1Q7Y4

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q7y400
1K8A4 1KD14 1VQ53 1VQN3 3CPW2 1QVG2 3CC73 3I563 1M1K4 1VQ43 1YIJ3 1VQP3 3CCU3 3G6E3 1S723 1Q864 3CMA3 2OTL3 1YHQ3 3CCV3 1Q814 1VQ63 1W2B2 1QVF2 3CCS3 3CCM3 1VQL3 3CC43 3CCL3 3CCJ3 1Q824 1YJ93 1K734 1VQM3 1K9M4 1VQ83 1VQ73 1YIT3 3CCR3 1KC84 1YI23 1NJI4 1KQS2 3G713 3CME3 3G4S3 3CC23 3CCE3 1VQK3 3OW22 1YJN3 1N8R4 2QA43 3CCQ3 1JJ22 1VQ93 2QEX3 3CD63 2OTJ3 1Q7Y4 1YJW3 3I553 3CXC2 1M904 1VQO3
chains in the Genus database with same CATH superfamily
2K0MA 1SARA 2XGLA 2QGUA 1OGXA 2IA7A 5BXQA 1IDPA 1IV9A 4R1KA 3JUQA 4FMBA 2L1SA 1YIJ3 3NM2A 3AGOA 3B4PA 1R4CA 1GOYA 1FZUA 1DMQA 2BIRA 2O3OA 4HM3B 4N6V0 1Q7HA 5LC6A 3CCJ3 1K734 1KSIA 4AKZA 1BVIA 3OWSA 1BSAA 3LXUX 3J7Yd 3D5GA 1VQ83 2CKFB 4N6TA 4WYKA 4BL3A 4H3UA 3IJEB 2W9QA 2CX1A 2RFRA 3G4S3 3HOHA 5D81A 1DMMA 2W56A 2CWTA 1O7MB 1A90A 2OTJ3 1UGHI 2R41A 2YFJB 3M8CA 3PGBA 4FCMA 2PZVA 5M19A 2I9WA 5IW9A 3MG1A 5GSPA 2ZA4A 2KF4A 2CHCA 3I563 3S29A 3Q1CA 2UUGC 1C7HA 1I0XA 1MWUA 2GXFA 1FGOA 2UX0A 3CCV3 1FYSA 3AMOA 3FH1A 3DGMA 1AY7A 1I8VA 4OUQA 2F5WA 1SPUA 5D83A 1HZ1A 3DY5A 4HJLB 1A67A 5RNTA 5ELJA 4AKYA 5IG4A 4BTXA 2YFLB 5HGRA 1SIIA 1DYUA 1WNHA 1YJN3 2YFIB 4KFDA 2OWPA 4HM2B 4HVNA 1Q40A 4L7KA 1F8NA 2GU1A 3UB1A 2HMLB 1UUGB 1TUHA 3PCRA 1GY6A 3GWRA 1GMRA 4RNYA 4R4KA 2P0MA 1BNRA 3EE1A 4LMIA 8CHOA 1QJGA 3BIRA 4N6UA 3AHSA 5JPUA 5BVBA 1R4YA 2HMNB 3KN4A 1BNEA 3MG2A 2FGTA 3WDGB 3O8YA 5EQLA 2KF5A 1SQWA 2BMRB 1RGLA 1ROVA 1UI8A 3CU3A 1IVVA 4HAAA 2P0XA 3OX9A 5DREA 2F4YA 1BNJA 3D9RA 3MPHA 1OHPA 3K9MC 4GSPA 5KP3A 3N9HA 1C54A 3JUOA 3FLJA 5IG5A 1VQ53 3LT8A 2CFKA 3NUVA 2RCDA 5G1LA 1B21A 1L5GB 1HYFA 1RN7A 2D42A 3ROBA 4J5GA 1OGZA 2AADA 4MJDA 4N6NB 1DETA 3CCU3 1V58A 4WYKB 3BNBA 1AVLA 1RGEA 1QAKA 4FMDA 1W4NA 1TRQA 3GSPA 4CPKA 1LRAA 1IV7A 3BNEA 1IQXA 3FG4A 1I3FA 1VQL3 3CC43 1X1XA 1W01A 3CPOA 1E97A 1JZOA 1VQM3 1OPYA 3T8NA 3SX1A 2CH9A 4BIRA 3I0YA 4HZBB 1KC84 3EX9A 3T0UA 5BIRA 5AIGA 3ALAA 3IPTA 3QRDA 3DMCA 3KKGA 3NX0A 1RGKA 4HM6B 1RGFA 4OVMA 1HKXA 5KP4A 1VQ93 2RBIA 1ULJB 3G8ZA 4JRFA 2RNTA 3KIIA 4LYLB 3X40A 3CXC2 1NJI4 3LTAA 1U5OA 1N5PA 1W2ZA 2GEYA 3DGOA 3CPW2 1QVG2 3SYUA 1RRLA 3DZLA 1CH0A 4IIAA 2B24B 2Y74A 2WOHA 3JUMA 4GHOA 4EW5A 1GSPA 1JV2B 1NDOB 2Z7AA 1Q864 1M9GA 3HX8A 1GD3A 1LVNA 3HIIA 3X41A 4EV2A 1W2B2 1BRGA 4N6LA 1Q40B 2O9UX 1V74A 2SBLA 1B3SA 2LYXA 3CNXA 1JKGB 3DGYA 4MEIA 1GY5A 5G2GA 1CYUA 3NHXA 1RRHA 3DXOA 4HKVB 4STDA 3CCE3 1B2MA 1LOXA 3VGNA 3CNMA 1OUNA 2W03A 1LQGC 1ULIB 3Q2PA 1JBTA 4I5QA 3NV0A 1BSCA 3RNTA 1V57A 1BRJA 1D6ZA 1IQYA 1PFPA 3K7CA 7STDA 1FW7A 5CLKA 1X1YA 3F8HA 3U97A 3EC9A 1JZDA 1YVSA 1DMNA 1NU3A 1RGAA 1B20A 1PY3A 3MKIA 1GMPA 2L4VA 4KVHA 3GAXA 1BOXA 2IY2A 1LOWA 1FGQA 3F40A 4O8SA 4ILFA 3CCS3 5IERA 1Q824 3AHWA 1UCJA 2WGOA 4HM8B 5CF2A 1OCVA 1JRQA 1JB5A 3H3HA 3B4OA 1G0TA 4G1MB 1I2FA 3MHEA 3LOYA 1D6YA 1EG9B 1IK3A 5TGNA 1AVKA 2Z76A 3N8BA 1NO3A 3BU4A 1ZGXA 1LNIA 2E2VA 2W9PA 1OHSA 1KD14 3EJVA 1RDSA 3S27A 3OWUA 3AGNA 2GU3A 3B8LA 1ISKA 1O7HB 2BHMA 4FMAA 4FMCA 9RNTA 3ZFZA 1VQP3 3DH2A 2MF7A 2H0IA 2W04A 4EYCA 1B2SA 1TTOA 4XDWA 3KSPA 1BANA 4CDLA 4BTYA 1Q9EA 1UCLA 3D5IA 1N9JA 1K28A 1K9M4 1O7PB 2WGQA 3F7XA 3PCSA 3FG3A 5STDA 3S28A 1STFI 4FCJA 1W5ZA 2CW9A 4R9LA 3CC23 4K1VA 3WODG 4K61A 2XEPA 1N8QA 4J8TA 2QEX3 2BO9B 4MMZB 4RNTA 5FW5A 1VQN3 5IG0A 3MYTA 4X2HA 4EXRA 4JF8A 1E3VA 4WP5A 1A2PA 4GL6A 4IT7A 1ASKA 4N3VA 1PU4A 5DRVA 1I70A 1FGTA 1MWTA 2XF3A 3DM8A 1Q42A 2PNCA 3D3LA 2K54A 1YHQ3 3WMDA 1UI7A 3E99A 3A76A 4ORLA 3DUKA 1QAFA 1OH0A 1US1A 3NV0B 2IUKA 5JBSA 3CCL3 1FUSA 3UL5A 1TJDA 5IG3A 1W6GA 3WHOA 4BL2A 1CEWI 3MSOA 4CCVA 2GSPA 1BGSA 1WMPA 2ZDJA 3OXAA 4LZIA 3K0ZA 3KSED 1N5HA 1TRPA 2GBWB 3FKAA 1JJ22 5M18A 2F86B 3CD63 1WMOA 3V92A 4KT3B 3FCSB 1M904 3PZWA 3H51A 1FUTA 4XDVA 4DKIA 2IUJA 2KF3A 3Q3FA 1RJOA 1B27A 1T2IA 2W2CA 2FXTA 2OQEA 8RNTA 1EEJA 3KFQC 2CFGA 3GRDA 5BU4A 2CFDA 1VQ63 3OWYA 1ZS7A 2HMMB 1TP6A 2BMOB 3DGLA 4K90B 3ECFA 2Z77A 5G1KA 1BSDA 1NB3I 1ROAA 3JVCA 1UGIA 3LTCA 4OK0A 1LNHA 1JN5B 1YI23 1IVXA 1S5AA 1BRNL 3PS8A 3X3YA 3F7SA 1LOYA 4FR9A 3B7CA 1AR0A 3CME3 1TIJA 4KZ1A 3EB8A 2OOVA 3HZPA 1HU9A 1FA3A 3PXMA 4GB5A 4QWTA 2CFWA 6STDA 3I553 1DE3A 3X3XA 1WMNA 1BNFA 1BNGA 4BU4A 5M1AA 2FNQA 1BUQA 1FGRA 5FGOA 1BIRA 3WA2X 1JKGA 1MWSA 1FGMA 4O2HA 2OTL3 3EQQB 4RBNA 2BNGA 3SOYA 1NB5I 1TFKA 2RSXA 1DVDA 1IVWA 4X2OA 2OCTA 3FG1A 4N6OB 5CK6A 2IYJA 4HYZA 2B1XB 1BAOA 3X42A 1CYVA 3D79A 3A5EA 4LSOA 1M1XB 2D1WA 3NQYA 1EKMA 2CX0A 4LGQA 3CCQ3 1GOVA 5CXOA 2KXGA 1Q7Y4 3ZG5A 1J2BA 3GZYB 3EN8A 1G96A 1G02A 5CF1A 1KWIA 5IENA 2HMOB 4PEJA 1JN5A 1UCIA 2H0HA 4HM7B 2HMKB 3G6E3 3L0RA 2A15A 4ZM8A 5A0OB 2INXA 2E2UA 2XFSA 1ZO2A 1RSNA 1O7WB 2K3DA 2Q07A 4WHAA 1GS3A 2C10A 1SJWA 2BMQB 1GY7A 1T2HA 3GZBA 1O7GB 1YGEA 2GBXB 4XM4A 2MC8A 3RGAA 3CCR3 1SIHA 4HM4B 5AEUB 5AYSC 3EHCA 1UCKA 3G0KA 4HZ9B 3NQZA 3K5TA 3UJMA 1RGCA 3S67A 1IT8A 1BRHA 5JPPA 1MGWA 5LC7A 1K41A 2ZHXB 2P05A 3FSDA 4O3VA 2V1LA 1B2XA 1W6CA 2UGIA 1BNSA 4L8PA 4U13A 3DGNA 4XBYA 5AIHA 4NHFA 1NNVA 5IEPA 3NBJA 3SVAA 3CMA3 4EBGA 4XBXA 2CG0A 2CK3H 3HK4A 3IMAB 2XFTA 1RN1A 2XH9A 3K63A 4O02B 3CCM3 2QIYA 2LQVA 3UNLA 3HI7A 4Q53A 4HM1B 1AQZA 1VQ73 3KCHA 5EVHA 2KCDA 3EBYA 1W6YA 4R80A 2HMJB 2HOHA 2CC3A 1W7CA 1LOVA 1X1UA 2QA43 1W02A 2STDA 4WWUC 2J8XB 1O7NB 3FF0A 3VSYA 1RMSA 4XB5A 2XSHB 4AEQA 3LYGA 1JBSA 3BB9A 1TU5A 1OHOA 3ZG0A 1LXEA 4LEHA 4NREA 1VZZA 1UW1A 2AAEA 4BTWA 1IVUA 4HM5B 2P38A 3UL6A 4H61A 2W0QA 3QK9A 5IEOA 1GD4A 1T5YA 3LZAA 1GYBA 2M7OA 5AEWB 2BT3A 5AI1A 3NM7A 1VQQA 1RNBA 3F8XA 4L8OA 5D82A 3F9SA 3WOFB 1BRSA 1KQS2 1OF5A 1QALA 3G713 1VQK3 3T8UA 4J9AA 3EBTA 1YNVX 3NXJA 1YJW3 1IQ8A 1GOUA 5AYRB 1EUIC 1BU4A 3G16A 1K8A4 1B2UA 3SOAA 3LTDA 1RKYA 1IYYA 1RLSA 1M1K4 3LH4A 1VQ43 1WQLB 7RNTA 2XGNA 1W00A 2CFLA 3LT9A 1D6UA 1S723 5IF6A 4HBRA 4MMXB 3RDEA 5KP1A 1Q814 3JUNA 5EEOA 6GSPA 1FUWA 2F99A 4TX4A 2CIUA 3SXXA 1N9EA 3MG3A 3BLZA 2XR8B 3HIGA 4KFEA 4RNZA 3TDGA 4KFFA 1JNQA 3NBBA 2R4IA 3NBRA 1X1WA 3VF1A 3SLUA 2C4BA 1BRIA 2F56A 1AV4A 4NPBA 6RNTA 4IPBA 1YGWA 3FZWA 4R9KA 1RGHA 3V98A 1E3RA 3PYJA 1UDII 3LMLA 3JUPA 2GEXA 2KRTA 1IT7A 1BSBA 1RCLA 2OOVC 4I4KA 2F5MA 3GZXB 5AIFA 3RGRA 2CG1A 3FGYA 1UUWB 1EQKA 1MWRA 3WR2A 3LTBA 3CC73 1RN4A 1WTHA 1BSEA 5ELUA 1JB2A 3X3ZA 4HM0B 1QVF2 4HOHA 1Z1SA 4FCZA 1IU7A 1EA2A 3KE7A 5I97A 1RCKA 4WFOA 1JBRA 2ML6A 1B2ZA 4MMYB 1DVCA 3N54B 2OQEC 3EF8A 1TFOA 2E2TA 3OV4A 3SEDA 1YIT3 1MOLA 1QMAA 1RNTA 2Z6BA 1U8CB 2WOFA 1BUJA 2WO0A 2ZL8A 4RZMA 1RGGA 1N8R4 1STDA 2P09A 1PYLA 2JQ5A 3BNCA 1OACA 1A2KA 7GSPA 1VQO3 1RHLA 5AIIA 3WOEB 2ML5A 3S5CA 1A2VA 2JDIH 3WA3A 3ER7A 1Y4KA 2IMJA 3GZRA 1I2GA 2XSOB 2F98A 3STDA 2Y73A 4EV5A 3FF2A 2C11A 1OF5B 1MNLA 2CWUA 1ZX2A 2W56B 1MGRA 1CQSA 4XBTA 1RTUA 1T3BA 3D4AA 4N6MA 1YJ93 3MWZA 1I0VA 1I2EA 2CWVA 1UUVB 4K1UA 1JB4A 5HOHA 1YVBI 1NWWA 2XRXB 3URPA 2KF6A 1GMQA 2RGQA 2KAAA 4J5KA 1BNIA 3Q90A 3BNDA 2H0GA 1I3IA 4CJNA 3OW22 3V99A 2SARA 2W6JH 3EN1B 3U1WA 4EC6A 2YX9A 1BRKA 3AMOB 3F14A 2BU4A 1LQMB 3KZTA
chains in the Genus database with same CATH topology
2K0MA 2XGLA 2QGUA 1OGXA 2IA7A 5BXQA 1IDPA 1IV9A 4R1KA 3JUQA 4FMBA 1YIJ3 3NM2A 3B4PA 1R4CA 2O3OA 1DMQA 4HM3B 4N6V0 5LC6A 3CCJ3 1K734 1KSIA 4AKZA 3OWSA 3LXUX 3J7Yd 1VQ83 2CKFB 4N6TA 4WYKA 4H3UA 3IJEB 2W9QA 3G4S3 2RFRA 5D81A 1DMMA 2W56A 2CWTA 1O7MB 1A90A 2OTJ3 3PGBA 2YFJB 3M8CA 4FCMA 2PZVA 2I9WA 5IW9A 3MG1A 2CHCA 3I563 3S29A 3Q1CA 1C7HA 2GXFA 1FGOA 2UX0A 3CCV3 3AMOA 3FH1A 3DGMA 4OUQA 1SPUA 5D83A 3DY5A 4HJLB 1A67A 5ELJA 4AKYA 5IG4A 4BTXA 2YFLB 5HGRA 1SIIA 1DYUA 1WNHA 1YJN3 2YFIB 4KFDA 2OWPA 4HM2B 4HVNA 1Q40A 4L7KA 1F8NA 2GU1A 3UB1A 2HMLB 1TUHA 3PCRA 1GY6A 3GWRA 4RNYA 4R4KA 2P0MA 3EE1A 4LMIA 8CHOA 1QJGA 4N6UA 5JPUA 5BVBA 2HMNB 3KN4A 3MG2A 2FGTA 3WDGB 3O8YA 5EQLA 1SQWA 2BMRB 1ROVA 1UI8A 3CU3A 1IVVA 2P0XA 3OX9A 5DREA 3D9RA 3MPHA 1OHPA 3K9MC 5KP3A 3N9HA 3JUOA 3FLJA 5IG5A 1VQ53 3LT8A 2CFKA 3NUVA 2RCDA 1L5GB 1RN7A 2D42A 3ROBA 1OGZA 4MJDA 4N6NB 3CCU3 4WYKB 3BNBA 1AVLA 4FMDA 1QAKA 1W4NA 3BNEA 1IV7A 3FG4A 1IQXA 1VQL3 3CC43 1W01A 3CPOA 1E97A 1VQM3 1OPYA 3T8NA 3SX1A 2CH9A 1KC84 3I0YA 4HZBB 3EX9A 3T0UA 5AIGA 3ALAA 3IPTA 3QRDA 3DMCA 3KKGA 3NX0A 4HM6B 4OVMA 1HKXA 5KP4A 1VQ93 1ULJB 3G8ZA 4JRFA 3KIIA 3CXC2 3X40A 1NJI4 3LTAA 1U5OA 1N5PA 1W2ZA 2GEYA 3DGOA 3CPW2 1QVG2 1RRLA 3DZLA 4IIAA 2B24B 2Y74A 2WOHA 3JUMA 1JV2B 1NDOB 2Z7AA 1Q864 1M9GA 3HX8A 1GD3A 1LVNA 3HIIA 3X41A 4EV2A 1W2B2 4N6LA 1Q40B 2O9UX 1V74A 2SBLA 2LYXA 3CNXA 1JKGB 4MEIA 1GY5A 5G2GA 1CYUA 3NHXA 1RRHA 3DXOA 4HKVB 4STDA 3CCE3 1LOXA 3VGNA 3CNMA 1OUNA 2W03A 3Q2PA 1ULIB 3NV0A 1D6ZA 1IQYA 1PFPA 3K7CA 7STDA 5CLKA 3F8HA 3U97A 3EC9A 1DMNA 1NU3A 3MKIA 4KVHA 2L4VA 3GAXA 3CCS3 3F40A 1FGQA 4O8SA 5IERA 1Q824 2WGOA 4HM8B 5CF2A 1OCVA 1JRQA 1JB5A 3H3HA 3B4OA 4G1MB 3MHEA 3LOYA 1D6YA 1EG9B 1IK3A 5TGNA 1AVKA 2Z76A 3N8BA 1NO3A 2E2VA 2W9PA 1OHSA 1KD14 3EJVA 3S27A 3OWUA 1ISKA 2GU3A 3B8LA 1O7HB 2BHMA 4FMAA 4FMCA 1VQP3 2MF7A 2W04A 4EYCA 4XDWA 3KSPA 4CDLA 4BTYA 1N9JA 1K28A 1K9M4 1O7PB 2WGQA 3F7XA 3PCSA 3FG3A 5STDA 3S28A 1STFI 4FCJA 1W5ZA 2CW9A 4R9LA 3CC23 4K1VA 3WODG 4K61A 2XEPA 1N8QA 4J8TA 2QEX3 2BO9B 4MMZB 5FW5A 1VQN3 5IG0A 3MYTA 4X2HA 4EXRA 4JF8A 1E3VA 4WP5A 4GL6A 4IT7A 1ASKA 4N3VA 1PU4A 5DRVA 1FGTA 2XF3A 3DM8A 1Q42A 2PNCA 3D3LA 2K54A 1YHQ3 3WMDA 1UI7A 3E99A 3A76A 4ORLA 3DUKA 1QAFA 1OH0A 1US1A 3NV0B 2IUKA 5JBSA 3CCL3 5IG3A 3UL5A 1W6GA 1CEWI 3MSOA 4CCVA 1WMPA 2ZDJA 3OXAA 4LZIA 3K0ZA 3KSED 1N5HA 2GBWB 1JJ22 3FKAA 3CD63 2F86B 1WMOA 3V92A 3FCSB 1M904 3PZWA 3H51A 4XDVA 2IUJA 1RJOA 2W2CA 2FXTA 2OQEA 3KFQC 2CFGA 3GRDA 2CFDA 1VQ63 3OWYA 2HMMB 1TP6A 2BMOB 3DGLA 4K90B 3ECFA 2Z77A 1NB3I 1ROAA 3JVCA 3LTCA 4OK0A 1LNHA 1JN5B 1YI23 1IVXA 1S5AA 3PS8A 3X3YA 3F7SA 3CME3 4FR9A 3B7CA 1AR0A 1TIJA 4KZ1A 3EB8A 2OOVA 3HZPA 1HU9A 1FA3A 3PXMA 4GB5A 4QWTA 2CFWA 6STDA 3I553 3X3XA 1WMNA 2FNQA 1BUQA 1FGRA 5FGOA 3WA2X 1JKGA 1FGMA 4O2HA 2OTL3 3EQQB 4RBNA 2BNGA 3SOYA 1NB5I 1TFKA 2RSXA 1DVDA 1IVWA 4X2OA 2OCTA 3FG1A 4N6OB 5CK6A 4HYZA 2B1XB 3X42A 1CYVA 4LSOA 1M1XB 2D1WA 3NQYA 1EKMA 4LGQA 3CCQ3 5CXOA 2KXGA 1Q7Y4 1J2BA 3GZYB 3EN8A 1G96A 5CF1A 1KWIA 5IENA 2HMOB 4PEJA 1JN5A 4HM7B 2HMKB 3G6E3 3L0RA 2A15A 4ZM8A 5A0OB 2INXA 2E2UA 2XFSA 1ZO2A 1O7WB 2Q07A 4WHAA 1GS3A 2C10A 1SJWA 2BMQB 1GY7A 3GZBA 1O7GB 1YGEA 2GBXB 4XM4A 2MC8A 3RGAA 3CCR3 1SIHA 4HM4B 5AEUB 5AYSC 3EHCA 3G0KA 4HZ9B 3NQZA 3K5TA 3UJMA 3S67A 1IT8A 5JPPA 5LC7A 1K41A 2P05A 3FSDA 4O3VA 2V1LA 1W6CA 4L8PA 4U13A 3DGNA 4XBYA 5AIHA 4NHFA 5IEPA 3NBJA 3SVAA 3CMA3 4EBGA 4XBXA 2CG0A 2CK3H 3HK4A 3IMAB 2XFTA 2XH9A 3K63A 4O02B 3CCM3 2QIYA 2LQVA 3UNLA 3HI7A 4Q53A 4HM1B 1VQ73 5EVHA 2KCDA 3EBYA 1W6YA 4R80A 2HMJB 1W7CA 2CC3A 2QA43 1W02A 2STDA 4WWUC 1O7NB 3FF0A 3VSYA 4XB5A 2XSHB 4AEQA 3LYGA 3BB9A 1TU5A 1OHOA 1LXEA 4LEHA 4NREA 1VZZA 1UW1A 4BTWA 1IVUA 4HM5B 2P38A 3UL6A 4H61A 2W0QA 3QK9A 5IEOA 1GD4A 1T5YA 3LZAA 1GYBA 2M7OA 5AEWB 2BT3A 5AI1A 3NM7A 3F8XA 4L8OA 5D82A 3F9SA 3WOFB 1KQS2 1OF5A 1QALA 3G713 1VQK3 3T8UA 4J9AA 3EBTA 3NXJA 1YJW3 1IQ8A 5AYRB 3G16A 1K8A4 3SOAA 3LTDA 1RKYA 1M1K4 3LH4A 1VQ43 1WQLB 2XGNA 1W00A 2CFLA 3LT9A 1D6UA 1S723 5IF6A 4HBRA 4MMXB 3RDEA 5KP1A 1Q814 3JUNA 5EEOA 1FUWA 2F99A 4TX4A 2CIUA 3SXXA 1N9EA 3MG3A 3BLZA 2XR8B 3HIGA 4KFEA 4RNZA 3TDGA 4KFFA 1JNQA 3NBBA 2R4IA 3NBRA 3VF1A 3SLUA 1AV4A 4IPBA 3FZWA 4R9KA 3V98A 1E3RA 3PYJA 3LMLA 3JUPA 2GEXA 2KRTA 1IT7A 4I4KA 2OOVC 3GZXB 5AIFA 3RGRA 2CG1A 3FGYA 1UUWB 1EQKA 3LTBA 3CC73 1WTHA 5ELUA 1JB2A 3X3ZA 4HM0B 1QVF2 1Z1SA 4FCZA 1IU7A 1EA2A 3KE7A 5I97A 4WFOA 2ML6A 4MMYB 1DVCA 3N54B 2OQEC 3EF8A 1TFOA 2E2TA 3OV4A 3SEDA 1YIT3 1MOLA 1QMAA 2Z6BA 1U8CB 2WOFA 2WO0A 2ZL8A 4RZMA 1N8R4 1STDA 2P09A 2JQ5A 3BNCA 1OACA 1A2KA 1VQO3 5AIIA 3WOEB 2ML5A 3S5CA 1A2VA 2JDIH 3WA3A 3ER7A 1Y4KA 2IMJA 3GZRA 2XSOB 3STDA 2F98A 4EV5A 2Y73A 3FF2A 2C11A 1OF5B 1MNLA 2CWUA 1ZX2A 2W56B 1CQSA 4XBTA 4N6MA 1YJ93 3MWZA 2CWVA 1UUVB 4K1UA 1JB4A 1YVBI 1NWWA 2XRXB 2RGQA 3Q90A 3BNDA 3OW22 3V99A 3EN1B 2W6JH 3U1WA 4EC6A 2YX9A 3AMOB 3F14A 3KZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A 4;  1KD1 4;  1VQ5 3;  1VQN 3;  3CPW 2;  1QVG 2;  3CC7 3;  3I56 3;  1M1K 4;  1VQ4 3;  1YIJ 3;  1VQP 3;  3CCU 3;  3G6E 3;  1S72 3;  1Q86 4;  3CMA 3;  2OTL 3;  1YHQ 3;  3CCV 3;  1Q81 4;  1VQ6 3;  1W2B 2;  1QVF 2;  3CCS 3;  3CCM 3;  1VQL 3;  3CC4 3;  3CCL 3;  3CCJ 3;  1Q82 4;  1YJ9 3;  1K73 4;  1VQM 3;  1K9M 4;  1VQ8 3;  1VQ7 3;  1YIT 3;  3CCR 3;  1KC8 4;  1YI2 3;  1NJI 4;  1KQS 2;  3G71 3;  3CME 3;  3G4S 3;  3CC2 3;  3CCE 3;  1VQK 3;  3OW2 2;  1YJN 3;  1N8R 4;  2QA4 3;  3CCQ 3;  1JJ2 2;  1VQ9 3;  2QEX 3;  3CD6 3;  2OTJ 3;  1Q7Y 4;  1YJW 3;  3I55 3;  3CXC 2;  1M90 4;  1VQO 3; 
#chains in the Genus database with same CATH topology
 2K0M A;  1SAR A;  2XGL A;  2QGU A;  1OGX A;  2IA7 A;  5BXQ A;  1IDP A;  1IV9 A;  4R1K A;  3JUQ A;  4FMB A;  2L1S A;  1YIJ 3;  3NM2 A;  3AGO A;  3B4P A;  1R4C A;  1GOY A;  1FZU A;  1DMQ A;  2BIR A;  2O3O A;  4HM3 B;  4N6V 0;  1Q7H A;  5LC6 A;  3CCJ 3;  1K73 4;  1KSI A;  4AKZ A;  1BVI A;  3OWS A;  1BSA A;  3LXU X;  3J7Y d;  3D5G A;  1VQ8 3;  2CKF B;  4N6T A;  4WYK A;  4BL3 A;  4H3U A;  3IJE B;  2W9Q A;  2CX1 A;  2RFR A;  3G4S 3;  3HOH A;  5D81 A;  1DMM A;  2W56 A;  2CWT A;  1O7M B;  1A90 A;  2OTJ 3;  1UGH I;  2R41 A;  2YFJ B;  3M8C A;  3PGB A;  4FCM A;  2PZV A;  5M19 A;  2I9W A;  5IW9 A;  3MG1 A;  5GSP A;  2ZA4 A;  2KF4 A;  2CHC A;  3I56 3;  3S29 A;  3Q1C A;  2UUG C;  1C7H A;  1I0X A;  1MWU A;  2GXF A;  1FGO A;  2UX0 A;  3CCV 3;  1FYS A;  3AMO A;  3FH1 A;  3DGM A;  1AY7 A;  1I8V A;  4OUQ A;  2F5W A;  1SPU A;  5D83 A;  1HZ1 A;  3DY5 A;  4HJL B;  1A67 A;  5RNT A;  5ELJ A;  4AKY A;  5IG4 A;  4BTX A;  2YFL B;  5HGR A;  1SII A;  1DYU A;  1WNH A;  1YJN 3;  2YFI B;  4KFD A;  2OWP A;  4HM2 B;  4HVN A;  1Q40 A;  4L7K A;  1F8N A;  2GU1 A;  3UB1 A;  2HML B;  1UUG B;  1TUH A;  3PCR A;  1GY6 A;  3GWR A;  1GMR A;  4RNY A;  4R4K A;  2P0M A;  1BNR A;  3EE1 A;  4LMI A;  8CHO A;  1QJG A;  3BIR A;  4N6U A;  3AHS A;  5JPU A;  5BVB A;  1R4Y A;  2HMN B;  3KN4 A;  1BNE A;  3MG2 A;  2FGT A;  3WDG B;  3O8Y A;  5EQL A;  2KF5 A;  1SQW A;  2BMR B;  1RGL A;  1ROV A;  1UI8 A;  3CU3 A;  1IVV A;  4HAA A;  2P0X A;  3OX9 A;  5DRE A;  2F4Y A;  1BNJ A;  3D9R A;  3MPH A;  1OHP A;  3K9M C;  4GSP A;  5KP3 A;  3N9H A;  1C54 A;  3JUO A;  3FLJ A;  5IG5 A;  1VQ5 3;  3LT8 A;  2CFK A;  3NUV A;  2RCD A;  5G1L A;  1B21 A;  1L5G B;  1HYF A;  1RN7 A;  2D42 A;  3ROB A;  4J5G A;  1OGZ A;  2AAD A;  4MJD A;  4N6N B;  1DET A;  3CCU 3;  1V58 A;  4WYK B;  3BNB A;  1AVL A;  1RGE A;  1QAK A;  4FMD A;  1W4N A;  1TRQ A;  3GSP A;  4CPK A;  1LRA A;  1IV7 A;  3BNE A;  1IQX A;  3FG4 A;  1I3F A;  1VQL 3;  3CC4 3;  1X1X A;  1W01 A;  3CPO A;  1E97 A;  1JZO A;  1VQM 3;  1OPY A;  3T8N A;  3SX1 A;  2CH9 A;  4BIR A;  3I0Y A;  4HZB B;  1KC8 4;  3EX9 A;  3T0U A;  5BIR A;  5AIG A;  3ALA A;  3IPT A;  3QRD A;  3DMC A;  3KKG A;  3NX0 A;  1RGK A;  4HM6 B;  1RGF A;  4OVM A;  1HKX A;  5KP4 A;  1VQ9 3;  2RBI A;  1ULJ B;  3G8Z A;  4JRF A;  2RNT A;  3KII A;  4LYL B;  3X40 A;  3CXC 2;  1NJI 4;  3LTA A;  1U5O A;  1N5P A;  1W2Z A;  2GEY A;  3DGO A;  3CPW 2;  1QVG 2;  3SYU A;  1RRL A;  3DZL A;  1CH0 A;  4IIA A;  2B24 B;  2Y74 A;  2WOH A;  3JUM A;  4GHO A;  4EW5 A;  1GSP A;  1JV2 B;  1NDO B;  2Z7A A;  1Q86 4;  1M9G A;  3HX8 A;  1GD3 A;  1LVN A;  3HII A;  3X41 A;  4EV2 A;  1W2B 2;  1BRG A;  4N6L A;  1Q40 B;  2O9U X;  1V74 A;  2SBL A;  1B3S A;  2LYX A;  3CNX A;  1JKG B;  3DGY A;  4MEI A;  1GY5 A;  5G2G A;  1CYU A;  3NHX A;  1RRH A;  3DXO A;  4HKV B;  4STD A;  3CCE 3;  1B2M A;  1LOX A;  3VGN A;  3CNM A;  1OUN A;  2W03 A;  1LQG C;  1ULI B;  3Q2P A;  1JBT A;  4I5Q A;  3NV0 A;  1BSC A;  3RNT A;  1V57 A;  1BRJ A;  1D6Z A;  1IQY A;  1PFP A;  3K7C A;  7STD A;  1FW7 A;  5CLK A;  1X1Y A;  3F8H A;  3U97 A;  3EC9 A;  1JZD A;  1YVS A;  1DMN A;  1NU3 A;  1RGA A;  1B20 A;  1PY3 A;  3MKI A;  1GMP A;  2L4V A;  4KVH A;  3GAX A;  1BOX A;  2IY2 A;  1LOW A;  1FGQ A;  3F40 A;  4O8S A;  4ILF A;  3CCS 3;  5IER A;  1Q82 4;  3AHW A;  1UCJ A;  2WGO A;  4HM8 B;  5CF2 A;  1OCV A;  1JRQ A;  1JB5 A;  3H3H A;  3B4O A;  1G0T A;  4G1M B;  1I2F A;  3MHE A;  3LOY A;  1D6Y A;  1EG9 B;  1IK3 A;  5TGN A;  1AVK A;  2Z76 A;  3N8B A;  1NO3 A;  3BU4 A;  1ZGX A;  1LNI A;  2E2V A;  2W9P A;  1OHS A;  1KD1 4;  3EJV A;  1RDS A;  3S27 A;  3OWU A;  3AGN A;  2GU3 A;  3B8L A;  1ISK A;  1O7H B;  2BHM A;  4FMA A;  4FMC A;  9RNT A;  3ZFZ A;  1VQP 3;  3DH2 A;  2MF7 A;  2H0I A;  2W04 A;  4EYC A;  1B2S A;  1TTO A;  4XDW A;  3KSP A;  1BAN A;  4CDL A;  4BTY A;  1Q9E A;  1UCL A;  3D5I A;  1N9J A;  1K28 A;  1K9M 4;  1O7P B;  2WGQ A;  3F7X A;  3PCS A;  3FG3 A;  5STD A;  3S28 A;  1STF I;  4FCJ A;  1W5Z A;  2CW9 A;  4R9L A;  3CC2 3;  4K1V A;  3WOD G;  4K61 A;  2XEP A;  1N8Q A;  4J8T A;  2QEX 3;  2BO9 B;  4MMZ B;  4RNT A;  5FW5 A;  1VQN 3;  5IG0 A;  3MYT A;  4X2H A;  4EXR A;  4JF8 A;  1E3V A;  4WP5 A;  1A2P A;  4GL6 A;  4IT7 A;  1ASK A;  4N3V A;  1PU4 A;  5DRV A;  1I70 A;  1FGT A;  1MWT A;  2XF3 A;  3DM8 A;  1Q42 A;  2PNC A;  3D3L A;  2K54 A;  1YHQ 3;  3WMD A;  1UI7 A;  3E99 A;  3A76 A;  4ORL A;  3DUK A;  1QAF A;  1OH0 A;  1US1 A;  3NV0 B;  2IUK A;  5JBS A;  3CCL 3;  1FUS A;  3UL5 A;  1TJD A;  5IG3 A;  1W6G A;  3WHO A;  4BL2 A;  1CEW I;  3MSO A;  4CCV A;  2GSP A;  1BGS A;  1WMP A;  2ZDJ A;  3OXA A;  4LZI A;  3K0Z A;  3KSE D;  1N5H A;  1TRP A;  2GBW B;  3FKA A;  1JJ2 2;  5M18 A;  2F86 B;  3CD6 3;  1WMO A;  3V92 A;  4KT3 B;  3FCS B;  1M90 4;  3PZW A;  3H51 A;  1FUT A;  4XDV A;  4DKI A;  2IUJ A;  2KF3 A;  3Q3F A;  1RJO A;  1B27 A;  1T2I A;  2W2C A;  2FXT A;  2OQE A;  8RNT A;  1EEJ A;  3KFQ C;  2CFG A;  3GRD A;  5BU4 A;  2CFD A;  1VQ6 3;  3OWY A;  1ZS7 A;  2HMM B;  1TP6 A;  2BMO B;  3DGL A;  4K90 B;  3ECF A;  2Z77 A;  5G1K A;  1BSD A;  1NB3 I;  1ROA A;  3JVC A;  1UGI A;  3LTC A;  4OK0 A;  1LNH A;  1JN5 B;  1YI2 3;  1IVX A;  1S5A A;  1BRN L;  3PS8 A;  3X3Y A;  3F7S A;  1LOY A;  4FR9 A;  3B7C A;  1AR0 A;  3CME 3;  1TIJ A;  4KZ1 A;  3EB8 A;  2OOV A;  3HZP A;  1HU9 A;  1FA3 A;  3PXM A;  4GB5 A;  4QWT A;  2CFW A;  6STD A;  3I55 3;  1DE3 A;  3X3X A;  1WMN A;  1BNF A;  1BNG A;  4BU4 A;  5M1A A;  2FNQ A;  1BUQ A;  1FGR A;  5FGO A;  1BIR A;  3WA2 X;  1JKG A;  1MWS A;  1FGM A;  4O2H A;  2OTL 3;  3EQQ B;  4RBN A;  2BNG A;  3SOY A;  1NB5 I;  1TFK A;  2RSX A;  1DVD A;  1IVW A;  4X2O A;  2OCT A;  3FG1 A;  4N6O B;  5CK6 A;  2IYJ A;  4HYZ A;  2B1X B;  1BAO A;  3X42 A;  1CYV A;  3D79 A;  3A5E A;  4LSO A;  1M1X B;  2D1W A;  3NQY A;  1EKM A;  2CX0 A;  4LGQ A;  3CCQ 3;  1GOV A;  5CXO A;  2KXG A;  1Q7Y 4;  3ZG5 A;  1J2B A;  3GZY B;  3EN8 A;  1G96 A;  1G02 A;  5CF1 A;  1KWI A;  5IEN A;  2HMO B;  4PEJ A;  1JN5 A;  1UCI A;  2H0H A;  4HM7 B;  2HMK B;  3G6E 3;  3L0R A;  2A15 A;  4ZM8 A;  5A0O B;  2INX A;  2E2U A;  2XFS A;  1ZO2 A;  1RSN A;  1O7W B;  2K3D A;  2Q07 A;  4WHA A;  1GS3 A;  2C10 A;  1SJW A;  2BMQ B;  1GY7 A;  1T2H A;  3GZB A;  1O7G B;  1YGE A;  2GBX B;  4XM4 A;  2MC8 A;  3RGA A;  3CCR 3;  1SIH A;  4HM4 B;  5AEU B;  5AYS C;  3EHC A;  1UCK A;  3G0K A;  4HZ9 B;  3NQZ A;  3K5T A;  3UJM A;  1RGC A;  3S67 A;  1IT8 A;  1BRH A;  5JPP A;  1MGW A;  5LC7 A;  1K41 A;  2ZHX B;  2P05 A;  3FSD A;  4O3V A;  2V1L A;  1B2X A;  1W6C A;  2UGI A;  1BNS A;  4L8P A;  4U13 A;  3DGN A;  4XBY A;  5AIH A;  4NHF A;  1NNV A;  5IEP A;  3NBJ A;  3SVA A;  3CMA 3;  4EBG A;  4XBX A;  2CG0 A;  2CK3 H;  3HK4 A;  3IMA B;  2XFT A;  1RN1 A;  2XH9 A;  3K63 A;  4O02 B;  3CCM 3;  2QIY A;  2LQV A;  3UNL A;  3HI7 A;  4Q53 A;  4HM1 B;  1AQZ A;  1VQ7 3;  3KCH A;  5EVH A;  2KCD A;  3EBY A;  1W6Y A;  4R80 A;  2HMJ B;  2HOH A;  2CC3 A;  1W7C A;  1LOV A;  1X1U A;  2QA4 3;  1W02 A;  2STD A;  4WWU C;  2J8X B;  1O7N B;  3FF0 A;  3VSY A;  1RMS A;  4XB5 A;  2XSH B;  4AEQ A;  3LYG A;  1JBS A;  3BB9 A;  1TU5 A;  1OHO A;  3ZG0 A;  1LXE A;  4LEH A;  4NRE A;  1VZZ A;  1UW1 A;  2AAE A;  4BTW A;  1IVU A;  4HM5 B;  2P38 A;  3UL6 A;  4H61 A;  2W0Q A;  3QK9 A;  5IEO A;  1GD4 A;  1T5Y A;  3LZA A;  1GYB A;  2M7O A;  5AEW B;  2BT3 A;  5AI1 A;  3NM7 A;  1VQQ A;  1RNB A;  3F8X A;  4L8O A;  5D82 A;  3F9S A;  3WOF B;  1BRS A;  1KQS 2;  1OF5 A;  1QAL A;  3G71 3;  1VQK 3;  3T8U A;  4J9A A;  3EBT A;  1YNV X;  3NXJ A;  1YJW 3;  1IQ8 A;  1GOU A;  5AYR B;  1EUI C;  1BU4 A;  3G16 A;  1K8A 4;  1B2U A;  3SOA A;  3LTD A;  1RKY A;  1IYY A;  1RLS A;  1M1K 4;  3LH4 A;  1VQ4 3;  1WQL B;  7RNT A;  2XGN A;  1W00 A;  2CFL A;  3LT9 A;  1D6U A;  1S72 3;  5IF6 A;  4HBR A;  4MMX B;  3RDE A;  5KP1 A;  1Q81 4;  3JUN A;  5EEO A;  6GSP A;  1FUW A;  2F99 A;  4TX4 A;  2CIU A;  3SXX A;  1N9E A;  3MG3 A;  3BLZ A;  2XR8 B;  3HIG A;  4KFE A;  4RNZ A;  3TDG A;  4KFF A;  1JNQ A;  3NBB A;  2R4I A;  3NBR A;  1X1W A;  3VF1 A;  3SLU A;  2C4B A;  1BRI A;  2F56 A;  1AV4 A;  4NPB A;  6RNT A;  4IPB A;  1YGW A;  3FZW A;  4R9K A;  1RGH A;  3V98 A;  1E3R A;  3PYJ A;  1UDI I;  3LML A;  3JUP A;  2GEX A;  2KRT A;  1IT7 A;  1BSB A;  1RCL A;  2OOV C;  4I4K A;  2F5M A;  3GZX B;  5AIF A;  3RGR A;  2CG1 A;  3FGY A;  1UUW B;  1EQK A;  1MWR A;  3WR2 A;  3LTB A;  3CC7 3;  1RN4 A;  1WTH A;  1BSE A;  5ELU A;  1JB2 A;  3X3Z A;  4HM0 B;  1QVF 2;  4HOH A;  1Z1S A;  4FCZ A;  1IU7 A;  1EA2 A;  3KE7 A;  5I97 A;  1RCK A;  4WFO A;  1JBR A;  2ML6 A;  1B2Z A;  4MMY B;  1DVC A;  3N54 B;  2OQE C;  3EF8 A;  1TFO A;  2E2T A;  3OV4 A;  3SED A;  1YIT 3;  1MOL A;  1QMA A;  1RNT A;  2Z6B A;  1U8C B;  2WOF A;  1BUJ A;  2WO0 A;  2ZL8 A;  4RZM A;  1RGG A;  1N8R 4;  1STD A;  2P09 A;  1PYL A;  2JQ5 A;  3BNC A;  1OAC A;  1A2K A;  7GSP A;  1VQO 3;  1RHL A;  5AII A;  3WOE B;  2ML5 A;  3S5C A;  1A2V A;  2JDI H;  3WA3 A;  3ER7 A;  1Y4K A;  2IMJ A;  3GZR A;  1I2G A;  2XSO B;  2F98 A;  3STD A;  2Y73 A;  4EV5 A;  3FF2 A;  2C11 A;  1OF5 B;  1MNL A;  2CWU A;  1ZX2 A;  2W56 B;  1MGR A;  1CQS A;  4XBT A;  1RTU A;  1T3B A;  3D4A A;  4N6M A;  1YJ9 3;  3MWZ A;  1I0V A;  1I2E A;  2CWV A;  1UUV B;  4K1U A;  1JB4 A;  5HOH A;  1YVB I;  1NWW A;  2XRX B;  3URP A;  2KF6 A;  1GMQ A;  2RGQ A;  2KAA A;  4J5K A;  1BNI A;  3Q90 A;  3BND A;  2H0G A;  1I3I A;  4CJN A;  3OW2 2;  3V99 A;  2SAR A;  2W6J H;  3EN1 B;  3U1W A;  4EC6 A;  2YX9 A;  1BRK A;  3AMO B;  3F14 A;  2BU4 A;  1LQM B;  3KZT A; 
#chains in the Genus database with same CATH homology
 2K0M A;  2XGL A;  2QGU A;  1OGX A;  2IA7 A;  5BXQ A;  1IDP A;  1IV9 A;  4R1K A;  3JUQ A;  4FMB A;  1YIJ 3;  3NM2 A;  3B4P A;  1R4C A;  2O3O A;  1DMQ A;  4HM3 B;  4N6V 0;  5LC6 A;  3CCJ 3;  1K73 4;  1KSI A;  4AKZ A;  3OWS A;  3LXU X;  3J7Y d;  1VQ8 3;  2CKF B;  4N6T A;  4WYK A;  4H3U A;  3IJE B;  2W9Q A;  3G4S 3;  2RFR A;  5D81 A;  1DMM A;  2W56 A;  2CWT A;  1O7M B;  1A90 A;  2OTJ 3;  3PGB A;  2YFJ B;  3M8C A;  4FCM A;  2PZV A;  2I9W A;  5IW9 A;  3MG1 A;  2CHC A;  3I56 3;  3S29 A;  3Q1C A;  1C7H A;  2GXF A;  1FGO A;  2UX0 A;  3CCV 3;  3AMO A;  3FH1 A;  3DGM A;  4OUQ A;  1SPU A;  5D83 A;  3DY5 A;  4HJL B;  1A67 A;  5ELJ A;  4AKY A;  5IG4 A;  4BTX A;  2YFL B;  5HGR A;  1SII A;  1DYU A;  1WNH A;  1YJN 3;  2YFI B;  4KFD A;  2OWP A;  4HM2 B;  4HVN A;  1Q40 A;  4L7K A;  1F8N A;  2GU1 A;  3UB1 A;  2HML B;  1TUH A;  3PCR A;  1GY6 A;  3GWR A;  4RNY A;  4R4K A;  2P0M A;  3EE1 A;  4LMI A;  8CHO A;  1QJG A;  4N6U A;  5JPU A;  5BVB A;  2HMN B;  3KN4 A;  3MG2 A;  2FGT A;  3WDG B;  3O8Y A;  5EQL A;  1SQW A;  2BMR B;  1ROV A;  1UI8 A;  3CU3 A;  1IVV A;  2P0X A;  3OX9 A;  5DRE A;  3D9R A;  3MPH A;  1OHP A;  3K9M C;  5KP3 A;  3N9H A;  3JUO A;  3FLJ A;  5IG5 A;  1VQ5 3;  3LT8 A;  2CFK A;  3NUV A;  2RCD A;  1L5G B;  1RN7 A;  2D42 A;  3ROB A;  1OGZ A;  4MJD A;  4N6N B;  3CCU 3;  4WYK B;  3BNB A;  1AVL A;  4FMD A;  1QAK A;  1W4N A;  3BNE A;  1IV7 A;  3FG4 A;  1IQX A;  1VQL 3;  3CC4 3;  1W01 A;  3CPO A;  1E97 A;  1VQM 3;  1OPY A;  3T8N A;  3SX1 A;  2CH9 A;  1KC8 4;  3I0Y A;  4HZB B;  3EX9 A;  3T0U A;  5AIG A;  3ALA A;  3IPT A;  3QRD A;  3DMC A;  3KKG A;  3NX0 A;  4HM6 B;  4OVM A;  1HKX A;  5KP4 A;  1VQ9 3;  1ULJ B;  3G8Z A;  4JRF A;  3KII A;  3CXC 2;  3X40 A;  1NJI 4;  3LTA A;  1U5O A;  1N5P A;  1W2Z A;  2GEY A;  3DGO A;  3CPW 2;  1QVG 2;  1RRL A;  3DZL A;  4IIA A;  2B24 B;  2Y74 A;  2WOH A;  3JUM A;  1JV2 B;  1NDO B;  2Z7A A;  1Q86 4;  1M9G A;  3HX8 A;  1GD3 A;  1LVN A;  3HII A;  3X41 A;  4EV2 A;  1W2B 2;  4N6L A;  1Q40 B;  2O9U X;  1V74 A;  2SBL A;  2LYX A;  3CNX A;  1JKG B;  4MEI A;  1GY5 A;  5G2G A;  1CYU A;  3NHX A;  1RRH A;  3DXO A;  4HKV B;  4STD A;  3CCE 3;  1LOX A;  3VGN A;  3CNM A;  1OUN A;  2W03 A;  3Q2P A;  1ULI B;  3NV0 A;  1D6Z A;  1IQY A;  1PFP A;  3K7C A;  7STD A;  5CLK A;  3F8H A;  3U97 A;  3EC9 A;  1DMN A;  1NU3 A;  3MKI A;  4KVH A;  2L4V A;  3GAX A;  3CCS 3;  3F40 A;  1FGQ A;  4O8S A;  5IER A;  1Q82 4;  2WGO A;  4HM8 B;  5CF2 A;  1OCV A;  1JRQ A;  1JB5 A;  3H3H A;  3B4O A;  4G1M B;  3MHE A;  3LOY A;  1D6Y A;  1EG9 B;  1IK3 A;  5TGN A;  1AVK A;  2Z76 A;  3N8B A;  1NO3 A;  2E2V A;  2W9P A;  1OHS A;  1KD1 4;  3EJV A;  3S27 A;  3OWU A;  1ISK A;  2GU3 A;  3B8L A;  1O7H B;  2BHM A;  4FMA A;  4FMC A;  1VQP 3;  2MF7 A;  2W04 A;  4EYC A;  4XDW A;  3KSP A;  4CDL A;  4BTY A;  1N9J A;  1K28 A;  1K9M 4;  1O7P B;  2WGQ A;  3F7X A;  3PCS A;  3FG3 A;  5STD A;  3S28 A;  1STF I;  4FCJ A;  1W5Z A;  2CW9 A;  4R9L A;  3CC2 3;  4K1V A;  3WOD G;  4K61 A;  2XEP A;  1N8Q A;  4J8T A;  2QEX 3;  2BO9 B;  4MMZ B;  5FW5 A;  1VQN 3;  5IG0 A;  3MYT A;  4X2H A;  4EXR A;  4JF8 A;  1E3V A;  4WP5 A;  4GL6 A;  4IT7 A;  1ASK A;  4N3V A;  1PU4 A;  5DRV A;  1FGT A;  2XF3 A;  3DM8 A;  1Q42 A;  2PNC A;  3D3L A;  2K54 A;  1YHQ 3;  3WMD A;  1UI7 A;  3E99 A;  3A76 A;  4ORL A;  3DUK A;  1QAF A;  1OH0 A;  1US1 A;  3NV0 B;  2IUK A;  5JBS A;  3CCL 3;  5IG3 A;  3UL5 A;  1W6G A;  1CEW I;  3MSO A;  4CCV A;  1WMP A;  2ZDJ A;  3OXA A;  4LZI A;  3K0Z A;  3KSE D;  1N5H A;  2GBW B;  1JJ2 2;  3FKA A;  3CD6 3;  2F86 B;  1WMO A;  3V92 A;  3FCS B;  1M90 4;  3PZW A;  3H51 A;  4XDV A;  2IUJ A;  1RJO A;  2W2C A;  2FXT A;  2OQE A;  3KFQ C;  2CFG A;  3GRD A;  2CFD A;  1VQ6 3;  3OWY A;  2HMM B;  1TP6 A;  2BMO B;  3DGL A;  4K90 B;  3ECF A;  2Z77 A;  1NB3 I;  1ROA A;  3JVC A;  3LTC A;  4OK0 A;  1LNH A;  1JN5 B;  1YI2 3;  1IVX A;  1S5A A;  3PS8 A;  3X3Y A;  3F7S A;  3CME 3;  4FR9 A;  3B7C A;  1AR0 A;  1TIJ A;  4KZ1 A;  3EB8 A;  2OOV A;  3HZP A;  1HU9 A;  1FA3 A;  3PXM A;  4GB5 A;  4QWT A;  2CFW A;  6STD A;  3I55 3;  3X3X A;  1WMN A;  2FNQ A;  1BUQ A;  1FGR A;  5FGO A;  3WA2 X;  1JKG A;  1FGM A;  4O2H A;  2OTL 3;  3EQQ B;  4RBN A;  2BNG A;  3SOY A;  1NB5 I;  1TFK A;  2RSX A;  1DVD A;  1IVW A;  4X2O A;  2OCT A;  3FG1 A;  4N6O B;  5CK6 A;  4HYZ A;  2B1X B;  3X42 A;  1CYV A;  4LSO A;  1M1X B;  2D1W A;  3NQY A;  1EKM A;  4LGQ A;  3CCQ 3;  5CXO A;  2KXG A;  1Q7Y 4;  1J2B A;  3GZY B;  3EN8 A;  1G96 A;  5CF1 A;  1KWI A;  5IEN A;  2HMO B;  4PEJ A;  1JN5 A;  4HM7 B;  2HMK B;  3G6E 3;  3L0R A;  2A15 A;  4ZM8 A;  5A0O B;  2INX A;  2E2U A;  2XFS A;  1ZO2 A;  1O7W B;  2Q07 A;  4WHA A;  1GS3 A;  2C10 A;  1SJW A;  2BMQ B;  1GY7 A;  3GZB A;  1O7G B;  1YGE A;  2GBX B;  4XM4 A;  2MC8 A;  3RGA A;  3CCR 3;  1SIH A;  4HM4 B;  5AEU B;  5AYS C;  3EHC A;  3G0K A;  4HZ9 B;  3NQZ A;  3K5T A;  3UJM A;  3S67 A;  1IT8 A;  5JPP A;  5LC7 A;  1K41 A;  2P05 A;  3FSD A;  4O3V A;  2V1L A;  1W6C A;  4L8P A;  4U13 A;  3DGN A;  4XBY A;  5AIH A;  4NHF A;  5IEP A;  3NBJ A;  3SVA A;  3CMA 3;  4EBG A;  4XBX A;  2CG0 A;  2CK3 H;  3HK4 A;  3IMA B;  2XFT A;  2XH9 A;  3K63 A;  4O02 B;  3CCM 3;  2QIY A;  2LQV A;  3UNL A;  3HI7 A;  4Q53 A;  4HM1 B;  1VQ7 3;  5EVH A;  2KCD A;  3EBY A;  1W6Y A;  4R80 A;  2HMJ B;  1W7C A;  2CC3 A;  2QA4 3;  1W02 A;  2STD A;  4WWU C;  1O7N B;  3FF0 A;  3VSY A;  4XB5 A;  2XSH B;  4AEQ A;  3LYG A;  3BB9 A;  1TU5 A;  1OHO A;  1LXE A;  4LEH A;  4NRE A;  1VZZ A;  1UW1 A;  4BTW A;  1IVU A;  4HM5 B;  2P38 A;  3UL6 A;  4H61 A;  2W0Q A;  3QK9 A;  5IEO A;  1GD4 A;  1T5Y A;  3LZA A;  1GYB A;  2M7O A;  5AEW B;  2BT3 A;  5AI1 A;  3NM7 A;  3F8X A;  4L8O A;  5D82 A;  3F9S A;  3WOF B;  1KQS 2;  1OF5 A;  1QAL A;  3G71 3;  1VQK 3;  3T8U A;  4J9A A;  3EBT A;  3NXJ A;  1YJW 3;  1IQ8 A;  5AYR B;  3G16 A;  1K8A 4;  3SOA A;  3LTD A;  1RKY A;  1M1K 4;  3LH4 A;  1VQ4 3;  1WQL B;  2XGN A;  1W00 A;  2CFL A;  3LT9 A;  1D6U A;  1S72 3;  5IF6 A;  4HBR A;  4MMX B;  3RDE A;  5KP1 A;  1Q81 4;  3JUN A;  5EEO A;  1FUW A;  2F99 A;  4TX4 A;  2CIU A;  3SXX A;  1N9E A;  3MG3 A;  3BLZ A;  2XR8 B;  3HIG A;  4KFE A;  4RNZ A;  3TDG A;  4KFF A;  1JNQ A;  3NBB A;  2R4I A;  3NBR A;  3VF1 A;  3SLU A;  1AV4 A;  4IPB A;  3FZW A;  4R9K A;  3V98 A;  1E3R A;  3PYJ A;  3LML A;  3JUP A;  2GEX A;  2KRT A;  1IT7 A;  4I4K A;  2OOV C;  3GZX B;  5AIF A;  3RGR A;  2CG1 A;  3FGY A;  1UUW B;  1EQK A;  3LTB A;  3CC7 3;  1WTH A;  5ELU A;  1JB2 A;  3X3Z A;  4HM0 B;  1QVF 2;  1Z1S A;  4FCZ A;  1IU7 A;  1EA2 A;  3KE7 A;  5I97 A;  4WFO A;  2ML6 A;  4MMY B;  1DVC A;  3N54 B;  2OQE C;  3EF8 A;  1TFO A;  2E2T A;  3OV4 A;  3SED A;  1YIT 3;  1MOL A;  1QMA A;  2Z6B A;  1U8C B;  2WOF A;  2WO0 A;  2ZL8 A;  4RZM A;  1N8R 4;  1STD A;  2P09 A;  2JQ5 A;  3BNC A;  1OAC A;  1A2K A;  1VQO 3;  5AII A;  3WOE B;  2ML5 A;  3S5C A;  1A2V A;  2JDI H;  3WA3 A;  3ER7 A;  1Y4K A;  2IMJ A;  3GZR A;  2XSO B;  3STD A;  2F98 A;  4EV5 A;  2Y73 A;  3FF2 A;  2C11 A;  1OF5 B;  1MNL A;  2CWU A;  1ZX2 A;  2W56 B;  1CQS A;  4XBT A;  4N6M A;  1YJ9 3;  3MWZ A;  2CWV A;  1UUV B;  4K1U A;  1JB4 A;  1YVB I;  1NWW A;  2XRX B;  2RGQ A;  3Q90 A;  3BND A;  3OW2 2;  3V99 A;  3EN1 B;  2W6J H;  3U1W A;  4EC6 A;  2YX9 A;  3AMO B;  3F14 A;  3KZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...