM B;  1I0V A;  1OHS A;  4HM8 B;  1RGA A;  5AI1 A;  1D6Z A;  4OK0 A;  1OF5 A;  3MWZ A;  3CCL 3;  4ZM8 A;  5D82 A;  2RCD A;  1W5Z A;  1WQL B;  3U97 A;  4X2O A;  1CEW I;  1US1 A;  4XM4 A;  3JUP A;  3V98 A;  5KP4 A;  2W03 A;  3A76 A;  1JBS A;  3V99 A;  1VQ7 3;  1M9G A;  2CW9 A;  2I9W A;  3KSP A;  4AKY A;  1X1Y A;  1M1X B;  3JVC A;  2UGI A;  3HK4 A;  1LNH A;  3O8Y A;  4CPK A;  1X1U A;  3BNB A;  3DGM A;  5RNT A;  2P09 A;  1W01 A;  3HI7 A;  3VF1 A;  1AVL A;  3SOA A;  2UX0 A;  1RGC A;  2CG0 A;  3VSY A;  1IVW A;  1DMQ A;  3CPW 2;  1VQ9 3;  1D6U A;  3DGN A;  4R4K A;  1UCJ A;  4OVM A;  2F56 A;  3AGO A;  1BNR A;  4NPB A;  2OWP A;  5IG4 A;  1RGH A;  1YJW 3;  5CXO A;  4BL3 A;  1G0T A;  3DGY A;  2KAA A;  3QRD A;  4FCJ A;  3K5T A;  2R4I A;  3ALA A;  1TU5 A;  1Q7Y 4;  3KCH A;  1Q7H A;  3DGO A;  3LZA A;  4FCM A;  3FCS B;  2CC3 A;  2JQ5 A;  2Z7A A;  3SYU A;  4WYK A;  1OCV A;  1BNJ A;  1AVK A;  4HBR A;  3OWY A;  1T5Y A;  3FKA A;  4WWU C;  3T0U A;  1NO3 A;  3LT9 A;  4O02 B;  5IG3 A;  1EA2 A;  2RNT A;  2WGQ A;  2K54 A;  2HOH A;  1BNI A;  3NHX A;  4HKV B;  4XDW A;  1B2U A;  3D3L A;  1FGO A;  2XR8 B;  1N9E A;  2P38 A;  3B4O A;  1D6Y A;  1LQG C;  3CU3 A;  1RN7 A;  1QAL A;  2CHC A;  2QEX 3;  4OUQ A;  3AHS A;  1DE3 A;  3GZX B;  4HM3 B;  1VQO 3;  3EF8 A;  1BNS A;  1GOY A;  1T2H A;  1IVU A;  1LOX A;  1RN1 A;  2Y74 A;  1OH0 A;  3MG2 A;  3JUM A;  1GS3 A;  1G96 A;  2O3O A;  1AY7 A;  2HML B;  4EXR A;  7RNT A;  1QVG 2;  2XRX B;  1VQ5 3;  3LH4 A;  2H0H A;  3GZR A;  1M1K 4;  1BSC A;  3AGN A;  2A15 A;  1EUI C;  1LVN A;  4BTY A;  3S29 A;  2RFR A;  3ECF A;  4FMC A;  3ROB A;  1RRH A;  2W6J H;  3CCS 3;  3K0Z A;  3KFQ C;  3NM2 A;  4HJL B;  2E2U A;  2MF7 A;  4RNY A;  4ORL A;  3NBR A;  4HM5 B;  3IJE B;  1FUW A;  1W6Y A;  2QA4 3;  1TJD A;  3X3Z A;  3I56 3;  3X42 A;  5EVH A;  3UNL A;  1GMP A;  3ZG5 A;  3N8B A;  4MEI A;  1YHQ 3;  2W9Q A;  5EEO A;  3I55 3;  1NB3 I;  2LQV A;  1FUS A;  2YFL B;  1W2Z A;  4I5Q A;  1JB4 A;  1NJI 4;  2C11 A;  3JUQ A;  2KF3 A;  2D1W A;  7GSP A;  3F40 A;  3EN8 A;  4JRF A;  4BTX A;  4GSP A;  2AAE A;  5IF6 A;  3MKI A;  1W7C A;  3FH1 A;  4KFF A;  4FMB A;  3TDG A;  2H0G A;  1W4N A;  2ML5 A;  2KF6 A;  3G6E 3;  1SPU A;  2F5M A;  3K63 A; 
#chains in the Genus database with same CATH homology
 4XBX A;  2WOF A;  4G1M B;  1JRQ A;  5A0O B;  2LYX A;  4PEJ A;  5D81 A;  1K8A 4;  2FXT A;  1F8N A;  1W00 A;  4H61 A;  3T8N A;  3WOD G;  1IT8 A;  3GAX A;  5CF1 A;  3CCQ 3;  3BNC A;  3G8Z A;  3NQZ A;  4N6T A;  5LC7 A;  3HZP A;  3G16 A;  3PCR A;  1YVB I;  2XF3 A;  1IK3 A;  1ASK A;  4N6U A;  4R9L A;  1OHP A;  1RRL A;  5AEW B;  1KC8 4;  1ZO2 A;  2P05 A;  1EKM A;  4J9A A;  3CME 3;  3Q2P A;  3CC7 3;  1FA3 A;  3H51 A;  2L4V A;  4XBT A;  1NU3 A;  4X2H A;  5BXQ A;  1JN5 B;  1K28 A;  2YFJ B;  5FW5 A;  4QWT A;  2CH9 A;  1K73 4;  3UL5 A;  3PGB A;  3S67 A;  1Y4K A;  1QAK A;  2CKF B;  2E2V A;  3SOY A;  5IG5 A;  4L7K A;  4N6L A;  1FGR A;  3FLJ A;  8CHO A;  1ISK A;  1VZZ A;  2KXG A;  3DXO A;  5AEU B;  3J7Y d;  1AV4 A;  1O7M B;  3FG1 A;  5TGN A;  4WP5 A;  5ELU A;  3CNX A;  4HZ9 B;  1RKY A;  1DVC A;  5IW9 A;  5KP3 A;  1JV2 B;  7STD A;  3OW2 2;  3G71 3;  2HMN B;  3BNE A;  4EV2 A;  1YIJ 3;  1M90 4;  3F7S A;  2INX A;  2W9P A;  1Q40 B;  2W56 B;  2IUJ A;  2B24 B;  5JPP A;  1NWW A;  3X3X A;  4IIA A;  3FG3 A;  3PCS A;  3EHC A;  4EV5 A;  1N8Q A;  2E2T A;  3LTC A;  4KVH A;  1YGE A;  1N5P A;  3DUK A;  1U5O A;  4N3V A;  3NBB A;  2CFL A;  2XGL A;  3FF0 A;  3OWU A;  1O7N B;  2CFG A;  1TUH A;  4STD A;  3DM8 A;  1E3R A;  1VQ8 3;  1DMN A;  1YI2 3;  3NBJ A;  4R9K A;  2XFT A;  3CNM A;  2GEY A;  4TX4 A;  1YJ9 3;  1S5A A;  4LZI A;  1IV7 A;  1L5G B;  2CWV A;  2JDI H;  2P0M A;  3OXA A;  3WA2 X;  1Q86 4;  2BHM A;  1BUQ A;  1KQS 2;  2BMO B;  2CG1 A;  2RSX A;  2SBL A;  4Q53 A;  1J2B A;  1JB2 A;  5STD A;  1WMO A;  1JKG B;  2OQE A;  3L0R A;  1R4C A;  2M7O A;  5BVB A;  4N6M A;  2YFI B;  4BTW A;  4J8T A;  1A67 A;  2F86 B;  4CCV A;  1IDP A;  3ER7 A;  1GY5 A;  1VQM 3;  4XBY A;  1ULJ B;  3EB8 A;  1UUW B;  2W2C A;  3LYG A;  3SED A;  4AKZ A;  3CCV 3;  5I97 A;  3KN4 A;  2O9U X;  3MG3 A;  2BMR B;  1K41 A;  1CQS A;  2CWT A;  3WOF B;  3SLU A;  3AMO B;  2HMK B;  4HVN A;  4L8P A;  3VGN A;  4HM2 B;  5KP1 A;  1A2V A;  4MMY B;  1SIH A;  5FGO A;  2CFK A;  1O7P B;  4FMD A;  1DMM A;  1HKX A;  1GD4 A;  3F7X A;  3LTA A;  3PYJ A;  2B1X B;  1VQP 3;  4U13 A;  2HMO B;  5CF2 A;  1IQ8 A;  1IVV A;  1EG9 B;  2XSO B;  4IPB A;  5DRE A;  3S27 A;  4O2H A;  3LTB A;  2WO0 A;  4MMX B;  1Q81 4;  3E99 A;  2BNG A;  3JUO A;  4HM6 B;  2XEP A;  3FZW A;  2GBX B;  1KSI A;  2CFW A;  1STF I;  4CDL A;  1NB5 I;  4HYZ A;  3CCR 3;  1Z1S A;  1Q40 A;  2W56 A;  1TFO A;  2QGU A;  4N6O B;  3EBT A;  2QIY A;  4NHF A;  1W2B 2;  1YJN 3;  3FF2 A;  1U8C B;  3CXC 2;  2FGT A;  3PXM A;  1QMA A;  1E97 A;  3F8X A;  3B4P A;  3FSD A;  4WYK B;  3MSO A;  5DRV A;  1W02 A;  3X41 A;  2K0M A;  1FGM A;  2XFS A;  4R80 A;  2Z77 A;  4WFO A;  4RNZ A;  5IER A;  3EBY A;  3D9R A;  3SX1 A;  1PFP A;  3LOY A;  4JF8 A;  3G0K A;  4N6N B;  3WMD A;  2V1L A;  3NV0 B;  3S28 A;  1A90 A;  5AII A;  1JJ2 2;  4IT7 A;  3SXX A;  5AIH A;  1OPY A;  3FGY A;  3KE7 A;  1UI7 A;  1V74 A;  3MPH A;  3HIG A;  4EBG A;  1STD A;  1N8R 4;  2IA7 A;  1IT7 A;  2PZV A;  3BB9 A;  3H3H A;  3OV4 A;  1C7H A;  3K7C A;  2XSH B;  4H3U A;  4EYC A;  4LEH A;  1QVF 2;  2Q07 A;  2FNQ A;  3NM7 A;  3RDE A;  6STD A;  3F14 A;  1QAF A;  3EJV A;  3NQY A;  1ZX2 A;  4HM1 B;  3RGA A;  3S5C A;  5AIF A;  1N5H A;  3CCE 3;  3G4S 3;  1VQ6 3;  5AIG A;  2P0X A;  1MNL A;  1HU9 A;  3AMO A;  3V92 A;  3KKG A;  3NX0 A;  3N54 B;  2WGO A;  2YX9 A;  4LGQ A;  3Q1C A;  2F99 A;  3GZB A;  2OCT A;  4RBN A;  2KRT A;  3LXU X;  2OQE C;  5IG0 A;  5LC6 A;  1MOL A;  3EE1 A;  3UL6 A;  3IPT A;  3HII A;  3MHE A;  1ROV A;  3FG4 A;  4FMA A;  2W0Q A;  1GY6 A;  1A2K A;  3DY5 A;  3STD A;  1GY7 A;  2OOV C;  2Z6B A;  3KII A;  2HMJ B;  1IV9 A;  1OHO A;  3DGL A;  1VQN 3;  1WTH A;  4K1U A;  2RGQ A;  3I0Y A;  1EQK A;  4XB5 A;  1O7G B;  5JBS A;  1DYU A;  1N9J A;  1TP6 A;  4HM4 B;  1WNH A;  2C10 A;  1E3V A;  3CMA 3;  4AEQ A;  1FGQ A;  2ZL8 A;  5JPU A;  3OWS A;  2IUK A;  1AR0 A;  5AYR B;  2WOH A;  3WOE B;  1TIJ A;  2IMJ A;  4FR9 A;  4K90 B;  3EC9 A;  4O3V A;  2CK3 H;  1SJW A;  1UW1 A;  2CWU A;  1IU7 A;  1SII A;  4K1V A;  1OUN A;  1JN5 A;  3NV0 A;  3CC4 3;  2GXF A;  4LMI A;  1WMN A;  1IVX A;  2OOV A;  3PZW A;  2STD A;  3Q90 A;  3GZY B;  5HGR A;  1OF5 B;  1O7W B;  3MG1 A;  2W04 A;  4LSO A;  5D83 A;  3EN1 B;  3UJM A;  1FGT A;  1KWI A;  2GEX A;  3JUN A;  3KSE D;  4GB5 A;  5G2G A;  1SQW A;  2Z76 A;  1NDO B;  2Y73 A;  2KCD A;  3EQQ B;  2GU1 A;  3IMA B;  2BMQ B;  2CFD A;  4HM0 B;  3QK9 A;  5CK6 A;  2MC8 A;  1YIT 3;  1GD3 A;  3M8C A;  3LT8 A;  4KFE A;  2OTL 3;  3U1W A;  4N6V 0;  1QJG A;  3EX9 A;  1ULI B;  3LML A;  2PNC A;  3DMC A;  3X40 A;  2CIU A;  2XH9 A;  1S72 3;  3CCU 3;  2F98 A;  3DZL A;  4RZM A;  1IQX A;  1OGZ A;  1K9M 4;  1DVD A;  3NXJ A;  3KZT A;  1Q42 A;  3K9M C;  3PS8 A;  1W6G A;  1LXE A;  2D42 A;  2BO9 B;  4MMZ B;  4FCZ A;  2OTJ 3;  1IQY A;  1WMP A;  3LTD A;  3CCJ 3;  4NRE A;  5AYS C;  1PU4 A;  1OGX A;  3CCM 3;  1VQL 3;  3F9S A;  3GRD A;  1OAC A;  5ELJ A;  4MJD A;  5IEO A;  3WDG B;  3HX8 A;  2XGN A;  1W6C A;  1CYV A;  3CPO A;  4KFD A;  1UUV B;  1JB5 A;  4O8S A;  4I4K A;  4XDV A;  4WHA A;  3SVA A;  3T8U A;  2GU3 A;  1GYB A;  1VQ4 3;  3BND A;  3CD6 3;  3MYT A;  2GBW B;  4GL6 A;  1JKG A;  1RJO A;  3F8H A;  4EC6 A;  3X3Y A;  1O7H B;  4R1K A;  3B7C A;  4HM7 B;  3WA3 A;  3BLZ A;  2HMM B;  5EQL A;  1Q82 4;  3RGR A;  1TFK A;  5IEP A;  1ROA A;  4K61 A;  4KZ1 A;  2ML6 A;  2BT3 A;  2ZDJ A;  3B8L A;  1JNQ A;  4HZB B;  3GWR A;  1CYU A;  5CLK A;  1VQK 3;  3UB1 A;  3N9H A;  3OX9 A;  1KD1 4;  1UI8 A;  5IEN A;  3NUV A;  1OHS A;  4HM8 B;  5AI1 A;  1D6Z A;  4OK0 A;  1OF5 A;  3MWZ A;  3CCL 3;  4ZM8 A;  5D82 A;  2RCD A;  1W5Z A;  1WQL B;  3U97 A;  4X2O A;  1CEW I;  1US1 A;  4XM4 A;  3JUP A;  3V98 A;  5KP4 A;  2W03 A;  3A76 A;  3V99 A;  1VQ7 3;  1M9G A;  2CW9 A;  2I9W A;  3KSP A;  4AKY A;  1M1X B;  3JVC A;  3HK4 A;  1LNH A;  3O8Y A;  3BNB A;  3DGM A;  2P09 A;  1W01 A;  3HI7 A;  3VF1 A;  1AVL A;  3SOA A;  2UX0 A;  2CG0 A;  3VSY A;  1IVW A;  1DMQ A;  3CPW 2;  1VQ9 3;  1D6U A;  3DGN A;  4R4K A;  4OVM A;  2OWP A;  5IG4 A;  1YJW 3;  5CXO A;  4FCJ A;  3QRD A;  1TU5 A;  3K5T A;  2R4I A;  3ALA A;  1Q7Y 4;  4FCM A;  3DGO A;  3LZA A;  3FCS B;  2CC3 A;  2JQ5 A;  2Z7A A;  4WYK A;  1OCV A;  1AVK A;  4HBR A;  3OWY A;  1T5Y A;  3FKA A;  4WWU C;  3T0U A;  1NO3 A;  3LT9 A;  4O02 B;  5IG3 A;  1EA2 A;  2WGQ A;  2K54 A;  3NHX A;  4HKV B;  4XDW A;  3D3L A;  1FGO A;  2XR8 B;  1N9E A;  2P38 A;  3B4O A;  1D6Y A;  3CU3 A;  1RN7 A;  1QAL A;  2CHC A;  2QEX 3;  4OUQ A;  3GZX B;  4HM3 B;  1VQO 3;  3EF8 A;  1IVU A;  1LOX A;  2Y74 A;  1OH0 A;  3MG2 A;  3JUM A;  1GS3 A;  1G96 A;  2O3O A;  4EXR A;  2HML B;  1QVG 2;  1VQ5 3;  2XRX B;  3LH4 A;  3GZR A;  1M1K 4;  2A15 A;  1LVN A;  4BTY A;  3S29 A;  2RFR A;  3ECF A;  4FMC A;  3ROB A;  1RRH A;  2W6J H;  3CCS 3;  3K0Z A;  3KFQ C;  3NM2 A;  4HJL B;  2E2U A;  2MF7 A;  4RNY A;  4ORL A;  3NBR A;  4HM5 B;  3IJE B;  1FUW A;  1W6Y A;  2QA4 3;  3X3Z A;  3I56 3;  3X42 A;  5EVH A;  3UNL A;  3N8B A;  4MEI A;  1YHQ 3;  2W9Q A;  5EEO A;  3I55 3;  1NB3 I;  2LQV A;  2YFL B;  1W2Z A;  1JB4 A;  1NJI 4;  2C11 A;  3JUQ A;  2D1W A;  3F40 A;  3EN8 A;  4JRF A;  4BTX A;  5IF6 A;  3MKI A;  1W7C A;  3FH1 A;  4KFF A;  4FMB A;  3TDG A;  1W4N A;  2ML5 A;  4L8O A;  3G6E 3;  1SPU A;  3CC2 3;  3K63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...