3ER7A

Crystal structure of ntf2-like protein of unknown function (yp_001812677.1) from exiguobacterium sp. 255-15 at 1.50 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
b'TTLDRYFDLFDASRTDEKAFDDLISLFSDEITFVLNGQEQHGIDAWKQFVRMVFTANQDIKHMYAGWVPSETGDTMETRWAVCGKSADGSVFTQDGTDIARLNADGKIVYLANVPDDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized NTF2-like protein
molecule tags Structural genomics, unknown function
source organism Exiguobacterium sibiricum 255-15
publication title Crystal structure of NTF2-like protein of unknown function (YP_001812677.1) from EXIGUOBACTERIUM SP. 255-15 at 1.50 A resolution
rcsb
total genus 30
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3er7A00
4R1KA 3DXOA 3WMDA 2CKFB 3OWYA 5IG0A 1STDA 2BMRB 2YFJB 2QIYA 1GYBA 2CHCA 4HM8B 3EJVA 3STDA 3EBYA 3DZLA 2B24B 4WP5A 3T8NA 5IEOA 2HMOB 3FZWA 3MG3A 5CF2A 5AIHA 1EG9B 3H3HA 4HKVB 1GS3A 4I4KA 5IERA 6STDA 2HMMB 4X2HA 1O7PB 5CXOA 2K54A 3F8XA 2F98A 4HZ9B 3B8LA 3OWUA 1C7HA 2GBXB 4HM2B 2JQ5A 3MKIA 1NU3A 2Z7AA 3BLZA 3JUNA 1UUVB 3MSOA 1GY7A 1O7MB 3FLJA 2XRXB 3NM2A 1ISKA 4X2OA 4XB5A 2I9WA 4FCJA 5FW5A 2GEYA 3SOYA 3D9RA 2XR8B 3GRDA 3CPOA 3B4OA 1OF5A 4J8TA 2HMLB 4R9LA 1Q40A 2GEXA 3DUKA 3F9SA 4IIAA 3UJMA 1O7HB 4HM6B 3NUVA 3GZYB 4RZMA 5AI1A 1W01A 5JPPA 1QMAA 3RGRA 1BUQA 2UX0A 3NV0A 3FF2A 3I0YA 4K1UA 3LZAA 1U5OA 1JKGA 1S5AA 5KP3A 5AEWB 3B4PA 3GZXB 3RGAA 3EC9A 4OVMA 3B7CA 3GWRA 3KKGA 4HM4B 4R9KA 1OHOA 1OCVA 3F7SA 4XBXA 4J9AA 4WYKB 8CHOA 1ZX2A 4HVNA 4FCMA 4N3VA 4CDLA 5HGRA 4HJLB 4KVHA 2Z77A 3T8UA 2QGUA 1OPYA 2XSOB 5CLKA 1JN5A 1EA2A 1Z1SA 2GXFA 3DMCA 3OX9A 5KP1A 1IDPA 2B1XB 2STDA 1NWWA 1OUNA 4HM1B 4L7KA 5CK6A 3CNXA 5G2GA 5AIGA 2W2CA 2GBWB 2Z76A 3EN8A 2BMQB 3JUPA 4HM3B 3EF8A 1Q42A 1W02A 3HK4A 2RCDA 3EN1B 1AR0A 3H51A 2BMOB 5AIFA 1ULJB 3EQQB 1OH0A 3Q90A 3DM8A 3BB9A 3CU3A 1OGXA 3ECFA 4XBYA 1CQSA 2F86B 3KE7A 3FH1A 3SOAA 3VSYA 3FGYA 5STDA 3MG1A 3MG2A 5JPUA 1A2KA 3A76A 1E97A 3IPTA 5KP4A 3EX9A 2OWPA 3GZBA 3FKAA 1K41A 4L8PA 2F99A 1O7WB 3MHEA 4XM4A 5IG4A 1JB5A 1OGZA 3KSPA 4XDWA 5IENA 4HM7B 1HKXA 3F8HA 2HMKB 4XBTA 5IF6A 1ULIB 1O7GB 2IMJA 3GZRA 3JUMA 4LGQA 5D82A 1JKGB 3HX8A 5IG5A 4L8OA 3FSDA 3ROBA 5IG3A 1O7NB 2R4IA 5IEPA 3EHCA 2HMNB 4GB5A 5DRVA 5D81A 1DMMA 1ZO2A 3K7CA 1DMNA 3SEDA 3G8ZA 2YFLB 3KZTA 4WYKA 3JUOA 5EVHA 3NBRA 1VZZA 2BNGA 2HMJB 3ER7A 3OV4A 2RGQA 3E99A 4HM0B 2A15A 5BVBA 3LYGA 4U13A 7STDA 3JUQA 1TP6A 3MYTA 3F40A 1JN5B 1WQLB 1NDOB 2PZVA 3NXJA 2YFIB 4LEHA 5AIIA 3M8CA 3NHXA 5AEUB 4OUQA 5BXQA 1TUHA 5DREA 4MJDA 3CNMA 1SJWA 3F7XA 1OF5B 4Q53A 3S5CA 1QJGA 1Q40B 3UNLA 4PEJA 4WWUC 1GY5A 4HZBB 3VGNA 1OHSA 3K0ZA 5D83A 4HM5B 1JB2A 1UUWB 4K1VA 3HZPA 3NV0B 3OXAA 4STDA 4XDVA 1DMQA 1GY6A 3F14A 3FF0A 5CF1A 3EBTA 1OHPA 1JB4A 1E3RA 3G16A 4LMIA 4ORLA 1ASKA 2RFRA 3OWSA 5TGNA 1E3VA 1W6YA 2INXA 2XSHB 3G0KA 4H3UA 1W00A
chains in the Genus database with same CATH superfamily
3DXOA 1LQGC 4FMBA 9RNTA 1BNFA 3GSPA 3NBBA 5IG0A 1STDA 4EBGA 1US1A 3STDA 3X42A 3EJVA 4BIRA 4CJNA 1NNVA 3DZLA 3T8NA 3FCSB 5IEOA 2HMOB 1JNQA 3MG3A 5CF2A 3CC23 1RLSA 1X1XA 4HKVB 1GS3A 4I4KA 1Q824 6STDA 2P09A 2R41A 1B2MA 2CWVA 5CXOA 1M1XB 2F98A 3CCV3 3KIIA 1BNSA 4KFEA 2JQ5A 2L1SA 4BU4A 1A90A 2CX1A 1UUVB 3CCQ3 3FLJA 3CMA3 3A5EA 1YVSA 4XB5A 5RNTA 5ELUA 3GRDA 1B21A 3LTCA 1TRPA 1QVF2 4WHAA 1GOYA 3CCJ3 1O7HB 1RN7A 1BSAA 1NO3A 3GZYB 5AI1A 5JPUA 2KF3A 2OCTA 2V1LA 4J5KA 3PZWA 3D4AA 1U5OA 3CCU3 2K0MA 1W6CA 1DYUA 1BANA 3RGAA 5I97A 3KKGA 2F5MA 1OHOA 2KAAA 1BNGA 4XBXA 3UB1A 2XFSA 4N3VA 1CYVA 4HJLB 4KVHA 1KSIA 2CWTA 2QGUA 2K3DA 2XSOB 3HI7A 3LMLA 3FG4A 2GXFA 3UL5A 1BRGA 3DMCA 1IQYA 3RDEA 5CK6A 5G2GA 2Y73A 1TFOA 3JUPA 3DGLA 1JBTA 4EV2A 1Q42A 4H61A 5ELJA 1I8VA 1UI7A 2BMOB 2XH9A 1ULJB 2FGTA 3EQQB 3JVCA 1MOLA 3DM8A 3ECFA 3N54B 1OGXA 4XBYA 3G6E3 3KE7A 4BL3A 3FH1A 1HZ1A 5STDA 1A2KA 1D6ZA 3A76A 2ML5A 1RKYA 4L8PA 1N9EA 1PU4A 4ILFA 2LYXA 4HAAA 1OGZA 3KSPA 3BNBA 4HM7B 1HKXA 1CYUA 5IF6A 3D3LA 3JUMA 5D82A 1T2IA 1QALA 2BHMA 2P05A 4OK0A 1JKGB 3CME3 1VQP3 3UL6A 1UGIA 4EC6A 5IG3A 2R4IA 1LVNA 4GHOA 3IJEB 4CCVA 4RBNA 3CD63 1RCLA 1Q7Y4 1DMMA 3SEDA 1YJN3 1RMSA 4WYKA 3JUOA 4K90B 1LOXA 1VZZA 4HM0B 2LQVA 2RGQA 2A15A 2FNQA 2CG0A 1IVWA 3VF1A 1LQMB 1UDII 4LEHA 2GSPA 2CC3A 6RNTA 2CWUA 2YFIB 2FXTA 5BXQA 3M8CA 4MJDA 4EW5A 3CNMA 1SJWA 1SPUA 1OF5B 4Q53A 2KF4A 1IQ8A 1GY5A 3K0ZA 1M904 4HM5B 3NQYA 2BO9B 1N9JA 3WDGB 4JRFA 1GOVA 1NJI4 3AGNA 3FF0A 5CF1A 2GU3A 3EBTA 3CC43 4LMIA 1B3SA 1M9GA 1U8CB 3G16A 4FMAA 3OWSA 1DVDA 1RDSA 1MWSA 2INXA 3N8BA 4H3UA 2CFGA 1UW1A 4OUQA 1Y4KA 1QAFA 1YVBI 1JBSA 2YFJB 1RHLA 2XGNA 2B24B 5BU4A 1YNVX 3HIGA 1FW7A 1BSCA 1VQ73 3V92A 2W04A 1PYLA 1G0TA 1LOWA 1O7PB 2K54A 1BIRA 1AV4A 1RGLA 2GBXB 2ZHXB 2KXGA 3MKIA 4MEIA 1NU3A 1IQXA 4O8SA 1DETA 1YIT3 3MSOA 3NM2A 2XRXB 1UGHI 3ZG0A 4X2OA 3AHSA 3D9RA 3X41A 4J8TA 2HMLB 2W0QA 1RNTA 1Q40A 2GEXA 3DGMA 3F9SA 3PXMA 4N6OB 4R9LA 4RZMA 3UJMA 3WOEB 3CCE3 1VQL3 1BUQA 1X1UA 1RGFA 3QK9A 2CW9A 1UI8A 5M1AA 1BNJA 3FF2A 1FGQA 4FCZA 1B20A 1SQWA 1UUGB 2O9UX 3LTBA 1BGSA 3D79A 1S5AA 4DKIA 2E2UA 3V98A 1D6UA 5LC6A 3KSED 5AEWB 2ZDJA 3OW22 1J2BA 3BIRA 2OOVC 3HOHA 3B7CA 1TFKA 1RGCA 3WA3A 4J9AA 4WYKB 8CHOA 3S27A 1K28A 2SBLA 1VQ93 2RBIA 3HIIA 3SLUA 1UCJA 3D5GA 3PCRA 1G96A 1EQKA 3OX9A 3LH4A 5KP1A 2CFLA 1PY3A 1FUTA 1NWWA 1OUNA 4L7KA 3WR2A 2W2CA 3SX1A 1W2ZA 2WOHA 2BU4A 1IV9A 2RSXA 3EF8A 3HK4A 1W02A 4O2HA 3EN1B 5AIFA 1RGKA 1TJDA 1LNHA 4BTWA 6GSPA 1WTHA 5IG4A 3SOAA 1Q864 4HYZA 2CFKA 3FGYA 4N6LA 2OQEA 1T5YA 7RNTA 5HOHA 1BUJA 1GOUA 1TRQA 1W7CA 5KP4A 3FKAA 1RGGA 2XGLA 1ZS7A 1KD14 2CK3H 3G4S3 4XDWA 1SIIA 2HMKB 1Q7HA 4XBTA 5G1KA 3AMOA 5G1LA 1O7GB 3DGOA 3X40A 1GMQA 3BNDA 3DGNA 4KT3B 1X1YA 1RCKA 2CFWA 3FG3A 2XFTA 2KRTA 1I2FA 1RN4A 2UGIA 1YGEA 2W6JH 3EHCA 3K7CA 1DMNA 2C11A 3KZTA 2O3OA 5EVHA 1W5ZA 2BNGA 4G1MB 5M19A 3OV4A 1UCLA 4HBRA 1WMOA 1RRLA 1IVVA 3LYGA 4U13A 1TP6A 1MGRA 3MYTA 3WHOA 1MWUA 1ZGXA 4K61A 5AEUB 3URPA 3DY5A 1RGAA 1TUHA 5DREA 3F7XA 1I3FA 3O8YA 3S5CA 2OTJ3 1R4CA 1Q40B 3D5IA 4HZBB 1OHSA 5D83A 1PFPA 5LC7A 1UUWB 4XDVA 3Q3FA 4STDA 1BSDA 1W4NA 3F14A 3S29A 1WNHA 2P0XA 3X3XA 1IU7A 1JB4A 1ASKA 2H0GA 4K1UA 5TGNA 8RNTA 1W6YA 2E2TA 3S67A 4AEQA 1BSBA 1YI23 2PNCA 4R1KA 3OWYA 1SIHA 2BMRB 3I553 2QIYA 1GYBA 2CHCA 4HM8B 3X3YA 3FG1A 3EBYA 4WP5A 1BSEA 2IY2A 4N6NB 3LTDA 3FZWA 1RGHA 5AIHA 1EG9B 1CH0A 1GSPA 5IERA 2HMMB 1STFI 2H0HA 2KF5A 1FUSA 2L4VA 2IUKA 3KN4A 3NM7A 2UUGC 4KFDA 3GAXA 1HYFA 1R4YA 1C7HA 3B8LA 3OWUA 1YJ93 3BLZA 2Z7AA 3U97A 2CH9A 1GY7A 1ISKA 1GMRA 1B2SA 4FCJA 1V58A 2GEYA 5FW5A 1G02A 1N8QA 2M7OA 2XR8B 1N8R4 1Q814 3CPOA 3B4OA 3NX0A 1OF5A 3CC73 3DUKA 4IIAA 2IUJA 3AHWA 3NUVA 2MF7A 5JPPA 1W01A 1JBRA 1QAKA 1QMAA 1LOYA 1BNRA 5FGOA 2Q07A 1FA3A 4R80A 3SVAA 3K5TA 1EEJA 1VQO3 3I0YA 3LTAA 1RGEA 3EB8A 1W6GA 3LXUX 3DGYA 1WMPA 1RN1A 2RNTA 3B4PA 1IV7A 4KZ1A 1I2GA 2YX9A 3ALAA 4OVMA 1N5PA 3GWRA 2MC8A 1F8NA 1OCVA 3F7SA 1TU5A 3BNEA 4CDLA 2WGOA 2Z77A 3T8UA 5EQLA 1GD4A 2SARA 4MMXB 1K9M4 1JN5A 1Z1SA 1ROVA 1L5GB 3CCR3 2QA43 1IYYA 1IDPA 4AKZA 4HM1B 3CNXA 2P38A 2F56A 5AIGA 2Z76A 2CG1A 2KCDA 3EN8A 2BMQB 3CPW2 1BRNL 4HM3B 1K734 3KCHA 1AR0A 3H51A 4RNZA 3WOFB 4BL2A 1S723 2BT3A 1RTUA 3Q90A 3BB9A 3VSYA 4GL6A 1LRAA 1CQSA 2F86B 1KWIA 3RNTA 2QEX3 1VQ43 1I0VA 3GZBA 4N6TA 2OQEC 2F99A 4XM4A 4ZM8A 3F8HA 3GZRA 5AYSC 4LGQA 1FGTA 4NREA 3LT8A 3ROBA 1MWTA 2H0IA 2P0MA 1BNIA 3CCM3 2JDIH 4GB5A 1JRQA 2GU1A 2Z6BA 3IMAB 1NB3I 1BAOA 3KFQC 3G8ZA 2YFLB 1I3IA 5AYRB 1KQS2 3ER7A 3E99A 1B27A 1LNIA 4LZIA 1RNBA 4EXRA 3JUQA 4MMZB 1C54A 1BNEA 2BIRA 1W2B2 3NXJA 5AIIA 3NHXA 5JBSA 3J7Yd 3BNCA 4BTXA 1UCKA 1QJGA 1B2ZA 3UNLA 4LYLB 4IT7A 4WWUC 4CPKA 1VQK3 1KC84 1VQN3 1BRHA 4K1VA 3HZPA 3OXAA 4TX4A 1DMQA 3Q2PA 2W56A 3K9MC 1OHPA 1E3RA 4ORLA 1MGWA 4N6MA 2HOHA 2KF6A 2RFRA 3TDGA 1V57A 3PCSA 2XSHB 1FYSA 2XF3A 1GD3A 2C4BA 4RNYA 3WMDA 5A0OB 2CKFB 1BOXA 3PYJA 4N6UA 2WGQA 2OOVA 3AMOB 1IK3A 2Y74A 1NB5I 3H3HA 2AADA 2C10A 1YGWA 4O3VA 3V99A 1WMNA 1YJW3 1A2VA 1FGMA 4X2HA 1MWRA 3SYUA 3I563 3LOYA 3F8XA 1FUWA 3U1WA 4HZ9B 2AAEA 5BIRA 1AVLA 1T3BA 1UCIA 4R4KA 4HM2B 3S28A 3X3ZA 1IT7A 1A2PA 3JUNA 1IVXA 1CEWI 1O7MB 3NBJA 4O02B 2IA7A 1TIJA 2I9WA 3SOYA 4HOHA 1VQ63 1I70A 5EEOA 1DE3A 2ML6A 4HM6B 1JZDA 4FMCA 4AKYA 1AY7A 2W03A 4KFFA 3RGRA 2UX0A 4J5GA 3NV0A 3LZAA 1JKGA 3T0UA 1D6YA 5KP3A 3GZXB 1T2HA 1BRIA 3MWZA 4WFOA 1LOVA 1BRKA 2XEPA 3EC9A 5M18A 1AQZA 4HM4B 4R9KA 3PS8A 1IVUA 1HU9A 1TTOA 1VQQA 3WA2X 1ZX2A 4HVNA 3AGOA 4FCMA 2W9PA 5HGRA 1OPYA 2W9QA 1QVG2 1LXEA 1ROAA 5CLKA 1EA2A 1BRJA 2B1XB 2STDA 1YHQ3 2GBWB 1EKMA 2D42A 3CCL3 5GSPA 1M1K4 2CX0A 4QWTA 2RCDA 3ZG5A 4GSPA 1OH0A 4NPBA 2OTL3 4EV5A 1K8A4 3CU3A 1RJOA 2W56B 3G713 2ZL8A 3L0RA 1VQ83 3MG1A 3MG2A 4IPBA 3QRDA 3CXC2 2ZA4A 1E97A 3IPTA 3EX9A 2OWPA 4JF8A 7GSPA 1K41A 1O7WB 3MHEA 4I5QA 4LSOA 1JB5A 4FR9A 5IENA 3BU4A 2WO0A 1SARA 1ULIB 1BVIA 2F4YA 2IMJA 3EE1A 3HX8A 1B2UA 2WOFA 4RNTA 4BTYA 5IG5A 4L8OA 1OACA 3FSDA 1YIJ3 1O7NB 1VQ53 1FGRA 2E2VA 1Q9EA 3WODG 5IEPA 2HMNB 1X1WA 5DRVA 1GMPA 5D81A 1ZO2A 1B2XA 1EUIC 1FGOA 3NQZA 5IW9A 2J8XB 1JV2B 3NBRA 1I0XA 3K63A 2HMJB 4FMDA 5BVBA 3DH2A 1VQM3 3N9HA 7STDA 1AVKA 1JJ22 2CFDA 1V74A 3F40A 1JN5B 1WQLB 1NDOB 2PZVA 4NHFA 1RSNA 1BRSA 4EYCA 3ZFZA 4PEJA 1I2EA 3VGNA 1IT8A 4N6V0 3PGBA 1DVCA 3LT9A 1JB2A 2F5WA 1MNLA 3NV0B 1GY6A 1N5HA 3CCS3 2D1WA 2IYJA 1FZUA 3Q1CA 4MMYB 2CIUA 1JZOA 3MPHA 3SXXA 1A67A 1E3VA 3G0KA 1RRHA 1W00A 1BU4A
chains in the Genus database with same CATH topology
3DXOA 4FMBA 3NBBA 5IG0A 1STDA 4EBGA 1US1A 3STDA 3X42A 3EJVA 3DZLA 3T8NA 3FCSB 5IEOA 2HMOB 1JNQA 3MG3A 5CF2A 3CC23 4HKVB 1GS3A 4I4KA 1Q824 6STDA 2P09A 2CWVA 5CXOA 1M1XB 2F98A 3CCV3 3KIIA 4KFEA 2JQ5A 1A90A 1UUVB 3CCQ3 3FLJA 3CMA3 4XB5A 5ELUA 3GRDA 3LTCA 1QVF2 3CCJ3 1O7HB 1RN7A 1NO3A 3GZYB 5AI1A 5JPUA 2OCTA 2V1LA 3PZWA 1U5OA 3CCU3 2K0MA 1W6CA 1DYUA 3RGAA 5I97A 3KKGA 1OHOA 4XBXA 3UB1A 2XFSA 4N3VA 1CYVA 4HJLB 4KVHA 1KSIA 2CWTA 2QGUA 3HI7A 2XSOB 3LMLA 3FG4A 2GXFA 3UL5A 3DMCA 1IQYA 3RDEA 5CK6A 5G2GA 2Y73A 1TFOA 3JUPA 3DGLA 4EV2A 1Q42A 4H61A 5ELJA 1UI7A 3JVCA 2BMOB 2XH9A 1ULJB 2FGTA 3EQQB 1MOLA 3DM8A 3ECFA 3N54B 1OGXA 4XBYA 3G6E3 3KE7A 3FH1A 5STDA 1A2KA 1D6ZA 3A76A 2ML5A 1RKYA 4L8PA 1N9EA 1PU4A 2LYXA 1OGZA 3KSPA 3BNBA 4HM7B 1HKXA 1CYUA 5IF6A 3D3LA 3JUMA 5D82A 1QALA 2BHMA 2P05A 4OK0A 1JKGB 3CME3 1VQP3 3UL6A 4EC6A 5IG3A 2R4IA 1LVNA 4CCVA 3IJEB 4RBNA 3CD63 1Q7Y4 1DMMA 3SEDA 1YJN3 4WYKA 3JUOA 4K90B 1LOXA 1VZZA 4HM0B 2LQVA 2RGQA 2A15A 2FNQA 2CG0A 1IVWA 3VF1A 4LEHA 2CC3A 2CWUA 2YFIB 2FXTA 5BXQA 3M8CA 4MJDA 3CNMA 1SJWA 1SPUA 1OF5B 4Q53A 1IQ8A 1GY5A 3K0ZA 1M904 4HM5B 3NQYA 2BO9B 1N9JA 3WDGB 4JRFA 1NJI4 3FF0A 5CF1A 3EBTA 2GU3A 3CC43 4LMIA 1M9GA 1U8CB 3G16A 4FMAA 3OWSA 1DVDA 3N8BA 4H3UA 2CFGA 1UW1A 4OUQA 1Y4KA 1QAFA 1YVBI 2YFJB 2XGNA 2B24B 3HIGA 1VQ73 3V92A 2W04A 1O7PB 2K54A 1AV4A 2GBXB 4O8SA 2KXGA 3MKIA 4MEIA 1NU3A 1IQXA 1YIT3 3MSOA 3NM2A 2XRXB 4X2OA 3D9RA 3X41A 4J8TA 2HMLB 2W0QA 3DGMA 1Q40A 2GEXA 3F9SA 4N6OB 3PXMA 4R9LA 3UJMA 4RZMA 3WOEB 1VQL3 3CCE3 1BUQA 3QK9A 2CW9A 1UI8A 3FF2A 1FGQA 4FCZA 1SQWA 3LTBA 2O9UX 4K1UA 4ZM8A 1TU5A 1VQ43 1S5AA 2E2UA 3V98A 1D6UA 5LC6A 3KSED 5AEWB 2ZDJA 3OW22 1J2BA 2OOVC 3B7CA 1TFKA 3WA3A 4J9AA 4WYKB 8CHOA 3S27A 1K28A 2SBLA 1VQ93 3HIIA 3SLUA 3PCRA 1G96A 1EQKA 3OX9A 3LH4A 5KP1A 2CFLA 1NWWA 1OUNA 4L7KA 2W2CA 3SX1A 1W2ZA 2WOHA 1IV9A 2RSXA 3EF8A 3HK4A 1W02A 4O2HA 3EN1B 5AIFA 1LNHA 4BTWA 1WTHA 5IG4A 3SOAA 1Q864 4HYZA 2CFKA 3FGYA 4N6LA 2OQEA 1T5YA 5KP4A 1W7CA 3FKAA 2XGLA 1KD14 2CK3H 3G4S3 4XDWA 1SIIA 2HMKB 4XBTA 3AMOA 1O7GB 3DGOA 3X40A 3BNDA 3DGNA 2CFWA 3FG3A 2XFTA 2KRTA 3EHCA 1YGEA 2W6JH 3K7CA 1DMNA 2C11A 3KZTA 2O3OA 5EVHA 1W5ZA 2BNGA 4G1MB 3OV4A 4HBRA 1WMOA 1RRLA 1IVVA 3LYGA 4U13A 1TP6A 3MYTA 4K61A 5AEUB 3DY5A 1TUHA 5DREA 3F7XA 3O8YA 3S5CA 2OTJ3 1R4CA 1Q40B 4HZBB 1OHSA 5D83A 1PFPA 5LC7A 1UUWB 4XDVA 4STDA 1W4NA 3F14A 3S29A 1WNHA 2P0XA 3X3XA 1IU7A 1JB4A 1ASKA 5TGNA 1W6YA 2E2TA 3S67A 4AEQA 1YI23 2PNCA 4R1KA 3OWYA 1SIHA 2BMRB 3I553 2QIYA 1GYBA 2CHCA 4HM8B 3X3YA 3FG1A 3EBYA 4WP5A 4N6NB 3LTDA 3FZWA 5AIHA 1EG9B 5IERA 2HMMB 1STFI 2L4VA 2IUKA 3KN4A 3NM7A 4KFDA 3GAXA 3B8LA 3OWUA 1C7HA 1YJ93 3BLZA 2Z7AA 3U97A 2CH9A 1GY7A 1ISKA 4FCJA 5FW5A 2GEYA 1N8QA 2M7OA 2XR8B 1N8R4 1Q814 3CPOA 3B4OA 3NX0A 1OF5A 3CC73 3DUKA 4IIAA 2IUJA 3NUVA 2MF7A 5JPPA 1W01A 1FA3A 1QAKA 1QMAA 5FGOA 2Q07A 4R80A 3SVAA 3K5TA 1VQO3 3I0YA 3LTAA 3EB8A 1W6GA 3LXUX 1WMPA 3B4PA 1IV7A 4KZ1A 2YX9A 3ALAA 4OVMA 1N5PA 3GWRA 2MC8A 1F8NA 1OCVA 3F7SA 3BNEA 4CDLA 2WGOA 2Z77A 3T8UA 5EQLA 1GD4A 4MMXB 1K9M4 1JN5A 1Z1SA 1ROVA 1L5GB 3CCR3 2QA43 1IDPA 4AKZA 1W00A 4HM1B 3CNXA 2P38A 5AIGA 2CG1A 2Z76A 3CPW2 2KCDA 3EN8A 2BMQB 4HM3B 1K734 1AR0A 3H51A 4RNZA 3WOFB 1S723 2BT3A 3Q90A 3BB9A 3VSYA 4GL6A 2QEX3 1CQSA 2F86B 1KWIA 3GZBA 4N6TA 2OQEC 2F99A 4XM4A 3F8HA 3GZRA 5AYSC 4LGQA 1FGTA 4NREA 3LT8A 3ROBA 2P0MA 3CCM3 2JDIH 4GB5A 1JRQA 2GU1A 2Z6BA 3IMAB 1NB3I 3KFQC 3G8ZA 2YFLB 5AYRB 1KQS2 3ER7A 3E99A 4LZIA 4EXRA 3JUQA 4MMZB 1W2B2 3NXJA 5AIIA 3NHXA 5JBSA 3J7Yd 3BNCA 4BTXA 1QJGA 3UNLA 4IT7A 4WWUC 1VQK3 1KC84 1VQN3 4K1VA 3HZPA 3OXAA 4TX4A 1DMQA 3Q2PA 2W56A 3K9MC 1OHPA 1E3RA 4ORLA 4N6MA 3TDGA 2RFRA 3PCSA 2XSHB 2XF3A 1GD3A 4RNYA 3WMDA 5A0OB 2CKFB 3PYJA 4N6UA 2WGQA 2OOVA 3AMOB 1IK3A 2Y74A 1NB5I 3H3HA 4O3VA 2C10A 3V99A 1YJW3 1WMNA 1A2VA 1FGMA 4X2HA 3I563 3LOYA 3F8XA 1FUWA 3U1WA 4HZ9B 1AVLA 4R4KA 4HM2B 3S28A 3X3ZA 1IT7A 3JUNA 1IVXA 1CEWI 1O7MB 3NBJA 4O02B 2IA7A 1TIJA 2I9WA 3SOYA 1VQ63 5EEOA 2ML6A 4HM6B 4FMCA 4AKYA 2W03A 4KFFA 3RGRA 2UX0A 3NV0A 3LZAA 1JKGA 3T0UA 1D6YA 5KP3A 3GZXB 3MWZA 4WFOA 3EC9A 2XEPA 4HM4B 4R9KA 3PS8A 1IVUA 1HU9A 3WA2X 1ZX2A 4HVNA 4FCMA 2W9PA 5HGRA 1OPYA 2W9QA 1QVG2 1LXEA 1ROAA 5CLKA 1EA2A 2B1XB 2STDA 1YHQ3 2GBWB 1EKMA 2D42A 3CCL3 1M1K4 4QWTA 2RCDA 1OH0A 2OTL3 4EV5A 1K8A4 3CU3A 1RJOA 2W56B 3G713 2ZL8A 3L0RA 1VQ83 3MG1A 3MG2A 4IPBA 3QRDA 3CXC2 1E97A 3IPTA 3EX9A 2OWPA 4JF8A 1K41A 1O7WB 3MHEA 4LSOA 1JB5A 4FR9A 5IENA 2WO0A 1ULIB 2IMJA 3EE1A 3HX8A 4BTYA 2WOFA 5IG5A 1YIJ3 1VQ53 4L8OA 1OACA 3FSDA 1O7NB 1FGRA 2E2VA 3WODG 5IEPA 2HMNB 5DRVA 5D81A 1ZO2A 3NQZA 1FGOA 5IW9A 1JV2B 3NBRA 3K63A 4FMDA 2HMJB 5BVBA 1VQM3 3N9HA 7STDA 1AVKA 1JJ22 2CFDA 1V74A 3F40A 1JN5B 1WQLB 1NDOB 2PZVA 4NHFA 4EYCA 4PEJA 3VGNA 1IT8A 4N6V0 3PGBA 1DVCA 3LT9A 1JB2A 1MNLA 3NV0B 1GY6A 1N5HA 3CCS3 2D1WA 3Q1CA 4MMYB 2CIUA 3MPHA 3SXXA 1A67A 1E3VA 3G0KA 1RRHA 2INXA 4WHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R1K A;  3DXO A;  3WMD A;  2CKF B;  3OWY A;  5IG0 A;  1STD A;  2BMR B;  2YFJ B;  2QIY A;  1GYB A;  2CHC A;  4HM8 B;  3EJV A;  3STD A;  3EBY A;  3DZL A;  2B24 B;  4WP5 A;  3T8N A;  5IEO A;  2HMO B;  3FZW A;  3MG3 A;  5CF2 A;  5AIH A;  1EG9 B;  3H3H A;  4HKV B;  1GS3 A;  4I4K A;  5IER A;  6STD A;  2HMM B;  4X2H A;  1O7P B;  5CXO A;  2K54 A;  3F8X A;  2F98 A;  4HZ9 B;  3B8L A;  3OWU A;  1C7H A;  2GBX B;  4HM2 B;  2JQ5 A;  3MKI A;  1NU3 A;  2Z7A A;  3BLZ A;  3JUN A;  1UUV B;  3MSO A;  1GY7 A;  1O7M B;  3FLJ A;  2XRX B;  3NM2 A;  1ISK A;  4X2O A;  4XB5 A;  2I9W A;  4FCJ A;  5FW5 A;  2GEY A;  3SOY A;  3D9R A;  2XR8 B;  3GRD A;  3CPO A;  3B4O A;  1OF5 A;  4J8T A;  2HML B;  4R9L A;  1Q40 A;  2GEX A;  3DUK A;  3F9S A;  4IIA A;  3UJM A;  1O7H B;  4HM6 B;  3NUV A;  3GZY B;  4RZM A;  5AI1 A;  1W01 A;  5JPP A;  1QMA A;  3RGR A;  1BUQ A;  2UX0 A;  3NV0 A;  3FF2 A;  3I0Y A;  4K1U A;  3LZA A;  1U5O A;  1JKG A;  1S5A A;  5KP3 A;  5AEW B;  3B4P A;  3GZX B;  3RGA A;  3EC9 A;  4OVM A;  3B7C A;  3GWR A;  3KKG A;  4HM4 B;  4R9K A;  1OHO A;  1OCV A;  3F7S A;  4XBX A;  4J9A A;  4WYK B;  8CHO A;  1ZX2 A;  4HVN A;  4FCM A;  4N3V A;  4CDL A;  5HGR A;  4HJL B;  4KVH A;  2Z77 A;  3T8U A;  2QGU A;  1OPY A;  2XSO B;  5CLK A;  1JN5 A;  1EA2 A;  1Z1S A;  2GXF A;  3DMC A;  3OX9 A;  5KP1 A;  1IDP A;  2B1X B;  2STD A;  1NWW A;  1OUN A;  4HM1 B;  4L7K A;  5CK6 A;  3CNX A;  5G2G A;  5AIG A;  2W2C A;  2GBW B;  2Z76 A;  3EN8 A;  2BMQ B;  3JUP A;  4HM3 B;  3EF8 A;  1Q42 A;  1W02 A;  3HK4 A;  2RCD A;  3EN1 B;  1AR0 A;  3H51 A;  2BMO B;  5AIF A;  1ULJ B;  3EQQ B;  1OH0 A;  3Q90 A;  3DM8 A;  3BB9 A;  3CU3 A;  1OGX A;  3ECF A;  4XBY A;  1CQS A;  2F86 B;  3KE7 A;  3FH1 A;  3SOA A;  3VSY A;  3FGY A;  5STD A;  3MG1 A;  3MG2 A;  5JPU A;  1A2K A;  3A76 A;  1E97 A;  3IPT A;  5KP4 A;  3EX9 A;  2OWP A;  3GZB A;  3FKA A;  1K41 A;  4L8P A;  2F99 A;  1O7W B;  3MHE A;  4XM4 A;  5IG4 A;  1JB5 A;  1OGZ A;  3KSP A;  4XDW A;  5IEN A;  4HM7 B;  1HKX A;  3F8H A;  2HMK B;  4XBT A;  5IF6 A;  1ULI B;  1O7G B;  2IMJ A;  3GZR A;  3JUM A;  4LGQ A;  5D82 A;  1JKG B;  3HX8 A;  5IG5 A;  4L8O A;  3FSD A;  3ROB A;  5IG3 A;  1O7N B;  2R4I A;  5IEP A;  3EHC A;  2HMN B;  4GB5 A;  5DRV A;  5D81 A;  1DMM A;  1ZO2 A;  3K7C A;  1DMN A;  3SED A;  3G8Z A;  2YFL B;  3KZT A;  4WYK A;  3JUO A;  5EVH A;  3NBR A;  1VZZ A;  2BNG A;  2HMJ B;  3ER7 A;  3OV4 A;  2RGQ A;  3E99 A;  4HM0 B;  2A15 A;  5BVB A;  3LYG A;  4U13 A;  7STD A;  3JUQ A;  1TP6 A;  3MYT A;  3F40 A;  1JN5 B;  1WQL B;  1NDO B;  2PZV A;  3NXJ A;  2YFI B;  4LEH A;  5AII A;  3M8C A;  3NHX A;  5AEU B;  4OUQ A;  5BXQ A;  1TUH A;  5DRE A;  4MJD A;  3CNM A;  1SJW A;  3F7X A;  1OF5 B;  4Q53 A;  3S5C A;  1QJG A;  1Q40 B;  3UNL A;  4PEJ A;  4WWU C;  1GY5 A;  4HZB B;  3VGN A;  1OHS A;  3K0Z A;  5D83 A;  4HM5 B;  1JB2 A;  1UUW B;  4K1V A;  3HZP A;  3NV0 B;  3OXA A;  4STD A;  4XDV A;  1DMQ A;  1GY6 A;  3F14 A;  3FF0 A;  5CF1 A;  3EBT A;  1OHP A;  1JB4 A;  1E3R A;  3G16 A;  4LMI A;  4ORL A;  1ASK A;  2RFR A;  3OWS A;  5TGN A;  1E3V A;  1W6Y A;  2INX A;  2XSH B;  3G0K A;  4H3U A;  1W00 A; 
#chains in the Genus database with same CATH topology
 3DXO A;  1LQG C;  4FMB A;  9RNT A;  1BNF A;  3GSP A;  3NBB A;  5IG0 A;  1STD A;  4EBG A;  1US1 A;  3STD A;  3X42 A;  3EJV A;  4BIR A;  4CJN A;  1NNV A;  3DZL A;  3T8N A;  3FCS B;  5IEO A;  2HMO B;  1JNQ A;  3MG3 A;  5CF2 A;  3CC2 3;  1RLS A;  1X1X A;  4HKV B;  1GS3 A;  4I4K A;  1Q82 4;  6STD A;  2P09 A;  2R41 A;  1B2M A;  2CWV A;  5CXO A;  1M1X B;  2F98 A;  3CCV 3;  3KII A;  1BNS A;  4KFE A;  2JQ5 A;  2L1S A;  4BU4 A;  1A90 A;  2CX1 A;  1UUV B;  3CCQ 3;  3FLJ A;  3CMA 3;  3A5E A;  1YVS A;  4XB5 A;  5RNT A;  5ELU A;  3GRD A;  1B21 A;  3LTC A;  1TRP A;  1QVF 2;  4WHA A;  1GOY A;  3CCJ 3;  1O7H B;  1RN7 A;  1BSA A;  1NO3 A;  3GZY B;  5AI1 A;  5JPU A;  2KF3 A;  2OCT A;  2V1L A;  4J5K A;  3PZW A;  3D4A A;  1U5O A;  3CCU 3;  2K0M A;  1W6C A;  1DYU A;  1BAN A;  3RGA A;  5I97 A;  3KKG A;  2F5M A;  1OHO A;  2KAA A;  1BNG A;  4XBX A;  3UB1 A;  2XFS A;  4N3V A;  1CYV A;  4HJL B;  4KVH A;  1KSI A;  2CWT A;  2QGU A;  2K3D A;  2XSO B;  3HI7 A;  3LML A;  3FG4 A;  2GXF A;  3UL5 A;  1BRG A;  3DMC A;  1IQY A;  3RDE A;  5CK6 A;  5G2G A;  2Y73 A;  1TFO A;  3JUP A;  3DGL A;  1JBT A;  4EV2 A;  1Q42 A;  4H61 A;  5ELJ A;  1I8V A;  1UI7 A;  2BMO B;  2XH9 A;  1ULJ B;  2FGT A;  3EQQ B;  3JVC A;  1MOL A;  3DM8 A;  3ECF A;  3N54 B;  1OGX A;  4XBY A;  3G6E 3;  3KE7 A;  4BL3 A;  3FH1 A;  1HZ1 A;  5STD A;  1A2K A;  1D6Z A;  3A76 A;  2ML5 A;  1RKY A;  4L8P A;  1N9E A;  1PU4 A;  4ILF A;  2LYX A;  4HAA A;  1OGZ A;  3KSP A;  3BNB A;  4HM7 B;  1HKX A;  1CYU A;  5IF6 A;  3D3L A;  3JUM A;  5D82 A;  1T2I A;  1QAL A;  2BHM A;  2P05 A;  4OK0 A;  1JKG B;  3CME 3;  1VQP 3;  3UL6 A;  1UGI A;  4EC6 A;  5IG3 A;  2R4I A;  1LVN A;  4GHO A;  3IJE B;  4CCV A;  4RBN A;  3CD6 3;  1RCL A;  1Q7Y 4;  1DMM A;  3SED A;  1YJN 3;  1RMS A;  4WYK A;  3JUO A;  4K90 B;  1LOX A;  1VZZ A;  4HM0 B;  2LQV A;  2RGQ A;  2A15 A;  2FNQ A;  2CG0 A;  1IVW A;  3VF1 A;  1LQM B;  1UDI I;  4LEH A;  2GSP A;  2CC3 A;  6RNT A;  2CWU A;  2YFI B;  2FXT A;  5BXQ A;  3M8C A;  4MJD A;  4EW5 A;  3CNM A;  1SJW A;  1SPU A;  1OF5 B;  4Q53 A;  2KF4 A;  1IQ8 A;  1GY5 A;  3K0Z A;  1M90 4;  4HM5 B;  3NQY A;  2BO9 B;  1N9J A;  3WDG B;  4JRF A;  1GOV A;  1NJI 4;  3AGN A;  3FF0 A;  5CF1 A;  2GU3 A;  3EBT A;  3CC4 3;  4LMI A;  1B3S A;  1M9G A;  1U8C B;  3G16 A;  4FMA A;  3OWS A;  1DVD A;  1RDS A;  1MWS A;  2INX A;  3N8B A;  4H3U A;  2CFG A;  1UW1 A;  4OUQ A;  1Y4K A;  1QAF A;  1YVB I;  1JBS A;  2YFJ B;  1RHL A;  2XGN A;  2B24 B;  5BU4 A;  1YNV X;  3HIG A;  1FW7 A;  1BSC A;  1VQ7 3;  3V92 A;  2W04 A;  1PYL A;  1G0T A;  1LOW A;  1O7P B;  2K54 A;  1BIR A;  1AV4 A;  1RGL A;  2GBX B;  2ZHX B;  2KXG A;  3MKI A;  4MEI A;  1NU3 A;  1IQX A;  4O8S A;  1DET A;  1YIT 3;  3MSO A;  3NM2 A;  2XRX B;  1UGH I;  3ZG0 A;  4X2O A;  3AHS A;  3D9R A;  3X41 A;  4J8T A;  2HML B;  2W0Q A;  1RNT A;  1Q40 A;  2GEX A;  3DGM A;  3F9S A;  3PXM A;  4N6O B;  4R9L A;  4RZM A;  3UJM A;  3WOE B;  3CCE 3;  1VQL 3;  1BUQ A;  1X1U A;  1RGF A;  3QK9 A;  2CW9 A;  1UI8 A;  5M1A A;  1BNJ A;  3FF2 A;  1FGQ A;  4FCZ A;  1B20 A;  1SQW A;  1UUG B;  2O9U X;  3LTB A;  1BGS A;  3D79 A;  1S5A A;  4DKI A;  2E2U A;  3V98 A;  1D6U A;  5LC6 A;  3KSE D;  5AEW B;  2ZDJ A;  3OW2 2;  1J2B A;  3BIR A;  2OOV C;  3HOH A;  3B7C A;  1TFK A;  1RGC A;  3WA3 A;  4J9A A;  4WYK B;  8CHO A;  3S27 A;  1K28 A;  2SBL A;  1VQ9 3;  2RBI A;  3HII A;  3SLU A;  1UCJ A;  3D5G A;  3PCR A;  1G96 A;  1EQK A;  3OX9 A;  3LH4 A;  5KP1 A;  2CFL A;  1PY3 A;  1FUT A;  1NWW A;  1OUN A;  4L7K A;  3WR2 A;  2W2C A;  3SX1 A;  1W2Z A;  2WOH A;  2BU4 A;  1IV9 A;  2RSX A;  3EF8 A;  3HK4 A;  1W02 A;  4O2H A;  3EN1 B;  5AIF A;  1RGK A;  1TJD A;  1LNH A;  4BTW A;  6GSP A;  1WTH A;  5IG4 A;  3SOA A;  1Q86 4;  4HYZ A;  2CFK A;  3FGY A;  4N6L A;  2OQE A;  1T5Y A;  7RNT A;  5HOH A;  1BUJ A;  1GOU A;  1TRQ A;  1W7C A;  5KP4 A;  3FKA A;  1RGG A;  2XGL A;  1ZS7 A;  1KD1 4;  2CK3 H;  3G4S 3;  4XDW A;  1SII A;  2HMK B;  1Q7H A;  4XBT A;  5G1K A;  3AMO A;  5G1L A;  1O7G B;  3DGO A;  3X40 A;  1GMQ A;  3BND A;  3DGN A;  4KT3 B;  1X1Y A;  1RCK A;  2CFW A;  3FG3 A;  2XFT A;  2KRT A;  1I2F A;  1RN4 A;  2UGI A;  1YGE A;  2W6J H;  3EHC A;  3K7C A;  1DMN A;  2C11 A;  3KZT A;  2O3O A;  5EVH A;  1W5Z A;  2BNG A;  4G1M B;  5M19 A;  3OV4 A;  1UCL A;  4HBR A;  1WMO A;  1RRL A;  1IVV A;  3LYG A;  4U13 A;  1TP6 A;  1MGR A;  3MYT A;  3WHO A;  1MWU A;  1ZGX A;  4K61 A;  5AEU B;  3URP A;  3DY5 A;  1RGA A;  1TUH A;  5DRE A;  3F7X A;  1I3F A;  3O8Y A;  3S5C A;  2OTJ 3;  1R4C A;  1Q40 B;  3D5I A;  4HZB B;  1OHS A;  5D83 A;  1PFP A;  5LC7 A;  1UUW B;  4XDV A;  3Q3F A;  4STD A;  1BSD A;  1W4N A;  3F14 A;  3S29 A;  1WNH A;  2P0X A;  3X3X A;  1IU7 A;  1JB4 A;  1ASK A;  2H0G A;  4K1U A;  5TGN A;  8RNT A;  1W6Y A;  2E2T A;  3S67 A;  4AEQ A;  1BSB A;  1YI2 3;  2PNC A;  4R1K A;  3OWY A;  1SIH A;  2BMR B;  3I55 3;  2QIY A;  1GYB A;  2CHC A;  4HM8 B;  3X3Y A;  3FG1 A;  3EBY A;  4WP5 A;  1BSE A;  2IY2 A;  4N6N B;  3LTD A;  3FZW A;  1RGH A;  5AIH A;  1EG9 B;  1CH0 A;  1GSP A;  5IER A;  2HMM B;  1STF I;  2H0H A;  2KF5 A;  1FUS A;  2L4V A;  2IUK A;  3KN4 A;  3NM7 A;  2UUG C;  4KFD A;  3GAX A;  1HYF A;  1R4Y A;  1C7H A;  3B8L A;  3OWU A;  1YJ9 3;  3BLZ A;  2Z7A A;  3U97 A;  2CH9 A;  1GY7 A;  1ISK A;  1GMR A;  1B2S A;  4FCJ A;  1V58 A;  2GEY A;  5FW5 A;  1G02 A;  1N8Q A;  2M7O A;  2XR8 B;  1N8R 4;  1Q81 4;  3CPO A;  3B4O A;  3NX0 A;  1OF5 A;  3CC7 3;  3DUK A;  4IIA A;  2IUJ A;  3AHW A;  3NUV A;  2MF7 A;  5JPP A;  1W01 A;  1JBR A;  1QAK A;  1QMA A;  1LOY A;  1BNR A;  5FGO A;  2Q07 A;  1FA3 A;  4R80 A;  3SVA A;  3K5T A;  1EEJ A;  1VQO 3;  3I0Y A;  3LTA A;  1RGE A;  3EB8 A;  1W6G A;  3LXU X;  3DGY A;  1WMP A;  1RN1 A;  2RNT A;  3B4P A;  1IV7 A;  4KZ1 A;  1I2G A;  2YX9 A;  3ALA A;  4OVM A;  1N5P A;  3GWR A;  2MC8 A;  1F8N A;  1OCV A;  3F7S A;  1TU5 A;  3BNE A;  4CDL A;  2WGO A;  2Z77 A;  3T8U A;  5EQL A;  1GD4 A;  2SAR A;  4MMX B;  1K9M 4;  1JN5 A;  1Z1S A;  1ROV A;  1L5G B;  3CCR 3;  2QA4 3;  1IYY A;  1IDP A;  4AKZ A;  4HM1 B;  3CNX A;  2P38 A;  2F56 A;  5AIG A;  2Z76 A;  2CG1 A;  2KCD A;  3EN8 A;  2BMQ B;  3CPW 2;  1BRN L;  4HM3 B;  1K73 4;  3KCH A;  1AR0 A;  3H51 A;  4RNZ A;  3WOF B;  4BL2 A;  1S72 3;  2BT3 A;  1RTU A;  3Q90 A;  3BB9 A;  3VSY A;  4GL6 A;  1LRA A;  1CQS A;  2F86 B;  1KWI A;  3RNT A;  2QEX 3;  1VQ4 3;  1I0V A;  3GZB A;  4N6T A;  2OQE C;  2F99 A;  4XM4 A;  4ZM8 A;  3F8H A;  3GZR A;  5AYS C;  4LGQ A;  1FGT A;  4NRE A;  3LT8 A;  3ROB A;  1MWT A;  2H0I A;  2P0M A;  1BNI A;  3CCM 3;  2JDI H;  4GB5 A;  1JRQ A;  2GU1 A;  2Z6B A;  3IMA B;  1NB3 I;  1BAO A;  3KFQ C;  3G8Z A;  2YFL B;  1I3I A;  5AYR B;  1KQS 2;  3ER7 A;  3E99 A;  1B27 A;  1LNI A;  4LZI A;  1RNB A;  4EXR A;  3JUQ A;  4MMZ B;  1C54 A;  1BNE A;  2BIR A;  1W2B 2;  3NXJ A;  5AII A;  3NHX A;  5JBS A;  3J7Y d;  3BNC A;  4BTX A;  1UCK A;  1QJG A;  1B2Z A;  3UNL A;  4LYL B;  4IT7 A;  4WWU C;  4CPK A;  1VQK 3;  1KC8 4;  1VQN 3;  1BRH A;  4K1V A;  3HZP A;  3OXA A;  4TX4 A;  1DMQ A;  3Q2P A;  2W56 A;  3K9M C;  1OHP A;  1E3R A;  4ORL A;  1MGW A;  4N6M A;  2HOH A;  2KF6 A;  2RFR A;  3TDG A;  1V57 A;  3PCS A;  2XSH B;  1FYS A;  2XF3 A;  1GD3 A;  2C4B A;  4RNY A;  3WMD A;  5A0O B;  2CKF B;  1BOX A;  3PYJ A;  4N6U A;  2WGQ A;  2OOV A;  3AMO B;  1IK3 A;  2Y74 A;  1NB5 I;  3H3H A;  2AAD A;  2C10 A;  1YGW A;  4O3V A;  3V99 A;  1WMN A;  1YJW 3;  1A2V A;  1FGM A;  4X2H A;  1MWR A;  3SYU A;  3I56 3;  3LOY A;  3F8X A;  1FUW A;  3U1W A;  4HZ9 B;  2AAE A;  5BIR A;  1AVL A;  1T3B A;  1UCI A;  4R4K A;  4HM2 B;  3S28 A;  3X3Z A;  1IT7 A;  1A2P A;  3JUN A;  1IVX A;  1CEW I;  1O7M B;  3NBJ A;  4O02 B;  2IA7 A;  1TIJ A;  2I9W A;  3SOY A;  4HOH A;  1VQ6 3;  1I70 A;  5EEO A;  1DE3 A;  2ML6 A;  4HM6 B;  1JZD A;  4FMC A;  4AKY A;  1AY7 A;  2W03 A;  4KFF A;  3RGR A;  2UX0 A;  4J5G A;  3NV0 A;  3LZA A;  1JKG A;  3T0U A;  1D6Y A;  5KP3 A;  3GZX B;  1T2H A;  1BRI A;  3MWZ A;  4WFO A;  1LOV A;  1BRK A;  2XEP A;  3EC9 A;  5M18 A;  1AQZ A;  4HM4 B;  4R9K A;  3PS8 A;  1IVU A;  1HU9 A;  1TTO A;  1VQQ A;  3WA2 X;  1ZX2 A;  4HVN A;  3AGO A;  4FCM A;  2W9P A;  5HGR A;  1OPY A;  2W9Q A;  1QVG 2;  1LXE A;  1ROA A;  5CLK A;  1EA2 A;  1BRJ A;  2B1X B;  2STD A;  1YHQ 3;  2GBW B;  1EKM A;  2D42 A;  3CCL 3;  5GSP A;  1M1K 4;  2CX0 A;  4QWT A;  2RCD A;  3ZG5 A;  4GSP A;  1OH0 A;  4NPB A;  2OTL 3;  4EV5 A;  1K8A 4;  3CU3 A;  1RJO A;  2W56 B;  3G71 3;  2ZL8 A;  3L0R A;  1VQ8 3;  3MG1 A;  3MG2 A;  4IPB A;  3QRD A;  3CXC 2;  2ZA4 A;  1E97 A;  3IPT A;  3EX9 A;  2OWP A;  4JF8 A;  7GSP A;  1K41 A;  1O7W B;  3MHE A;  4I5Q A;  4LSO A;  1JB5 A;  4FR9 A;  5IEN A;  3BU4 A;  2WO0 A;  1SAR A;  1ULI B;  1BVI A;  2F4Y A;  2IMJ A;  3EE1 A;  3HX8 A;  1B2U A;  2WOF A;  4RNT A;  4BTY A;  5IG5 A;  4L8O A;  1OAC A;  3FSD A;  1YIJ 3;  1O7N B;  1VQ5 3;  1FGR A;  2E2V A;  1Q9E A;  3WOD G;  5IEP A;  2HMN B;  1X1W A;  5DRV A;  1GMP A;  5D81 A;  1ZO2 A;  1B2X A;  1EUI C;  1FGO A;  3NQZ A;  5IW9 A;  2J8X B;  1JV2 B;  3NBR A;  1I0X A;  3K63 A;  2HMJ B;  4FMD A;  5BVB A;  3DH2 A;  1VQM 3;  3N9H A;  7STD A;  1AVK A;  1JJ2 2;  2CFD A;  1V74 A;  3F40 A;  1JN5 B;  1WQL B;  1NDO B;  2PZV A;  4NHF A;  1RSN A;  1BRS A;  4EYC A;  3ZFZ A;  4PEJ A;  1I2E A;  3VGN A;  1IT8 A;  4N6V 0;  3PGB A;  1DVC A;  3LT9 A;  1JB2 A;  2F5W A;  1MNL A;  3NV0 B;  1GY6 A;  1N5H A;  3CCS 3;  2D1W A;  2IYJ A;  1FZU A;  3Q1C A;  4MMY B;  2CIU A;  1JZO A;  3MPH A;  3SXX A;  1A67 A;  1E3V A;  3G0K A;  1RRH A;  1W00 A;  1BU4 A; 
#chains in the Genus database with same CATH homology
 3DXO A;  4FMB A;  3NBB A;  5IG0 A;  1STD A;  4EBG A;  1US1 A;  3STD A;  3X42 A;  3EJV A;  3DZL A;  3T8N A;  3FCS B;  5IEO A;  2HMO B;  1JNQ A;  3MG3 A;  5CF2 A;  3CC2 3;  4HKV B;  1GS3 A;  4I4K A;  1Q82 4;  6STD A;  2P09 A;  2CWV A;  5CXO A;  1M1X B;  2F98 A;  3CCV 3;  3KII A;  4KFE A;  2JQ5 A;  1A90 A;  1UUV B;  3CCQ 3;  3FLJ A;  3CMA 3;  4XB5 A;  5ELU A;  3GRD A;  3LTC A;  1QVF 2;  3CCJ 3;  1O7H B;  1RN7 A;  1NO3 A;  3GZY B;  5AI1 A;  5JPU A;  2OCT A;  2V1L A;  3PZW A;  1U5O A;  3CCU 3;  2K0M A;  1W6C A;  1DYU A;  3RGA A;  5I97 A;  3KKG A;  1OHO A;  4XBX A;  3UB1 A;  2XFS A;  4N3V A;  1CYV A;  4HJL B;  4KVH A;  1KSI A;  2CWT A;  2QGU A;  3HI7 A;  2XSO B;  3LML A;  3FG4 A;  2GXF A;  3UL5 A;  3DMC A;  1IQY A;  3RDE A;  5CK6 A;  5G2G A;  2Y73 A;  1TFO A;  3JUP A;  3DGL A;  4EV2 A;  1Q42 A;  4H61 A;  5ELJ A;  1UI7 A;  3JVC A;  2BMO B;  2XH9 A;  1ULJ B;  2FGT A;  3EQQ B;  1MOL A;  3DM8 A;  3ECF A;  3N54 B;  1OGX A;  4XBY A;  3G6E 3;  3KE7 A;  3FH1 A;  5STD A;  1A2K A;  1D6Z A;  3A76 A;  2ML5 A;  1RKY A;  4L8P A;  1N9E A;  1PU4 A;  2LYX A;  1OGZ A;  3KSP A;  3BNB A;  4HM7 B;  1HKX A;  1CYU A;  5IF6 A;  3D3L A;  3JUM A;  5D82 A;  1QAL A;  2BHM A;  2P05 A;  4OK0 A;  1JKG B;  3CME 3;  1VQP 3;  3UL6 A;  4EC6 A;  5IG3 A;  2R4I A;  1LVN A;  4CCV A;  3IJE B;  4RBN A;  3CD6 3;  1Q7Y 4;  1DMM A;  3SED A;  1YJN 3;  4WYK A;  3JUO A;  4K90 B;  1LOX A;  1VZZ A;  4HM0 B;  2LQV A;  2RGQ A;  2A15 A;  2FNQ A;  2CG0 A;  1IVW A;  3VF1 A;  4LEH A;  2CC3 A;  2CWU A;  2YFI B;  2FXT A;  5BXQ A;  3M8C A;  4MJD A;  3CNM A;  1SJW A;  1SPU A;  1OF5 B;  4Q53 A;  1IQ8 A;  1GY5 A;  3K0Z A;  1M90 4;  4HM5 B;  3NQY A;  2BO9 B;  1N9J A;  3WDG B;  4JRF A;  1NJI 4;  3FF0 A;  5CF1 A;  3EBT A;  2GU3 A;  3CC4 3;  4LMI A;  1M9G A;  1U8C B;  3G16 A;  4FMA A;  3OWS A;  1DVD A;  3N8B A;  4H3U A;  2CFG A;  1UW1 A;  4OUQ A;  1Y4K A;  1QAF A;  1YVB I;  2YFJ B;  2XGN A;  2B24 B;  3HIG A;  1VQ7 3;  3V92 A;  2W04 A;  1O7P B;  2K54 A;  1AV4 A;  2GBX B;  4O8S A;  2KXG A;  3MKI A;  4MEI A;  1NU3 A;  1IQX A;  1YIT 3;  3MSO A;  3NM2 A;  2XRX B;  4X2O A;  3D9R A;  3X41 A;  4J8T A;  2HML B;  2W0Q A;  3DGM A;  1Q40 A;  2GEX A;  3F9S A;  4N6O B;  3PXM A;  4R9L A;  3UJM A;  4RZM A;  3WOE B;  1VQL 3;  3CCE 3;  1BUQ A;  3QK9 A;  2CW9 A;  1UI8 A;  3FF2 A;  1FGQ A;  4FCZ A;  1SQW A;  3LTB A;  2O9U X;  4K1U A;  4ZM8 A;  1TU5 A;  1VQ4 3;  1S5A A;  2E2U A;  3V98 A;  1D6U A;  5LC6 A;  3KSE D;  5AEW B;  2ZDJ A;  3OW2 2;  1J2B A;  2OOV C;  3B7C A;  1TFK A;  3WA3 A;  4J9A A;  4WYK B;  8CHO A;  3S27 A;  1K28 A;  2SBL A;  1VQ9 3;  3HII A;  3SLU A;  3PCR A;  1G96 A;  1EQK A;  3OX9 A;  3LH4 A;  5KP1 A;  2CFL A;  1NWW A;  1OUN A;  4L7K A;  2W2C A;  3SX1 A;  1W2Z A;  2WOH A;  1IV9 A;  2RSX A;  3EF8 A;  3HK4 A;  1W02 A;  4O2H A;  3EN1 B;  5AIF A;  1LNH A;  4BTW A;  1WTH A;  5IG4 A;  3SOA A;  1Q86 4;  4HYZ A;  2CFK A;  3FGY A;  4N6L A;  2OQE A;  1T5Y A;  5KP4 A;  1W7C A;  3FKA A;  2XGL A;  1KD1 4;  2CK3 H;  3G4S 3;  4XDW A;  1SII A;  2HMK B;  4XBT A;  3AMO A;  1O7G B;  3DGO A;  3X40 A;  3BND A;  3DGN A;  2CFW A;  3FG3 A;  2XFT A;  2KRT A;  3EHC A;  1YGE A;  2W6J H;  3K7C A;  1DMN A;  2C11 A;  3KZT A;  2O3O A;  5EVH A;  1W5Z A;  2BNG A;  4G1M B;  3OV4 A;  4HBR A;  1WMO A;  1RRL A;  1IVV A;  3LYG A;  4U13 A;  1TP6 A;  3MYT A;  4K61 A;  5AEU B;  3DY5 A;  1TUH A;  5DRE A;  3F7X A;  3O8Y A;  3S5C A;  2OTJ 3;  1R4C A;  1Q40 B;  4HZB B;  1OHS A;  5D83 A;  1PFP A;  5LC7 A;  1UUW B;  4XDV A;  4STD A;  1W4N A;  3F14 A;  3S29 A;  1WNH A;  2P0X A;  3X3X A;  1IU7 A;  1JB4 A;  1ASK A;  5TGN A;  1W6Y A;  2E2T A;  3S67 A;  4AEQ A;  1YI2 3;  2PNC A;  4R1K A;  3OWY A;  1SIH A;  2BMR B;  3I55 3;  2QIY A;  1GYB A;  2CHC A;  4HM8 B;  3X3Y A;  3FG1 A;  3EBY A;  4WP5 A;  4N6N B;  3LTD A;  3FZW A;  5AIH A;  1EG9 B;  5IER A;  2HMM B;  1STF I;  2L4V A;  2IUK A;  3KN4 A;  3NM7 A;  4KFD A;  3GAX A;  3B8L A;  3OWU A;  1C7H A;  1YJ9 3;  3BLZ A;  2Z7A A;  3U97 A;  2CH9 A;  1GY7 A;  1ISK A;  4FCJ A;  5FW5 A;  2GEY A;  1N8Q A;  2M7O A;  2XR8 B;  1N8R 4;  1Q81 4;  3CPO A;  3B4O A;  3NX0 A;  1OF5 A;  3CC7 3;  3DUK A;  4IIA A;  2IUJ A;  3NUV A;  2MF7 A;  5JPP A;  1W01 A;  1FA3 A;  1QAK A;  1QMA A;  5FGO A;  2Q07 A;  4R80 A;  3SVA A;  3K5T A;  1VQO 3;  3I0Y A;  3LTA A;  3EB8 A;  1W6G A;  3LXU X;  1WMP A;  3B4P A;  1IV7 A;  4KZ1 A;  2YX9 A;  3ALA A;  4OVM A;  1N5P A;  3GWR A;  2MC8 A;  1F8N A;  1OCV A;  3F7S A;  3BNE A;  4CDL A;  2WGO A;  2Z77 A;  3T8U A;  5EQL A;  1GD4 A;  4MMX B;  1K9M 4;  1JN5 A;  1Z1S A;  1ROV A;  1L5G B;  3CCR 3;  2QA4 3;  1IDP A;  4AKZ A;  1W00 A;  4HM1 B;  3CNX A;  2P38 A;  5AIG A;  2CG1 A;  2Z76 A;  3CPW 2;  2KCD A;  3EN8 A;  2BMQ B;  4HM3 B;  1K73 4;  1AR0 A;  3H51 A;  4RNZ A;  3WOF B;  1S72 3;  2BT3 A;  3Q90 A;  3BB9 A;  3VSY A;  4GL6 A;  2QEX 3;  1CQS A;  2F86 B;  1KWI A;  3GZB A;  4N6T A;  2OQE C;  2F99 A;  4XM4 A;  3F8H A;  3GZR A;  5AYS C;  4LGQ A;  1FGT A;  4NRE A;  3LT8 A;  3ROB A;  2P0M A;  3CCM 3;  2JDI H;  4GB5 A;  1JRQ A;  2GU1 A;  2Z6B A;  3IMA B;  1NB3 I;  3KFQ C;  3G8Z A;  2YFL B;  5AYR B;  1KQS 2;  3ER7 A;  3E99 A;  4LZI A;  4EXR A;  3JUQ A;  4MMZ B;  1W2B 2;  3NXJ A;  5AII A;  3NHX A;  5JBS A;  3J7Y d;  3BNC A;  4BTX A;  1QJG A;  3UNL A;  4IT7 A;  4WWU C;  1VQK 3;  1KC8 4;  1VQN 3;  4K1V A;  3HZP A;  3OXA A;  4TX4 A;  1DMQ A;  3Q2P A;  2W56 A;  3K9M C;  1OHP A;  1E3R A;  4ORL A;  4N6M A;  3TDG A;  2RFR A;  3PCS A;  2XSH B;  2XF3 A;  1GD3 A;  4RNY A;  3WMD A;  5A0O B;  2CKF B;  3PYJ A;  4N6U A;  2WGQ A;  2OOV A;  3AMO B;  1IK3 A;  2Y74 A;  1NB5 I;  3H3H A;  4O3V A;  2C10 A;  3V99 A;  1YJW 3;  1WMN A;  1A2V A;  1FGM A;  4X2H A;  3I56 3;  3LOY A;  3F8X A;  1FUW A;  3U1W A;  4HZ9 B;  1AVL A;  4R4K A;  4HM2 B;  3S28 A;  3X3Z A;  1IT7 A;  3JUN A;  1IVX A;  1CEW I;  1O7M B;  3NBJ A;  4O02 B;  2IA7 A;  1TIJ A;  2I9W A;  3SOY A;  1VQ6 3;  5EEO A;  2ML6 A;  4HM6 B;  4FMC A;  4AKY A;  2W03 A;  4KFF A;  3RGR A;  2UX0 A;  3NV0 A;  3LZA A;  1JKG A;  3T0U A;  1D6Y A;  5KP3 A;  3GZX B;  3MWZ A;  4WFO A;  3EC9 A;  2XEP A;  4HM4 B;  4R9K A;  3PS8 A;  1IVU A;  1HU9 A;  3WA2 X;  1ZX2 A;  4HVN A;  4FCM A;  2W9P A;  5HGR A;  1OPY A;  2W9Q A;  1QVG 2;  1LXE A;  1ROA A;  5CLK A;  1EA2 A;  2B1X B;  2STD A;  1YHQ 3;  2GBW B;  1EKM A;  2D42 A;  3CCL 3;  1M1K 4;  4QWT A;  2RCD A;  1OH0 A;  2OTL 3;  4EV5 A;  1K8A 4;  3CU3 A;  1RJO A;  2W56 B;  3G71 3;  2ZL8 A;  3L0R A;  1VQ8 3;  3MG1 A;  3MG2 A;  4IPB A;  3QRD A;  3CXC 2;  1E97 A;  3IPT A;  3EX9 A;  2OWP A;  4JF8 A;  1K41 A;  1O7W B;  3MHE A;  4LSO A;  1JB5 A;  4FR9 A;  5IEN A;  2WO0 A;  1ULI B;  2IMJ A;  3EE1 A;  3HX8 A;  4BTY A;  2WOF A;  5IG5 A;  1YIJ 3;  1VQ5 3;  4L8O A;  1OAC A;  3FSD A;  1O7N B;  1FGR A;  2E2V A;  3WOD G;  5IEP A;  2HMN B;  5DRV A;  5D81 A;  1ZO2 A;  3NQZ A;  1FGO A;  5IW9 A;  1JV2 B;  3NBR A;  3K63 A;  4FMD A;  2HMJ B;  5BVB A;  1VQM 3;  3N9H A;  7STD A;  1AVK A;  1JJ2 2;  2CFD A;  1V74 A;  3F40 A;  1JN5 B;  1WQL B;  1NDO B;  2PZV A;  4NHF A;  4EYC A;  4PEJ A;  3VGN A;  1IT8 A;  4N6V 0;  3PGB A;  1DVC A;  3LT9 A;  1JB2 A;  1MNL A;  3NV0 B;  1GY6 A;  1N5H A;  3CCS 3;  2D1W A;  3Q1C A;  4MMY B;  2CIU A;  3MPH A;  3SXX A;  1A67 A;  1E3V A;  3G0K A;  1RRH A;  2INX A;  4WHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...