1BUQA

Solution structure of delta-5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone-hemisuccinate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFFANSLKLPLAVELTQEVRAVANEAAFAFTVSFEFQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Delta 5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone hemisuccinate.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
molecule keywords PROTEIN (3-KETOSTEROID ISOMERASE-19-NORTESTOSTERONE-HEMISUCC
total genus 21
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1buqA00
1JB5A 1UUWB 2BMRB 1OGXA 3F8HA 4IIAA 4L8PA 5IEPA 3LZAA 4LGQA 3B7CA 5AI1A 5IG3A 2W2CA 1ZX2A 3E99A 3GWRA 2GXFA 3OX9A 2XR8B 1K41A 1S5AA 2GEYA 2YFLB 5IG5A 4HM6B 1Q42A 3VSYA 2YFJB 2STDA 1W02A 4HJLB 4X2HA 2RCDA 4WWUC 1SJWA 3NV0A 3DXOA 4HM0B 3FGYA 3JUMA 3G8ZA 3UNLA 4XM4A 1JB4A 1EA2A 1JB2A 1ULIB 1OF5A 1OHPA 2INXA 1GY6A 2JQ5A 3A76A 7STDA 2Z76A 3NHXA 1VZZA 3CNXA 4N3VA 5CK6A 1IDPA 3FF2A 2F98A 1UUVB 3D9RA 5IERA 1STDA 4L7KA 4MJDA 4XDVA 2R4IA 3T8NA 1AR0A 3F7SA 1O7WB 3SOYA 3EC9A 3G16A 2I9WA 1QMAA 1O7NB 3NBRA 3STDA 2XSOB 3OV4A 5AEUB 2GBWB 2OWPA 5KP1A 4J9AA 1OHSA 1DMNA 2IMJA 4XBYA 5BXQA 5EVHA 1Z1SA 4RZMA 4KVHA 3SOAA 2K54A 2XRXB 4LEHA 5IEOA 1TUHA 2A15A 3F14A 2YFIB 1TP6A 3B4OA 3FF0A 1U5OA 3IPTA 4HM5B 4STDA 4WYKA 5CF2A 3F8XA 1O7GB 5AIFA 4LMIA 4ORLA 3RGRA 3JUPA 3DM8A 3LYGA 3MG3A 3KSPA 4HM8B 4XBTA 3DMCA 2B24B 4H3UA 5KP4A 1JKGA 3EJVA 1O7PB 1JKGB 3UJMA 5STDA 3S5CA 2HMMB 3EQQB 3NV0B 4R9LA 3NUVA 3MG1A 4FCMA 4HM2B 2B1XB 3FKAA 1OPYA 2CHCA 4WYKB 4I4KA 4XBXA 5D82A 5HGRA 4HZ9B 3H51A 3HK4A 5CXOA 3CPOA 1HKXA 2XSHB 3MSOA 3FZWA 4HM7B 2QIYA 3HZPA 3MG2A 6STDA 3JUOA 5IG4A 3ROBA 3KE7A 2Z77A 3F40A 1GS3A 3EX9A 3EN8A 4WP5A 4HZBB 5DREA 1ISKA 4XB5A 5G2GA 1W00A 1OUNA 4K1VA 1OH0A 1OHOA 3WMDA 1Q40B 4PEJA 3K7CA 3Q90A 5D83A 1O7MB 5IG0A 3FLJA 4R1KA 2HMLB 4L8OA 5AIHA 5JPPA 2HMNB 3OWUA 1GY7A 4K1UA 3T8UA 5JPUA 3DZLA 5CF1A 3EBTA 5TGNA 2F99A 1JN5A 2HMKB 1W6YA 1C7HA 3RGAA 3VGNA 8CHOA 2RGQA 4HM4B 5D81A 3CU3A 1ASKA 4CDLA 1GY5A 3OWYA 4XDWA 3BB9A 2RFRA 3EBYA 3ECFA 1OCVA 1O7HB 3EHCA 3GZYB 3HX8A 5FW5A 3BLZA 4GB5A 3MYTA 1OGZA 3EF8A 4OVMA 5AIGA 3OXAA 1E3VA 2CKFB 4HM1B 3JUQA 1E97A 2QGUA 2HMJB 1OF5B 4U13A 3GZBA 3FH1A 1DMQA 1DMMA 3F7XA 3I0YA 3JUNA 3KZTA 3MKIA 1W01A 4HM3B 4J8TA 1ZO2A 3G0KA 3OWSA 4FCJA 3NM2A 3KKGA 1E3RA 3CNMA 3GZRA 3MHEA 5IENA 3NXJA 5BVBA 4OUQA 1JN5B 2PZVA 3EN1B 3M8CA 3B8LA 2BMQB 2HMOB 4HKVB 4Q53A 2Z7AA 1BUQA 5IF6A 5DRVA 2GBXB 1QJGA 2GEXA 2BNGA 1NDOB 3DUKA 1CQSA 3FSDA 4HVNA 5KP3A 3B4PA 3ER7A 4R9KA 1NWWA 3F9SA 5CLKA 3GRDA 3GZXB 1A2KA 1Q40A 1ULJB 2UX0A 3H3HA 3K0ZA 4X2OA 2BMOB 1WQLB 1EG9B 5AIIA 3SEDA 5AEWB 1GYBA 1NU3A 2F86B
chains in the Genus database with same CATH superfamily
1CYUA 2CWTA 3SYUA 3F8HA 1OGXA 2KXGA 3S29A 1PY3A 2P09A 1BGSA 3B7CA 3O8YA 4K61A 4WFOA 1DVDA 3CCL3 3DGYA 1LOWA 3ZFZA 2XH9A 1W4NA 2YFLB 4G1MB 4HM6B 1B20A 3CMA3 2J8XB 4H61A 4N6MA 3N54B 1SJWA 1RSNA 5AYSC 2F5MA 2RSXA 1LNIA 4HM0B 2XF3A 1QAKA 3ECFA 3A76A 2INXA 1T3BA 2Q07A 1MWSA 3NHXA 3DGLA 1VZZA 1UCKA 5G1KA 1ZS7A 3BIRA 2CWVA 2GU3A 1D6ZA 4L7KA 2OQEA 3D79A 1MNLA 4MJDA 4BTYA 1Q814 1AR0A 1K734 4JRFA 4O3VA 3G16A 5AEUB 1QMAA 1O7NB 1W5ZA 2OWPA 4J9AA 1DMNA 2IMJA 4XBYA 5BXQA 1MWTA 4RZMA 1BNFA 4EW5A 3I553 1A2VA 2CFGA 4KFDA 4LEHA 4QWTA 3F14A 2O9UX 1X1XA 2YFIB 3B4OA 1U5OA 3CCM3 3F8XA 1O7GB 3RGRA 3X3XA 3MG3A 3LYGA 2ZHXB 2SBLA 2B24B 3WR2A 1UW1A 2C11A 4AKZA 1KWIA 3J7Yd 1W6CA 1JKGB 1GOYA 1Y4KA 2V1LA 3EQQB 1MOLA 3LOYA 4RNYA 1RCLA 3CME3 4I4KA 4HZ9B 1ROVA 1GMPA 3HK4A 3NBBA 1M1XB 4WHAA 2CG0A 1IK3A 4HM7B 4IPBA 3EX9A 1UDII 3HI7A 4ZM8A 3LT9A 1D6UA 2H0IA 2Y73A 4HYZA 1VQQA 1IQYA 2RNTA 3Q3FA 1OH0A 2CX1A 1T5YA 1OHOA 4K1VA 1K8A4 4FMDA 3BNCA 5D83A 3Q90A 1VQ43 3AHWA 4O8SA 3LTBA 3FLJA 4L8OA 5AIHA 2IA7A 1I3FA 3DZLA 1LQMB 1QVF2 1W7CA 2F99A 2HMKB 3BNEA 1BSDA 3VGNA 5D81A 1RGFA 4EXRA 1ASKA 4CDLA 2W9PA 3OWYA 4XDWA 1RRLA 3EBYA 1RGLA 4GSPA 3BLZA 2H0GA 3CC23 1BSEA 1RMSA 4O2HA 1JJ22 3JUQA 2QGUA 3CC73 5HOHA 3FH1A 1DETA 1DMQA 1DMMA 3G6E3 1W2ZA 4J8TA 4MMYB 1LOVA 1OACA 1YGWA 3KKGA 1E3RA 3KFQC 3I563 1HU9A 4N6NB 3NXJA 5BVBA 1JN5B 2D42A 3JVCA 5AYRB 3B8LA 1MGWA 8RNTA 1A67A 2QA43 2BNGA 1SIIA 3DUKA 3TDGA 1NNVA 1S723 3B4PA 3CCU3 1AY7A 3ER7A 4R9KA 3GRDA 1DE3A 3H3HA 3WOEB 3OW22 1T2HA 2CK3H 3X3YA 2KF4A 2BHMA 3D4AA 4TX4A 2CFWA 4R80A 4IIAA 1I2EA 4GHOA 3LZAA 2LYXA 1VQ73 5AI1A 5I97A 2W2CA 2ZA4A 1ZX2A 2YX9A 3E99A 2GXFA 2IY2A 3GWRA 3T0UA 1RKYA 2F4YA 1K41A 2GEYA 3HOHA 1BRKA 2KAAA 3X41A 1QALA 4EV2A 4LZIA 2JDIH 1TJDA 3NV0A 3DXOA 1I0XA 3DGOA 4BTWA 3G8ZA 3UNLA 4HM8B 1B21A 1JB2A 3Q2PA 1OF5A 7RNTA 4MEIA 2OCTA 2FXTA 2Z76A 1QAFA 3DH2A 3CCR3 1G02A 1JBRA 5GSPA 4DKIA 2F98A 5IERA 1JZDA 1Q7Y4 3T8NA 1B2UA 1IV7A 3EB8A 1O7WB 3LMLA 1LNHA 1YJ93 1UGHI 1HZ1A 2BIRA 1BRNL 1IT8A 3CCE3 4IT7A 5KP1A 1JRQA 1OHSA 1VQO3 1LRAA 1RGEA 1DVCA 2K3DA 1AVKA 2O3OA 3K5TA 3SOAA 2K54A 6GSPA 4ILFA 1TUHA 3IPTA 1GOUA 1BRHA 4BTXA 3NX0A 4WYKA 3CCV3 6RNTA 2OQEC 1Q864 2ZL8A 3DY5A 1FUSA 2WOFA 3DMCA 1PYLA 1BIRA 2XGLA 4H3UA 5KP4A 5RNTA 1O7PB 1KC84 5STDA 2F56A 1V57A 2W0QA 4OK0A 5EQLA 1BRSA 3NUVA 2CFKA 2CFLA 3FKAA 4XBXA 5D82A 4WYKB 1UCLA 3BU4A 4GL6A 1YNVX 2KCDA 5CXOA 2OTJ3 3V92A 1D6YA 2E2UA 5IG4A 1IU7A 2ML5A 1R4YA 3JUOA 2MC8A 1YIJ3 3KIIA 4R4KA 5DREA 1N9JA 3CCQ3 4RNZA 2K0MA 1SQWA 1DYUA 4PEJA 3K7CA 2KF3A 1O7MB 1WMPA 1N9EA 1RTUA 2HMNB 5BU4A 4N6OB 1BOXA 4K1UA 1W2B2 5IW9A 2W9QA 2ZDJA 1BSAA 3ZG0A 1JN5A 3ALAA 1W6YA 4O02B 1TU5A 2RGQA 1JZOA 1FUTA 3D5IA 3RNTA 3BB9A 4HBRA 1OCVA 3GZYB 3HX8A 2IUJA 1N8QA 2E2VA 2Z6BA 1RDSA 3MYTA 1OGZA 4GB5A 5AIGA 3OXAA 1E3VA 2CKFB 3NM7A 2W04A 1V58A 1W6GA 5JBSA 3BNDA 4HM3B 3I0YA 3F7XA 3SEDA 3JUNA 4AEQA 1W01A 1A2PA 3PYJA 3OWSA 3G0KA 4FCJA 3SLUA 3MHEA 1BNSA 1X1YA 3GZRA 1AV4A 3CCJ3 1R4CA 3LTCA 2BMQB 4Q53A 3AGOA 5IF6A 2C4BA 2GBXB 1QJGA 2GEXA 5DRVA 5G1LA 4HVNA 5KP3A 2M7OA 3G713 1X1WA 3GZXB 4X2OA 3LH4A 3K0ZA 2QEX3 1KD14 1EG9B 1MGRA 1AQZA 1GYBA 1I3IA 2F86B 2OOVC 1UUWB 3WA2X 3UB1A 2BMRB 3X3ZA 4MMZB 1G0TA 1I70A 4LGQA 1VQP3 2AAEA 1U8CB 5IG3A 1SIHA 1LXEA 1TRQA 1EUIC 1M1K4 5IG5A 2L1SA 1CEWI 2YFJB 4HJLB 1GD4A 4X2HA 1QVG2 2RCDA 1VQ83 1UI7A 3KCHA 1RGGA 4FR9A 1UCIA 1MWRA 3JUMA 4XM4A 1JBTA 1I2FA 1WTHA 1OHPA 1CYVA 1GY6A 2JQ5A 7STDA 1LOYA 3CNXA 3S28A 1RGKA 1IDPA 3FF2A 1RGAA 1UUVB 1PU4A 3D9RA 1BRJA 1STDA 3FG1A 2GSPA 3F7SA 3SOYA 3EC9A 1N5PA 4FMAA 2I9WA 3NBRA 2XSOB 3OV4A 5BIRA 2GBWB 2UGIA 5LC7A 1TRPA 1BNRA 1L5GB 1Z1SA 1UCJA 4KVHA 1NO3A 3SX1A 4BIRA 3DGNA 4BU4A 2LQVA 1EKMA 2A15A 2W03A 1TP6A 3NQZA 4HM5B 4STDA 5CF2A 3D3LA 4N6V0 4LMIA 1UGIA 2BT3A 2WGQA 3JUPA 3U1WA 1JKGA 2CWUA 3EJVA 3UJMA 2HMMB 1CH0A 3NV0B 4R9LA 3SXXA 3CPW2 4HM2B 1EEJA 2B1XB 1J2BA 3U97A 1YJW3 2CX0A 3LTAA 1WMNA 3CPOA 4KT3B 1HKXA 1WMOA 3K63A 3MSOA 3FZWA 1IV9A 2QIYA 3HZPA 3SVAA 6STDA 1BUJA 1K9M4 3KE7A 2Z77A 1GS3A 2KRTA 3EN8A 4WP5A 1RRHA 4CCVA 4N6LA 3N9HA 5M19A 5A0OB 3UL5A 3K9MC 1TIJA 4FCZA 2HOHA 1NB3I 1VQ63 1Q40B 1BRGA 5IG0A 3PZWA 4EV5A 2IUKA 3URPA 5JPPA 1TFKA 1BANA 1BNEA 2MF7A 7GSPA 3RGAA 8CHOA 1C7HA 2CH9A 4HM4B 3CU3A 3DGMA 1GY5A 4J5KA 1F8NA 1VQK3 1N5HA 3FCSB 1GOVA 3QRDA 3V99A 1C54A 1RCKA 2C10A 3EF8A 9RNTA 2CIUA 1N8R4 1FYSA 4HM1B 1KSIA 2BO9B 1OF5B 1IQ8A 2L4VA 1BSCA 3GZBA 4WWUC 4BL3A 1B27A 3UL6A 1HYFA 2OTL3 2P0MA 5IENA 1FA3A 1FW7A 3NBJA 1FGQA 4RBNA 2RBIA 3EN1B 3M8CA 3MWZA 1A90A 1BUQA 2HMOB 4FMBA 4LYLB 1Q9EA 1RGCA 1VQ93 1ZGXA 1RNBA 2BMOB 1WQLB 4JF8A 4KFEA 1NB5I 1I2GA 4RNTA 4CJNA 2OOVA 1BNIA 1JB5A 4L8PA 5IEPA 1I8VA 3AMOB 1IVWA 1STFI 4J5GA 4NPBA 3QK9A 2PNCA 2FGTA 3FG4A 4LSOA 2CW9A 3CXC2 4BL2A 3OX9A 2XR8B 1S5AA 3WHOA 2W6JH 4EBGA 1Q42A 4FMCA 3VSYA 3EE1A 3CCS3 2STDA 1W02A 1YVBI 3BNBA 5ELUA 1FGOA 1UI8A 1YIT3 1AVLA 2XFSA 3FGYA 4N6UA 2W56B 2Y74A 3AHSA 1JB4A 1EA2A 2IYJA 1ULIB 1VQL3 1NJI4 1FGRA 2WO0A 1RNTA 1KQS2 4N6TA 2P0XA 1WNHA 4N3VA 5CK6A 1BU4A 1BVIA 1BSBA 2ML6A 5M1AA 1YI23 3MPHA 2XEPA 2R4IA 4XDVA 1FUWA 1VQ53 3FG3A 4CPKA 3RDEA 1LVNA 2W56A 3STDA 3LT8A 2CFDA 4K90B 2D1WA 3D5GA 1IQXA 1B2ZA 3WDGB 3IMAB 4MMXB 3PGBA 3PCRA 4HAAA 1JV2B 5EVHA 2GU1A 2XRXB 5IEOA 2BU4A 1B3SA 1I0VA 3WMDA 3FF0A 1K28A 3NQYA 2UUGC 5AIFA 1RHLA 1GMRA 4ORLA 1BNJA 3DM8A 4XBTA 3KSPA 4AKYA 2R41A 1ROAA 3AMOA 3V98A 2KF6A 4EYCA 4FCMA 3MG1A 5FGOA 1G96A 5M18A 1OPYA 2CHCA 2XGNA 3KSED 5HGRA 3WA3A 2P05A 3H51A 1JNQA 4NHFA 1B2XA 3Q1CA 3G4S3 1IVUA 1RJOA 2XSHB 3N8BA 1X1UA 1RN7A 2WGOA 3AGNA 3L0RA 3MG2A 1RGHA 5ELJA 1RN4A 3ROBA 2H0HA 3F40A 3GAXA 1IVXA 4HZBB 1ISKA 4XB5A 1IVVA 1GMQA 3LTDA 4KFFA 1W00A 5G2GA 1VQN3 1OUNA 1T2IA 1US1A 3CD63 1FZUA 3S27A 1SARA 1TFOA 2AADA 1FGMA 1LQGC 1PFPA 4EC6A 1YJN3 4R1KA 2HMLB 1RLSA 3CC43 3OWUA 1GY7A 3T8UA 2SARA 5JPUA 1UUGB 5CF1A 3EBTA 1LOXA 5TGNA 2FNQA 2CC3A 3IJEB 1B2SA 3WOFB 1M9GA 5EEOA 1BRIA 3HIGA 3KN4A 1JBSA 2RFRA 5LC6A 3PCSA 3EHCA 1YHQ3 1O7HB 1TTOA 1IT7A 1GD3A 5FW5A 3A5EA 3X42A 4OVMA 4KZ1A 1M904 2F5WA 1IYYA 2CG1A 1Q824 1E97A 1BAOA 2HMJB 2XFTA 4U13A 4HOHA 3MKIA 3ZG5A 3KZTA 3S67A 1V74A 1ZO2A 3NM2A 1EQKA 1SPUA 3PXMA 3CNMA 1YGEA 1Q7HA 4NREA 4OUQA 3X40A 1GSPA 1FGTA 2PZVA 1VQM3 3GSPA 4HKVB 2P38A 2Z7AA 1B2MA 3PS8A 3FSDA 1NDOB 1YVSA 1CQSA 3VF1A 4I5QA 1MWUA 1RN1A 3WODG 1NWWA 3F9SA 5CLKA 3LXUX 1A2KA 1Q40A 1ULJB 2UX0A 5AIIA 5AEWB 3HIIA 3S5CA 2E2TA 2WOHA 1BNGA 1NU3A 2KF5A
chains in the Genus database with same CATH topology
1CYUA 2CWTA 3F8HA 1OGXA 2KXGA 3S29A 2P09A 4K61A 3B7CA 3O8YA 4WFOA 1DVDA 3CCL3 2XH9A 1W4NA 2YFLB 4G1MB 4HM6B 3CMA3 4H61A 4N6MA 3N54B 1SJWA 5AYSC 2RSXA 4HM0B 2XF3A 1QAKA 3ECFA 3A76A 2INXA 2Q07A 3NHXA 3DGLA 1VZZA 2CWVA 2GU3A 1D6ZA 4L7KA 2OQEA 4MJDA 1MNLA 4BTYA 1Q814 1K734 1AR0A 4JRFA 4O3VA 3G16A 5AEUB 1QMAA 1O7NB 1W5ZA 2OWPA 4J9AA 1DMNA 2IMJA 4XBYA 5BXQA 4RZMA 3I553 1A2VA 2CFGA 4KFDA 4LEHA 4QWTA 3F14A 2O9UX 2YFIB 3B4OA 1U5OA 3CCM3 3F8XA 1O7GB 3RGRA 3X3XA 3MG3A 3LYGA 2SBLA 2B24B 1UW1A 2C11A 4AKZA 1KWIA 3J7Yd 1W6CA 1JKGB 1Y4KA 2V1LA 3EQQB 1MOLA 3LOYA 4RNYA 3CME3 4I4KA 4HZ9B 1ROVA 3HK4A 3NBBA 4WHAA 1M1XB 2CG0A 1IK3A 4HM7B 4IPBA 3EX9A 3HI7A 4ZM8A 3LT9A 1D6UA 4HYZA 2Y73A 1IQYA 4K1VA 1OH0A 1T5YA 1OHOA 1K8A4 4FMDA 3BNCA 5D83A 3Q90A 1VQ43 4O8SA 3LTBA 3FLJA 4L8OA 5AIHA 2IA7A 3DZLA 1QVF2 1W7CA 2F99A 2HMKB 3BNEA 3VGNA 5D81A 4EXRA 1ASKA 4CDLA 2W9PA 3OWYA 4XDWA 1RRLA 3EBYA 3BLZA 3CC23 4O2HA 1JJ22 3JUQA 2QGUA 3CC73 3FH1A 1DMQA 1DMMA 3G6E3 1W2ZA 4J8TA 4MMYB 1OACA 3KKGA 1E3RA 3KFQC 3I563 1HU9A 4N6NB 3NXJA 5BVBA 1JN5B 2D42A 3JVCA 5AYRB 3B8LA 1A67A 2QA43 2BNGA 1SIIA 3DUKA 3TDGA 1S723 3B4PA 3CCU3 3ER7A 4R9KA 3GRDA 3H3HA 3WOEB 3OW22 2CK3H 3X3YA 4TX4A 2BHMA 2CFWA 4R80A 4IIAA 3LZAA 2LYXA 1VQ73 5AI1A 5I97A 2W2CA 1ZX2A 2YX9A 3E99A 2GXFA 3GWRA 3T0UA 1RKYA 1K41A 2GEYA 3X41A 4EV2A 1QALA 4LZIA 2JDIH 3NV0A 3DXOA 4BTWA 3DGOA 3G8ZA 3UNLA 4HM8B 1JB2A 3Q2PA 1OF5A 4MEIA 2OCTA 2FXTA 2Z76A 1QAFA 3CCR3 2F98A 5IERA 1Q7Y4 3T8NA 1IV7A 3EB8A 1O7WB 3LMLA 1LNHA 1YJ93 1IT8A 3CCE3 4IT7A 5KP1A 1JRQA 1OHSA 1VQO3 1DVCA 2O3OA 1AVKA 3K5TA 3SOAA 2K54A 1TUHA 3IPTA 4BTXA 3NX0A 4WYKA 3CCV3 2OQEC 1Q864 2ZL8A 3DY5A 3DMCA 2WOFA 2XGLA 4H3UA 5KP4A 1KC84 1O7PB 5STDA 4OK0A 2W0QA 5EQLA 3NUVA 2CFKA 2CFLA 3FKAA 4XBXA 5D82A 4WYKB 5CXOA 4GL6A 2KCDA 2OTJ3 3V92A 1D6YA 2E2UA 5IG4A 1IU7A 2ML5A 3JUOA 2MC8A 1YIJ3 3KIIA 4R4KA 5DREA 1N9JA 3CCQ3 4RNZA 2K0MA 1SQWA 1DYUA 4PEJA 3K7CA 1O7MB 1WMPA 1N9EA 2HMNB 4N6OB 4K1UA 1W2B2 5IW9A 2W9QA 2ZDJA 1JN5A 3ALAA 1W6YA 4O02B 1TU5A 2RGQA 3BB9A 4HBRA 1OCVA 3GZYB 3HX8A 2IUJA 1N8QA 2E2VA 2Z6BA 4GB5A 3MYTA 1OGZA 5AIGA 3OXAA 1E3VA 2CKFB 3NM7A 2W04A 1W6GA 5JBSA 3BNDA 4HM3B 3I0YA 3F7XA 3SEDA 3JUNA 4AEQA 1W01A 3PYJA 3OWSA 3G0KA 4FCJA 3SLUA 3MHEA 3GZRA 1AV4A 3CCJ3 1R4CA 3LTCA 2BMQB 4Q53A 5IF6A 5DRVA 2GBXB 1QJGA 2GEXA 4HVNA 5KP3A 2M7OA 3G713 3GZXB 4X2OA 3LH4A 3K0ZA 2QEX3 1KD14 1EG9B 1GYBA 2F86B 2OOVC 1UUWB 3WA2X 3UB1A 2BMRB 3X3ZA 4MMZB 4LGQA 1VQP3 1U8CB 5IG3A 1SIHA 1LXEA 1M1K4 5IG5A 1CEWI 2YFJB 4HJLB 1GD4A 4X2HA 1QVG2 2RCDA 1VQ83 1UI7A 4FR9A 3JUMA 4XM4A 1WTHA 2JQ5A 1OHPA 1CYVA 1GY6A 7STDA 3CNXA 3S28A 1PU4A 1IDPA 3FF2A 1UUVB 3D9RA 3FG1A 1STDA 3F7SA 3SOYA 3EC9A 1N5PA 4FMAA 2I9WA 3NBRA 2XSOB 3OV4A 2GBWB 5LC7A 1L5GB 1Z1SA 4KVHA 1NO3A 3SX1A 3DGNA 2LQVA 1EKMA 2A15A 2W03A 1TP6A 3NQZA 4HM5B 4STDA 5CF2A 3D3LA 4N6V0 4LMIA 2BT3A 2WGQA 3JUPA 3U1WA 1JKGA 2CWUA 3EJVA 3UJMA 2HMMB 4R9LA 3NV0B 3CPW2 4HM2B 2B1XB 1J2BA 3U97A 1YJW3 3LTAA 1WMNA 3CPOA 1HKXA 1WMOA 3K63A 3MSOA 3FZWA 1IV9A 2QIYA 3HZPA 3SVAA 6STDA 1K9M4 3KE7A 2Z77A 1GS3A 2KRTA 3EN8A 4WP5A 1RRHA 4CCVA 4N6LA 3N9HA 5A0OB 3UL5A 3K9MC 1TIJA 4FCZA 1VQ63 1NB3I 1Q40B 5IG0A 3PZWA 4EV5A 2IUKA 5JPPA 1TFKA 2MF7A 3RGAA 8CHOA 1C7HA 2CH9A 4HM4B 3CU3A 3DGMA 1GY5A 1F8NA 1VQK3 1N5HA 3FCSB 3QRDA 3V99A 2C10A 3EF8A 2CIUA 1N8R4 4HM1B 1KSIA 2BO9B 1OF5B 1IQ8A 2L4VA 3GZBA 4WWUC 3UL6A 2OTL3 2P0MA 5IENA 1FA3A 3NBJA 1FGQA 4RBNA 3MWZA 3EN1B 3M8CA 1A90A 1BUQA 2HMOB 4FMBA 1VQ93 2BMOB 1WQLB 4JF8A 4KFEA 1NB5I 2OOVA 1JB5A 4L8PA 5IEPA 3AMOB 1IVWA 1STFI 3QK9A 2PNCA 2FGTA 3FG4A 4LSOA 2CW9A 3CXC2 3OX9A 2XR8B 1S5AA 2W6JH 4EBGA 1Q42A 4FMCA 3VSYA 3EE1A 3CCS3 2STDA 1W02A 1YVBI 3BNBA 5ELUA 1FGOA 1UI8A 1YIT3 1AVLA 2XFSA 3FGYA 4N6UA 2W56B 2Y74A 1VQL3 1JB4A 1EA2A 1ULIB 1NJI4 1FGRA 2WO0A 1KQS2 4N6TA 2P0XA 1WNHA 4N3VA 5CK6A 1YI23 2ML6A 3MPHA 2XEPA 2R4IA 4XDVA 1FUWA 1VQ53 3FG3A 3RDEA 1LVNA 2W56A 3STDA 3LT8A 2CFDA 4K90B 2D1WA 1IQXA 3WDGB 3IMAB 4MMXB 3PGBA 3PCRA 1JV2B 5EVHA 2GU1A 2XRXB 5IEOA 3WMDA 3FF0A 1K28A 3NQYA 5AIFA 4ORLA 3DM8A 4XBTA 3KSPA 4AKYA 1ROAA 3AMOA 3V98A 4EYCA 4FCMA 3MG1A 5FGOA 1G96A 1OPYA 2CHCA 2XGNA 3KSED 5HGRA 3WA3A 2P05A 3H51A 1JNQA 4NHFA 3Q1CA 3G4S3 1IVUA 1RJOA 2XSHB 3N8BA 5ELJA 1RN7A 2WGOA 3L0RA 3MG2A 3SXXA 3ROBA 3F40A 3GAXA 1IVXA 4HZBB 1ISKA 4XB5A 1IVVA 3LTDA 4KFFA 1W00A 5G2GA 1VQN3 1OUNA 1US1A 3CD63 3S27A 1TFOA 1FGMA 1PFPA 4EC6A 1YJN3 4R1KA 2HMLB 3CC43 3OWUA 1GY7A 3T8UA 5JPUA 5CF1A 3EBTA 1LOXA 5TGNA 2FNQA 2CC3A 3IJEB 3WOFB 1M9GA 5EEOA 3HIGA 3KN4A 2RFRA 5LC6A 3PCSA 3EHCA 1YHQ3 1O7HB 1IT7A 1GD3A 5FW5A 3X42A 4OVMA 4KZ1A 1M904 2CG1A 1Q824 1E97A 2HMJB 2XFTA 4U13A 3MKIA 3KZTA 3S67A 1V74A 1ZO2A 3NM2A 1EQKA 1SPUA 3PXMA 3CNMA 1YGEA 4NREA 4OUQA 3X40A 2PZVA 1FGTA 1VQM3 4HKVB 2P38A 2Z7AA 3PS8A 3FSDA 1NDOB 1CQSA 3VF1A 3WODG 1NWWA 3F9SA 5CLKA 3LXUX 1A2KA 1Q40A 1ULJB 2UX0A 5AIIA 5AEWB 3HIIA 3S5CA 2E2TA 2WOHA 1NU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB5 A;  1UUW B;  2BMR B;  1OGX A;  3F8H A;  4IIA A;  4L8P A;  5IEP A;  3LZA A;  4LGQ A;  3B7C A;  5AI1 A;  5IG3 A;  2W2C A;  1ZX2 A;  3E99 A;  3GWR A;  2GXF A;  3OX9 A;  2XR8 B;  1K41 A;  1S5A A;  2GEY A;  2YFL B;  5IG5 A;  4HM6 B;  1Q42 A;  3VSY A;  2YFJ B;  2STD A;  1W02 A;  4HJL B;  4X2H A;  2RCD A;  4WWU C;  1SJW A;  3NV0 A;  3DXO A;  4HM0 B;  3FGY A;  3JUM A;  3G8Z A;  3UNL A;  4XM4 A;  1JB4 A;  1EA2 A;  1JB2 A;  1ULI B;  1OF5 A;  1OHP A;  2INX A;  1GY6 A;  2JQ5 A;  3A76 A;  7STD A;  2Z76 A;  3NHX A;  1VZZ A;  3CNX A;  4N3V A;  5CK6 A;  1IDP A;  3FF2 A;  2F98 A;  1UUV B;  3D9R A;  5IER A;  1STD A;  4L7K A;  4MJD A;  4XDV A;  2R4I A;  3T8N A;  1AR0 A;  3F7S A;  1O7W B;  3SOY A;  3EC9 A;  3G16 A;  2I9W A;  1QMA A;  1O7N B;  3NBR A;  3STD A;  2XSO B;  3OV4 A;  5AEU B;  2GBW B;  2OWP A;  5KP1 A;  4J9A A;  1OHS A;  1DMN A;  2IMJ A;  4XBY A;  5BXQ A;  5EVH A;  1Z1S A;  4RZM A;  4KVH A;  3SOA A;  2K54 A;  2XRX B;  4LEH A;  5IEO A;  1TUH A;  2A15 A;  3F14 A;  2YFI B;  1TP6 A;  3B4O A;  3FF0 A;  1U5O A;  3IPT A;  4HM5 B;  4STD A;  4WYK A;  5CF2 A;  3F8X A;  1O7G B;  5AIF A;  4LMI A;  4ORL A;  3RGR A;  3JUP A;  3DM8 A;  3LYG A;  3MG3 A;  3KSP A;  4HM8 B;  4XBT A;  3DMC A;  2B24 B;  4H3U A;  5KP4 A;  1JKG A;  3EJV A;  1O7P B;  1JKG B;  3UJM A;  5STD A;  3S5C A;  2HMM B;  3EQQ B;  3NV0 B;  4R9L A;  3NUV A;  3MG1 A;  4FCM A;  4HM2 B;  2B1X B;  3FKA A;  1OPY A;  2CHC A;  4WYK B;  4I4K A;  4XBX A;  5D82 A;  5HGR A;  4HZ9 B;  3H51 A;  3HK4 A;  5CXO A;  3CPO A;  1HKX A;  2XSH B;  3MSO A;  3FZW A;  4HM7 B;  2QIY A;  3HZP A;  3MG2 A;  6STD A;  3JUO A;  5IG4 A;  3ROB A;  3KE7 A;  2Z77 A;  3F40 A;  1GS3 A;  3EX9 A;  3EN8 A;  4WP5 A;  4HZB B;  5DRE A;  1ISK A;  4XB5 A;  5G2G A;  1W00 A;  1OUN A;  4K1V A;  1OH0 A;  1OHO A;  3WMD A;  1Q40 B;  4PEJ A;  3K7C A;  3Q90 A;  5D83 A;  1O7M B;  5IG0 A;  3FLJ A;  4R1K A;  2HML B;  4L8O A;  5AIH A;  5JPP A;  2HMN B;  3OWU A;  1GY7 A;  4K1U A;  3T8U A;  5JPU A;  3DZL A;  5CF1 A;  3EBT A;  5TGN A;  2F99 A;  1JN5 A;  2HMK B;  1W6Y A;  1C7H A;  3RGA A;  3VGN A;  8CHO A;  2RGQ A;  4HM4 B;  5D81 A;  3CU3 A;  1ASK A;  4CDL A;  1GY5 A;  3OWY A;  4XDW A;  3BB9 A;  2RFR A;  3EBY A;  3ECF A;  1OCV A;  1O7H B;  3EHC A;  3GZY B;  3HX8 A;  5FW5 A;  3BLZ A;  4GB5 A;  3MYT A;  1OGZ A;  3EF8 A;  4OVM A;  5AIG A;  3OXA A;  1E3V A;  2CKF B;  4HM1 B;  3JUQ A;  1E97 A;  2QGU A;  2HMJ B;  1OF5 B;  4U13 A;  3GZB A;  3FH1 A;  1DMQ A;  1DMM A;  3F7X A;  3I0Y A;  3JUN A;  3KZT A;  3MKI A;  1W01 A;  4HM3 B;  4J8T A;  1ZO2 A;  3G0K A;  3OWS A;  4FCJ A;  3NM2 A;  3KKG A;  1E3R A;  3CNM A;  3GZR A;  3MHE A;  5IEN A;  3NXJ A;  5BVB A;  4OUQ A;  1JN5 B;  2PZV A;  3EN1 B;  3M8C A;  3B8L A;  2BMQ B;  2HMO B;  4HKV B;  4Q53 A;  2Z7A A;  1BUQ A;  5IF6 A;  5DRV A;  2GBX B;  1QJG A;  2GEX A;  2BNG A;  1NDO B;  3DUK A;  1CQS A;  3FSD A;  4HVN A;  5KP3 A;  3B4P A;  3ER7 A;  4R9K A;  1NWW A;  3F9S A;  5CLK A;  3GRD A;  3GZX B;  1A2K A;  1Q40 A;  1ULJ B;  2UX0 A;  3H3H A;  3K0Z A;  4X2O A;  2BMO B;  1WQL B;  1EG9 B;  5AII A;  3SED A;  5AEW B;  1GYB A;  1NU3 A;  2F86 B; 
#chains in the Genus database with same CATH topology
 1CYU A;  2CWT A;  3SYU A;  3F8H A;  1OGX A;  2KXG A;  3S29 A;  1PY3 A;  2P09 A;  1BGS A;  3B7C A;  3O8Y A;  4K61 A;  4WFO A;  1DVD A;  3CCL 3;  3DGY A;  1LOW A;  3ZFZ A;  2XH9 A;  1W4N A;  2YFL B;  4G1M B;  4HM6 B;  1B20 A;  3CMA 3;  2J8X B;  4H61 A;  4N6M A;  3N54 B;  1SJW A;  1RSN A;  5AYS C;  2F5M A;  2RSX A;  1LNI A;  4HM0 B;  2XF3 A;  1QAK A;  3ECF A;  3A76 A;  2INX A;  1T3B A;  2Q07 A;  1MWS A;  3NHX A;  3DGL A;  1VZZ A;  1UCK A;  5G1K A;  1ZS7 A;  3BIR A;  2CWV A;  2GU3 A;  1D6Z A;  4L7K A;  2OQE A;  3D79 A;  1MNL A;  4MJD A;  4BTY A;  1Q81 4;  1AR0 A;  1K73 4;  4JRF A;  4O3V A;  3G16 A;  5AEU B;  1QMA A;  1O7N B;  1W5Z A;  2OWP A;  4J9A A;  1DMN A;  2IMJ A;  4XBY A;  5BXQ A;  1MWT A;  4RZM A;  1BNF A;  4EW5 A;  3I55 3;  1A2V A;  2CFG A;  4KFD A;  4LEH A;  4QWT A;  3F14 A;  2O9U X;  1X1X A;  2YFI B;  3B4O A;  1U5O A;  3CCM 3;  3F8X A;  1O7G B;  3RGR A;  3X3X A;  3MG3 A;  3LYG A;  2ZHX B;  2SBL A;  2B24 B;  3WR2 A;  1UW1 A;  2C11 A;  4AKZ A;  1KWI A;  3J7Y d;  1W6C A;  1JKG B;  1GOY A;  1Y4K A;  2V1L A;  3EQQ B;  1MOL A;  3LOY A;  4RNY A;  1RCL A;  3CME 3;  4I4K A;  4HZ9 B;  1ROV A;  1GMP A;  3HK4 A;  3NBB A;  1M1X B;  4WHA A;  2CG0 A;  1IK3 A;  4HM7 B;  4IPB A;  3EX9 A;  1UDI I;  3HI7 A;  4ZM8 A;  3LT9 A;  1D6U A;  2H0I A;  2Y73 A;  4HYZ A;  1VQQ A;  1IQY A;  2RNT A;  3Q3F A;  1OH0 A;  2CX1 A;  1T5Y A;  1OHO A;  4K1V A;  1K8A 4;  4FMD A;  3BNC A;  5D83 A;  3Q90 A;  1VQ4 3;  3AHW A;  4O8S A;  3LTB A;  3FLJ A;  4L8O A;  5AIH A;  2IA7 A;  1I3F A;  3DZL A;  1LQM B;  1QVF 2;  1W7C A;  2F99 A;  2HMK B;  3BNE A;  1BSD A;  3VGN A;  5D81 A;  1RGF A;  4EXR A;  1ASK A;  4CDL A;  2W9P A;  3OWY A;  4XDW A;  1RRL A;  3EBY A;  1RGL A;  4GSP A;  3BLZ A;  2H0G A;  3CC2 3;  1BSE A;  1RMS A;  4O2H A;  1JJ2 2;  3JUQ A;  2QGU A;  3CC7 3;  5HOH A;  3FH1 A;  1DET A;  1DMQ A;  1DMM A;  3G6E 3;  1W2Z A;  4J8T A;  4MMY B;  1LOV A;  1OAC A;  1YGW A;  3KKG A;  1E3R A;  3KFQ C;  3I56 3;  1HU9 A;  4N6N B;  3NXJ A;  5BVB A;  1JN5 B;  2D42 A;  3JVC A;  5AYR B;  3B8L A;  1MGW A;  8RNT A;  1A67 A;  2QA4 3;  2BNG A;  1SII A;  3DUK A;  3TDG A;  1NNV A;  1S72 3;  3B4P A;  3CCU 3;  1AY7 A;  3ER7 A;  4R9K A;  3GRD A;  1DE3 A;  3H3H A;  3WOE B;  3OW2 2;  1T2H A;  2CK3 H;  3X3Y A;  2KF4 A;  2BHM A;  3D4A A;  4TX4 A;  2CFW A;  4R80 A;  4IIA A;  1I2E A;  4GHO A;  3LZA A;  2LYX A;  1VQ7 3;  5AI1 A;  5I97 A;  2W2C A;  2ZA4 A;  1ZX2 A;  2YX9 A;  3E99 A;  2GXF A;  2IY2 A;  3GWR A;  3T0U A;  1RKY A;  2F4Y A;  1K41 A;  2GEY A;  3HOH A;  1BRK A;  2KAA A;  3X41 A;  1QAL A;  4EV2 A;  4LZI A;  2JDI H;  1TJD A;  3NV0 A;  3DXO A;  1I0X A;  3DGO A;  4BTW A;  3G8Z A;  3UNL A;  4HM8 B;  1B21 A;  1JB2 A;  3Q2P A;  1OF5 A;  7RNT A;  4MEI A;  2OCT A;  2FXT A;  2Z76 A;  1QAF A;  3DH2 A;  3CCR 3;  1G02 A;  1JBR A;  5GSP A;  4DKI A;  2F98 A;  5IER A;  1JZD A;  1Q7Y 4;  3T8N A;  1B2U A;  1IV7 A;  3EB8 A;  1O7W B;  3LML A;  1LNH A;  1YJ9 3;  1UGH I;  1HZ1 A;  2BIR A;  1BRN L;  1IT8 A;  3CCE 3;  4IT7 A;  5KP1 A;  1JRQ A;  1OHS A;  1VQO 3;  1LRA A;  1RGE A;  1DVC A;  2K3D A;  1AVK A;  2O3O A;  3K5T A;  3SOA A;  2K54 A;  6GSP A;  4ILF A;  1TUH A;  3IPT A;  1GOU A;  1BRH A;  4BTX A;  3NX0 A;  4WYK A;  3CCV 3;  6RNT A;  2OQE C;  1Q86 4;  2ZL8 A;  3DY5 A;  1FUS A;  2WOF A;  3DMC A;  1PYL A;  1BIR A;  2XGL A;  4H3U A;  5KP4 A;  5RNT A;  1O7P B;  1KC8 4;  5STD A;  2F56 A;  1V57 A;  2W0Q A;  4OK0 A;  5EQL A;  1BRS A;  3NUV A;  2CFK A;  2CFL A;  3FKA A;  4XBX A;  5D82 A;  4WYK B;  1UCL A;  3BU4 A;  4GL6 A;  1YNV X;  2KCD A;  5CXO A;  2OTJ 3;  3V92 A;  1D6Y A;  2E2U A;  5IG4 A;  1IU7 A;  2ML5 A;  1R4Y A;  3JUO A;  2MC8 A;  1YIJ 3;  3KII A;  4R4K A;  5DRE A;  1N9J A;  3CCQ 3;  4RNZ A;  2K0M A;  1SQW A;  1DYU A;  4PEJ A;  3K7C A;  2KF3 A;  1O7M B;  1WMP A;  1N9E A;  1RTU A;  2HMN B;  5BU4 A;  4N6O B;  1BOX A;  4K1U A;  1W2B 2;  5IW9 A;  2W9Q A;  2ZDJ A;  1BSA A;  3ZG0 A;  1JN5 A;  3ALA A;  1W6Y A;  4O02 B;  1TU5 A;  2RGQ A;  1JZO A;  1FUT A;  3D5I A;  3RNT A;  3BB9 A;  4HBR A;  1OCV A;  3GZY B;  3HX8 A;  2IUJ A;  1N8Q A;  2E2V A;  2Z6B A;  1RDS A;  3MYT A;  1OGZ A;  4GB5 A;  5AIG A;  3OXA A;  1E3V A;  2CKF B;  3NM7 A;  2W04 A;  1V58 A;  1W6G A;  5JBS A;  3BND A;  4HM3 B;  3I0Y A;  3F7X A;  3SED A;  3JUN A;  4AEQ A;  1W01 A;  1A2P A;  3PYJ A;  3OWS A;  3G0K A;  4FCJ A;  3SLU A;  3MHE A;  1BNS A;  1X1Y A;  3GZR A;  1AV4 A;  3CCJ 3;  1R4C A;  3LTC A;  2BMQ B;  4Q53 A;  3AGO A;  5IF6 A;  2C4B A;  2GBX B;  1QJG A;  2GEX A;  5DRV A;  5G1L A;  4HVN A;  5KP3 A;  2M7O A;  3G71 3;  1X1W A;  3GZX B;  4X2O A;  3LH4 A;  3K0Z A;  2QEX 3;  1KD1 4;  1EG9 B;  1MGR A;  1AQZ A;  1GYB A;  1I3I A;  2F86 B;  2OOV C;  1UUW B;  3WA2 X;  3UB1 A;  2BMR B;  3X3Z A;  4MMZ B;  1G0T A;  1I70 A;  4LGQ A;  1VQP 3;  2AAE A;  1U8C B;  5IG3 A;  1SIH A;  1LXE A;  1TRQ A;  1EUI C;  1M1K 4;  5IG5 A;  2L1S A;  1CEW I;  2YFJ B;  4HJL B;  1GD4 A;  4X2H A;  1QVG 2;  2RCD A;  1VQ8 3;  1UI7 A;  3KCH A;  1RGG A;  4FR9 A;  1UCI A;  1MWR A;  3JUM A;  4XM4 A;  1JBT A;  1I2F A;  1WTH A;  1OHP A;  1CYV A;  1GY6 A;  2JQ5 A;  7STD A;  1LOY A;  3CNX A;  3S28 A;  1RGK A;  1IDP A;  3FF2 A;  1RGA A;  1UUV B;  1PU4 A;  3D9R A;  1BRJ A;  1STD A;  3FG1 A;  2GSP A;  3F7S A;  3SOY A;  3EC9 A;  1N5P A;  4FMA A;  2I9W A;  3NBR A;  2XSO B;  3OV4 A;  5BIR A;  2GBW B;  2UGI A;  5LC7 A;  1TRP A;  1BNR A;  1L5G B;  1Z1S A;  1UCJ A;  4KVH A;  1NO3 A;  3SX1 A;  4BIR A;  3DGN A;  4BU4 A;  2LQV A;  1EKM A;  2A15 A;  2W03 A;  1TP6 A;  3NQZ A;  4HM5 B;  4STD A;  5CF2 A;  3D3L A;  4N6V 0;  4LMI A;  1UGI A;  2BT3 A;  2WGQ A;  3JUP A;  3U1W A;  1JKG A;  2CWU A;  3EJV A;  3UJM A;  2HMM B;  1CH0 A;  3NV0 B;  4R9L A;  3SXX A;  3CPW 2;  4HM2 B;  1EEJ A;  2B1X B;  1J2B A;  3U97 A;  1YJW 3;  2CX0 A;  3LTA A;  1WMN A;  3CPO A;  4KT3 B;  1HKX A;  1WMO A;  3K63 A;  3MSO A;  3FZW A;  1IV9 A;  2QIY A;  3HZP A;  3SVA A;  6STD A;  1BUJ A;  1K9M 4;  3KE7 A;  2Z77 A;  1GS3 A;  2KRT A;  3EN8 A;  4WP5 A;  1RRH A;  4CCV A;  4N6L A;  3N9H A;  5M19 A;  5A0O B;  3UL5 A;  3K9M C;  1TIJ A;  4FCZ A;  2HOH A;  1NB3 I;  1VQ6 3;  1Q40 B;  1BRG A;  5IG0 A;  3PZW A;  4EV5 A;  2IUK A;  3URP A;  5JPP A;  1TFK A;  1BAN A;  1BNE A;  2MF7 A;  7GSP A;  3RGA A;  8CHO A;  1C7H A;  2CH9 A;  4HM4 B;  3CU3 A;  3DGM A;  1GY5 A;  4J5K A;  1F8N A;  1VQK 3;  1N5H A;  3FCS B;  1GOV A;  3QRD A;  3V99 A;  1C54 A;  1RCK A;  2C10 A;  3EF8 A;  9RNT A;  2CIU A;  1N8R 4;  1FYS A;  4HM1 B;  1KSI A;  2BO9 B;  1OF5 B;  1IQ8 A;  2L4V A;  1BSC A;  3GZB A;  4WWU C;  4BL3 A;  1B27 A;  3UL6 A;  1HYF A;  2OTL 3;  2P0M A;  5IEN A;  1FA3 A;  1FW7 A;  3NBJ A;  1FGQ A;  4RBN A;  2RBI A;  3EN1 B;  3M8C A;  3MWZ A;  1A90 A;  1BUQ A;  2HMO B;  4FMB A;  4LYL B;  1Q9E A;  1RGC A;  1VQ9 3;  1ZGX A;  1RNB A;  2BMO B;  1WQL B;  4JF8 A;  4KFE A;  1NB5 I;  1I2G A;  4RNT A;  4CJN A;  2OOV A;  1BNI A;  1JB5 A;  4L8P A;  5IEP A;  1I8V A;  3AMO B;  1IVW A;  1STF I;  4J5G A;  4NPB A;  3QK9 A;  2PNC A;  2FGT A;  3FG4 A;  4LSO A;  2CW9 A;  3CXC 2;  4BL2 A;  3OX9 A;  2XR8 B;  1S5A A;  3WHO A;  2W6J H;  4EBG A;  1Q42 A;  4FMC A;  3VSY A;  3EE1 A;  3CCS 3;  2STD A;  1W02 A;  1YVB I;  3BNB A;  5ELU A;  1FGO A;  1UI8 A;  1YIT 3;  1AVL A;  2XFS A;  3FGY A;  4N6U A;  2W56 B;  2Y74 A;  3AHS A;  1JB4 A;  1EA2 A;  2IYJ A;  1ULI B;  1VQL 3;  1NJI 4;  1FGR A;  2WO0 A;  1RNT A;  1KQS 2;  4N6T A;  2P0X A;  1WNH A;  4N3V A;  5CK6 A;  1BU4 A;  1BVI A;  1BSB A;  2ML6 A;  5M1A A;  1YI2 3;  3MPH A;  2XEP A;  2R4I A;  4XDV A;  1FUW A;  1VQ5 3;  3FG3 A;  4CPK A;  3RDE A;  1LVN A;  2W56 A;  3STD A;  3LT8 A;  2CFD A;  4K90 B;  2D1W A;  3D5G A;  1IQX A;  1B2Z A;  3WDG B;  3IMA B;  4MMX B;  3PGB A;  3PCR A;  4HAA A;  1JV2 B;  5EVH A;  2GU1 A;  2XRX B;  5IEO A;  2BU4 A;  1B3S A;  1I0V A;  3WMD A;  3FF0 A;  1K28 A;  3NQY A;  2UUG C;  5AIF A;  1RHL A;  1GMR A;  4ORL A;  1BNJ A;  3DM8 A;  4XBT A;  3KSP A;  4AKY A;  2R41 A;  1ROA A;  3AMO A;  3V98 A;  2KF6 A;  4EYC A;  4FCM A;  3MG1 A;  5FGO A;  1G96 A;  5M18 A;  1OPY A;  2CHC A;  2XGN A;  3KSE D;  5HGR A;  3WA3 A;  2P05 A;  3H51 A;  1JNQ A;  4NHF A;  1B2X A;  3Q1C A;  3G4S 3;  1IVU A;  1RJO A;  2XSH B;  3N8B A;  1X1U A;  1RN7 A;  2WGO A;  3AGN A;  3L0R A;  3MG2 A;  1RGH A;  5ELJ A;  1RN4 A;  3ROB A;  2H0H A;  3F40 A;  3GAX A;  1IVX A;  4HZB B;  1ISK A;  4XB5 A;  1IVV A;  1GMQ A;  3LTD A;  4KFF A;  1W00 A;  5G2G A;  1VQN 3;  1OUN A;  1T2I A;  1US1 A;  3CD6 3;  1FZU A;  3S27 A;  1SAR A;  1TFO A;  2AAD A;  1FGM A;  1LQG C;  1PFP A;  4EC6 A;  1YJN 3;  4R1K A;  2HML B;  1RLS A;  3CC4 3;  3OWU A;  1GY7 A;  3T8U A;  2SAR A;  5JPU A;  1UUG B;  5CF1 A;  3EBT A;  1LOX A;  5TGN A;  2FNQ A;  2CC3 A;  3IJE B;  1B2S A;  3WOF B;  1M9G A;  5EEO A;  1BRI A;  3HIG A;  3KN4 A;  1JBS A;  2RFR A;  5LC6 A;  3PCS A;  3EHC A;  1YHQ 3;  1O7H B;  1TTO A;  1IT7 A;  1GD3 A;  5FW5 A;  3A5E A;  3X42 A;  4OVM A;  4KZ1 A;  1M90 4;  2F5W A;  1IYY A;  2CG1 A;  1Q82 4;  1E97 A;  1BAO A;  2HMJ B;  2XFT A;  4U13 A;  4HOH A;  3MKI A;  3ZG5 A;  3KZT A;  3S67 A;  1V74 A;  1ZO2 A;  3NM2 A;  1EQK A;  1SPU A;  3PXM A;  3CNM A;  1YGE A;  1Q7H A;  4NRE A;  4OUQ A;  3X40 A;  1GSP A;  1FGT A;  2PZV A;  1VQM 3;  3GSP A;  4HKV B;  2P38 A;  2Z7A A;  1B2M A;  3PS8 A;  3FSD A;  1NDO B;  1YVS A;  1CQS A;  3VF1 A;  4I5Q A;  1MWU A;  1RN1 A;  3WOD G;  1NWW A;  3F9S A;  5CLK A;  3LXU X;  1A2K A;  1Q40 A;  1ULJ B;  2UX0 A;  5AII A;  5AEW B;  3HII A;  3S5C A;  2E2T A;  2WOH A;  1BNG A;  1NU3 A;  2KF5 A; 
#chains in the Genus database with same CATH homology
 1CYU A;  2CWT A;  3F8H A;  1OGX A;  2KXG A;  3S29 A;  2P09 A;  4K61 A;  3B7C A;  3O8Y A;  4WFO A;  1DVD A;  3CCL 3;  2XH9 A;  1W4N A;  2YFL B;  4G1M B;  4HM6 B;  3CMA 3;  4H61 A;  4N6M A;  3N54 B;  1SJW A;  5AYS C;  2RSX A;  4HM0 B;  2XF3 A;  1QAK A;  3ECF A;  3A76 A;  2INX A;  2Q07 A;  3NHX A;  3DGL A;  1VZZ A;  2CWV A;  2GU3 A;  1D6Z A;  4L7K A;  2OQE A;  4MJD A;  1MNL A;  4BTY A;  1Q81 4;  1K73 4;  1AR0 A;  4JRF A;  4O3V A;  3G16 A;  5AEU B;  1QMA A;  1O7N B;  1W5Z A;  2OWP A;  4J9A A;  1DMN A;  2IMJ A;  4XBY A;  5BXQ A;  4RZM A;  3I55 3;  1A2V A;  2CFG A;  4KFD A;  4LEH A;  4QWT A;  3F14 A;  2O9U X;  2YFI B;  3B4O A;  1U5O A;  3CCM 3;  3F8X A;  1O7G B;  3RGR A;  3X3X A;  3MG3 A;  3LYG A;  2SBL A;  2B24 B;  1UW1 A;  2C11 A;  4AKZ A;  1KWI A;  3J7Y d;  1W6C A;  1JKG B;  1Y4K A;  2V1L A;  3EQQ B;  1MOL A;  3LOY A;  4RNY A;  3CME 3;  4I4K A;  4HZ9 B;  1ROV A;  3HK4 A;  3NBB A;  4WHA A;  1M1X B;  2CG0 A;  1IK3 A;  4HM7 B;  4IPB A;  3EX9 A;  3HI7 A;  4ZM8 A;  3LT9 A;  1D6U A;  4HYZ A;  2Y73 A;  1IQY A;  4K1V A;  1OH0 A;  1T5Y A;  1OHO A;  1K8A 4;  4FMD A;  3BNC A;  5D83 A;  3Q90 A;  1VQ4 3;  4O8S A;  3LTB A;  3FLJ A;  4L8O A;  5AIH A;  2IA7 A;  3DZL A;  1QVF 2;  1W7C A;  2F99 A;  2HMK B;  3BNE A;  3VGN A;  5D81 A;  4EXR A;  1ASK A;  4CDL A;  2W9P A;  3OWY A;  4XDW A;  1RRL A;  3EBY A;  3BLZ A;  3CC2 3;  4O2H A;  1JJ2 2;  3JUQ A;  2QGU A;  3CC7 3;  3FH1 A;  1DMQ A;  1DMM A;  3G6E 3;  1W2Z A;  4J8T A;  4MMY B;  1OAC A;  3KKG A;  1E3R A;  3KFQ C;  3I56 3;  1HU9 A;  4N6N B;  3NXJ A;  5BVB A;  1JN5 B;  2D42 A;  3JVC A;  5AYR B;  3B8L A;  1A67 A;  2QA4 3;  2BNG A;  1SII A;  3DUK A;  3TDG A;  1S72 3;  3B4P A;  3CCU 3;  3ER7 A;  4R9K A;  3GRD A;  3H3H A;  3WOE B;  3OW2 2;  2CK3 H;  3X3Y A;  4TX4 A;  2BHM A;  2CFW A;  4R80 A;  4IIA A;  3LZA A;  2LYX A;  1VQ7 3;  5AI1 A;  5I97 A;  2W2C A;  1ZX2 A;  2YX9 A;  3E99 A;  2GXF A;  3GWR A;  3T0U A;  1RKY A;  1K41 A;  2GEY A;  3X41 A;  4EV2 A;  1QAL A;  4LZI A;  2JDI H;  3NV0 A;  3DXO A;  4BTW A;  3DGO A;  3G8Z A;  3UNL A;  4HM8 B;  1JB2 A;  3Q2P A;  1OF5 A;  4MEI A;  2OCT A;  2FXT A;  2Z76 A;  1QAF A;  3CCR 3;  2F98 A;  5IER A;  1Q7Y 4;  3T8N A;  1IV7 A;  3EB8 A;  1O7W B;  3LML A;  1LNH A;  1YJ9 3;  1IT8 A;  3CCE 3;  4IT7 A;  5KP1 A;  1JRQ A;  1OHS A;  1VQO 3;  1DVC A;  2O3O A;  1AVK A;  3K5T A;  3SOA A;  2K54 A;  1TUH A;  3IPT A;  4BTX A;  3NX0 A;  4WYK A;  3CCV 3;  2OQE C;  1Q86 4;  2ZL8 A;  3DY5 A;  3DMC A;  2WOF A;  2XGL A;  4H3U A;  5KP4 A;  1KC8 4;  1O7P B;  5STD A;  4OK0 A;  2W0Q A;  5EQL A;  3NUV A;  2CFK A;  2CFL A;  3FKA A;  4XBX A;  5D82 A;  4WYK B;  5CXO A;  4GL6 A;  2KCD A;  2OTJ 3;  3V92 A;  1D6Y A;  2E2U A;  5IG4 A;  1IU7 A;  2ML5 A;  3JUO A;  2MC8 A;  1YIJ 3;  3KII A;  4R4K A;  5DRE A;  1N9J A;  3CCQ 3;  4RNZ A;  2K0M A;  1SQW A;  1DYU A;  4PEJ A;  3K7C A;  1O7M B;  1WMP A;  1N9E A;  2HMN B;  4N6O B;  4K1U A;  1W2B 2;  5IW9 A;  2W9Q A;  2ZDJ A;  1JN5 A;  3ALA A;  1W6Y A;  4O02 B;  1TU5 A;  2RGQ A;  3BB9 A;  4HBR A;  1OCV A;  3GZY B;  3HX8 A;  2IUJ A;  1N8Q A;  2E2V A;  2Z6B A;  4GB5 A;  3MYT A;  1OGZ A;  5AIG A;  3OXA A;  1E3V A;  2CKF B;  3NM7 A;  2W04 A;  1W6G A;  5JBS A;  3BND A;  4HM3 B;  3I0Y A;  3F7X A;  3SED A;  3JUN A;  4AEQ A;  1W01 A;  3PYJ A;  3OWS A;  3G0K A;  4FCJ A;  3SLU A;  3MHE A;  3GZR A;  1AV4 A;  3CCJ 3;  1R4C A;  3LTC A;  2BMQ B;  4Q53 A;  5IF6 A;  5DRV A;  2GBX B;  1QJG A;  2GEX A;  4HVN A;  5KP3 A;  2M7O A;  3G71 3;  3GZX B;  4X2O A;  3LH4 A;  3K0Z A;  2QEX 3;  1KD1 4;  1EG9 B;  1GYB A;  2F86 B;  2OOV C;  1UUW B;  3WA2 X;  3UB1 A;  2BMR B;  3X3Z A;  4MMZ B;  4LGQ A;  1VQP 3;  1U8C B;  5IG3 A;  1SIH A;  1LXE A;  1M1K 4;  5IG5 A;  1CEW I;  2YFJ B;  4HJL B;  1GD4 A;  4X2H A;  1QVG 2;  2RCD A;  1VQ8 3;  1UI7 A;  4FR9 A;  3JUM A;  4XM4 A;  1WTH A;  2JQ5 A;  1OHP A;  1CYV A;  1GY6 A;  7STD A;  3CNX A;  3S28 A;  1PU4 A;  1IDP A;  3FF2 A;  1UUV B;  3D9R A;  3FG1 A;  1STD A;  3F7S A;  3SOY A;  3EC9 A;  1N5P A;  4FMA A;  2I9W A;  3NBR A;  2XSO B;  3OV4 A;  2GBW B;  5LC7 A;  1L5G B;  1Z1S A;  4KVH A;  1NO3 A;  3SX1 A;  3DGN A;  2LQV A;  1EKM A;  2A15 A;  2W03 A;  1TP6 A;  3NQZ A;  4HM5 B;  4STD A;  5CF2 A;  3D3L A;  4N6V 0;  4LMI A;  2BT3 A;  2WGQ A;  3JUP A;  3U1W A;  1JKG A;  2CWU A;  3EJV A;  3UJM A;  2HMM B;  4R9L A;  3NV0 B;  3CPW 2;  4HM2 B;  2B1X B;  1J2B A;  3U97 A;  1YJW 3;  3LTA A;  1WMN A;  3CPO A;  1HKX A;  1WMO A;  3K63 A;  3MSO A;  3FZW A;  1IV9 A;  2QIY A;  3HZP A;  3SVA A;  6STD A;  1K9M 4;  3KE7 A;  2Z77 A;  1GS3 A;  2KRT A;  3EN8 A;  4WP5 A;  1RRH A;  4CCV A;  4N6L A;  3N9H A;  5A0O B;  3UL5 A;  3K9M C;  1TIJ A;  4FCZ A;  1VQ6 3;  1NB3 I;  1Q40 B;  5IG0 A;  3PZW A;  4EV5 A;  2IUK A;  5JPP A;  1TFK A;  2MF7 A;  3RGA A;  8CHO A;  1C7H A;  2CH9 A;  4HM4 B;  3CU3 A;  3DGM A;  1GY5 A;  1F8N A;  1VQK 3;  1N5H A;  3FCS B;  3QRD A;  3V99 A;  2C10 A;  3EF8 A;  2CIU A;  1N8R 4;  4HM1 B;  1KSI A;  2BO9 B;  1OF5 B;  1IQ8 A;  2L4V A;  3GZB A;  4WWU C;  3UL6 A;  2OTL 3;  2P0M A;  5IEN A;  1FA3 A;  3NBJ A;  1FGQ A;  4RBN A;  3MWZ A;  3EN1 B;  3M8C A;  1A90 A;  1BUQ A;  2HMO B;  4FMB A;  1VQ9 3;  2BMO B;  1WQL B;  4JF8 A;  4KFE A;  1NB5 I;  2OOV A;  1JB5 A;  4L8P A;  5IEP A;  3AMO B;  1IVW A;  1STF I;  3QK9 A;  2PNC A;  2FGT A;  3FG4 A;  4LSO A;  2CW9 A;  3CXC 2;  3OX9 A;  2XR8 B;  1S5A A;  2W6J H;  4EBG A;  1Q42 A;  4FMC A;  3VSY A;  3EE1 A;  3CCS 3;  2STD A;  1W02 A;  1YVB I;  3BNB A;  5ELU A;  1FGO A;  1UI8 A;  1YIT 3;  1AVL A;  2XFS A;  3FGY A;  4N6U A;  2W56 B;  2Y74 A;  1VQL 3;  1JB4 A;  1EA2 A;  1ULI B;  1NJI 4;  1FGR A;  2WO0 A;  1KQS 2;  4N6T A;  2P0X A;  1WNH A;  4N3V A;  5CK6 A;  1YI2 3;  2ML6 A;  3MPH A;  2XEP A;  2R4I A;  4XDV A;  1FUW A;  1VQ5 3;  3FG3 A;  3RDE A;  1LVN A;  2W56 A;  3STD A;  3LT8 A;  2CFD A;  4K90 B;  2D1W A;  1IQX A;  3WDG B;  3IMA B;  4MMX B;  3PGB A;  3PCR A;  1JV2 B;  5EVH A;  2GU1 A;  2XRX B;  5IEO A;  3WMD A;  3FF0 A;  1K28 A;  3NQY A;  5AIF A;  4ORL A;  3DM8 A;  4XBT A;  3KSP A;  4AKY A;  1ROA A;  3AMO A;  3V98 A;  4EYC A;  4FCM A;  3MG1 A;  5FGO A;  1G96 A;  1OPY A;  2CHC A;  2XGN A;  3KSE D;  5HGR A;  3WA3 A;  2P05 A;  3H51 A;  1JNQ A;  4NHF A;  3Q1C A;  3G4S 3;  1IVU A;  1RJO A;  2XSH B;  3N8B A;  5ELJ A;  1RN7 A;  2WGO A;  3L0R A;  3MG2 A;  3SXX A;  3ROB A;  3F40 A;  3GAX A;  1IVX A;  4HZB B;  1ISK A;  4XB5 A;  1IVV A;  3LTD A;  4KFF A;  1W00 A;  5G2G A;  1VQN 3;  1OUN A;  1US1 A;  3CD6 3;  3S27 A;  1TFO A;  1FGM A;  1PFP A;  4EC6 A;  1YJN 3;  4R1K A;  2HML B;  3CC4 3;  3OWU A;  1GY7 A;  3T8U A;  5JPU A;  5CF1 A;  3EBT A;  1LOX A;  5TGN A;  2FNQ A;  2CC3 A;  3IJE B;  3WOF B;  1M9G A;  5EEO A;  3HIG A;  3KN4 A;  2RFR A;  5LC6 A;  3PCS A;  3EHC A;  1YHQ 3;  1O7H B;  1IT7 A;  1GD3 A;  5FW5 A;  3X42 A;  4OVM A;  4KZ1 A;  1M90 4;  2CG1 A;  1Q82 4;  1E97 A;  2HMJ B;  2XFT A;  4U13 A;  3MKI A;  3KZT A;  3S67 A;  1V74 A;  1ZO2 A;  3NM2 A;  1EQK A;  1SPU A;  3PXM A;  3CNM A;  1YGE A;  4NRE A;  4OUQ A;  3X40 A;  2PZV A;  1FGT A;  1VQM 3;  4HKV B;  2P38 A;  2Z7A A;  3PS8 A;  3FSD A;  1NDO B;  1CQS A;  3VF1 A;  3WOD G;  1NWW A;  3F9S A;  5CLK A;  3LXU X;  1A2K A;  1Q40 A;  1ULJ B;  2UX0 A;  5AII A;  5AEW B;  3HII A;  3S5C A;  2E2T A;  2WOH A;  1NU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...