1Q7Y4

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q7y400
1VQP3 3CCE3 1VQ53 3OW22 3I553 1YI23 3CCS3 3CCU3 3CCL3 1YHQ3 1Q824 1VQ63 1M904 1JJ22 2QA43 1Q864 3CC23 2QEX3 3CXC2 1VQK3 1NJI4 1VQ43 3CMA3 3CME3 1K9M4 1KQS2 1N8R4 1YJN3 1Q814 1VQO3 1KC84 1VQN3 3CPW2 1YJW3 3CCM3 1K734 3G6E3 1S723 1QVG2 1Q7Y4 1VQ83 1K8A4 3G713 1M1K4 2OTL3 1VQ93 3G4S3 1YIJ3 1YJ93 1W2B2 1QVF2 1VQM3 3CC43 1VQ73 3CCJ3 1YIT3 1KD14 1VQL3 3CC73 3I563 3CCQ3 2OTJ3 3CCV3 3CCR3 3CD63
chains in the Genus database with same CATH superfamily
2GU3A 1BRGA 5AIGA 4RNTA 4CCVA 1YI23 2GBXB 1BSCA 2HMKB 2KF5A 1JBSA 5CK6A 1A90A 1UCIA 2QEX3 1VQK3 1Q40A 3PXMA 2I9WA 5EQLA 1DMQA 4BTXA 1W6GA 5LC6A 1AV4A 3SLUA 1UDII 3F40A 1KC84 3HZPA 1B3SA 1EUIC 2W56A 1OH0A 8RNTA 1TJDA 2QGUA 1MWTA 1A67A 3BNEA 1JBRA 3NQZA 5AYSC 2XGLA 3UNLA 2J8XB 3BLZA 3AGNA 3SXXA 1HYFA 3MG1A 1JB4A 1AVKA 2WOFA 3LOYA 5JPPA 3EF8A 3CCQ3 1ASKA 4AEQA 3H3HA 2P0XA 1IQ8A 1ZX2A 2RNTA 3PZWA 3U97A 3X3XA 2K3DA 5IG0A 4MJDA 3WOEB 1B2XA 1IVUA 1I0VA 3CCU3 1IVVA 2Z77A 4LSOA 1BANA 1US1A 2QA43 2IYJA 3LZAA 3WA3A 4H61A 1FGQA 1Q864 3NBBA 4MMXB 1MGRA 2H0GA 2CWVA 3K5TA 1MOLA 4X2HA 1O7HB 4HOHA 1YJN3 3STDA 1GD4A 1M1XB 2GXFA 5M18A 2KF4A 2YFIB 4N6MA 1VQO3 2E2TA 3FG3A 3F8XA 3GSPA 1NDOB 4HJLB 2RBIA 3FKAA 3F14A 4EV5A 2C11A 1IVWA 8CHOA 2B24B 1W02A 3GZBA 3V92A 3G713 1RSNA 5JPUA 5G1LA 3EN1B 4XM4A 3WODG 2CHCA 1RGAA 3NXJA 4HZ9B 2KCDA 1VQ73 3EE1A 3DY5A 1HU9A 4HM8B 1GOVA 3JUNA 3GZRA 1UCLA 1W01A 3NBRA 4XBTA 1ZO2A 2BIRA 2GU1A 4LEHA 1EA2A 3T8NA 1UUGB 4L8PA 3GRDA 3DM8A 3D5IA 1EKMA 3AHSA 3MPHA 2Y73A 2KXGA 4EW5A 5KP1A 1UI8A 1RN4A 1RRLA 1OF5A 1Q7HA 1JKGA 4J5GA 3ZG0A 3G8ZA 2ZA4A 2OOVC 1BU4A 3NV0B 1C54A 2XGNA 3HI7A 1KWIA 3KE7A 2CFDA 4OUQA 1WMPA 5IERA 1YIJ3 5FGOA 3MG2A 4DKIA 3I563 3ALAA 4R1KA 5EEOA 3N54B 1NB3I 2CW9A 4JF8A 1VQP3 5D83A 3I553 1NO3A 2BNGA 3WOFB 3LTAA 2CWTA 1BRHA 2BT3A 3A5EA 2V1LA 3HIGA 2CFWA 2HMOB 3CXC2 1OUNA 3DGOA 1YGEA 1LOVA 3UB1A 1BNRA 5IW9A 3EQQB 2L1SA 4WYKB 2A15A 2YFJB 3LXUX 1UI7A 3D79A 4N6TA 5HGRA 3F9SA 2XEPA 1DVCA 1IU7A 2B1XB 1DYUA 2CH9A 3G16A 5CLKA 1GMPA 1YJ93 1GMQA 7GSPA 1VQL3 2P0MA 1MGWA 5A0OB 3D4AA 2CFGA 1IVXA 3DGMA 6STDA 2PZVA 4HBRA 1N5PA 4FMCA 1RRHA 2HMJB 3OX9A 4MMYB 4ILFA 3OWYA 4JRFA 3B7CA 2FNQA 3LMLA 3FCSB 4N6OB 5AIFA 1BNJA 3V98A 1T2HA 1L5GB 3Q3FA 3T8UA 5IENA 1HZ1A 2XFTA 3VF1A 4J5KA 1B2SA 1A2PA 1W00A 3CCM3 4FCMA 3CNXA 4TX4A 3ZG5A 4XB5A 3OWSA 1GOUA 1MWSA 2WGOA 1MNLA 2KF3A 2D42A 1O7MB 2LYXA 4STDA 1RTUA 1GS3A 3RDEA 1BSEA 1UGHI 4HVNA 2W2CA 2WO0A 2ZDJA 4IT7A 5BU4A 5CF1A 1M9GA 1VQ53 1QAKA 5AYRB 5RNTA 2E2VA 3BNDA 1DE3A 1CEWI 1MWRA 1GSPA 1DMMA 2RGQA 1G96A 1BGSA 2QIYA 5D81A 4HM3B 3IMAB 5G1KA 1KQS2 1OHPA 3FG4A 4GL6A 1CQSA 3WHOA 4FMAA 5BVBA 1BNEA 4WHAA 4AKZA 1LRAA 1K734 3FG1A 4QWTA 1B2ZA 4O3VA 1SIIA 4HZBB 1RCLA 1VQQA 4OK0A 3O8YA 1SARA 4R9LA 3F8HA 1UCKA 2GEYA 3LTDA 4BL3A 1PY3A 3B4PA 1JN5B 3NUVA 1GD3A 1F8NA 2F99A 1IV7A 1TFOA 2Z6BA 4KZ1A 4H3UA 2C10A 2W6JH 3OXAA 2ML6A 3S67A 1YVBI 4N6NB 5IG3A 2Y74A 2F4YA 3OWUA 2YX9A 4J8TA 3TDGA 1NJI4 3N8BA 2W9QA 2UUGC 1TU5A 1B21A 5LC7A 1N8R4 1NWWA 2BMQB 2XH9A 1RGKA 3D3LA 1STDA 2OQEC 4GHOA 4K1UA 1G02A 2L4VA 2IMJA 3WA2X 1RDSA 2ZHXB 5JBSA 4RNZA 1I2FA 4G1MB 2GSPA 1E3VA 3G0KA 3NV0A 3Q2PA 1SQWA 3KFQC 1AVLA 1TP6A 1B2UA 2IY2A 3JUPA 2SARA 4ORLA 3KSPA 2P38A 3F7SA 3CCV3 1I3FA 2O3OA 4O8SA 1ZGXA 3RGRA 3DMCA 1R4CA 3KCHA 2XR8B 1BUJA 1I8VA 3PYJA 3QK9A 1FW7A 2GEXA 1J2BA 4CDLA 3CCL3 1BUQA 1N9EA 5AI1A 4R4KA 3LT8A 4KVHA 1IQXA 1BNSA 4WP5A 4MEIA 4WYKA 1RNTA 3G6E3 4KT3B 2F56A 5BXQA 2C4BA 1FZUA 2OTL3 1GY7A 1BNFA 3KIIA 3DGNA 4N3VA 3CCJ3 1YIT3 3IJEB 1D6ZA 2IUJA 1W7CA 2STDA 1UW1A 1T2IA 3AGOA 1LOYA 2BU4A 4N6UA 3UJMA 1JV2B 3NM2A 5STDA 4N6V0 1IV9A 1Y4KA 4XDWA 3SYUA 4EC6A 3K63A 2Z76A 1VQ63 1JB2A 1JJ22 1O7WB 1OHOA 2INXA 2UX0A 3NQYA 1VQ43 3IPTA 2IUKA 2CKFB 1R4YA 5AIHA 4BTWA 1YGWA 2RFRA 1FGTA 4LZIA 3WR2A 3EB8A 1X1UA 3KZTA 1YJW3 1AY7A 4RZMA 4K90B 1UUWB 1DETA 1I3IA 4I4KA 5IEOA 5AEWB 1EQKA 3BU4A 1WMNA 2P09A 1NU3A 5ELJA 3ECFA 3WDGB 4KFEA 1W2B2 4BTYA 3N9HA 3NM7A 4HM1B 1B27A 1BRKA 1TRQA 2AADA 1IK3A 1HKXA 1X1WA 3UL6A 1JBTA 3M8CA 3VGNA 5G2GA 1T3BA 1IQYA 1OACA 1GYBA 1ZS7A 1I2EA 1YNVX 2ZL8A 3BIRA 3EC9A 3X3YA 1RLSA 2WOHA 3E99A 1EG9B 1RHLA 1V57A 2F86B 5CXOA 1JKGB 2KF6A 6RNTA 2K54A 1A2VA 3FLJA 4FR9A 1O7PB 3DXOA 1BRNL 1JNQA 4EV2A 3MKIA 1WMOA 3I0YA 3SOAA 3S28A 4ZM8A 1BIRA 3QRDA 5CF2A 3H51A 1OPYA 3MG3A 1T5YA 2GBWB 1K41A 1EEJA 4L7KA 1LNHA 1Q42A 1TRPA 1WNHA 2XRXB 3X40A 1RGHA 1SJWA 3MYTA 1FGOA 1RGFA 4NHFA 1I0XA 1FA3A 1STFI 4AKYA 1RMSA 1CYUA 1LNIA 1M904 2CK3H 3D5GA 4OVMA 2FGTA 3HIIA 1N5HA 3X41A 1LXEA 3CMA3 3BNCA 4FMDA 3B8LA 1K9M4 4FMBA 1ISKA 1U5OA 1AR0A 2CG1A 3EBYA 1VQN3 1OGZA 4CJNA 1DMNA 4IIAA 1K28A 1OCVA 1IT8A 1SPUA 4EYCA 1UGIA 1VQ93 1RGEA 1RGCA 1BNGA 2R41A 1QVF2 3B4OA 1C7HA 2XF3A 2W04A 3KN4A 3AMOB 4KFFA 4XDVA 5GSPA 1KD14 2F98A 1YVSA 1BRIA 3CPW2 5IF6A 5M19A 1BSAA 3CCR3 2Q07A 1ROAA 5D82A 3L0RA 2RSXA 2LQVA 3URPA 2E2UA 3Q1CA 1VZZA 1Q824 1LOWA 3K0ZA 2YFLB 1JZDA 4HYZA 3ER7A 3GZXB 4BU4A 2UGIA 3CU3A 3SOYA 3J7Yd 3NX0A 3K7CA 4X2OA 1B2MA 3LTCA 3EJVA 1W4NA 4EXRA 3FH1A 1FGMA 1V58A 1RKYA 1RJOA 4Q53A 2OOVA 3DGYA 1VQ83 2JQ5A 2HMLB 1FUTA 4FCZA 2D1WA 3JVCA 1DVDA 1Z1SA 3FF0A 1VQM3 4N6LA 4O02B 3UL5A 2RCDA 3JUMA 1RN7A 3HOHA 2W03A 1U8CB 1W6CA 3LTBA 2KRTA 1W2ZA 1BAOA 2W9PA 3LT9A 1LQMB 2BMRB 1MWUA 2R4IA 3CD63 3FGYA 3ZFZA 3BNBA 3OW22 4R9KA 1E3RA 1I70A 2XSHB 1YHQ3 1Q40B 1GY5A 1O7NB 5DREA 3VSYA 2OWPA 2W0QA 4XBYA 3OV4A 3CME3 1WQLB 3EHCA 2BO9B 3MSOA 3MWZA 3F7XA 3GZYB 2W56B 1Q814 4U13A 3CNMA 3FSDA 4K61A 1FUSA 1ULJB 1S723 1OHSA 3T0UA 1Q7Y4 1ROVA 3BB9A 3Q90A 1S5AA 1D6YA 1QAFA 3GAXA 4LGQA 1BVIA 1FUWA 2OCTA 1IT7A 3AHWA 5AEUB 4HM6B 1RNBA 4HM4B 1PFPA 4HM5B 3S27A 1NNVA 4HKVB 2CX0A 4J9AA 4L8OA 3CCE3 2FXTA 2HMMB 4O2HA 4WWUC 2HMNB 3PS8A 2SBLA 1JB5A 3DZLA 5ELUA 4BL2A 1LOXA 3A76A 5TGNA 3X42A 5FW5A 4HM2B 1BOXA 1RCKA 2H0HA 1CYVA 4GSPA 1RN1A 2JDIH 2P05A 1BSDA 1CH0A 2Z7AA 1W6YA 3WMDA 3SEDA 1RGLA 5IEPA 2CX1A 2H0IA 3D9RA 3HX8A 2F5MA 2HOHA 3K9MC 1QALA 2MC8A 5I97A 7STDA 1QMAA 3KSED 3MHEA 3G4S3 1G0TA 5DRVA 4K1VA 1BRJA 2ML5A 5HOHA 3CC73 3EBTA 2OTJ3 3DUKA 3JUQA 3FF2A 1FGRA 1LVNA 1QJGA 1TTOA 2KAAA 4NPBA 2CIUA 5AIIA 3PGBA 5EVHA 1WTHA 1PYLA 3EN8A 3CCS3 4BIRA 1BNIA 4HAAA 1B20A 2XFSA 3KKGA 4RNYA 1BRSA 2WGQA 4PEJA 3PCSA 3NBJA 2AAEA 5BIRA 1AQZA 3CPOA 3DGLA 6GSPA 1OF5B 1TUHA 3NHXA 5KP4A 1N8QA 2CFKA 2PNCA 1X1XA 4LYLB 1IYYA 1E97A 1O7GB 3RGAA 3S5CA 1IDPA 2CG0A 1K8A4 1TIJA 1GMRA 1OGXA 1W5ZA 9RNTA 4KFDA 1TFKA 2CFLA 4CPKA 2O9UX 2BHMA 1NB5I 1RGGA 3AMOA 3PCRA 4IPBA 1JRQA 4XBXA 1BSBA 1V74A 1JN5A 4LMIA 1D6UA 2F5WA 2M7OA 3DH2A 3X3ZA 3SX1A 3JUOA 1I2GA 4EBGA 1GY6A 1UUVB 4RBNA 1GOYA 4GB5A 2IA7A 3FZWA 4HM7B 3U1WA 3V99A 2XSOB 1A2KA 3CC23 4NREA 3S29A 2CC3A 4I5QA 3LYGA 5M1AA 2OQEA 2BMOB 2MF7A 1PU4A 3LH4A 3GWRA 4R80A 3SVAA 1KSIA 1LQGC 4HM0B 1QVG2 3HK4A 1JZOA 2CWUA 3RNTA 1M1K4 1X1YA 4WFOA 1ULIB 5KP3A 2K0MA 3ROBA 4MMZB 3CC43 5IG4A 3EX9A 1N9JA 1UCJA 5IG5A 7RNTA 1FYSA 4FCJA 1Q9EA 1SIHA
chains in the Genus database with same CATH topology
2GU3A 5AIGA 4CCVA 1YI23 2GBXB 2HMKB 1A90A 5CK6A 2QEX3 1VQK3 1Q40A 3PXMA 2I9WA 5EQLA 1DMQA 4BTXA 1W6GA 5LC6A 1AV4A 3SLUA 3F40A 1KC84 3HZPA 2W56A 1OH0A 2QGUA 1A67A 3BNEA 3NQZA 5AYSC 2XGLA 3UNLA 3BLZA 3SXXA 3MG1A 1JB4A 1AVKA 2WOFA 3LOYA 5JPPA 3EF8A 3CCQ3 1ASKA 4AEQA 3H3HA 2P0XA 1IQ8A 1ZX2A 3PZWA 3U97A 3X3XA 5IG0A 4MJDA 3WOEB 1IVUA 3CCU3 1IVVA 2Z77A 4LSOA 1US1A 2QA43 3LZAA 3WA3A 1Q864 4H61A 1FGQA 3NBBA 4MMXB 2CWVA 3K5TA 1MOLA 4X2HA 1O7HB 1YJN3 3STDA 1GD4A 1M1XB 2GXFA 1VQO3 2YFIB 4N6MA 2E2TA 3FG3A 3F8XA 1NDOB 4HJLB 3FKAA 3F14A 4EV5A 2C11A 1IVWA 8CHOA 2B24B 1W02A 3GZBA 3V92A 3G713 5JPUA 3EN1B 4XM4A 3WODG 2CHCA 4HZ9B 3NXJA 1VQ73 2KCDA 3EE1A 3DY5A 1HU9A 4HM8B 3JUNA 3GZRA 1W01A 3NBRA 4XBTA 1ZO2A 2GU1A 4LEHA 1EA2A 3T8NA 4L8PA 3GRDA 3DM8A 1EKMA 3MPHA 2Y73A 2KXGA 5KP1A 1UI8A 1RRLA 1OF5A 1JKGA 3G8ZA 2OOVC 3NV0B 2XGNA 3HI7A 1KWIA 3KE7A 2CFDA 4OUQA 1WMPA 5IERA 1YIJ3 5FGOA 3MG2A 3I563 3ALAA 4R1KA 5EEOA 3N54B 1NB3I 2CW9A 4JF8A 1VQP3 5D83A 3I553 1NO3A 2BNGA 3WOFB 3LTAA 2CWTA 2BT3A 2V1LA 3HIGA 2CFWA 2HMOB 3CXC2 1OUNA 3DGOA 1YGEA 3UB1A 5IW9A 3EQQB 4WYKB 2A15A 2YFJB 3LXUX 1UI7A 4N6TA 5HGRA 3F9SA 2XEPA 1DVCA 1IU7A 2B1XB 1DYUA 2CH9A 3G16A 5CLKA 1YJ93 1VQL3 2P0MA 5A0OB 2CFGA 1IVXA 3DGMA 6STDA 2PZVA 4HBRA 1N5PA 4FMCA 1RRHA 2HMJB 3OX9A 4MMYB 3OWYA 4JRFA 3B7CA 2FNQA 3LMLA 3FCSB 4N6OB 5AIFA 3V98A 1L5GB 3T8UA 5IENA 2XFTA 3VF1A 1W00A 3CCM3 4FCMA 3CNXA 4TX4A 4XB5A 3OWSA 2WGOA 1MNLA 2D42A 1O7MB 2LYXA 4STDA 1GS3A 3RDEA 4HVNA 2W2CA 2WO0A 2ZDJA 4IT7A 5CF1A 1VQ53 1M9GA 1QAKA 5AYRB 2E2VA 3BNDA 1CEWI 2RGQA 1DMMA 1G96A 2QIYA 5D81A 4HM3B 3IMAB 1KQS2 1OHPA 3FG4A 4GL6A 1CQSA 4FMAA 5BVBA 4WHAA 4AKZA 1K734 3FG1A 4QWTA 4O3VA 1SIIA 4HZBB 4OK0A 3O8YA 4R9LA 3F8HA 2GEYA 3LTDA 3B4PA 1JN5B 3NUVA 2F99A 1GD3A 1F8NA 1IV7A 2Z6BA 1TFOA 4KZ1A 4H3UA 2C10A 2W6JH 3OXAA 2ML6A 3S67A 1YVBI 4N6NB 5IG3A 2Y74A 3OWUA 2YX9A 4J8TA 3TDGA 1NJI4 3N8BA 2W9QA 1TU5A 5LC7A 1N8R4 1NWWA 2BMQB 2XH9A 3D3LA 4K1UA 1STDA 2OQEC 2L4VA 2IMJA 3WA2X 5JBSA 4RNZA 4G1MB 1E3VA 3G0KA 3NV0A 3Q2PA 1SQWA 3KFQC 1AVLA 1TP6A 3JUPA 4ORLA 3KSPA 2P38A 3F7SA 3CCV3 2O3OA 4O8SA 3RGRA 3DMCA 1R4CA 2XR8B 3PYJA 3QK9A 2GEXA 1J2BA 4CDLA 3CCL3 1BUQA 1N9EA 5AI1A 4R4KA 3LT8A 4KVHA 1IQXA 4WP5A 4MEIA 4WYKA 3G6E3 5BXQA 2OTL3 1GY7A 3KIIA 3DGNA 4N3VA 3CCJ3 1YIT3 3IJEB 1D6ZA 2IUJA 1W7CA 2STDA 1UW1A 4N6UA 3UJMA 1JV2B 3NM2A 5STDA 4N6V0 1IV9A 1Y4KA 4XDWA 4EC6A 3K63A 2Z76A 1VQ63 1JB2A 1JJ22 1O7WB 1OHOA 2INXA 2UX0A 3NQYA 1VQ43 3IPTA 2IUKA 2CKFB 5AIHA 4BTWA 2RFRA 1FGTA 4LZIA 3EB8A 3KZTA 1YJW3 4RZMA 4K90B 1UUWB 5IEOA 4I4KA 5AEWB 1EQKA 1WMNA 2P09A 1NU3A 5ELJA 3ECFA 3WDGB 4KFEA 1W2B2 4BTYA 3N9HA 3NM7A 4HM1B 1IK3A 1HKXA 3UL6A 3M8CA 3VGNA 5G2GA 1IQYA 1OACA 1GYBA 2ZL8A 3EC9A 3X3YA 2WOHA 3E99A 1EG9B 5CXOA 2F86B 1JKGB 2K54A 1A2VA 3FLJA 4FR9A 1O7PB 3DXOA 1JNQA 4EV2A 3MKIA 1WMOA 3I0YA 3SOAA 3S28A 4ZM8A 3QRDA 5CF2A 3H51A 1OPYA 3MG3A 1T5YA 2GBWB 1K41A 4L7KA 3X40A 1LNHA 1Q42A 1WNHA 2XRXB 1SJWA 3MYTA 1FGOA 4NHFA 1FA3A 1STFI 4AKYA 1CYUA 1M904 2CK3H 4OVMA 2FGTA 3HIIA 1N5HA 3X41A 1LXEA 3CMA3 3BNCA 4FMDA 3B8LA 1K9M4 4FMBA 1ISKA 1U5OA 1AR0A 2CG1A 3EBYA 1VQN3 1OGZA 1DMNA 4IIAA 1K28A 1OCVA 1IT8A 1SPUA 4EYCA 1VQ93 1QVF2 3B4OA 1C7HA 2XF3A 2W04A 3KN4A 3AMOB 4KFFA 4XDVA 1KD14 2F98A 3CPW2 5IF6A 3CCR3 2Q07A 1ROAA 5D82A 3L0RA 2RSXA 2LQVA 2E2UA 3Q1CA 1VZZA 1Q824 3K0ZA 2YFLB 4HYZA 3ER7A 3GZXB 3CU3A 3SOYA 3J7Yd 3NX0A 3K7CA 4X2OA 3LTCA 3EJVA 1W4NA 4EXRA 3FH1A 1FGMA 1RKYA 1RJOA 4Q53A 2OOVA 1VQ83 2JQ5A 2HMLB 4FCZA 2D1WA 3JVCA 1DVDA 1Z1SA 3FF0A 1VQM3 4N6LA 4O02B 3UL5A 2RCDA 3JUMA 1RN7A 3LTBA 2W03A 1U8CB 1W6CA 2KRTA 1W2ZA 2W9PA 3LT9A 2R4IA 2BMRB 3CD63 3FGYA 3BNBA 3OW22 4R9KA 1E3RA 1YHQ3 2XSHB 1Q40B 1GY5A 1O7NB 5DREA 3VSYA 2OWPA 2W0QA 4XBYA 3OV4A 3CME3 1WQLB 3EHCA 2BO9B 3MSOA 3MWZA 3F7XA 3GZYB 2W56B 1Q814 4U13A 3CNMA 3FSDA 4K61A 1ULJB 1S723 1OHSA 3T0UA 1Q7Y4 1ROVA 3BB9A 3Q90A 1S5AA 1D6YA 1QAFA 3GAXA 4LGQA 1FUWA 2OCTA 1IT7A 5AEUB 4HM6B 4HM4B 1PFPA 4HM5B 3S27A 4HKVB 4J9AA 4L8OA 3CCE3 2FXTA 2HMMB 4O2HA 4WWUC 2HMNB 3PS8A 2SBLA 1JB5A 3DZLA 5ELUA 1LOXA 3A76A 5TGNA 3X42A 5FW5A 4HM2B 1CYVA 2JDIH 2P05A 2Z7AA 1W6YA 3WMDA 3SEDA 5IEPA 3K9MC 2MC8A 3D9RA 3HX8A 5I97A 1QALA 7STDA 1QMAA 3KSED 3MHEA 3G4S3 5DRVA 4K1VA 2ML5A 3CC73 2OTJ3 3EBTA 3DUKA 3JUQA 3FF2A 1LVNA 1FGRA 1QJGA 2CIUA 5AIIA 3PGBA 5EVHA 1WTHA 3EN8A 3CCS3 2XFSA 3KKGA 4RNYA 2WGQA 4PEJA 3PCSA 3NBJA 3CPOA 3DGLA 1OF5B 1TUHA 3NHXA 5KP4A 1N8QA 2CFKA 2PNCA 1E97A 1O7GB 3RGAA 3S5CA 1IDPA 2CG0A 1K8A4 1TIJA 1OGXA 1W5ZA 4KFDA 1TFKA 2CFLA 2O9UX 2BHMA 1NB5I 3AMOA 4XBXA 3PCRA 4IPBA 1JRQA 1V74A 1JN5A 4LMIA 1D6UA 2M7OA 3X3ZA 4EBGA 3SX1A 3JUOA 1GY6A 1UUVB 4RBNA 4GB5A 2IA7A 3FZWA 4HM7B 3U1WA 3V99A 2XSOB 1A2KA 3CC23 4NREA 3S29A 2CC3A 3LYGA 2OQEA 2BMOB 2MF7A 1PU4A 3LH4A 3GWRA 4R80A 3SVAA 1KSIA 1QVG2 4HM0B 3HK4A 2CWUA 1M1K4 4WFOA 1ULIB 5KP3A 2K0MA 3ROBA 4MMZB 3CC43 5IG4A 3EX9A 1N9JA 5IG5A 4FCJA 1SIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP 3;  3CCE 3;  1VQ5 3;  3OW2 2;  3I55 3;  1YI2 3;  3CCS 3;  3CCU 3;  3CCL 3;  1YHQ 3;  1Q82 4;  1VQ6 3;  1M90 4;  1JJ2 2;  2QA4 3;  1Q86 4;  3CC2 3;  2QEX 3;  3CXC 2;  1VQK 3;  1NJI 4;  1VQ4 3;  3CMA 3;  3CME 3;  1K9M 4;  1KQS 2;  1N8R 4;  1YJN 3;  1Q81 4;  1VQO 3;  1KC8 4;  1VQN 3;  3CPW 2;  1YJW 3;  3CCM 3;  1K73 4;  3G6E 3;  1S72 3;  1QVG 2;  1Q7Y 4;  1VQ8 3;  1K8A 4;  3G71 3;  1M1K 4;  2OTL 3;  1VQ9 3;  3G4S 3;  1YIJ 3;  1YJ9 3;  1W2B 2;  1QVF 2;  1VQM 3;  3CC4 3;  1VQ7 3;  3CCJ 3;  1YIT 3;  1KD1 4;  1VQL 3;  3CC7 3;  3I56 3;  3CCQ 3;  2OTJ 3;  3CCV 3;  3CCR 3;  3CD6 3; 
#chains in the Genus database with same CATH topology
 2GU3 A;  1BRG A;  5AIG A;  4RNT A;  4CCV A;  1YI2 3;  2GBX B;  1BSC A;  2HMK B;  2KF5 A;  1JBS A;  5CK6 A;  1A90 A;  1UCI A;  2QEX 3;  1VQK 3;  1Q40 A;  3PXM A;  2I9W A;  5EQL A;  1DMQ A;  4BTX A;  1W6G A;  5LC6 A;  1AV4 A;  3SLU A;  1UDI I;  3F40 A;  1KC8 4;  3HZP A;  1B3S A;  1EUI C;  2W56 A;  1OH0 A;  8RNT A;  1TJD A;  2QGU A;  1MWT A;  1A67 A;  3BNE A;  1JBR A;  3NQZ A;  5AYS C;  2XGL A;  3UNL A;  2J8X B;  3BLZ A;  3AGN A;  3SXX A;  1HYF A;  3MG1 A;  1JB4 A;  1AVK A;  2WOF A;  3LOY A;  5JPP A;  3EF8 A;  3CCQ 3;  1ASK A;  4AEQ A;  3H3H A;  2P0X A;  1IQ8 A;  1ZX2 A;  2RNT A;  3PZW A;  3U97 A;  3X3X A;  2K3D A;  5IG0 A;  4MJD A;  3WOE B;  1B2X A;  1IVU A;  1I0V A;  3CCU 3;  1IVV A;  2Z77 A;  4LSO A;  1BAN A;  1US1 A;  2QA4 3;  2IYJ A;  3LZA A;  3WA3 A;  4H61 A;  1FGQ A;  1Q86 4;  3NBB A;  4MMX B;  1MGR A;  2H0G A;  2CWV A;  3K5T A;  1MOL A;  4X2H A;  1O7H B;  4HOH A;  1YJN 3;  3STD A;  1GD4 A;  1M1X B;  2GXF A;  5M18 A;  2KF4 A;  2YFI B;  4N6M A;  1VQO 3;  2E2T A;  3FG3 A;  3F8X A;  3GSP A;  1NDO B;  4HJL B;  2RBI A;  3FKA A;  3F14 A;  4EV5 A;  2C11 A;  1IVW A;  8CHO A;  2B24 B;  1W02 A;  3GZB A;  3V92 A;  3G71 3;  1RSN A;  5JPU A;  5G1L A;  3EN1 B;  4XM4 A;  3WOD G;  2CHC A;  1RGA A;  3NXJ A;  4HZ9 B;  2KCD A;  1VQ7 3;  3EE1 A;  3DY5 A;  1HU9 A;  4HM8 B;  1GOV A;  3JUN A;  3GZR A;  1UCL A;  1W01 A;  3NBR A;  4XBT A;  1ZO2 A;  2BIR A;  2GU1 A;  4LEH A;  1EA2 A;  3T8N A;  1UUG B;  4L8P A;  3GRD A;  3DM8 A;  3D5I A;  1EKM A;  3AHS A;  3MPH A;  2Y73 A;  2KXG A;  4EW5 A;  5KP1 A;  1UI8 A;  1RN4 A;  1RRL A;  1OF5 A;  1Q7H A;  1JKG A;  4J5G A;  3ZG0 A;  3G8Z A;  2ZA4 A;  2OOV C;  1BU4 A;  3NV0 B;  1C54 A;  2XGN A;  3HI7 A;  1KWI A;  3KE7 A;  2CFD A;  4OUQ A;  1WMP A;  5IER A;  1YIJ 3;  5FGO A;  3MG2 A;  4DKI A;  3I56 3;  3ALA A;  4R1K A;  5EEO A;  3N54 B;  1NB3 I;  2CW9 A;  4JF8 A;  1VQP 3;  5D83 A;  3I55 3;  1NO3 A;  2BNG A;  3WOF B;  3LTA A;  2CWT A;  1BRH A;  2BT3 A;  3A5E A;  2V1L A;  3HIG A;  2CFW A;  2HMO B;  3CXC 2;  1OUN A;  3DGO A;  1YGE A;  1LOV A;  3UB1 A;  1BNR A;  5IW9 A;  3EQQ B;  2L1S A;  4WYK B;  2A15 A;  2YFJ B;  3LXU X;  1UI7 A;  3D79 A;  4N6T A;  5HGR A;  3F9S A;  2XEP A;  1DVC A;  1IU7 A;  2B1X B;  1DYU A;  2CH9 A;  3G16 A;  5CLK A;  1GMP A;  1YJ9 3;  1GMQ A;  7GSP A;  1VQL 3;  2P0M A;  1MGW A;  5A0O B;  3D4A A;  2CFG A;  1IVX A;  3DGM A;  6STD A;  2PZV A;  4HBR A;  1N5P A;  4FMC A;  1RRH A;  2HMJ B;  3OX9 A;  4MMY B;  4ILF A;  3OWY A;  4JRF A;  3B7C A;  2FNQ A;  3LML A;  3FCS B;  4N6O B;  5AIF A;  1BNJ A;  3V98 A;  1T2H A;  1L5G B;  3Q3F A;  3T8U A;  5IEN A;  1HZ1 A;  2XFT A;  3VF1 A;  4J5K A;  1B2S A;  1A2P A;  1W00 A;  3CCM 3;  4FCM A;  3CNX A;  4TX4 A;  3ZG5 A;  4XB5 A;  3OWS A;  1GOU A;  1MWS A;  2WGO A;  1MNL A;  2KF3 A;  2D42 A;  1O7M B;  2LYX A;  4STD A;  1RTU A;  1GS3 A;  3RDE A;  1BSE A;  1UGH I;  4HVN A;  2W2C A;  2WO0 A;  2ZDJ A;  4IT7 A;  5BU4 A;  5CF1 A;  1M9G A;  1VQ5 3;  1QAK A;  5AYR B;  5RNT A;  2E2V A;  3BND A;  1DE3 A;  1CEW I;  1MWR A;  1GSP A;  1DMM A;  2RGQ A;  1G96 A;  1BGS A;  2QIY A;  5D81 A;  4HM3 B;  3IMA B;  5G1K A;  1KQS 2;  1OHP A;  3FG4 A;  4GL6 A;  1CQS A;  3WHO A;  4FMA A;  5BVB A;  1BNE A;  4WHA A;  4AKZ A;  1LRA A;  1K73 4;  3FG1 A;  4QWT A;  1B2Z A;  4O3V A;  1SII A;  4HZB B;  1RCL A;  1VQQ A;  4OK0 A;  3O8Y A;  1SAR A;  4R9L A;  3F8H A;  1UCK A;  2GEY A;  3LTD A;  4BL3 A;  1PY3 A;  3B4P A;  1JN5 B;  3NUV A;  1GD3 A;  1F8N A;  2F99 A;  1IV7 A;  1TFO A;  2Z6B A;  4KZ1 A;  4H3U A;  2C10 A;  2W6J H;  3OXA A;  2ML6 A;  3S67 A;  1YVB I;  4N6N B;  5IG3 A;  2Y74 A;  2F4Y A;  3OWU A;  2YX9 A;  4J8T A;  3TDG A;  1NJI 4;  3N8B A;  2W9Q A;  2UUG C;  1TU5 A;  1B21 A;  5LC7 A;  1N8R 4;  1NWW A;  2BMQ B;  2XH9 A;  1RGK A;  3D3L A;  1STD A;  2OQE C;  4GHO A;  4K1U A;  1G02 A;  2L4V A;  2IMJ A;  3WA2 X;  1RDS A;  2ZHX B;  5JBS A;  4RNZ A;  1I2F A;  4G1M B;  2GSP A;  1E3V A;  3G0K A;  3NV0 A;  3Q2P A;  1SQW A;  3KFQ C;  1AVL A;  1TP6 A;  1B2U A;  2IY2 A;  3JUP A;  2SAR A;  4ORL A;  3KSP A;  2P38 A;  3F7S A;  3CCV 3;  1I3F A;  2O3O A;  4O8S A;  1ZGX A;  3RGR A;  3DMC A;  1R4C A;  3KCH A;  2XR8 B;  1BUJ A;  1I8V A;  3PYJ A;  3QK9 A;  1FW7 A;  2GEX A;  1J2B A;  4CDL A;  3CCL 3;  1BUQ A;  1N9E A;  5AI1 A;  4R4K A;  3LT8 A;  4KVH A;  1IQX A;  1BNS A;  4WP5 A;  4MEI A;  4WYK A;  1RNT A;  3G6E 3;  4KT3 B;  2F56 A;  5BXQ A;  2C4B A;  1FZU A;  2OTL 3;  1GY7 A;  1BNF A;  3KII A;  3DGN A;  4N3V A;  3CCJ 3;  1YIT 3;  3IJE B;  1D6Z A;  2IUJ A;  1W7C A;  2STD A;  1UW1 A;  1T2I A;  3AGO A;  1LOY A;  2BU4 A;  4N6U A;  3UJM A;  1JV2 B;  3NM2 A;  5STD A;  4N6V 0;  1IV9 A;  1Y4K A;  4XDW A;  3SYU A;  4EC6 A;  3K63 A;  2Z76 A;  1VQ6 3;  1JB2 A;  1JJ2 2;  1O7W B;  1OHO A;  2INX A;  2UX0 A;  3NQY A;  1VQ4 3;  3IPT A;  2IUK A;  2CKF B;  1R4Y A;  5AIH A;  4BTW A;  1YGW A;  2RFR A;  1FGT A;  4LZI A;  3WR2 A;  3EB8 A;  1X1U A;  3KZT A;  1YJW 3;  1AY7 A;  4RZM A;  4K90 B;  1UUW B;  1DET A;  1I3I A;  4I4K A;  5IEO A;  5AEW B;  1EQK A;  3BU4 A;  1WMN A;  2P09 A;  1NU3 A;  5ELJ A;  3ECF A;  3WDG B;  4KFE A;  1W2B 2;  4BTY A;  3N9H A;  3NM7 A;  4HM1 B;  1B27 A;  1BRK A;  1TRQ A;  2AAD A;  1IK3 A;  1HKX A;  1X1W A;  3UL6 A;  1JBT A;  3M8C A;  3VGN A;  5G2G A;  1T3B A;  1IQY A;  1OAC A;  1GYB A;  1ZS7 A;  1I2E A;  1YNV X;  2ZL8 A;  3BIR A;  3EC9 A;  3X3Y A;  1RLS A;  2WOH A;  3E99 A;  1EG9 B;  1RHL A;  1V57 A;  2F86 B;  5CXO A;  1JKG B;  2KF6 A;  6RNT A;  2K54 A;  1A2V A;  3FLJ A;  4FR9 A;  1O7P B;  3DXO A;  1BRN L;  1JNQ A;  4EV2 A;  3MKI A;  1WMO A;  3I0Y A;  3SOA A;  3S28 A;  4ZM8 A;  1BIR A;  3QRD A;  5CF2 A;  3H51 A;  1OPY A;  3MG3 A;  1T5Y A;  2GBW B;  1K41 A;  1EEJ A;  4L7K A;  1LNH A;  1Q42 A;  1TRP A;  1WNH A;  2XRX B;  3X40 A;  1RGH A;  1SJW A;  3MYT A;  1FGO A;  1RGF A;  4NHF A;  1I0X A;  1FA3 A;  1STF I;  4AKY A;  1RMS A;  1CYU A;  1LNI A;  1M90 4;  2CK3 H;  3D5G A;  4OVM A;  2FGT A;  3HII A;  1N5H A;  3X41 A;  1LXE A;  3CMA 3;  3BNC A;  4FMD A;  3B8L A;  1K9M 4;  4FMB A;  1ISK A;  1U5O A;  1AR0 A;  2CG1 A;  3EBY A;  1VQN 3;  1OGZ A;  4CJN A;  1DMN A;  4IIA A;  1K28 A;  1OCV A;  1IT8 A;  1SPU A;  4EYC A;  1UGI A;  1VQ9 3;  1RGE A;  1RGC A;  1BNG A;  2R41 A;  1QVF 2;  3B4O A;  1C7H A;  2XF3 A;  2W04 A;  3KN4 A;  3AMO B;  4KFF A;  4XDV A;  5GSP A;  1KD1 4;  2F98 A;  1YVS A;  1BRI A;  3CPW 2;  5IF6 A;  5M19 A;  1BSA A;  3CCR 3;  2Q07 A;  1ROA A;  5D82 A;  3L0R A;  2RSX A;  2LQV A;  3URP A;  2E2U A;  3Q1C A;  1VZZ A;  1Q82 4;  1LOW A;  3K0Z A;  2YFL B;  1JZD A;  4HYZ A;  3ER7 A;  3GZX B;  4BU4 A;  2UGI A;  3CU3 A;  3SOY A;  3J7Y d;  3NX0 A;  3K7C A;  4X2O A;  1B2M A;  3LTC A;  3EJV A;  1W4N A;  4EXR A;  3FH1 A;  1FGM A;  1V58 A;  1RKY A;  1RJO A;  4Q53 A;  2OOV A;  3DGY A;  1VQ8 3;  2JQ5 A;  2HML B;  1FUT A;  4FCZ A;  2D1W A;  3JVC A;  1DVD A;  1Z1S A;  3FF0 A;  1VQM 3;  4N6L A;  4O02 B;  3UL5 A;  2RCD A;  3JUM A;  1RN7 A;  3HOH A;  2W03 A;  1U8C B;  1W6C A;  3LTB A;  2KRT A;  1W2Z A;  1BAO A;  2W9P A;  3LT9 A;  1LQM B;  2BMR B;  1MWU A;  2R4I A;  3CD6 3;  3FGY A;  3ZFZ A;  3BNB A;  3OW2 2;  4R9K A;  1E3R A;  1I70 A;  2XSH B;  1YHQ 3;  1Q40 B;  1GY5 A;  1O7N B;  5DRE A;  3VSY A;  2OWP A;  2W0Q A;  4XBY A;  3OV4 A;  3CME 3;  1WQL B;  3EHC A;  2BO9 B;  3MSO A;  3MWZ A;  3F7X A;  3GZY B;  2W56 B;  1Q81 4;  4U13 A;  3CNM A;  3FSD A;  4K61 A;  1FUS A;  1ULJ B;  1S72 3;  1OHS A;  3T0U A;  1Q7Y 4;  1ROV A;  3BB9 A;  3Q90 A;  1S5A A;  1D6Y A;  1QAF A;  3GAX A;  4LGQ A;  1BVI A;  1FUW A;  2OCT A;  1IT7 A;  3AHW A;  5AEU B;  4HM6 B;  1RNB A;  4HM4 B;  1PFP A;  4HM5 B;  3S27 A;  1NNV A;  4HKV B;  2CX0 A;  4J9A A;  4L8O A;  3CCE 3;  2FXT A;  2HMM B;  4O2H A;  4WWU C;  2HMN B;  3PS8 A;  2SBL A;  1JB5 A;  3DZL A;  5ELU A;  4BL2 A;  1LOX A;  3A76 A;  5TGN A;  3X42 A;  5FW5 A;  4HM2 B;  1BOX A;  1RCK A;  2H0H A;  1CYV A;  4GSP A;  1RN1 A;  2JDI H;  2P05 A;  1BSD A;  1CH0 A;  2Z7A A;  1W6Y A;  3WMD A;  3SED A;  1RGL A;  5IEP A;  2CX1 A;  2H0I A;  3D9R A;  3HX8 A;  2F5M A;  2HOH A;  3K9M C;  1QAL A;  2MC8 A;  5I97 A;  7STD A;  1QMA A;  3KSE D;  3MHE A;  3G4S 3;  1G0T A;  5DRV A;  4K1V A;  1BRJ A;  2ML5 A;  5HOH A;  3CC7 3;  3EBT A;  2OTJ 3;  3DUK A;  3JUQ A;  3FF2 A;  1FGR A;  1LVN A;  1QJG A;  1TTO A;  2KAA A;  4NPB A;  2CIU A;  5AII A;  3PGB A;  5EVH A;  1WTH A;  1PYL A;  3EN8 A;  3CCS 3;  4BIR A;  1BNI A;  4HAA A;  1B20 A;  2XFS A;  3KKG A;  4RNY A;  1BRS A;  2WGQ A;  4PEJ A;  3PCS A;  3NBJ A;  2AAE A;  5BIR A;  1AQZ A;  3CPO A;  3DGL A;  6GSP A;  1OF5 B;  1TUH A;  3NHX A;  5KP4 A;  1N8Q A;  2CFK A;  2PNC A;  1X1X A;  4LYL B;  1IYY A;  1E97 A;  1O7G B;  3RGA A;  3S5C A;  1IDP A;  2CG0 A;  1K8A 4;  1TIJ A;  1GMR A;  1OGX A;  1W5Z A;  9RNT A;  4KFD A;  1TFK A;  2CFL A;  4CPK A;  2O9U X;  2BHM A;  1NB5 I;  1RGG A;  3AMO A;  3PCR A;  4IPB A;  1JRQ A;  4XBX A;  1BSB A;  1V74 A;  1JN5 A;  4LMI A;  1D6U A;  2F5W A;  2M7O A;  3DH2 A;  3X3Z A;  3SX1 A;  3JUO A;  1I2G A;  4EBG A;  1GY6 A;  1UUV B;  4RBN A;  1GOY A;  4GB5 A;  2IA7 A;  3FZW A;  4HM7 B;  3U1W A;  3V99 A;  2XSO B;  1A2K A;  3CC2 3;  4NRE A;  3S29 A;  2CC3 A;  4I5Q A;  3LYG A;  5M1A A;  2OQE A;  2BMO B;  2MF7 A;  1PU4 A;  3LH4 A;  3GWR A;  4R80 A;  3SVA A;  1KSI A;  1LQG C;  4HM0 B;  1QVG 2;  3HK4 A;  1JZO A;  2CWU A;  3RNT A;  1M1K 4;  1X1Y A;  4WFO A;  1ULI B;  5KP3 A;  2K0M A;  3ROB A;  4MMZ B;  3CC4 3;  5IG4 A;  3EX9 A;  1N9J A;  1UCJ A;  5IG5 A;  7RNT A;  1FYS A;  4FCJ A;  1Q9E A;  1SIH A; 
#chains in the Genus database with same CATH homology
 2GU3 A;  5AIG A;  4CCV A;  1YI2 3;  2GBX B;  2HMK B;  1A90 A;  5CK6 A;  2QEX 3;  1VQK 3;  1Q40 A;  3PXM A;  2I9W A;  5EQL A;  1DMQ A;  4BTX A;  1W6G A;  5LC6 A;  1AV4 A;  3SLU A;  3F40 A;  1KC8 4;  3HZP A;  2W56 A;  1OH0 A;  2QGU A;  1A67 A;  3BNE A;  3NQZ A;  5AYS C;  2XGL A;  3UNL A;  3BLZ A;  3SXX A;  3MG1 A;  1JB4 A;  1AVK A;  2WOF A;  3LOY A;  5JPP A;  3EF8 A;  3CCQ 3;  1ASK A;  4AEQ A;  3H3H A;  2P0X A;  1IQ8 A;  1ZX2 A;  3PZW A;  3U97 A;  3X3X A;  5IG0 A;  4MJD A;  3WOE B;  1IVU A;  3CCU 3;  1IVV A;  2Z77 A;  4LSO A;  1US1 A;  2QA4 3;  3LZA A;  3WA3 A;  1Q86 4;  4H61 A;  1FGQ A;  3NBB A;  4MMX B;  2CWV A;  3K5T A;  1MOL A;  4X2H A;  1O7H B;  1YJN 3;  3STD A;  1GD4 A;  1M1X B;  2GXF A;  1VQO 3;  2YFI B;  4N6M A;  2E2T A;  3FG3 A;  3F8X A;  1NDO B;  4HJL B;  3FKA A;  3F14 A;  4EV5 A;  2C11 A;  1IVW A;  8CHO A;  2B24 B;  1W02 A;  3GZB A;  3V92 A;  3G71 3;  5JPU A;  3EN1 B;  4XM4 A;  3WOD G;  2CHC A;  4HZ9 B;  3NXJ A;  1VQ7 3;  2KCD A;  3EE1 A;  3DY5 A;  1HU9 A;  4HM8 B;  3JUN A;  3GZR A;  1W01 A;  3NBR A;  4XBT A;  1ZO2 A;  2GU1 A;  4LEH A;  1EA2 A;  3T8N A;  4L8P A;  3GRD A;  3DM8 A;  1EKM A;  3MPH A;  2Y73 A;  2KXG A;  5KP1 A;  1UI8 A;  1RRL A;  1OF5 A;  1JKG A;  3G8Z A;  2OOV C;  3NV0 B;  2XGN A;  3HI7 A;  1KWI A;  3KE7 A;  2CFD A;  4OUQ A;  1WMP A;  5IER A;  1YIJ 3;  5FGO A;  3MG2 A;  3I56 3;  3ALA A;  4R1K A;  5EEO A;  3N54 B;  1NB3 I;  2CW9 A;  4JF8 A;  1VQP 3;  5D83 A;  3I55 3;  1NO3 A;  2BNG A;  3WOF B;  3LTA A;  2CWT A;  2BT3 A;  2V1L A;  3HIG A;  2CFW A;  2HMO B;  3CXC 2;  1OUN A;  3DGO A;  1YGE A;  3UB1 A;  5IW9 A;  3EQQ B;  4WYK B;  2A15 A;  2YFJ B;  3LXU X;  1UI7 A;  4N6T A;  5HGR A;  3F9S A;  2XEP A;  1DVC A;  1IU7 A;  2B1X B;  1DYU A;  2CH9 A;  3G16 A;  5CLK A;  1YJ9 3;  1VQL 3;  2P0M A;  5A0O B;  2CFG A;  1IVX A;  3DGM A;  6STD A;  2PZV A;  4HBR A;  1N5P A;  4FMC A;  1RRH A;  2HMJ B;  3OX9 A;  4MMY B;  3OWY A;  4JRF A;  3B7C A;  2FNQ A;  3LML A;  3FCS B;  4N6O B;  5AIF A;  3V98 A;  1L5G B;  3T8U A;  5IEN A;  2XFT A;  3VF1 A;  1W00 A;  3CCM 3;  4FCM A;  3CNX A;  4TX4 A;  4XB5 A;  3OWS A;  2WGO A;  1MNL A;  2D42 A;  1O7M B;  2LYX A;  4STD A;  1GS3 A;  3RDE A;  4HVN A;  2W2C A;  2WO0 A;  2ZDJ A;  4IT7 A;  5CF1 A;  1VQ5 3;  1M9G A;  1QAK A;  5AYR B;  2E2V A;  3BND A;  1CEW I;  2RGQ A;  1DMM A;  1G96 A;  2QIY A;  5D81 A;  4HM3 B;  3IMA B;  1KQS 2;  1OHP A;  3FG4 A;  4GL6 A;  1CQS A;  4FMA A;  5BVB A;  4WHA A;  4AKZ A;  1K73 4;  3FG1 A;  4QWT A;  4O3V A;  1SII A;  4HZB B;  4OK0 A;  3O8Y A;  4R9L A;  3F8H A;  2GEY A;  3LTD A;  3B4P A;  1JN5 B;  3NUV A;  2F99 A;  1GD3 A;  1F8N A;  1IV7 A;  2Z6B A;  1TFO A;  4KZ1 A;  4H3U A;  2C10 A;  2W6J H;  3OXA A;  2ML6 A;  3S67 A;  1YVB I;  4N6N B;  5IG3 A;  2Y74 A;  3OWU A;  2YX9 A;  4J8T A;  3TDG A;  1NJI 4;  3N8B A;  2W9Q A;  1TU5 A;  5LC7 A;  1N8R 4;  1NWW A;  2BMQ B;  2XH9 A;  3D3L A;  4K1U A;  1STD A;  2OQE C;  2L4V A;  2IMJ A;  3WA2 X;  5JBS A;  4RNZ A;  4G1M B;  1E3V A;  3G0K A;  3NV0 A;  3Q2P A;  1SQW A;  3KFQ C;  1AVL A;  1TP6 A;  3JUP A;  4ORL A;  3KSP A;  2P38 A;  3F7S A;  3CCV 3;  2O3O A;  4O8S A;  3RGR A;  3DMC A;  1R4C A;  2XR8 B;  3PYJ A;  3QK9 A;  2GEX A;  1J2B A;  4CDL A;  3CCL 3;  1BUQ A;  1N9E A;  5AI1 A;  4R4K A;  3LT8 A;  4KVH A;  1IQX A;  4WP5 A;  4MEI A;  4WYK A;  3G6E 3;  5BXQ A;  2OTL 3;  1GY7 A;  3KII A;  3DGN A;  4N3V A;  3CCJ 3;  1YIT 3;  3IJE B;  1D6Z A;  2IUJ A;  1W7C A;  2STD A;  1UW1 A;  4N6U A;  3UJM A;  1JV2 B;  3NM2 A;  5STD A;  4N6V 0;  1IV9 A;  1Y4K A;  4XDW A;  4EC6 A;  3K63 A;  2Z76 A;  1VQ6 3;  1JB2 A;  1JJ2 2;  1O7W B;  1OHO A;  2INX A;  2UX0 A;  3NQY A;  1VQ4 3;  3IPT A;  2IUK A;  2CKF B;  5AIH A;  4BTW A;  2RFR A;  1FGT A;  4LZI A;  3EB8 A;  3KZT A;  1YJW 3;  4RZM A;  4K90 B;  1UUW B;  5IEO A;  4I4K A;  5AEW B;  1EQK A;  1WMN A;  2P09 A;  1NU3 A;  5ELJ A;  3ECF A;  3WDG B;  4KFE A;  1W2B 2;  4BTY A;  3N9H A;  3NM7 A;  4HM1 B;  1IK3 A;  1HKX A;  3UL6 A;  3M8C A;  3VGN A;  5G2G A;  1IQY A;  1OAC A;  1GYB A;  2ZL8 A;  3EC9 A;  3X3Y A;  2WOH A;  3E99 A;  1EG9 B;  5CXO A;  2F86 B;  1JKG B;  2K54 A;  1A2V A;  3FLJ A;  4FR9 A;  1O7P B;  3DXO A;  1JNQ A;  4EV2 A;  3MKI A;  1WMO A;  3I0Y A;  3SOA A;  3S28 A;  4ZM8 A;  3QRD A;  5CF2 A;  3H51 A;  1OPY A;  3MG3 A;  1T5Y A;  2GBW B;  1K41 A;  4L7K A;  3X40 A;  1LNH A;  1Q42 A;  1WNH A;  2XRX B;  1SJW A;  3MYT A;  1FGO A;  4NHF A;  1FA3 A;  1STF I;  4AKY A;  1CYU A;  1M90 4;  2CK3 H;  4OVM A;  2FGT A;  3HII A;  1N5H A;  3X41 A;  1LXE A;  3CMA 3;  3BNC A;  4FMD A;  3B8L A;  1K9M 4;  4FMB A;  1ISK A;  1U5O A;  1AR0 A;  2CG1 A;  3EBY A;  1VQN 3;  1OGZ A;  1DMN A;  4IIA A;  1K28 A;  1OCV A;  1IT8 A;  1SPU A;  4EYC A;  1VQ9 3;  1QVF 2;  3B4O A;  1C7H A;  2XF3 A;  2W04 A;  3KN4 A;  3AMO B;  4KFF A;  4XDV A;  1KD1 4;  2F98 A;  3CPW 2;  5IF6 A;  3CCR 3;  2Q07 A;  1ROA A;  5D82 A;  3L0R A;  2RSX A;  2LQV A;  2E2U A;  3Q1C A;  1VZZ A;  1Q82 4;  3K0Z A;  2YFL B;  4HYZ A;  3ER7 A;  3GZX B;  3CU3 A;  3SOY A;  3J7Y d;  3NX0 A;  3K7C A;  4X2O A;  3LTC A;  3EJV A;  1W4N A;  4EXR A;  3FH1 A;  1FGM A;  1RKY A;  1RJO A;  4Q53 A;  2OOV A;  1VQ8 3;  2JQ5 A;  2HML B;  4FCZ A;  2D1W A;  3JVC A;  1DVD A;  1Z1S A;  3FF0 A;  1VQM 3;  4N6L A;  4O02 B;  3UL5 A;  2RCD A;  3JUM A;  1RN7 A;  3LTB A;  2W03 A;  1U8C B;  1W6C A;  2KRT A;  1W2Z A;  2W9P A;  3LT9 A;  2R4I A;  2BMR B;  3CD6 3;  3FGY A;  3BNB A;  3OW2 2;  4R9K A;  1E3R A;  1YHQ 3;  2XSH B;  1Q40 B;  1GY5 A;  1O7N B;  5DRE A;  3VSY A;  2OWP A;  2W0Q A;  4XBY A;  3OV4 A;  3CME 3;  1WQL B;  3EHC A;  2BO9 B;  3MSO A;  3MWZ A;  3F7X A;  3GZY B;  2W56 B;  1Q81 4;  4U13 A;  3CNM A;  3FSD A;  4K61 A;  1ULJ B;  1S72 3;  1OHS A;  3T0U A;  1Q7Y 4;  1ROV A;  3BB9 A;  3Q90 A;  1S5A A;  1D6Y A;  1QAF A;  3GAX A;  4LGQ A;  1FUW A;  2OCT A;  1IT7 A;  5AEU B;  4HM6 B;  4HM4 B;  1PFP A;  4HM5 B;  3S27 A;  4HKV B;  4J9A A;  4L8O A;  3CCE 3;  2FXT A;  2HMM B;  4O2H A;  4WWU C;  2HMN B;  3PS8 A;  2SBL A;  1JB5 A;  3DZL A;  5ELU A;  1LOX A;  3A76 A;  5TGN A;  3X42 A;  5FW5 A;  4HM2 B;  1CYV A;  2JDI H;  2P05 A;  2Z7A A;  1W6Y A;  3WMD A;  3SED A;  5IEP A;  3K9M C;  2MC8 A;  3D9R A;  3HX8 A;  5I97 A;  1QAL A;  7STD A;  1QMA A;  3KSE D;  3MHE A;  3G4S 3;  5DRV A;  4K1V A;  2ML5 A;  3CC7 3;  2OTJ 3;  3EBT A;  3DUK A;  3JUQ A;  3FF2 A;  1LVN A;  1FGR A;  1QJG A;  2CIU A;  5AII A;  3PGB A;  5EVH A;  1WTH A;  3EN8 A;  3CCS 3;  2XFS A;  3KKG A;  4RNY A;  2WGQ A;  4PEJ A;  3PCS A;  3NBJ A;  3CPO A;  3DGL A;  1OF5 B;  1TUH A;  3NHX A;  5KP4 A;  1N8Q A;  2CFK A;  2PNC A;  1E97 A;  1O7G B;  3RGA A;  3S5C A;  1IDP A;  2CG0 A;  1K8A 4;  1TIJ A;  1OGX A;  1W5Z A;  4KFD A;  1TFK A;  2CFL A;  2O9U X;  2BHM A;  1NB5 I;  3AMO A;  4XBX A;  3PCR A;  4IPB A;  1JRQ A;  1V74 A;  1JN5 A;  4LMI A;  1D6U A;  2M7O A;  3X3Z A;  4EBG A;  3SX1 A;  3JUO A;  1GY6 A;  1UUV B;  4RBN A;  4GB5 A;  2IA7 A;  3FZW A;  4HM7 B;  3U1W A;  3V99 A;  2XSO B;  1A2K A;  3CC2 3;  4NRE A;  3S29 A;  2CC3 A;  3LYG A;  2OQE A;  2BMO B;  2MF7 A;  1PU4 A;  3LH4 A;  3GWR A;  4R80 A;  3SVA A;  1KSI A;  1QVG 2;  4HM0 B;  3HK4 A;  2CWU A;  1M1K 4;  4WFO A;  1ULI B;  5KP3 A;  2K0M A;  3ROB A;  4MMZ B;  3CC4 3;  5IG4 A;  3EX9 A;  1N9J A;  5IG5 A;  4FCJ A;  1SIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...