1BUQA

Solution structure of delta-5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone-hemisuccinate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFFANSLKLPLAVELTQEVRAVANEAAFAFTVSFEFQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (3-KETOSTEROID ISOMERASE-19-NORTESTOSTERONE-HEMISUCC
publication title Solution structure of Delta 5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone hemisuccinate.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 21
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1buqA00
4K1UA 5FW5A 3OX9A 3F7SA 4CDLA 1Q40A 3M8CA 4H3UA 5G2GA 3G8ZA 3MYTA 4XM4A 2STDA 4K1VA 3H3HA 4XBXA 4J8TA 1JB4A 3NHXA 1UUVB 3NUVA 4I4KA 3BB9A 5D82A 1TP6A 5KP3A 1DMNA 4HM0B 2PZVA 3NV0A 1OHPA 3DMCA 1JKGA 4HM5B 4WYKB 1OPYA 3B8LA 1VZZA 3T8UA 2HMJB 2QGUA 3E99A 1NU3A 2A15A 1WQLB 4HM1B 3UJMA 1EG9B 3STDA 5IG3A 8CHOA 2BNGA 3JUNA 4HM6B 1S5AA 3EF8A 3KZTA 2HMNB 3MG3A 3CNXA 1Q40B 2W2CA 4OVMA 3A76A 2HMKB 2JQ5A 3GRDA 1O7PB 3SOYA 3SEDA 2RGQA 4L7KA 3MG1A 5BVBA 3T8NA 3FF2A 3KE7A 5AIFA 2BMOB 5AIHA 1ASKA 4HM3B 5CK6A 1OHOA 3KKGA 3D9RA 4X2OA 2B24B 1OGXA 1E3VA 3FGYA 5JPPA 3EJVA 1JKGB 3ECFA 1DMQA 3CPOA 5HGRA 3LYGA 1W00A 4ORLA 1W6YA 3DXOA 4FCJA 5DRVA 5IENA 3F9SA 5IF6A 3HX8A 1GS3A 2QIYA 2XRXB 1SJWA 1GY6A 2UX0A 2HMOB 3FLJA 3EN8A 3GZXB 3NM2A 3NXJA 1JB5A 3GZBA 3CU3A 1O7NB 4OUQA 1OH0A 5EVHA 1A2KA 3VGNA 3OXAA 4WP5A 5IG4A 1JN5A 1JB2A 4GB5A 5AEUB 5CF1A 2XSHB 3LZAA 1OGZA 2B1XB 1QJGA 3EC9A 3F8HA 1ISKA 1K41A 4HVNA 3K7CA 3JUPA 2Z77A 5AEWB 5AI1A 4HZBB 1ULIB 3Q90A 7STDA 3GWRA 4HM7B 1OHSA 1GYBA 2RFRA 1NWWA 3UNLA 3DM8A 1C7HA 5KP4A 1W02A 1UUWB 4LMIA 3JUMA 1NDOB 1QMAA 3EBYA 3OWYA 1O7HB 2GBWB 2XSOB 1Q42A 3MHEA 4PEJA 3MSOA 3EHCA 1JN5B 3OV4A 4XBYA 1CQSA 4R9LA 2F98A 4XB5A 4HKVB 4N3VA 6STDA 3WMDA 1ULJB 3GZYB 3CNMA 1IDPA 4Q53A 4LEHA 3F7XA 3JUQA 1O7MB 1OUNA 3RGRA 2INXA 5JPUA 1AR0A 4HM4B 3F40A 4HM8B 3DZLA 1EA2A 3FZWA 3FF0A 3ER7A 4FCMA 1OF5B 1E97A 3FH1A 3F14A 3G0KA 2YFIB 4R9KA 3B7CA 3EX9A 2CHCA 5AIIA 4WWUC 1Z1SA 5AIGA 3B4PA 2HMMB 4IIAA 3BLZA 5CXOA 3H51A 5TGNA 2K54A 1DMMA 4MJDA 3S5CA 3OWUA 5CF2A 3KSPA 3F8XA 5DREA 5IG0A 2I9WA 1HKXA 1O7WB 5STDA 2HMLB 5IEPA 2XR8B 3JUOA 4XBTA 3HZPA 5IG5A 3I0YA 3NBRA 1STDA 2YFJB 2Z7AA 3OWSA 4X2HA 3B4OA 2IMJA 3EBTA 1U5OA 3HK4A 2GEXA 4STDA 1OF5A 5D83A 5IEOA 5D81A 1O7GB 3IPTA 5KP1A 2BMRB 2F86B 5IERA 3GZRA 4HM2B 1BUQA 4XDVA 1ZX2A 1TUHA 3EQQB 4U13A 2F99A 2GBXB 2YFLB 3FKAA 3DUKA 3EN1B 4HJLB 3ROBA 2GEYA 3VSYA 1OCVA 5BXQA 2CKFB 1E3RA 2BMQB 2RCDA 3K0ZA 3G16A 4L8PA 3NV0B 4L8OA 4J9AA 5CLKA 1W01A 2R4IA 3MG2A 1GY5A 4KVHA 4WYKA 4RZMA 3MKIA 4LGQA 3SOAA 2GXFA 3FSDA 2Z76A 1GY7A 4HZ9B 4R1KA 3RGAA 1ZO2A 4XDWA 2OWPA
chains in the Genus database with same CATH superfamily
1STFI 1UCKA 4K1UA 7GSPA 5HOHA 1K734 5FW5A 1RHLA 3OX9A 1BRGA 1PYLA 3F7SA 3UL5A 4CDLA 1Q40A 2IUKA 4CCVA 2RSXA 1IT8A 1K28A 1W6CA 5RNTA 1BANA 3G4S3 3M8CA 3QK9A 3X41A 1FW7A 2OQEC 5G1KA 1PU4A 4O02B 2KCDA 1R4YA 3KCHA 5BU4A 1Q864 1AQZA 1UGIA 2D42A 3G6E3 1RCKA 4H3UA 4N6V0 5G2GA 3G8ZA 3MYTA 1IV9A 1RN1A 2WGQA 4XM4A 1TTOA 3LTDA 4AKYA 1ROAA 2STDA 4H61A 4K1VA 2OOVA 1IQ8A 2ZHXB 4ZM8A 1BNFA 3H3HA 2ZA4A 3CXC2 1AVKA 4XBXA 1GMRA 4J8TA 1JB4A 1Q824 1VQK3 3NHXA 1CYVA 1UUVB 1K9M4 4WFOA 3HIGA 3NUVA 4I4KA 4NHFA 1Q814 3BB9A 1JZDA 5D82A 1BNSA 1TP6A 1WMNA 1GMQA 5KP3A 3ALAA 1DMNA 1B27A 4HM0B 1RRHA 1LOWA 2SARA 2PZVA 3NV0A 1OHPA 3DMCA 2D1WA 3KIIA 1HU9A 1JKGA 1BIRA 1V57A 1W2ZA 1OPYA 3B8LA 4HM5B 4WYKB 5BIRA 1VZZA 3T8UA 1DVCA 2HMJB 2QGUA 3E99A 2CG0A 1NU3A 3CC23 2K0MA 3PGBA 2A15A 3U97A 3DY5A 1FGQA 1WQLB 1RGKA 3KFQC 2BO9B 4HM1B 3UJMA 4WHAA 4HYZA 1A2VA 1EG9B 3CPW2 1RGAA 1YIT3 3STDA 5IG3A 1I3FA 5GSPA 5A0OB 8CHOA 2LQVA 2BNGA 2BU4A 3JUNA 4HM6B 4EYCA 4N6LA 1S5AA 2C10A 2CFDA 1PY3A 3G713 3EF8A 1FYSA 3U1WA 2WGOA 3KZTA 4LSOA 1B2UA 5ELJA 2FGTA 1QVG2 2MC8A 1TFKA 2HMNB 1BUJA 5EQLA 3MG3A 3CNXA 2XF3A 1Q40B 1W5ZA 1EUIC 1BU4A 1YJ93 2W2CA 4OVMA 3BNBA 3A76A 4KFDA 3CCS3 2QA43 2HMKB 2CWVA 1MGRA 1T3BA 2JQ5A 3GRDA 1O7PB 1MGWA 3NQZA 2XGNA 3EE1A 3WA2X 3LH4A 3SOYA 2BHMA 3LT9A 7RNTA 1UDII 1BGSA 3SEDA 3CMA3 2RGQA 1FGMA 3WDGB 2F4YA 6RNTA 4L7KA 2CWUA 3MG1A 1LNHA 5G1LA 1IYYA 4MMZB 5BVBA 1RJOA 3T8NA 1I3IA 3FF2A 1M904 3KE7A 1YJW3 5AIFA 4G1MB 1YGWA 3IMAB 1YGEA 1JV2B 1I2GA 1B20A 2BMOB 1ASKA 2P05A 2YX9A 4HM3B 5AIHA 1BSDA 3LMLA 1EQKA 3NX0A 5CK6A 2CFWA 1OHOA 3LTAA 1N5HA 1KSIA 3HI7A 3D9RA 3KKGA 4KFEA 4X2OA 2BIRA 4AKZA 3SYUA 1N8R4 1B21A 2B24B 4MEIA 1OGXA 1E3VA 1YHQ3 3FGYA 1NB3I 3A5EA 5JPPA 2CC3A 3EJVA 4GHOA 1JKGB 3ECFA 1FUTA 1W6GA 3BNCA 1NB5I 1UW1A 5AYRB 3NBBA 2M7OA 1DMQA 3CPOA 3PXMA 1AVLA 1IQYA 1SPUA 3FG1A 3MWZA 1TJDA 1HYFA 1FZUA 1QAKA 3HIIA 3S29A 2CFKA 2H0GA 5HGRA 3TDGA 1JBSA 3LYGA 1NJI4 1W00A 2OOVC 3PCSA 4ORLA 1SQWA 2H0IA 1RRLA 4EW5A 4DKIA 3CCV3 2IY2A 1RGLA 1TIJA 3L0RA 1F8NA 3S28A 4N6NB 1G96A 1W6YA 3DXOA 1CYUA 4FCJA 4EXRA 1BSAA 1T2IA 5DRVA 1V74A 8RNTA 5IENA 3F9SA 1BRHA 1JRQA 1TU5A 2OTJ3 5IF6A 3HX8A 3D79A 1GS3A 2QIYA 3CCJ3 2XFSA 3N8BA 4LYLB 3V92A 1KC84 2E2VA 2CWTA 1BVIA 1TRPA 2XRXB 6GSPA 1SJWA 4KFFA 3K5TA 5ELUA 2AAEA 1GY6A 1RDSA 2UGIA 3CME3 1IV7A 3VF1A 3NM7A 4RNZA 1IVVA 3HOHA 1GD4A 2UX0A 1K8A4 1GD3A 1L5GB 3UB1A 2HMOB 3FLJA 1RGCA 4FCZA 3SXXA 1DE3A 3EN8A 1MWSA 4KT3B 4CPKA 1RGEA 3GZXB 3NM2A 1RNBA 1ROVA 2C4BA 3NXJA 1JB5A 1UCJA 2CH9A 2KAAA 4R80A 3GZBA 1OACA 3CU3A 4J5GA 1O7NB 4OUQA 2P0MA 4RNYA 1OH0A 5EVHA 1A2KA 2L4VA 3WODG 2L1SA 1RLSA 2FXTA 3VGNA 3OXAA 4WP5A 1FA3A 1LOVA 5LC7A 3X42A 4JF8A 4EBGA 4N6UA 5IG4A 1JB2A 1JN5A 4GB5A 5AEUB 5CF1A 5JBSA 4KZ1A 2XSHB 3CCE3 1DETA 4BL3A 3LZAA 1OGZA 1B2MA 2OTL3 2BT3A 2B1XB 1MWRA 1N8QA 1QJGA 1BRKA 1LOYA 2O3OA 3EC9A 1B2SA 2GU3A 3F8HA 1N5PA 3PS8A 1ISKA 1K41A 1TFOA 3J7Yd 1JBTA 3CCM3 1M1K4 4HVNA 3K7CA 1D6ZA 3JUPA 1UUGB 1YJN3 2Z77A 4O3VA 5AEWB 5AI1A 4NREA 4HZBB 1ULIB 1DYUA 4CJNA 5IW9A 1T2HA 2UUGC 2RNTA 3Q90A 7STDA 1JNQA 1WMOA 1NNVA 3GWRA 1YI23 3CCU3 1LXEA 4HM7B 1MNLA 1OHSA 1GYBA 1X1UA 2HOHA 4TX4A 2Z6BA 4GSPA 2RFRA 1NWWA 3SLUA 3UNLA 3DM8A 2CFLA 4K90B 3O8YA 1LOXA 2OQEA 1PFPA 1C7HA 1I2EA 5M18A 5KP4A 1W02A 3S27A 4FMDA 1LQGC 2KRTA 1GMPA 4QWTA 1UUWB 2ZDJA 3EB8A 1W7CA 4LMIA 3UL6A 4BTYA 4ILFA 1V58A 3GSPA 3JUMA 1Q7Y4 3ZG0A 3K9MC 3DH2A 4N6OB 1NDOB 1IVUA 2WO0A 1M1XB 1I70A 2KF5A 4HBRA 1JBRA 3DGNA 1BSEA 1SIIA 1QMAA 3EBYA 4BU4A 3LXUX 1DVDA 3LTBA 3OWYA 4FMBA 1IQXA 1O7HB 2GBWB 1NO3A 2JDIH 2XEPA 2XSOB 2Q07A 4MMYB 1Q42A 3MHEA 3CCQ3 4PEJA 1IT7A 4MMXB 4O2HA 3MSOA 1QVF2 1Y4KA 2GSPA 2W03A 3EHCA 1JN5B 1UCLA 1JZOA 3OV4A 4XBYA 1D6UA 1CQSA 3DGOA 4R4KA 1R4CA 4R9LA 1VQ53 4HOHA 2O9UX 2F98A 4XB5A 2F5WA 4HKVB 3CCL3 4N3VA 6STDA 2W6JH 3WMDA 1ULJB 3GZYB 2CX0A 3NQYA 4FR9A 3FG3A 1FGRA 3CNMA 2P0XA 2OCTA 3FG4A 1IDPA 4Q53A 1YVBI 4LEHA 1JJ22 1A2PA 2RBIA 3F7XA 3JUQA 3KN4A 4FMAA 1US1A 1HZ1A 1O7MB 3AMOA 1B2ZA 1OUNA 3K63A 2WOHA 3BNEA 3V98A 3I563 4EC6A 1CEWI 1WNHA 3RGRA 1GOUA 2INXA 4RNTA 1RGGA 5JPUA 1AR0A 3S67A 4J5KA 4BL2A 4HM4B 2H0HA 3CCR3 1VQ43 1FUWA 3F40A 4HM8B 3DZLA 1BAOA 3WA3A 2F5MA 3Q2PA 1ZS7A 1EA2A 3D4AA 3SVAA 4RBNA 3FZWA 1VQ63 3FF0A 3ER7A 4FCMA 3ZG5A 2KF3A 1OF5B 1E97A 1B3SA 1RN7A 1Q7HA 3FH1A 1YVSA 3F14A 3G0KA 2YFIB 3FCSB 3AGNA 2CK3H 4R9KA 3B7CA 1X1YA 2ML5A 2CHCA 3EX9A 5AIIA 4EV5A 1BNRA 1WMPA 4IPBA 4WWUC 1N9EA 1MWUA 1WTHA 2WOFA 3GAXA 1Z1SA 5AIGA 3B4PA 3RDEA 1BSBA 2HMMB 1QALA 3KSED 3NBJA 4NPBA 4O8SA 3WOFB 1UCIA 4IIAA 1GOVA 3BLZA 2MF7A 2V1LA 1RKYA 5CXOA 1RNTA 2J8XB 3H51A 2E2UA 5LC6A 5TGNA 2K54A 4GL6A 1VQ93 2P38A 1DMMA 4MJDA 3ZFZA 1CH0A 3OWUA 3S5CA 5CF2A 3LT8A 1VQ83 3KSPA 1VQL3 3F8XA 1ZGXA 1G02A 5DREA 5IG0A 2I9WA 1HKXA 2IYJA 1O7WB 3BU4A 1A90A 5STDA 3WR2A 4BTXA 2HMLB 3D3LA 5IEPA 1VQN3 1T5YA 3D5GA 1J2BA 1VQO3 2XR8B 4I5QA 3JUOA 3DGMA 3AMOB 1S723 4XBTA 1D6YA 2XFTA 3SX1A 1LRAA 4FMCA 3HZPA 4BIRA 2PNCA 2C11A 4AEQA 5IG5A 3I0YA 3LOYA 3NBRA 1FGOA 1MWTA 1RMSA 1STDA 2YFJB 2Z7AA 3X3YA 1W2B2 1BOXA 1LVNA 5I97A 1GOYA 1GSPA 1RN4A 3OWSA 1BRIA 1UGHI 1IVWA 2XH9A 4X2HA 2E2TA 1LNIA 1SARA 3B4OA 2W9QA 4LZIA 1X1XA 3MPHA 4JRFA 1VQM3 2CIUA 2K3DA 2IMJA 1FGTA 2XGLA 1RTUA 2KF4A 3EBTA 1G0TA 1U5OA 1C54A 3HK4A 2GEXA 1I0XA 4STDA 1BSCA 1AV4A 1OF5A 3BNDA 5D83A 5EEOA 2GU1A 1SIHA 3RNTA 1U8CB 5IEOA 1VQP3 2CX1A 2CW9A 3PZWA 5D81A 1O7GB 1RGHA 3IPTA 1RSNA 2W56A 5KP1A 5FGOA 1KQS2 2LYXA 2BMRB 4BTWA 2CFGA 2F86B 5IERA 2F56A 3AGOA 1X1WA 1Q9EA 3GZRA 1BRSA 3Q1CA 4HM2B 5AYSC 3V99A 1EKMA 1BUQA 1BRJA 3N9HA 4XDVA 2QEX3 1I0VA 2FNQA 1ZX2A 1YNVX 2R41A 1TUHA 2KF6A 1LQMB 1QAFA 3IJEB 3I553 3X40A 5M19A 1VQQA 1KD14 1TRQA 3CD63 3EQQB 4U13A 3PCRA 3QRDA 1BNEA 2CG1A 1BRNL 3LTCA 2F99A 2GBXB 2P09A 1BNJA 2YFLB 2Y73A 3FKAA 4HAAA 1RCLA 3AHSA 3DUKA 3EN1B 4HJLB 3ROBA 2GEYA 3PYJA 4EV2A 3OW22 3VSYA 1OCVA 5BXQA 2W0QA 2SBLA 2CKFB 1E3RA 1UI8A 3CC73 1RGFA 2W04A 3AHWA 1VQ73 3CC43 2BMQB 2RCDA 4K61A 1IVXA 1MOLA 3K0ZA 3G16A 1YIJ3 3JVCA 4IT7A 1KWIA 2KXGA 4L8PA 2IUJA 3URPA 3NV0B 2AADA 1I2FA 1AY7A 4L8OA 4N6TA 2IA7A 1BNIA 1I8VA 3DGYA 4J9AA 2W9PA 1W01A 5CLKA 2R4IA 3WOEB 1B2XA 1EEJA 3X3XA 9RNTA 1A67A 3MG2A 1GY5A 4OK0A 3WHOA 4KVHA 4WYKA 3N54B 4RZMA 4N6MA 1IU7A 3MKIA 3DGLA 4LGQA 3SOAA 1BNGA 3D5IA 2GXFA 3T0UA 1UI7A 3FSDA 2ZL8A 1N9JA 2Z76A 5M1AA 1GY7A 4HZ9B 4R1KA 1FUSA 2ML6A 1M9GA 1W4NA 2Y74A 2W56B 3BIRA 3RGAA 3X3ZA 1IK3A 3Q3FA 1ZO2A 4XDWA 2OWPA
chains in the Genus database with same CATH topology
1STFI 4K1UA 1K734 5FW5A 3OX9A 3F7SA 3UL5A 4CDLA 1Q40A 2IUKA 4CCVA 2RSXA 1IT8A 1K28A 1W6CA 3G4S3 3M8CA 3QK9A 3X41A 2OQEC 1PU4A 4O02B 2KCDA 1Q864 3G6E3 2D42A 4H3UA 4N6V0 5G2GA 3G8ZA 3MYTA 1IV9A 2WGQA 4XM4A 3LTDA 4AKYA 1ROAA 2STDA 4H61A 4K1VA 2OOVA 1IQ8A 4ZM8A 3H3HA 3CXC2 1AVKA 4XBXA 4J8TA 1JB4A 1Q824 1VQK3 3NHXA 1CYVA 1UUVB 1K9M4 4WFOA 3HIGA 3NUVA 4I4KA 4NHFA 1Q814 3BB9A 5D82A 1TP6A 1WMNA 5KP3A 3ALAA 1DMNA 4HM0B 1RRHA 2PZVA 3NV0A 1OHPA 3DMCA 2D1WA 3KIIA 1HU9A 1JKGA 4HM5B 1W2ZA 1OPYA 3B8LA 4WYKB 1VZZA 3T8UA 1DVCA 2HMJB 2QGUA 3E99A 2CG0A 1NU3A 3CC23 2K0MA 3PGBA 2A15A 3U97A 3DY5A 1FGQA 1WQLB 3KFQC 2BO9B 4HM1B 3UJMA 4WHAA 4HYZA 1A2VA 1EG9B 3CPW2 1YIT3 3STDA 5IG3A 5A0OB 8CHOA 2LQVA 2BNGA 3JUNA 4EYCA 4HM6B 4N6LA 1S5AA 2C10A 2CFDA 3G713 3EF8A 3U1WA 2WGOA 3KZTA 4LSOA 5ELJA 2FGTA 1QVG2 2MC8A 1TFKA 2HMNB 5EQLA 3MG3A 3CNXA 2XF3A 1Q40B 1W5ZA 1YJ93 2W2CA 4OVMA 3BNBA 3A76A 4KFDA 3CCS3 2QA43 2HMKB 2CWVA 2JQ5A 3GRDA 1O7PB 3NQZA 2XGNA 3EE1A 3WA2X 3LH4A 3SOYA 2BHMA 3LT9A 3CMA3 3SEDA 2RGQA 1FGMA 3WDGB 4L7KA 2CWUA 3MG1A 1LNHA 4MMZB 5BVBA 1RJOA 3T8NA 3FF2A 1M904 3KE7A 1YJW3 5AIFA 4G1MB 3IMAB 1YGEA 1JV2B 2BMOB 2P05A 2YX9A 1ASKA 4HM3B 5AIHA 3LMLA 1EQKA 3NX0A 5CK6A 2CFWA 1OHOA 3LTAA 1N5HA 1KSIA 3HI7A 3D9RA 3KKGA 4KFEA 4X2OA 4AKZA 1N8R4 2B24B 4MEIA 1OGXA 1E3VA 1YHQ3 3FGYA 1NB3I 5JPPA 2CC3A 3EJVA 1JKGB 3ECFA 1W6GA 3BNCA 1NB5I 1UW1A 5AYRB 3NBBA 2M7OA 1DMQA 3CPOA 3PXMA 1AVLA 1IQYA 1SPUA 3FG1A 3MWZA 1QAKA 3HIIA 3S29A 2CFKA 5HGRA 3TDGA 3LYGA 1NJI4 1W00A 2OOVC 3PCSA 4ORLA 1SQWA 1RRLA 3CCV3 3L0RA 1TIJA 1F8NA 3S28A 4N6NB 1G96A 1W6YA 3DXOA 1CYUA 4FCJA 4EXRA 5DRVA 1V74A 5IENA 3F9SA 1JRQA 1TU5A 2OTJ3 5IF6A 3HX8A 1GS3A 2QIYA 3CCJ3 2XFSA 3N8BA 1KC84 3V92A 2E2VA 2CWTA 2XRXB 1SJWA 4KFFA 3K5TA 5ELUA 1GY6A 3CME3 1IV7A 3VF1A 3NM7A 4RNZA 1IVVA 1GD4A 2UX0A 1K8A4 1GD3A 1L5GB 3UB1A 2HMOB 3FLJA 4FCZA 3SXXA 3EN8A 3GZXB 3NM2A 1ROVA 3NXJA 1JB5A 4R80A 2CH9A 3GZBA 1OACA 3CU3A 1O7NB 4OUQA 2P0MA 4RNYA 1OH0A 5EVHA 1A2KA 2L4VA 3WODG 2FXTA 3VGNA 3OXAA 4WP5A 1FA3A 5LC7A 3X42A 4JF8A 4EBGA 4N6UA 5IG4A 1JB2A 1JN5A 4GB5A 5AEUB 5CF1A 5JBSA 4KZ1A 2XSHB 3CCE3 3LZAA 1OGZA 2OTL3 2BT3A 2B1XB 2O3OA 1N8QA 1QJGA 3EC9A 3F8HA 3PS8A 1ISKA 2GU3A 1N5PA 1K41A 1TFOA 3J7Yd 3CCM3 1M1K4 4HVNA 3K7CA 1D6ZA 3JUPA 1YJN3 2Z77A 4O3VA 5AEWB 5AI1A 4NREA 4HZBB 1ULIB 1DYUA 5IW9A 3Q90A 7STDA 1JNQA 1WMOA 3GWRA 1YI23 3CCU3 1LXEA 4HM7B 1MNLA 1OHSA 1GYBA 4TX4A 2Z6BA 2RFRA 1NWWA 3SLUA 3UNLA 3DM8A 2CFLA 4K90B 3O8YA 1LOXA 2OQEA 1PFPA 1C7HA 5KP4A 1W02A 3S27A 4FMDA 2KRTA 4QWTA 1UUWB 2ZDJA 3EB8A 1W7CA 4LMIA 3UL6A 4BTYA 1Q7Y4 3JUMA 3K9MC 4N6OB 1NDOB 1IVUA 2WO0A 1M1XB 4HBRA 3DGNA 1SIIA 1QMAA 3EBYA 3LXUX 1DVDA 3LTBA 3OWYA 4FMBA 1IQXA 1O7HB 2GBWB 1NO3A 2JDIH 2XEPA 2XSOB 2Q07A 4MMYB 1Q42A 3MHEA 3CCQ3 4PEJA 1IT7A 4MMXB 4O2HA 3MSOA 1QVF2 1Y4KA 2W03A 3EHCA 1JN5B 3OV4A 4XBYA 1D6UA 1CQSA 3DGOA 4R4KA 1R4CA 4R9LA 1VQ53 2O9UX 2F98A 4XB5A 4HKVB 3CCL3 4N3VA 6STDA 2W6JH 3WMDA 1ULJB 3GZYB 3NQYA 4FR9A 3FG3A 1FGRA 3CNMA 2P0XA 2OCTA 3FG4A 1IDPA 4Q53A 1YVBI 4LEHA 1JJ22 3KN4A 4FMAA 3F7XA 3JUQA 1US1A 1O7MB 3AMOA 1OUNA 3K63A 2WOHA 3BNEA 3V98A 3I563 4EC6A 1CEWI 1WNHA 3RGRA 2INXA 5JPUA 1AR0A 3S67A 4HM4B 3CCR3 1VQ43 1FUWA 3F40A 4HM8B 3DZLA 3WA3A 3Q2PA 1EA2A 3SVAA 4RBNA 3FZWA 1VQ63 3FF0A 3ER7A 4FCMA 1OF5B 1E97A 1RN7A 3FH1A 3F14A 3G0KA 2YFIB 3FCSB 2CK3H 4R9KA 3B7CA 2ML5A 3EX9A 2CHCA 5AIIA 4EV5A 1WMPA 4IPBA 4WWUC 1N9EA 1WTHA 2WOFA 3GAXA 1Z1SA 5AIGA 3B4PA 3RDEA 2HMMB 1QALA 3KSED 3NBJA 4O8SA 3WOFB 4IIAA 3BLZA 2MF7A 2V1LA 1RKYA 5CXOA 3H51A 5TGNA 2E2UA 5LC6A 2K54A 4GL6A 1VQ93 2P38A 1DMMA 4MJDA 3S5CA 3OWUA 5CF2A 3LT8A 1VQ83 3KSPA 1VQL3 3F8XA 5DREA 5IG0A 2I9WA 1HKXA 1O7WB 1A90A 5STDA 4BTXA 2HMLB 3D3LA 5IEPA 1VQN3 1T5YA 1J2BA 1VQO3 2XR8B 3JUOA 3DGMA 3AMOB 1S723 4XBTA 1D6YA 2XFTA 3SX1A 4FMCA 3HZPA 2PNCA 2C11A 4AEQA 5IG5A 3I0YA 3LOYA 3NBRA 1FGOA 1STDA 2YFJB 3X3YA 2Z7AA 1W2B2 1LVNA 5I97A 3OWSA 2XH9A 1IVWA 4X2HA 2E2TA 3B4OA 2W9QA 4LZIA 3MPHA 4JRFA 1VQM3 2CIUA 2IMJA 1FGTA 2XGLA 3EBTA 1U5OA 3HK4A 2GEXA 4STDA 1OF5A 1AV4A 3BNDA 5D83A 5EEOA 2GU1A 1SIHA 1U8CB 5IEOA 1VQP3 2CW9A 3PZWA 5D81A 1O7GB 3IPTA 2W56A 5KP1A 5FGOA 1KQS2 2LYXA 2BMRB 4BTWA 2CFGA 2F86B 5IERA 3GZRA 3Q1CA 4HM2B 5AYSC 3V99A 1EKMA 1BUQA 3N9HA 4XDVA 2QEX3 2FNQA 1ZX2A 1TUHA 1QAFA 3IJEB 3I553 3X40A 1KD14 3CD63 3EQQB 4U13A 3PCRA 3QRDA 2CG1A 3LTCA 2F99A 2GBXB 2P09A 2YFLB 2Y73A 3FKAA 3DUKA 3EN1B 4HJLB 3ROBA 2GEYA 3PYJA 4EV2A 3OW22 3VSYA 1OCVA 5BXQA 2W0QA 2SBLA 2CKFB 1E3RA 1UI8A 3CC73 2W04A 1VQ73 3CC43 2BMQB 2RCDA 4K61A 1IVXA 1MOLA 3K0ZA 3G16A 1YIJ3 3JVCA 4IT7A 1KWIA 2KXGA 4L8PA 2IUJA 3NV0B 4L8OA 4N6TA 2IA7A 4J9AA 2W9PA 1W01A 5CLKA 2R4IA 3WOEB 3X3XA 1A67A 3MG2A 1GY5A 4OK0A 4KVHA 4WYKA 3N54B 4RZMA 4N6MA 1IU7A 3MKIA 3DGLA 4LGQA 3SOAA 2GXFA 3T0UA 1UI7A 3FSDA 2ZL8A 1N9JA 2Z76A 1GY7A 4HZ9B 4R1KA 2ML6A 2Y74A 1M9GA 1W4NA 2W56B 3RGAA 3X3ZA 1IK3A 1ZO2A 4XDWA 2OWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1U A;  5FW5 A;  3OX9 A;  3F7S A;  4CDL A;  1Q40 A;  3M8C A;  4H3U A;  5G2G A;  3G8Z A;  3MYT A;  4XM4 A;  2STD A;  4K1V A;  3H3H A;  4XBX A;  4J8T A;  1JB4 A;  3NHX A;  1UUV B;  3NUV A;  4I4K A;  3BB9 A;  5D82 A;  1TP6 A;  5KP3 A;  1DMN A;  4HM0 B;  2PZV A;  3NV0 A;  1OHP A;  3DMC A;  1JKG A;  4HM5 B;  4WYK B;  1OPY A;  3B8L A;  1VZZ A;  3T8U A;  2HMJ B;  2QGU A;  3E99 A;  1NU3 A;  2A15 A;  1WQL B;  4HM1 B;  3UJM A;  1EG9 B;  3STD A;  5IG3 A;  8CHO A;  2BNG A;  3JUN A;  4HM6 B;  1S5A A;  3EF8 A;  3KZT A;  2HMN B;  3MG3 A;  3CNX A;  1Q40 B;  2W2C A;  4OVM A;  3A76 A;  2HMK B;  2JQ5 A;  3GRD A;  1O7P B;  3SOY A;  3SED A;  2RGQ A;  4L7K A;  3MG1 A;  5BVB A;  3T8N A;  3FF2 A;  3KE7 A;  5AIF A;  2BMO B;  5AIH A;  1ASK A;  4HM3 B;  5CK6 A;  1OHO A;  3KKG A;  3D9R A;  4X2O A;  2B24 B;  1OGX A;  1E3V A;  3FGY A;  5JPP A;  3EJV A;  1JKG B;  3ECF A;  1DMQ A;  3CPO A;  5HGR A;  3LYG A;  1W00 A;  4ORL A;  1W6Y A;  3DXO A;  4FCJ A;  5DRV A;  5IEN A;  3F9S A;  5IF6 A;  3HX8 A;  1GS3 A;  2QIY A;  2XRX B;  1SJW A;  1GY6 A;  2UX0 A;  2HMO B;  3FLJ A;  3EN8 A;  3GZX B;  3NM2 A;  3NXJ A;  1JB5 A;  3GZB A;  3CU3 A;  1O7N B;  4OUQ A;  1OH0 A;  5EVH A;  1A2K A;  3VGN A;  3OXA A;  4WP5 A;  5IG4 A;  1JN5 A;  1JB2 A;  4GB5 A;  5AEU B;  5CF1 A;  2XSH B;  3LZA A;  1OGZ A;  2B1X B;  1QJG A;  3EC9 A;  3F8H A;  1ISK A;  1K41 A;  4HVN A;  3K7C A;  3JUP A;  2Z77 A;  5AEW B;  5AI1 A;  4HZB B;  1ULI B;  3Q90 A;  7STD A;  3GWR A;  4HM7 B;  1OHS A;  1GYB A;  2RFR A;  1NWW A;  3UNL A;  3DM8 A;  1C7H A;  5KP4 A;  1W02 A;  1UUW B;  4LMI A;  3JUM A;  1NDO B;  1QMA A;  3EBY A;  3OWY A;  1O7H B;  2GBW B;  2XSO B;  1Q42 A;  3MHE A;  4PEJ A;  3MSO A;  3EHC A;  1JN5 B;  3OV4 A;  4XBY A;  1CQS A;  4R9L A;  2F98 A;  4XB5 A;  4HKV B;  4N3V A;  6STD A;  3WMD A;  1ULJ B;  3GZY B;  3CNM A;  1IDP A;  4Q53 A;  4LEH A;  3F7X A;  3JUQ A;  1O7M B;  1OUN A;  3RGR A;  2INX A;  5JPU A;  1AR0 A;  4HM4 B;  3F40 A;  4HM8 B;  3DZL A;  1EA2 A;  3FZW A;  3FF0 A;  3ER7 A;  4FCM A;  1OF5 B;  1E97 A;  3FH1 A;  3F14 A;  3G0K A;  2YFI B;  4R9K A;  3B7C A;  3EX9 A;  2CHC A;  5AII A;  4WWU C;  1Z1S A;  5AIG A;  3B4P A;  2HMM B;  4IIA A;  3BLZ A;  5CXO A;  3H51 A;  5TGN A;  2K54 A;  1DMM A;  4MJD A;  3S5C A;  3OWU A;  5CF2 A;  3KSP A;  3F8X A;  5DRE A;  5IG0 A;  2I9W A;  1HKX A;  1O7W B;  5STD A;  2HML B;  5IEP A;  2XR8 B;  3JUO A;  4XBT A;  3HZP A;  5IG5 A;  3I0Y A;  3NBR A;  1STD A;  2YFJ B;  2Z7A A;  3OWS A;  4X2H A;  3B4O A;  2IMJ A;  3EBT A;  1U5O A;  3HK4 A;  2GEX A;  4STD A;  1OF5 A;  5D83 A;  5IEO A;  5D81 A;  1O7G B;  3IPT A;  5KP1 A;  2BMR B;  2F86 B;  5IER A;  3GZR A;  4HM2 B;  1BUQ A;  4XDV A;  1ZX2 A;  1TUH A;  3EQQ B;  4U13 A;  2F99 A;  2GBX B;  2YFL B;  3FKA A;  3DUK A;  3EN1 B;  4HJL B;  3ROB A;  2GEY A;  3VSY A;  1OCV A;  5BXQ A;  2CKF B;  1E3R A;  2BMQ B;  2RCD A;  3K0Z A;  3G16 A;  4L8P A;  3NV0 B;  4L8O A;  4J9A A;  5CLK A;  1W01 A;  2R4I A;  3MG2 A;  1GY5 A;  4KVH A;  4WYK A;  4RZM A;  3MKI A;  4LGQ A;  3SOA A;  2GXF A;  3FSD A;  2Z76 A;  1GY7 A;  4HZ9 B;  4R1K A;  3RGA A;  1ZO2 A;  4XDW A;  2OWP A; 
#chains in the Genus database with same CATH topology
 1STF I;  1UCK A;  4K1U A;  7GSP A;  5HOH A;  1K73 4;  5FW5 A;  1RHL A;  3OX9 A;  1BRG A;  1PYL A;  3F7S A;  3UL5 A;  4CDL A;  1Q40 A;  2IUK A;  4CCV A;  2RSX A;  1IT8 A;  1K28 A;  1W6C A;  5RNT A;  1BAN A;  3G4S 3;  3M8C A;  3QK9 A;  3X41 A;  1FW7 A;  2OQE C;  5G1K A;  1PU4 A;  4O02 B;  2KCD A;  1R4Y A;  3KCH A;  5BU4 A;  1Q86 4;  1AQZ A;  1UGI A;  2D42 A;  3G6E 3;  1RCK A;  4H3U A;  4N6V 0;  5G2G A;  3G8Z A;  3MYT A;  1IV9 A;  1RN1 A;  2WGQ A;  4XM4 A;  1TTO A;  3LTD A;  4AKY A;  1ROA A;  2STD A;  4H61 A;  4K1V A;  2OOV A;  1IQ8 A;  2ZHX B;  4ZM8 A;  1BNF A;  3H3H A;  2ZA4 A;  3CXC 2;  1AVK A;  4XBX A;  1GMR A;  4J8T A;  1JB4 A;  1Q82 4;  1VQK 3;  3NHX A;  1CYV A;  1UUV B;  1K9M 4;  4WFO A;  3HIG A;  3NUV A;  4I4K A;  4NHF A;  1Q81 4;  3BB9 A;  1JZD A;  5D82 A;  1BNS A;  1TP6 A;  1WMN A;  1GMQ A;  5KP3 A;  3ALA A;  1DMN A;  1B27 A;  4HM0 B;  1RRH A;  1LOW A;  2SAR A;  2PZV A;  3NV0 A;  1OHP A;  3DMC A;  2D1W A;  3KII A;  1HU9 A;  1JKG A;  1BIR A;  1V57 A;  1W2Z A;  1OPY A;  3B8L A;  4HM5 B;  4WYK B;  5BIR A;  1VZZ A;  3T8U A;  1DVC A;  2HMJ B;  2QGU A;  3E99 A;  2CG0 A;  1NU3 A;  3CC2 3;  2K0M A;  3PGB A;  2A15 A;  3U97 A;  3DY5 A;  1FGQ A;  1WQL B;  1RGK A;  3KFQ C;  2BO9 B;  4HM1 B;  3UJM A;  4WHA A;  4HYZ A;  1A2V A;  1EG9 B;  3CPW 2;  1RGA A;  1YIT 3;  3STD A;  5IG3 A;  1I3F A;  5GSP A;  5A0O B;  8CHO A;  2LQV A;  2BNG A;  2BU4 A;  3JUN A;  4HM6 B;  4EYC A;  4N6L A;  1S5A A;  2C10 A;  2CFD A;  1PY3 A;  3G71 3;  3EF8 A;  1FYS A;  3U1W A;  2WGO A;  3KZT A;  4LSO A;  1B2U A;  5ELJ A;  2FGT A;  1QVG 2;  2MC8 A;  1TFK A;  2HMN B;  1BUJ A;  5EQL A;  3MG3 A;  3CNX A;  2XF3 A;  1Q40 B;  1W5Z A;  1EUI C;  1BU4 A;  1YJ9 3;  2W2C A;  4OVM A;  3BNB A;  3A76 A;  4KFD A;  3CCS 3;  2QA4 3;  2HMK B;  2CWV A;  1MGR A;  1T3B A;  2JQ5 A;  3GRD A;  1O7P B;  1MGW A;  3NQZ A;  2XGN A;  3EE1 A;  3WA2 X;  3LH4 A;  3SOY A;  2BHM A;  3LT9 A;  7RNT A;  1UDI I;  1BGS A;  3SED A;  3CMA 3;  2RGQ A;  1FGM A;  3WDG B;  2F4Y A;  6RNT A;  4L7K A;  2CWU A;  3MG1 A;  1LNH A;  5G1L A;  1IYY A;  4MMZ B;  5BVB A;  1RJO A;  3T8N A;  1I3I A;  3FF2 A;  1M90 4;  3KE7 A;  1YJW 3;  5AIF A;  4G1M B;  1YGW A;  3IMA B;  1YGE A;  1JV2 B;  1I2G A;  1B20 A;  2BMO B;  1ASK A;  2P05 A;  2YX9 A;  4HM3 B;  5AIH A;  1BSD A;  3LML A;  1EQK A;  3NX0 A;  5CK6 A;  2CFW A;  1OHO A;  3LTA A;  1N5H A;  1KSI A;  3HI7 A;  3D9R A;  3KKG A;  4KFE A;  4X2O A;  2BIR A;  4AKZ A;  3SYU A;  1N8R 4;  1B21 A;  2B24 B;  4MEI A;  1OGX A;  1E3V A;  1YHQ 3;  3FGY A;  1NB3 I;  3A5E A;  5JPP A;  2CC3 A;  3EJV A;  4GHO A;  1JKG B;  3ECF A;  1FUT A;  1W6G A;  3BNC A;  1NB5 I;  1UW1 A;  5AYR B;  3NBB A;  2M7O A;  1DMQ A;  3CPO A;  3PXM A;  1AVL A;  1IQY A;  1SPU A;  3FG1 A;  3MWZ A;  1TJD A;  1HYF A;  1FZU A;  1QAK A;  3HII A;  3S29 A;  2CFK A;  2H0G A;  5HGR A;  3TDG A;  1JBS A;  3LYG A;  1NJI 4;  1W00 A;  2OOV C;  3PCS A;  4ORL A;  1SQW A;  2H0I A;  1RRL A;  4EW5 A;  4DKI A;  3CCV 3;  2IY2 A;  1RGL A;  1TIJ A;  3L0R A;  1F8N A;  3S28 A;  4N6N B;  1G96 A;  1W6Y A;  3DXO A;  1CYU A;  4FCJ A;  4EXR A;  1BSA A;  1T2I A;  5DRV A;  1V74 A;  8RNT A;  5IEN A;  3F9S A;  1BRH A;  1JRQ A;  1TU5 A;  2OTJ 3;  5IF6 A;  3HX8 A;  3D79 A;  1GS3 A;  2QIY A;  3CCJ 3;  2XFS A;  3N8B A;  4LYL B;  3V92 A;  1KC8 4;  2E2V A;  2CWT A;  1BVI A;  1TRP A;  2XRX B;  6GSP A;  1SJW A;  4KFF A;  3K5T A;  5ELU A;  2AAE A;  1GY6 A;  1RDS A;  2UGI A;  3CME 3;  1IV7 A;  3VF1 A;  3NM7 A;  4RNZ A;  1IVV A;  3HOH A;  1GD4 A;  2UX0 A;  1K8A 4;  1GD3 A;  1L5G B;  3UB1 A;  2HMO B;  3FLJ A;  1RGC A;  4FCZ A;  3SXX A;  1DE3 A;  3EN8 A;  1MWS A;  4KT3 B;  4CPK A;  1RGE A;  3GZX B;  3NM2 A;  1RNB A;  1ROV A;  2C4B A;  3NXJ A;  1JB5 A;  1UCJ A;  2CH9 A;  2KAA A;  4R80 A;  3GZB A;  1OAC A;  3CU3 A;  4J5G A;  1O7N B;  4OUQ A;  2P0M A;  4RNY A;  1OH0 A;  5EVH A;  1A2K A;  2L4V A;  3WOD G;  2L1S A;  1RLS A;  2FXT A;  3VGN A;  3OXA A;  4WP5 A;  1FA3 A;  1LOV A;  5LC7 A;  3X42 A;  4JF8 A;  4EBG A;  4N6U A;  5IG4 A;  1JB2 A;  1JN5 A;  4GB5 A;  5AEU B;  5CF1 A;  5JBS A;  4KZ1 A;  2XSH B;  3CCE 3;  1DET A;  4BL3 A;  3LZA A;  1OGZ A;  1B2M A;  2OTL 3;  2BT3 A;  2B1X B;  1MWR A;  1N8Q A;  1QJG A;  1BRK A;  1LOY A;  2O3O A;  3EC9 A;  1B2S A;  2GU3 A;  3F8H A;  1N5P A;  3PS8 A;  1ISK A;  1K41 A;  1TFO A;  3J7Y d;  1JBT A;  3CCM 3;  1M1K 4;  4HVN A;  3K7C A;  1D6Z A;  3JUP A;  1UUG B;  1YJN 3;  2Z77 A;  4O3V A;  5AEW B;  5AI1 A;  4NRE A;  4HZB B;  1ULI B;  1DYU A;  4CJN A;  5IW9 A;  1T2H A;  2UUG C;  2RNT A;  3Q90 A;  7STD A;  1JNQ A;  1WMO A;  1NNV A;  3GWR A;  1YI2 3;  3CCU 3;  1LXE A;  4HM7 B;  1MNL A;  1OHS A;  1GYB A;  1X1U A;  2HOH A;  4TX4 A;  2Z6B A;  4GSP A;  2RFR A;  1NWW A;  3SLU A;  3UNL A;  3DM8 A;  2CFL A;  4K90 B;  3O8Y A;  1LOX A;  2OQE A;  1PFP A;  1C7H A;  1I2E A;  5M18 A;  5KP4 A;  1W02 A;  3S27 A;  4FMD A;  1LQG C;  2KRT A;  1GMP A;  4QWT A;  1UUW B;  2ZDJ A;  3EB8 A;  1W7C A;  4LMI A;  3UL6 A;  4BTY A;  4ILF A;  1V58 A;  3GSP A;  3JUM A;  1Q7Y 4;  3ZG0 A;  3K9M C;  3DH2 A;  4N6O B;  1NDO B;  1IVU A;  2WO0 A;  1M1X B;  1I70 A;  2KF5 A;  4HBR A;  1JBR A;  3DGN A;  1BSE A;  1SII A;  1QMA A;  3EBY A;  4BU4 A;  3LXU X;  1DVD A;  3LTB A;  3OWY A;  4FMB A;  1IQX A;  1O7H B;  2GBW B;  1NO3 A;  2JDI H;  2XEP A;  2XSO B;  2Q07 A;  4MMY B;  1Q42 A;  3MHE A;  3CCQ 3;  4PEJ A;  1IT7 A;  4MMX B;  4O2H A;  3MSO A;  1QVF 2;  1Y4K A;  2GSP A;  2W03 A;  3EHC A;  1JN5 B;  1UCL A;  1JZO A;  3OV4 A;  4XBY A;  1D6U A;  1CQS A;  3DGO A;  4R4K A;  1R4C A;  4R9L A;  1VQ5 3;  4HOH A;  2O9U X;  2F98 A;  4XB5 A;  2F5W A;  4HKV B;  3CCL 3;  4N3V A;  6STD A;  2W6J H;  3WMD A;  1ULJ B;  3GZY B;  2CX0 A;  3NQY A;  4FR9 A;  3FG3 A;  1FGR A;  3CNM A;  2P0X A;  2OCT A;  3FG4 A;  1IDP A;  4Q53 A;  1YVB I;  4LEH A;  1JJ2 2;  1A2P A;  2RBI A;  3F7X A;  3JUQ A;  3KN4 A;  4FMA A;  1US1 A;  1HZ1 A;  1O7M B;  3AMO A;  1B2Z A;  1OUN A;  3K63 A;  2WOH A;  3BNE A;  3V98 A;  3I56 3;  4EC6 A;  1CEW I;  1WNH A;  3RGR A;  1GOU A;  2INX A;  4RNT A;  1RGG A;  5JPU A;  1AR0 A;  3S67 A;  4J5K A;  4BL2 A;  4HM4 B;  2H0H A;  3CCR 3;  1VQ4 3;  1FUW A;  3F40 A;  4HM8 B;  3DZL A;  1BAO A;  3WA3 A;  2F5M A;  3Q2P A;  1ZS7 A;  1EA2 A;  3D4A A;  3SVA A;  4RBN A;  3FZW A;  1VQ6 3;  3FF0 A;  3ER7 A;  4FCM A;  3ZG5 A;  2KF3 A;  1OF5 B;  1E97 A;  1B3S A;  1RN7 A;  1Q7H A;  3FH1 A;  1YVS A;  3F14 A;  3G0K A;  2YFI B;  3FCS B;  3AGN A;  2CK3 H;  4R9K A;  3B7C A;  1X1Y A;  2ML5 A;  2CHC A;  3EX9 A;  5AII A;  4EV5 A;  1BNR A;  1WMP A;  4IPB A;  4WWU C;  1N9E A;  1MWU A;  1WTH A;  2WOF A;  3GAX A;  1Z1S A;  5AIG A;  3B4P A;  3RDE A;  1BSB A;  2HMM B;  1QAL A;  3KSE D;  3NBJ A;  4NPB A;  4O8S A;  3WOF B;  1UCI A;  4IIA A;  1GOV A;  3BLZ A;  2MF7 A;  2V1L A;  1RKY A;  5CXO A;  1RNT A;  2J8X B;  3H51 A;  2E2U A;  5LC6 A;  5TGN A;  2K54 A;  4GL6 A;  1VQ9 3;  2P38 A;  1DMM A;  4MJD A;  3ZFZ A;  1CH0 A;  3OWU A;  3S5C A;  5CF2 A;  3LT8 A;  1VQ8 3;  3KSP A;  1VQL 3;  3F8X A;  1ZGX A;  1G02 A;  5DRE A;  5IG0 A;  2I9W A;  1HKX A;  2IYJ A;  1O7W B;  3BU4 A;  1A90 A;  5STD A;  3WR2 A;  4BTX A;  2HML B;  3D3L A;  5IEP A;  1VQN 3;  1T5Y A;  3D5G A;  1J2B A;  1VQO 3;  2XR8 B;  4I5Q A;  3JUO A;  3DGM A;  3AMO B;  1S72 3;  4XBT A;  1D6Y A;  2XFT A;  3SX1 A;  1LRA A;  4FMC A;  3HZP A;  4BIR A;  2PNC A;  2C11 A;  4AEQ A;  5IG5 A;  3I0Y A;  3LOY A;  3NBR A;  1FGO A;  1MWT A;  1RMS A;  1STD A;  2YFJ B;  2Z7A A;  3X3Y A;  1W2B 2;  1BOX A;  1LVN A;  5I97 A;  1GOY A;  1GSP A;  1RN4 A;  3OWS A;  1BRI A;  1UGH I;  1IVW A;  2XH9 A;  4X2H A;  2E2T A;  1LNI A;  1SAR A;  3B4O A;  2W9Q A;  4LZI A;  1X1X A;  3MPH A;  4JRF A;  1VQM 3;  2CIU A;  2K3D A;  2IMJ A;  1FGT A;  2XGL A;  1RTU A;  2KF4 A;  3EBT A;  1G0T A;  1U5O A;  1C54 A;  3HK4 A;  2GEX A;  1I0X A;  4STD A;  1BSC A;  1AV4 A;  1OF5 A;  3BND A;  5D83 A;  5EEO A;  2GU1 A;  1SIH A;  3RNT A;  1U8C B;  5IEO A;  1VQP 3;  2CX1 A;  2CW9 A;  3PZW A;  5D81 A;  1O7G B;  1RGH A;  3IPT A;  1RSN A;  2W56 A;  5KP1 A;  5FGO A;  1KQS 2;  2LYX A;  2BMR B;  4BTW A;  2CFG A;  2F86 B;  5IER A;  2F56 A;  3AGO A;  1X1W A;  1Q9E A;  3GZR A;  1BRS A;  3Q1C A;  4HM2 B;  5AYS C;  3V99 A;  1EKM A;  1BUQ A;  1BRJ A;  3N9H A;  4XDV A;  2QEX 3;  1I0V A;  2FNQ A;  1ZX2 A;  1YNV X;  2R41 A;  1TUH A;  2KF6 A;  1LQM B;  1QAF A;  3IJE B;  3I55 3;  3X40 A;  5M19 A;  1VQQ A;  1KD1 4;  1TRQ A;  3CD6 3;  3EQQ B;  4U13 A;  3PCR A;  3QRD A;  1BNE A;  2CG1 A;  1BRN L;  3LTC A;  2F99 A;  2GBX B;  2P09 A;  1BNJ A;  2YFL B;  2Y73 A;  3FKA A;  4HAA A;  1RCL A;  3AHS A;  3DUK A;  3EN1 B;  4HJL B;  3ROB A;  2GEY A;  3PYJ A;  4EV2 A;  3OW2 2;  3VSY A;  1OCV A;  5BXQ A;  2W0Q A;  2SBL A;  2CKF B;  1E3R A;  1UI8 A;  3CC7 3;  1RGF A;  2W04 A;  3AHW A;  1VQ7 3;  3CC4 3;  2BMQ B;  2RCD A;  4K61 A;  1IVX A;  1MOL A;  3K0Z A;  3G16 A;  1YIJ 3;  3JVC A;  4IT7 A;  1KWI A;  2KXG A;  4L8P A;  2IUJ A;  3URP A;  3NV0 B;  2AAD A;  1I2F A;  1AY7 A;  4L8O A;  4N6T A;  2IA7 A;  1BNI A;  1I8V A;  3DGY A;  4J9A A;  2W9P A;  1W01 A;  5CLK A;  2R4I A;  3WOE B;  1B2X A;  1EEJ A;  3X3X A;  9RNT A;  1A67 A;  3MG2 A;  1GY5 A;  4OK0 A;  3WHO A;  4KVH A;  4WYK A;  3N54 B;  4RZM A;  4N6M A;  1IU7 A;  3MKI A;  3DGL A;  4LGQ A;  3SOA A;  1BNG A;  3D5I A;  2GXF A;  3T0U A;  1UI7 A;  3FSD A;  2ZL8 A;  1N9J A;  2Z76 A;  5M1A A;  1GY7 A;  4HZ9 B;  4R1K A;  1FUS A;  2ML6 A;  1M9G A;  1W4N A;  2Y74 A;  2W56 B;  3BIR A;  3RGA A;  3X3Z A;  1IK3 A;  3Q3F A;  1ZO2 A;  4XDW A;  2OWP A; 
#chains in the Genus database with same CATH homology
 1STF I;  4K1U A;  1K73 4;  5FW5 A;  3OX9 A;  3F7S A;  3UL5 A;  4CDL A;  1Q40 A;  2IUK A;  4CCV A;  2RSX A;  1IT8 A;  1K28 A;  1W6C A;  3G4S 3;  3M8C A;  3QK9 A;  3X41 A;  2OQE C;  1PU4 A;  4O02 B;  2KCD A;  1Q86 4;  3G6E 3;  2D42 A;  4H3U A;  4N6V 0;  5G2G A;  3G8Z A;  3MYT A;  1IV9 A;  2WGQ A;  4XM4 A;  3LTD A;  4AKY A;  1ROA A;  2STD A;  4H61 A;  4K1V A;  2OOV A;  1IQ8 A;  4ZM8 A;  3H3H A;  3CXC 2;  1AVK A;  4XBX A;  4J8T A;  1JB4 A;  1Q82 4;  1VQK 3;  3NHX A;  1CYV A;  1UUV B;  1K9M 4;  4WFO A;  3HIG A;  3NUV A;  4I4K A;  4NHF A;  1Q81 4;  3BB9 A;  5D82 A;  1TP6 A;  1WMN A;  5KP3 A;  3ALA A;  1DMN A;  4HM0 B;  1RRH A;  2PZV A;  3NV0 A;  1OHP A;  3DMC A;  2D1W A;  3KII A;  1HU9 A;  1JKG A;  4HM5 B;  1W2Z A;  1OPY A;  3B8L A;  4WYK B;  1VZZ A;  3T8U A;  1DVC A;  2HMJ B;  2QGU A;  3E99 A;  2CG0 A;  1NU3 A;  3CC2 3;  2K0M A;  3PGB A;  2A15 A;  3U97 A;  3DY5 A;  1FGQ A;  1WQL B;  3KFQ C;  2BO9 B;  4HM1 B;  3UJM A;  4WHA A;  4HYZ A;  1A2V A;  1EG9 B;  3CPW 2;  1YIT 3;  3STD A;  5IG3 A;  5A0O B;  8CHO A;  2LQV A;  2BNG A;  3JUN A;  4EYC A;  4HM6 B;  4N6L A;  1S5A A;  2C10 A;  2CFD A;  3G71 3;  3EF8 A;  3U1W A;  2WGO A;  3KZT A;  4LSO A;  5ELJ A;  2FGT A;  1QVG 2;  2MC8 A;  1TFK A;  2HMN B;  5EQL A;  3MG3 A;  3CNX A;  2XF3 A;  1Q40 B;  1W5Z A;  1YJ9 3;  2W2C A;  4OVM A;  3BNB A;  3A76 A;  4KFD A;  3CCS 3;  2QA4 3;  2HMK B;  2CWV A;  2JQ5 A;  3GRD A;  1O7P B;  3NQZ A;  2XGN A;  3EE1 A;  3WA2 X;  3LH4 A;  3SOY A;  2BHM A;  3LT9 A;  3CMA 3;  3SED A;  2RGQ A;  1FGM A;  3WDG B;  4L7K A;  2CWU A;  3MG1 A;  1LNH A;  4MMZ B;  5BVB A;  1RJO A;  3T8N A;  3FF2 A;  1M90 4;  3KE7 A;  1YJW 3;  5AIF A;  4G1M B;  3IMA B;  1YGE A;  1JV2 B;  2BMO B;  2P05 A;  2YX9 A;  1ASK A;  4HM3 B;  5AIH A;  3LML A;  1EQK A;  3NX0 A;  5CK6 A;  2CFW A;  1OHO A;  3LTA A;  1N5H A;  1KSI A;  3HI7 A;  3D9R A;  3KKG A;  4KFE A;  4X2O A;  4AKZ A;  1N8R 4;  2B24 B;  4MEI A;  1OGX A;  1E3V A;  1YHQ 3;  3FGY A;  1NB3 I;  5JPP A;  2CC3 A;  3EJV A;  1JKG B;  3ECF A;  1W6G A;  3BNC A;  1NB5 I;  1UW1 A;  5AYR B;  3NBB A;  2M7O A;  1DMQ A;  3CPO A;  3PXM A;  1AVL A;  1IQY A;  1SPU A;  3FG1 A;  3MWZ A;  1QAK A;  3HII A;  3S29 A;  2CFK A;  5HGR A;  3TDG A;  3LYG A;  1NJI 4;  1W00 A;  2OOV C;  3PCS A;  4ORL A;  1SQW A;  1RRL A;  3CCV 3;  3L0R A;  1TIJ A;  1F8N A;  3S28 A;  4N6N B;  1G96 A;  1W6Y A;  3DXO A;  1CYU A;  4FCJ A;  4EXR A;  5DRV A;  1V74 A;  5IEN A;  3F9S A;  1JRQ A;  1TU5 A;  2OTJ 3;  5IF6 A;  3HX8 A;  1GS3 A;  2QIY A;  3CCJ 3;  2XFS A;  3N8B A;  1KC8 4;  3V92 A;  2E2V A;  2CWT A;  2XRX B;  1SJW A;  4KFF A;  3K5T A;  5ELU A;  1GY6 A;  3CME 3;  1IV7 A;  3VF1 A;  3NM7 A;  4RNZ A;  1IVV A;  1GD4 A;  2UX0 A;  1K8A 4;  1GD3 A;  1L5G B;  3UB1 A;  2HMO B;  3FLJ A;  4FCZ A;  3SXX A;  3EN8 A;  3GZX B;  3NM2 A;  1ROV A;  3NXJ A;  1JB5 A;  4R80 A;  2CH9 A;  3GZB A;  1OAC A;  3CU3 A;  1O7N B;  4OUQ A;  2P0M A;  4RNY A;  1OH0 A;  5EVH A;  1A2K A;  2L4V A;  3WOD G;  2FXT A;  3VGN A;  3OXA A;  4WP5 A;  1FA3 A;  5LC7 A;  3X42 A;  4JF8 A;  4EBG A;  4N6U A;  5IG4 A;  1JB2 A;  1JN5 A;  4GB5 A;  5AEU B;  5CF1 A;  5JBS A;  4KZ1 A;  2XSH B;  3CCE 3;  3LZA A;  1OGZ A;  2OTL 3;  2BT3 A;  2B1X B;  2O3O A;  1N8Q A;  1QJG A;  3EC9 A;  3F8H A;  3PS8 A;  1ISK A;  2GU3 A;  1N5P A;  1K41 A;  1TFO A;  3J7Y d;  3CCM 3;  1M1K 4;  4HVN A;  3K7C A;  1D6Z A;  3JUP A;  1YJN 3;  2Z77 A;  4O3V A;  5AEW B;  5AI1 A;  4NRE A;  4HZB B;  1ULI B;  1DYU A;  5IW9 A;  3Q90 A;  7STD A;  1JNQ A;  1WMO A;  3GWR A;  1YI2 3;  3CCU 3;  1LXE A;  4HM7 B;  1MNL A;  1OHS A;  1GYB A;  4TX4 A;  2Z6B A;  2RFR A;  1NWW A;  3SLU A;  3UNL A;  3DM8 A;  2CFL A;  4K90 B;  3O8Y A;  1LOX A;  2OQE A;  1PFP A;  1C7H A;  5KP4 A;  1W02 A;  3S27 A;  4FMD A;  2KRT A;  4QWT A;  1UUW B;  2ZDJ A;  3EB8 A;  1W7C A;  4LMI A;  3UL6 A;  4BTY A;  1Q7Y 4;  3JUM A;  3K9M C;  4N6O B;  1NDO B;  1IVU A;  2WO0 A;  1M1X B;  4HBR A;  3DGN A;  1SII A;  1QMA A;  3EBY A;  3LXU X;  1DVD A;  3LTB A;  3OWY A;  4FMB A;  1IQX A;  1O7H B;  2GBW B;  1NO3 A;  2JDI H;  2XEP A;  2XSO B;  2Q07 A;  4MMY B;  1Q42 A;  3MHE A;  3CCQ 3;  4PEJ A;  1IT7 A;  4MMX B;  4O2H A;  3MSO A;  1QVF 2;  1Y4K A;  2W03 A;  3EHC A;  1JN5 B;  3OV4 A;  4XBY A;  1D6U A;  1CQS A;  3DGO A;  4R4K A;  1R4C A;  4R9L A;  1VQ5 3;  2O9U X;  2F98 A;  4XB5 A;  4HKV B;  3CCL 3;  4N3V A;  6STD A;  2W6J H;  3WMD A;  1ULJ B;  3GZY B;  3NQY A;  4FR9 A;  3FG3 A;  1FGR A;  3CNM A;  2P0X A;  2OCT A;  3FG4 A;  1IDP A;  4Q53 A;  1YVB I;  4LEH A;  1JJ2 2;  3KN4 A;  4FMA A;  3F7X A;  3JUQ A;  1US1 A;  1O7M B;  3AMO A;  1OUN A;  3K63 A;  2WOH A;  3BNE A;  3V98 A;  3I56 3;  4EC6 A;  1CEW I;  1WNH A;  3RGR A;  2INX A;  5JPU A;  1AR0 A;  3S67 A;  4HM4 B;  3CCR 3;  1VQ4 3;  1FUW A;  3F40 A;  4HM8 B;  3DZL A;  3WA3 A;  3Q2P A;  1EA2 A;  3SVA A;  4RBN A;  3FZW A;  1VQ6 3;  3FF0 A;  3ER7 A;  4FCM A;  1OF5 B;  1E97 A;  1RN7 A;  3FH1 A;  3F14 A;  3G0K A;  2YFI B;  3FCS B;  2CK3 H;  4R9K A;  3B7C A;  2ML5 A;  3EX9 A;  2CHC A;  5AII A;  4EV5 A;  1WMP A;  4IPB A;  4WWU C;  1N9E A;  1WTH A;  2WOF A;  3GAX A;  1Z1S A;  5AIG A;  3B4P A;  3RDE A;  2HMM B;  1QAL A;  3KSE D;  3NBJ A;  4O8S A;  3WOF B;  4IIA A;  3BLZ A;  2MF7 A;  2V1L A;  1RKY A;  5CXO A;  3H51 A;  5TGN A;  2E2U A;  5LC6 A;  2K54 A;  4GL6 A;  1VQ9 3;  2P38 A;  1DMM A;  4MJD A;  3S5C A;  3OWU A;  5CF2 A;  3LT8 A;  1VQ8 3;  3KSP A;  1VQL 3;  3F8X A;  5DRE A;  5IG0 A;  2I9W A;  1HKX A;  1O7W B;  1A90 A;  5STD A;  4BTX A;  2HML B;  3D3L A;  5IEP A;  1VQN 3;  1T5Y A;  1J2B A;  1VQO 3;  2XR8 B;  3JUO A;  3DGM A;  3AMO B;  1S72 3;  4XBT A;  1D6Y A;  2XFT A;  3SX1 A;  4FMC A;  3HZP A;  2PNC A;  2C11 A;  4AEQ A;  5IG5 A;  3I0Y A;  3LOY A;  3NBR A;  1FGO A;  1STD A;  2YFJ B;  3X3Y A;  2Z7A A;  1W2B 2;  1LVN A;  5I97 A;  3OWS A;  2XH9 A;  1IVW A;  4X2H A;  2E2T A;  3B4O A;  2W9Q A;  4LZI A;  3MPH A;  4JRF A;  1VQM 3;  2CIU A;  2IMJ A;  1FGT A;  2XGL A;  3EBT A;  1U5O A;  3HK4 A;  2GEX A;  4STD A;  1OF5 A;  1AV4 A;  3BND A;  5D83 A;  5EEO A;  2GU1 A;  1SIH A;  1U8C B;  5IEO A;  1VQP 3;  2CW9 A;  3PZW A;  5D81 A;  1O7G B;  3IPT A;  2W56 A;  5KP1 A;  5FGO A;  1KQS 2;  2LYX A;  2BMR B;  4BTW A;  2CFG A;  2F86 B;  5IER A;  3GZR A;  3Q1C A;  4HM2 B;  5AYS C;  3V99 A;  1EKM A;  1BUQ A;  3N9H A;  4XDV A;  2QEX 3;  2FNQ A;  1ZX2 A;  1TUH A;  1QAF A;  3IJE B;  3I55 3;  3X40 A;  1KD1 4;  3CD6 3;  3EQQ B;  4U13 A;  3PCR A;  3QRD A;  2CG1 A;  3LTC A;  2F99 A;  2GBX B;  2P09 A;  2YFL B;  2Y73 A;  3FKA A;  3DUK A;  3EN1 B;  4HJL B;  3ROB A;  2GEY A;  3PYJ A;  4EV2 A;  3OW2 2;  3VSY A;  1OCV A;  5BXQ A;  2W0Q A;  2SBL A;  2CKF B;  1E3R A;  1UI8 A;  3CC7 3;  2W04 A;  1VQ7 3;  3CC4 3;  2BMQ B;  2RCD A;  4K61 A;  1IVX A;  1MOL A;  3K0Z A;  3G16 A;  1YIJ 3;  3JVC A;  4IT7 A;  1KWI A;  2KXG A;  4L8P A;  2IUJ A;  3NV0 B;  4L8O A;  4N6T A;  2IA7 A;  4J9A A;  2W9P A;  1W01 A;  5CLK A;  2R4I A;  3WOE B;  3X3X A;  1A67 A;  3MG2 A;  1GY5 A;  4OK0 A;  4KVH A;  4WYK A;  3N54 B;  4RZM A;  4N6M A;  1IU7 A;  3MKI A;  3DGL A;  4LGQ A;  3SOA A;  2GXF A;  3T0U A;  1UI7 A;  3FSD A;  2ZL8 A;  1N9J A;  2Z76 A;  1GY7 A;  4HZ9 B;  4R1K A;  2ML6 A;  2Y74 A;  1M9G A;  1W4N A;  2W56 B;  3RGA A;  3X3Z A;  1IK3 A;  1ZO2 A;  4XDW A;  2OWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...