1Q7Y4

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q7y400
3CXC2 1QVG2 3OW22 1VQ73 3CCQ3 3CMA3 1VQP3 1YJW3 3CC73 1N8R4 3G6E3 3CCM3 1YI23 1VQL3 2OTL3 1KQS2 1VQ53 3G713 2QA43 1W2B2 3CCE3 1Q864 1K734 3CCR3 3I553 1NJI4 1K8A4 1KD14 3G4S3 1VQ83 1VQ63 3CCL3 1Q7Y4 1KC84 3CCV3 1Q824 1VQN3 1VQK3 1VQM3 3CCJ3 1K9M4 1M1K4 1YIT3 1JJ22 1VQO3 3CME3 3CC43 1S723 1Q814 1YHQ3 3CCS3 1YJN3 1YJ93 1YIJ3 1VQ43 3CCU3 2QEX3 1M904 3CD63 2OTJ3 3CPW2 1VQ93 3CC23 1QVF2 3I563
chains in the Genus database with same CATH superfamily
1SJWA 1G02A 1TUHA 2W03A 3T8UA 1W00A 2ZDJA 2BNGA 1X1WA 1Q864 4HM6B 1MWUA 2C10A 1MGRA 1BAOA 2CC3A 2ZHXB 3S27A 1JBTA 2OTL3 3EC9A 3EX9A 1RDSA 3BNBA 3LYGA 1JKGB 1OHPA 2A15A 2OQEC 1JB2A 2RFRA 1KWIA 3CCL3 4MJDA 3KSED 4EYCA 4RBNA 1IVUA 3FG4A 3NX0A 3RDEA 1SPUA 2GEYA 1UGHI 2FGTA 1WMNA 1IVXA 1DMMA 1GY6A 1S5AA 1W7CA 1YJN3 3D5GA 1BUQA 1YIJ3 3OWYA 3LTDA 2GXFA 2Z76A 1MGWA 4HVNA 4FCZA 4FMAA 5D82A 1OUNA 2C11A 1EEJA 3CNXA 3CMA3 1VQP3 2MF7A 3DZLA 5CXOA 3WOFB 2YFIB 1BRHA 1EA2A 1C54A 3D5IA 5IEPA 3OXAA 1O7WB 3FG1A 3AGNA 1RGEA 2SBLA 3ALAA 3DUKA 2D42A 3K63A 3KKGA 2KF6A 4WYKB 5DREA 1STDA 4HM3B 5BU4A 3KSPA 3G4S3 4GB5A 1NNVA 4KFFA 2JQ5A 3URPA 4EW5A 1D6ZA 2CHCA 1DMQA 3K7CA 2KF5A 1RGHA 1SQWA 2F86B 1DE3A 2L1SA 3VF1A 1I0XA 1V74A 1UCIA 3DGNA 3CCS3 3F8HA 1TIJA 1OPYA 3KIIA 3BNEA 3HI7A 4BTXA 2CWUA 3I563 3SXXA 3HIIA 1W02A 1TP6A 1A90A 2HMNB 4FMDA 3B4PA 3ECFA 1B2ZA 3HOHA 4FMCA 4J5KA 4L8OA 3QRDA 5AIFA 2UUGC 1TRPA 1BRKA 1RNBA 4XM4A 3GSPA 5CF1A 1IU7A 2MC8A 3F7SA 1WMPA 1GYBA 3CPOA 3LT9A 4ZM8A 1YIT3 4BIRA 1GMRA 5IERA 1UW1A 1EG9B 3AHWA 1N9EA 2M7OA 2Z6BA 3OV4A 3B8LA 3NV0B 3UJMA 5G2GA 5IG3A 3O8YA 1BSBA 1BNEA 2CFGA 2CWTA 1BRIA 4MMXB 5EEOA 1F8NA 2W0QA 3DGYA 3VGNA 3X3YA 1KSIA 2BMRB 7GSPA 2CIUA 1NB3I 3NBBA 3CC73 1TFKA 3IMAB 4N6UA 5AYSC 1VZZA 2H0GA 3LTCA 1JN5A 4L7KA 3PS8A 1DVCA 1RGCA 3U97A 1IYYA 1SIIA 1Q40A 2KRTA 1OHSA 3DXOA 3EE1A 1JRQA 1YVSA 2W2CA 3E99A 3FLJA 1G96A 1YNVX 5GSPA 6RNTA 1VQM3 1N5PA 2ML5A 4X2OA 1JJ22 2JDIH 5ELJA 1QJGA 1YGEA 3SVAA 1HKXA 4HOHA 1I70A 1Y4KA 1UUWB 4EXRA 1Z1SA 1U5OA 1NO3A 1TU5A 1ZS7A 1IVWA 1OHOA 1TJDA 3LT8A 4KT3B 4EV5A 1CYVA 3VSYA 1JKGA 3Q1CA 3U1WA 1OCVA 3DY5A 1CEWI 3GZRA 3LZAA 1QVF2 3EB8A 5AYRB 1B27A 2SARA 2W6JH 5BVBA 1UCLA 1YJW3 1B3SA 1WMOA 3KFQC 4LMIA 8CHOA 1RN4A 3NQZA 1IQYA 1UI7A 2P05A 3G0KA 1O7GB 3QK9A 1I3IA 1NJI4 1A2VA 4HKVB 2HMJB 3D4AA 1VQN3 4R9KA 1VQK3 1AQZA 1UI8A 3F7XA 5AIHA 4WWUC 3X40A 2GU3A 1AVKA 4AKYA 1I2EA 4DKIA 4X2HA 4WHAA 1BNIA 2QGUA 3X41A 1RTUA 2HMLB 5D81A 4K1VA 1EQKA 2GEXA 4J9AA 4R80A 4WYKA 1O7MB 3JUMA 1RCLA 1BNRA 5IENA 5EVHA 2BIRA 3F9SA 3SOYA 4KZ1A 4JRFA 2CKFB 3CU3A 1I8VA 2R41A 5STDA 2F5MA 4BL3A 1ROAA 1OF5B 3RGRA 2AADA 2BMQB 1T2IA 4K61A 3A5EA 3WODG 3I553 1VQ43 3OWUA 4HJLB 3F40A 1JV2B 4XBXA 1B20A 5IG0A 1SARA 2GU1A 5BIRA 1NU3A 1FUSA 1BNFA 1VQO3 1AY7A 2LYXA 3JUOA 3WA3A 1O7HB 1W2ZA 2W04A 3G8ZA 4RZMA 4N6MA 3EBTA 1FGQA 1L5GB 4NHFA 4BU4A 3GAXA 1BNGA 2QEX3 1LOWA 2UX0A 3NHXA 3PCSA 4XDWA 2IUJA 4N6LA 6STDA 4HM4B 4MMYB 3BNCA 2F5WA 4CJNA 4AEQA 3KN4A 2E2TA 3SX1A 4IT7A 1T2HA 2CWVA 3NV0A 1GD3A 1U8CB 4KVHA 4R1KA 1GMQA 1BIRA 1LOYA 4IIAA 1Q7Y4 2XSOB 1ULIB 1R4YA 1AV4A 5FW5A 3SYUA 1Q824 1FGTA 1K9M4 2FNQA 3X3XA 2YFJB 5LC6A 1N9JA 2XH9A 1GY5A 2V1LA 3NBRA 2RBIA 4L8PA 1K28A 1RRLA 1RGAA 1N5HA 3NM7A 3FCSB 1UUVB 3UL6A 2CW9A 2ZA4A 1M1XB 3DMCA 3CNMA 2LQVA 1LQMB 3I0YA 1J2BA 1V58A 3ER7A 1IV7A 5CF2A 1DMNA 1RRHA 1W4NA 4N6V0 3S67A 1O7NB 3A76A 1QAKA 1YI23 3TDGA 2K3DA 3WDGB 3LTAA 2CG1A 5G1KA 4HM8B 3WOEB 1M9GA 1MWSA 1X1UA 1TTOA 3MHEA 3Q90A 4J8TA 3FGYA 1LRAA 1RLSA 5D83A 3H51A 5G1LA 2BMOB 2CFLA 3BB9A 2CFDA 3CME3 1MOLA 5CLKA 4MMZB 1ROVA 4RNYA 2F98A 4MEIA 1GS3A 4KFEA 2AAEA 2H0IA 2KF4A 3CPW2 1QVG2 1R4CA 1UDII 1ASKA 3DGMA 1RNTA 7RNTA 2P0MA 1W6GA 1QMAA 1EUIC 1TFOA 4HM0B 1JZOA 1T5YA 4EV2A 4O3VA 1Q7HA 3SEDA 3CCM3 5IF6A 1JBSA 1VQL3 3OWSA 5BXQA 1VQ53 2CFKA 4R9LA 2K0MA 1RCKA 5IW9A 2UGIA 4O2HA 2W56B 1OGZA 1GY7A 2F99A 4J5GA 4CPKA 1X1YA 5RNTA 3CCJ3 4OVMA 5EQLA 3BNDA 1NB5I 4AKZA 3IPTA 3EHCA 2INXA 1OGXA 1BNSA 3K0ZA 1B2SA 1QALA 3FG3A 3N9HA 3GWRA 1OF5A 4OK0A 3UB1A 1EKMA 5CK6A 4NPBA 1M904 1LNHA 5AI1A 5I97A 2FXTA 2GSPA 2W9PA 4XBTA 1MWRA 2CK3H 3B4OA 1RGGA 1HU9A 3FZWA 1B2XA 3G6E3 5M18A 2CFWA 1US1A 2O9UX 1KQS2 3SLUA 1VQQA 1I2FA 1HZ1A 3AMOB 3SOAA 4O02B 3RNTA 1WNHA 1JNQA 2PNCA 2STDA 3D9RA 3NXJA 3KE7A 4N6OB 4WP5A 1LOVA 3FKAA 3BIRA 2ML6A 3DGLA 1BRGA 5KP4A 1BU4A 3L0RA 2B1XB 3FSDA 3JUQA 3NUVA 3CCU3 1PFPA 4NREA 3CD63 1OACA 2CH9A 2WOFA 5FGOA 4CCVA 2KAAA 1FGOA 4EC6A 4HBRA 1CH0A 1LVNA 1VQ73 3CCQ3 1Q42A 1ZO2A 1FW7A 1UCKA 1STFI 1UUGB 1G0TA 2C4BA 2D1WA 2HMOB 3EQQB 1IDPA 2J8XB 2B24B 3K5TA 5M1AA 2OWPA 1BSCA 4HM1B 1K734 1W01A 5IG5A 1K8A4 4PEJA 2H0HA 4H3UA 2HMKB 2XFSA 1BRJA 3MYTA 1K41A 1BRSA 1AVLA 1SIHA 2I9WA 2XRXB 3PGBA 2IY2A 1D6UA 2K54A 3N8BA 4XB5A 1OH0A 2IUKA 3AHSA 3G16A 1W6CA 1M1K4 1I0VA 3JUNA 4FCJA 1I3FA 4BL2A 2YFLB 1Q814 2OOVA 1ULJB 1FUWA 3Q2PA 4GL6A 2WGOA 1GOVA 1C7HA 1GOYA 3NM2A 3V99A 1MWTA 3GZBA 4U13A 5AEWB 2Z77A 1AR0A 3V92A 9RNTA 3EF8A 1PU4A 3HZPA 1PYLA 3JVCA 1BSDA 4G1MB 1RJOA 1E97A 4LZIA 2BU4A 3STDA 5M19A 1IK3A 1V57A 3PYJA 1ZX2A 1CYUA 5LC7A 3UL5A 1IV9A 4RNTA 3T8NA 3ZFZA 1GD4A 3K9MC 3WHOA 1PY3A 3S5CA 3CCV3 1UCJA 4GSPA 3BU4A 1RN7A 1BGSA 5AIGA 1RHLA 1BSEA 3X3ZA 1JZDA 1IQ8A 1GOUA 2O3OA 1B2UA 1FYSA 1RN1A 4HZ9B 4Q53A 1IQXA 2XF3A 4HM2B 4HYZA 5HOHA 2L4VA 1BRNL 1W5ZA 1BOXA 1E3RA 2W56A 5TGNA 1D6YA 1QAFA 1VQ93 5AIIA 3S28A 2RNTA 3HIGA 3OW22 3LH4A 1Q9EA 3NBJA 2OQEA 6GSPA 2Z7AA 3FF2A 4LSOA 3M8CA 5JBSA 3MPHA 3UNLA 2RCDA 1YGWA 1CQSA 3Q3FA 2XR8B 3CCR3 1RGKA 2XGNA 5A0OB 1IVVA 1NDOB 2IMJA 2PZVA 3H3HA 4N3VA 4BTWA 4N6TA 4IPBA 1B2MA 4KFDA 4XBYA 1W2B2 3LOYA 3GRDA 4H61A 1DVDA 1MNLA 3DH2A 2CX1A 3MG1A 3MG3A 1T3BA 3X42A 8RNTA 3NQYA 5ELUA 3N54B 1HYFA 3AMOA 4O8SA 5HGRA 5KP1A 1RKYA 1ISKA 3CC23 1B21A 3ZG0A 2P0XA 2CX0A 3MWZA 4ORLA 4LGQA 3D79A 2RSXA 2IA7A 2Y74A 4N6NB 7STDA 3DM8A 3LTBA 2W9QA 2ZL8A 2HMMB 1BANA 1ZGXA 3KCHA 2WGQA 1IT8A 3CCE3 3RGAA 4HM5B 5KP3A 3AGOA 4ILFA 1A2PA 1O7PB 2P09A 2XGLA 4STDA 4BTYA 3HK4A 1BUJA 2XFTA 2Q07A 4HM7B 1WTHA 1X1XA 1TRQA 1W6YA 2GBXB 4FCMA 5IG4A 4K90B 2IYJA 3CC43 1S723 3IJEB 5AEUB 1LNIA 1DYUA 4WFOA 1BSAA 1A67A 1NWWA 3D3LA 4I5QA 4R4KA 1YJ93 2BHMA 3V98A 1LQGC 3MSOA 2OCTA 3ZG5A 2OTJ3 1FA3A 3MKIA 1DETA 2CG0A 1GSPA 1N8R4 1E3VA 4FR9A 1RGFA 1GMPA 1RSNA 4OUQA 3FF0A 3WR2A 3G713 2XSHB 1VQ83 3PXMA 1VQ63 2HOHA 3B7CA 1LOXA 3S29A 3WMDA 3F14A 1IT7A 4JF8A 1KC84 3F8XA 2KXGA 1RGLA 2P38A 4I4KA 3JUPA 3EN8A 3EJVA 3T0UA 2GBWB 5JPPA 3EBYA 2KF3A 1JBRA 5DRVA 3J7Yd 3BLZA 4LEHA 4QWTA 1YHQ3 5JPUA 3LXUX 3WA2X 4EBGA 3ROBA 3KZTA 1JB4A 2F56A 3HX8A 4TX4A 1BNJA 3FH1A 1FGMA 4RNZA 3CXC2 2XEPA 2OOVC 2YX9A 3GZYB 1WQLB 1I2GA 1A2KA 1FZUA 4CDLA 3PZWA 3GZXB 2BO9B 4XDVA 2QA43 3EN1B 1KD14 3LMLA 4HAAA 3MG2A 2Y73A 4K1UA 4LYLB 1YVBI 2WO0A 4HZBB 1RMSA 2F4YA 1LXEA 1JB5A 2BT3A 2E2UA 1BVIA 1N8QA 2WOHA 2QIYA 2R4IA 3DGOA 5IEOA 1FGRA 3OX9A 1UGIA 1JN5B 4GHOA 2E2VA 4FMBA 1Q40B 2RGQA 3PCRA 2KCDA 1FUTA
chains in the Genus database with same CATH topology
1SJWA 1TUHA 2W03A 3T8UA 1W00A 2ZDJA 2BNGA 4HM6B 2C10A 2CC3A 3S27A 2OTL3 3EC9A 3EX9A 3BNBA 3LYGA 1JKGB 1OHPA 2A15A 2OQEC 1JB2A 2RFRA 1KWIA 3CCL3 4MJDA 3KSED 4EYCA 4RBNA 1IVUA 3FG4A 3NX0A 3RDEA 1SPUA 2GEYA 2FGTA 1WMNA 1IVXA 1DMMA 1GY6A 1S5AA 1W7CA 1YJN3 1BUQA 1YIJ3 3OWYA 3LTDA 2GXFA 2Z76A 4HVNA 4FCZA 4FMAA 5D82A 1OUNA 2C11A 3CNXA 3CMA3 1VQP3 2MF7A 3DZLA 5CXOA 3WOFB 2YFIB 1EA2A 5IEPA 3OXAA 1O7WB 3FG1A 3ALAA 1W2B2 2SBLA 3DUKA 5DREA 2D42A 3K63A 3KKGA 4WYKB 1Q864 1STDA 4HM3B 3G4S3 3KSPA 4GB5A 4KFFA 2JQ5A 1D6ZA 2CHCA 1DMQA 3K7CA 1SQWA 2F86B 3VF1A 3DGNA 1V74A 3CCS3 3F8HA 1TIJA 1OPYA 3KIIA 3BNEA 3HI7A 4BTXA 2CWUA 3I563 3SXXA 3HIIA 1W02A 1TP6A 1A90A 2HMNB 4FMDA 3B4PA 3ECFA 4FMCA 4L8OA 3QRDA 5AIFA 4XM4A 5CF1A 1IU7A 2MC8A 3F7SA 1WMPA 1GYBA 3CPOA 3LT9A 4ZM8A 1YIT3 5IERA 1UW1A 1EG9B 1N9EA 2M7OA 2Z6BA 3OV4A 3B8LA 3NV0B 3UJMA 5G2GA 5IG3A 3O8YA 2CFGA 2CWTA 4MMXB 5EEOA 1F8NA 2W0QA 3VGNA 3X3YA 1KSIA 2BMRB 2CIUA 1NB3I 3NBBA 3CC73 1TFKA 3IMAB 4N6UA 5AYSC 1VZZA 3LTCA 1JN5A 4L7KA 3PS8A 1DVCA 3U97A 1SIIA 1Q40A 2KRTA 1OHSA 3DXOA 3EE1A 1JRQA 2W2CA 3E99A 3FLJA 1G96A 1VQM3 1N5PA 2ML5A 4X2OA 1JJ22 2JDIH 5ELJA 1QJGA 1YGEA 3SVAA 1HKXA 1UUWB 1Y4KA 4EXRA 1Z1SA 1U5OA 1NO3A 1TU5A 1IVWA 1OHOA 3LT8A 4EV5A 1CYVA 3VSYA 1JKGA 3Q1CA 3U1WA 1OCVA 3DY5A 1CEWI 3GZRA 3LZAA 1QVF2 3EB8A 5AYRB 2W6JH 5BVBA 1YJW3 1WMOA 3KFQC 4LMIA 8CHOA 3NQZA 1IQYA 1UI7A 2P05A 3G0KA 1O7GB 3QK9A 1NJI4 1A2VA 4HKVB 2HMJB 1VQN3 4R9KA 1VQK3 1UI8A 3F7XA 5AIHA 4WWUC 3X40A 2GU3A 1AVKA 4AKYA 4X2HA 4WHAA 2QGUA 3X41A 5D81A 2HMLB 4K1VA 1EQKA 2GEXA 4J9AA 4R80A 4WYKA 1O7MB 3JUMA 5IENA 5EVHA 3F9SA 3SOYA 4KZ1A 4JRFA 2CKFB 3CU3A 5STDA 1ROAA 1OF5B 3RGRA 2BMQB 4K61A 1VQ43 3WODG 3I553 3OWUA 4HJLB 3F40A 1JV2B 4XBXA 5IG0A 2GU1A 1NU3A 1VQO3 2LYXA 3WA3A 3JUOA 1O7HB 1W2ZA 2W04A 3G8ZA 4RZMA 4N6MA 3EBTA 1FGQA 1L5GB 4NHFA 3GAXA 2QEX3 2UX0A 3NHXA 3PCSA 4XDWA 2IUJA 4N6LA 6STDA 4HM4B 4MMYB 3BNCA 4AEQA 3KN4A 2E2TA 3SX1A 4IT7A 2CWVA 3NV0A 1GD3A 1U8CB 4KVHA 4R1KA 4IIAA 1Q7Y4 2XSOB 1ULIB 5FW5A 1AV4A 1Q824 1FGTA 1K9M4 2FNQA 3X3XA 2YFJB 5LC6A 1N9JA 2XH9A 1GY5A 2V1LA 3NBRA 4L8PA 1K28A 1RRLA 1N5HA 3NM7A 3FCSB 1UUVB 3UL6A 2CW9A 1M1XB 3DMCA 3CNMA 2LQVA 3I0YA 1J2BA 3ER7A 1IV7A 5CF2A 1DMNA 1RRHA 1W4NA 4N6V0 3S67A 1O7NB 3A76A 1QAKA 1YI23 3TDGA 3WDGB 3LTAA 2CG1A 4HM8B 3WOEB 1M9GA 3MHEA 3Q90A 4J8TA 3FGYA 5D83A 3H51A 2BMOB 2CFLA 3BB9A 2CFDA 3CME3 1MOLA 5CLKA 4MMZB 1ROVA 4RNYA 2F98A 4MEIA 1GS3A 4KFEA 3CPW2 1R4CA 1ASKA 3DGMA 2P0MA 1W6GA 1QMAA 1TFOA 4HM0B 1T5YA 4EV2A 4O3VA 3SEDA 3CCM3 1VQL3 5IF6A 3OWSA 5BXQA 1VQ53 2CFKA 4R9LA 2K0MA 5IW9A 4O2HA 2W56B 1OGZA 1GY7A 2F99A 3CCJ3 4OVMA 5EQLA 3BNDA 1NB5I 4AKZA 3IPTA 3EHCA 2INXA 1OGXA 3K0ZA 1QALA 3FG3A 3N9HA 3GWRA 1OF5A 4OK0A 3UB1A 1EKMA 5CK6A 1M904 1LNHA 5AI1A 5I97A 2FXTA 2W9PA 4XBTA 2CK3H 3B4OA 3FZWA 1HU9A 3G6E3 2CFWA 1US1A 2O9UX 1KQS2 3SLUA 3AMOB 3SOAA 4O02B 1WNHA 1JNQA 2PNCA 2STDA 3D9RA 3NXJA 3KE7A 4N6OB 4WP5A 3FKAA 3DGLA 5KP4A 3L0RA 2B1XB 3FSDA 3JUQA 3NUVA 3CCU3 1PFPA 4NREA 3CD63 1OACA 2CH9A 2WOFA 5FGOA 4CCVA 1FGOA 4EC6A 4HBRA 1LVNA 1VQ73 3CCQ3 1Q42A 1ZO2A 1STFI 2D1WA 2HMOB 3EQQB 1IDPA 3K5TA 2B24B 2OWPA 4HM1B 1K734 1W01A 5IG5A 1K8A4 4PEJA 4H3UA 2HMKB 2XFSA 3MYTA 1K41A 3PGBA 1AVLA 1SIHA 2I9WA 2XRXB 1D6UA 2K54A 3N8BA 4XB5A 1OH0A 2IUKA 1M1K4 3G16A 1W6CA 3JUNA 4FCJA 2YFLB 1Q814 2OOVA 1ULJB 1FUWA 3Q2PA 4GL6A 2WGOA 1C7HA 3V99A 3NM2A 3GZBA 4U13A 5AEWB 1PU4A 2Z77A 1AR0A 3V92A 1QVG2 3EF8A 3HZPA 3JVCA 4G1MB 1RJOA 1E97A 4LZIA 3STDA 1IK3A 3PYJA 1ZX2A 1CYUA 5LC7A 3UL5A 1IV9A 3T8NA 1GD4A 3K9MC 3S5CA 3CCV3 1RN7A 5AIGA 3X3ZA 1IQ8A 2O3OA 4Q53A 4HZ9B 1IQXA 2XF3A 4HM2B 4HYZA 2L4VA 1W5ZA 1E3RA 2W56A 5TGNA 1D6YA 1QAFA 1VQ93 5AIIA 3S28A 3HIGA 3OW22 3LH4A 3NBJA 2OQEA 5JBSA 2Z7AA 3FF2A 4LSOA 3M8CA 3MPHA 3UNLA 2RCDA 1CQSA 2XR8B 3CCR3 2XGNA 5A0OB 1IVVA 1NDOB 2IMJA 2PZVA 3H3HA 4N3VA 4BTWA 4N6TA 4IPBA 4KFDA 4XBYA 3LOYA 3GRDA 4H61A 1DVDA 1MNLA 3MG1A 3MG3A 3X42A 3NQYA 5ELUA 3N54B 3AMOA 4O8SA 1RKYA 5HGRA 5KP1A 1ISKA 3CC23 2P0XA 4ORLA 3MWZA 4LGQA 2RSXA 2IA7A 2Y74A 4N6NB 7STDA 3DM8A 3LTBA 2W9QA 2ZL8A 2HMMB 2WGQA 1IT8A 3CCE3 3RGAA 4HM5B 5KP3A 2P09A 1O7PB 2XGLA 4STDA 4BTYA 3HK4A 2XFTA 2Q07A 4HM7B 1WTHA 1W6YA 2GBXB 4FCMA 5IG4A 4K90B 3CC43 1S723 3IJEB 5AEUB 4WFOA 1DYUA 1A67A 1NWWA 3D3LA 1YJ93 4R4KA 2BHMA 3V98A 3MSOA 2OCTA 2OTJ3 1FA3A 3MKIA 2CG0A 1N8R4 1E3VA 4FR9A 4OUQA 3FF0A 3G713 2XSHB 1VQ83 3PXMA 1VQ63 3B7CA 1LOXA 3S29A 3WMDA 3F14A 1IT7A 4JF8A 1KC84 3F8XA 2KXGA 2P38A 4I4KA 3JUPA 3EN8A 3EJVA 3T0UA 2GBWB 5JPPA 3EBYA 5DRVA 3J7Yd 3BLZA 4LEHA 4QWTA 1YHQ3 5JPUA 3LXUX 3WA2X 4EBGA 3ROBA 3KZTA 1JB4A 3HX8A 4TX4A 3FH1A 1FGMA 4RNZA 3CXC2 2XEPA 2OOVC 2YX9A 3GZYB 1WQLB 4CDLA 1A2KA 3PZWA 3GZXB 2BO9B 4XDVA 2QA43 3EN1B 1KD14 3LMLA 4K1UA 3MG2A 2Y73A 1YVBI 2WO0A 4HZBB 1LXEA 1JB5A 2BT3A 2E2UA 1N8QA 2WOHA 2QIYA 2R4IA 3DGOA 5IEOA 1FGRA 3OX9A 1JN5B 2E2VA 4FMBA 1Q40B 2RGQA 3PCRA 2KCDA 2ML6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC 2;  1QVG 2;  3OW2 2;  1VQ7 3;  3CCQ 3;  3CMA 3;  1VQP 3;  1YJW 3;  3CC7 3;  1N8R 4;  3G6E 3;  3CCM 3;  1YI2 3;  1VQL 3;  2OTL 3;  1KQS 2;  1VQ5 3;  3G71 3;  2QA4 3;  1W2B 2;  3CCE 3;  1Q86 4;  1K73 4;  3CCR 3;  3I55 3;  1NJI 4;  1K8A 4;  1KD1 4;  3G4S 3;  1VQ8 3;  1VQ6 3;  3CCL 3;  1Q7Y 4;  1KC8 4;  3CCV 3;  1Q82 4;  1VQN 3;  1VQK 3;  1VQM 3;  3CCJ 3;  1K9M 4;  1M1K 4;  1YIT 3;  1JJ2 2;  1VQO 3;  3CME 3;  3CC4 3;  1S72 3;  1Q81 4;  1YHQ 3;  3CCS 3;  1YJN 3;  1YJ9 3;  1YIJ 3;  1VQ4 3;  3CCU 3;  2QEX 3;  1M90 4;  3CD6 3;  2OTJ 3;  3CPW 2;  1VQ9 3;  3CC2 3;  1QVF 2;  3I56 3; 
#chains in the Genus database with same CATH topology
 1SJW A;  1G02 A;  1TUH A;  2W03 A;  3T8U A;  1W00 A;  2ZDJ A;  2BNG A;  1X1W A;  1Q86 4;  4HM6 B;  1MWU A;  2C10 A;  1MGR A;  1BAO A;  2CC3 A;  2ZHX B;  3S27 A;  1JBT A;  2OTL 3;  3EC9 A;  3EX9 A;  1RDS A;  3BNB A;  3LYG A;  1JKG B;  1OHP A;  2A15 A;  2OQE C;  1JB2 A;  2RFR A;  1KWI A;  3CCL 3;  4MJD A;  3KSE D;  4EYC A;  4RBN A;  1IVU A;  3FG4 A;  3NX0 A;  3RDE A;  1SPU A;  2GEY A;  1UGH I;  2FGT A;  1WMN A;  1IVX A;  1DMM A;  1GY6 A;  1S5A A;  1W7C A;  1YJN 3;  3D5G A;  1BUQ A;  1YIJ 3;  3OWY A;  3LTD A;  2GXF A;  2Z76 A;  1MGW A;  4HVN A;  4FCZ A;  4FMA A;  5D82 A;  1OUN A;  2C11 A;  1EEJ A;  3CNX A;  3CMA 3;  1VQP 3;  2MF7 A;  3DZL A;  5CXO A;  3WOF B;  2YFI B;  1BRH A;  1EA2 A;  1C54 A;  3D5I A;  5IEP A;  3OXA A;  1O7W B;  3FG1 A;  3AGN A;  1RGE A;  2SBL A;  3ALA A;  3DUK A;  2D42 A;  3K63 A;  3KKG A;  2KF6 A;  4WYK B;  5DRE A;  1STD A;  4HM3 B;  5BU4 A;  3KSP A;  3G4S 3;  4GB5 A;  1NNV A;  4KFF A;  2JQ5 A;  3URP A;  4EW5 A;  1D6Z A;  2CHC A;  1DMQ A;  3K7C A;  2KF5 A;  1RGH A;  1SQW A;  2F86 B;  1DE3 A;  2L1S A;  3VF1 A;  1I0X A;  1V74 A;  1UCI A;  3DGN A;  3CCS 3;  3F8H A;  1TIJ A;  1OPY A;  3KII A;  3BNE A;  3HI7 A;  4BTX A;  2CWU A;  3I56 3;  3SXX A;  3HII A;  1W02 A;  1TP6 A;  1A90 A;  2HMN B;  4FMD A;  3B4P A;  3ECF A;  1B2Z A;  3HOH A;  4FMC A;  4J5K A;  4L8O A;  3QRD A;  5AIF A;  2UUG C;  1TRP A;  1BRK A;  1RNB A;  4XM4 A;  3GSP A;  5CF1 A;  1IU7 A;  2MC8 A;  3F7S A;  1WMP A;  1GYB A;  3CPO A;  3LT9 A;  4ZM8 A;  1YIT 3;  4BIR A;  1GMR A;  5IER A;  1UW1 A;  1EG9 B;  3AHW A;  1N9E A;  2M7O A;  2Z6B A;  3OV4 A;  3B8L A;  3NV0 B;  3UJM A;  5G2G A;  5IG3 A;  3O8Y A;  1BSB A;  1BNE A;  2CFG A;  2CWT A;  1BRI A;  4MMX B;  5EEO A;  1F8N A;  2W0Q A;  3DGY A;  3VGN A;  3X3Y A;  1KSI A;  2BMR B;  7GSP A;  2CIU A;  1NB3 I;  3NBB A;  3CC7 3;  1TFK A;  3IMA B;  4N6U A;  5AYS C;  1VZZ A;  2H0G A;  3LTC A;  1JN5 A;  4L7K A;  3PS8 A;  1DVC A;  1RGC A;  3U97 A;  1IYY A;  1SII A;  1Q40 A;  2KRT A;  1OHS A;  3DXO A;  3EE1 A;  1JRQ A;  1YVS A;  2W2C A;  3E99 A;  3FLJ A;  1G96 A;  1YNV X;  5GSP A;  6RNT A;  1VQM 3;  1N5P A;  2ML5 A;  4X2O A;  1JJ2 2;  2JDI H;  5ELJ A;  1QJG A;  1YGE A;  3SVA A;  1HKX A;  4HOH A;  1I70 A;  1Y4K A;  1UUW B;  4EXR A;  1Z1S A;  1U5O A;  1NO3 A;  1TU5 A;  1ZS7 A;  1IVW A;  1OHO A;  1TJD A;  3LT8 A;  4KT3 B;  4EV5 A;  1CYV A;  3VSY A;  1JKG A;  3Q1C A;  3U1W A;  1OCV A;  3DY5 A;  1CEW I;  3GZR A;  3LZA A;  1QVF 2;  3EB8 A;  5AYR B;  1B27 A;  2SAR A;  2W6J H;  5BVB A;  1UCL A;  1YJW 3;  1B3S A;  1WMO A;  3KFQ C;  4LMI A;  8CHO A;  1RN4 A;  3NQZ A;  1IQY A;  1UI7 A;  2P05 A;  3G0K A;  1O7G B;  3QK9 A;  1I3I A;  1NJI 4;  1A2V A;  4HKV B;  2HMJ B;  3D4A A;  1VQN 3;  4R9K A;  1VQK 3;  1AQZ A;  1UI8 A;  3F7X A;  5AIH A;  4WWU C;  3X40 A;  2GU3 A;  1AVK A;  4AKY A;  1I2E A;  4DKI A;  4X2H A;  4WHA A;  1BNI A;  2QGU A;  3X41 A;  1RTU A;  2HML B;  5D81 A;  4K1V A;  1EQK A;  2GEX A;  4J9A A;  4R80 A;  4WYK A;  1O7M B;  3JUM A;  1RCL A;  1BNR A;  5IEN A;  5EVH A;  2BIR A;  3F9S A;  3SOY A;  4KZ1 A;  4JRF A;  2CKF B;  3CU3 A;  1I8V A;  2R41 A;  5STD A;  2F5M A;  4BL3 A;  1ROA A;  1OF5 B;  3RGR A;  2AAD A;  2BMQ B;  1T2I A;  4K61 A;  3A5E A;  3WOD G;  3I55 3;  1VQ4 3;  3OWU A;  4HJL B;  3F40 A;  1JV2 B;  4XBX A;  1B20 A;  5IG0 A;  1SAR A;  2GU1 A;  5BIR A;  1NU3 A;  1FUS A;  1BNF A;  1VQO 3;  1AY7 A;  2LYX A;  3JUO A;  3WA3 A;  1O7H B;  1W2Z A;  2W04 A;  3G8Z A;  4RZM A;  4N6M A;  3EBT A;  1FGQ A;  1L5G B;  4NHF A;  4BU4 A;  3GAX A;  1BNG A;  2QEX 3;  1LOW A;  2UX0 A;  3NHX A;  3PCS A;  4XDW A;  2IUJ A;  4N6L A;  6STD A;  4HM4 B;  4MMY B;  3BNC A;  2F5W A;  4CJN A;  4AEQ A;  3KN4 A;  2E2T A;  3SX1 A;  4IT7 A;  1T2H A;  2CWV A;  3NV0 A;  1GD3 A;  1U8C B;  4KVH A;  4R1K A;  1GMQ A;  1BIR A;  1LOY A;  4IIA A;  1Q7Y 4;  2XSO B;  1ULI B;  1R4Y A;  1AV4 A;  5FW5 A;  3SYU A;  1Q82 4;  1FGT A;  1K9M 4;  2FNQ A;  3X3X A;  2YFJ B;  5LC6 A;  1N9J A;  2XH9 A;  1GY5 A;  2V1L A;  3NBR A;  2RBI A;  4L8P A;  1K28 A;  1RRL A;  1RGA A;  1N5H A;  3NM7 A;  3FCS B;  1UUV B;  3UL6 A;  2CW9 A;  2ZA4 A;  1M1X B;  3DMC A;  3CNM A;  2LQV A;  1LQM B;  3I0Y A;  1J2B A;  1V58 A;  3ER7 A;  1IV7 A;  5CF2 A;  1DMN A;  1RRH A;  1W4N A;  4N6V 0;  3S67 A;  1O7N B;  3A76 A;  1QAK A;  1YI2 3;  3TDG A;  2K3D A;  3WDG B;  3LTA A;  2CG1 A;  5G1K A;  4HM8 B;  3WOE B;  1M9G A;  1MWS A;  1X1U A;  1TTO A;  3MHE A;  3Q90 A;  4J8T A;  3FGY A;  1LRA A;  1RLS A;  5D83 A;  3H51 A;  5G1L A;  2BMO B;  2CFL A;  3BB9 A;  2CFD A;  3CME 3;  1MOL A;  5CLK A;  4MMZ B;  1ROV A;  4RNY A;  2F98 A;  4MEI A;  1GS3 A;  4KFE A;  2AAE A;  2H0I A;  2KF4 A;  3CPW 2;  1QVG 2;  1R4C A;  1UDI I;  1ASK A;  3DGM A;  1RNT A;  7RNT A;  2P0M A;  1W6G A;  1QMA A;  1EUI C;  1TFO A;  4HM0 B;  1JZO A;  1T5Y A;  4EV2 A;  4O3V A;  1Q7H A;  3SED A;  3CCM 3;  5IF6 A;  1JBS A;  1VQL 3;  3OWS A;  5BXQ A;  1VQ5 3;  2CFK A;  4R9L A;  2K0M A;  1RCK A;  5IW9 A;  2UGI A;  4O2H A;  2W56 B;  1OGZ A;  1GY7 A;  2F99 A;  4J5G A;  4CPK A;  1X1Y A;  5RNT A;  3CCJ 3;  4OVM A;  5EQL A;  3BND A;  1NB5 I;  4AKZ A;  3IPT A;  3EHC A;  2INX A;  1OGX A;  1BNS A;  3K0Z A;  1B2S A;  1QAL A;  3FG3 A;  3N9H A;  3GWR A;  1OF5 A;  4OK0 A;  3UB1 A;  1EKM A;  5CK6 A;  4NPB A;  1M90 4;  1LNH A;  5AI1 A;  5I97 A;  2FXT A;  2GSP A;  2W9P A;  4XBT A;  1MWR A;  2CK3 H;  3B4O A;  1RGG A;  1HU9 A;  3FZW A;  1B2X A;  3G6E 3;  5M18 A;  2CFW A;  1US1 A;  2O9U X;  1KQS 2;  3SLU A;  1VQQ A;  1I2F A;  1HZ1 A;  3AMO B;  3SOA A;  4O02 B;  3RNT A;  1WNH A;  1JNQ A;  2PNC A;  2STD A;  3D9R A;  3NXJ A;  3KE7 A;  4N6O B;  4WP5 A;  1LOV A;  3FKA A;  3BIR A;  2ML6 A;  3DGL A;  1BRG A;  5KP4 A;  1BU4 A;  3L0R A;  2B1X B;  3FSD A;  3JUQ A;  3NUV A;  3CCU 3;  1PFP A;  4NRE A;  3CD6 3;  1OAC A;  2CH9 A;  2WOF A;  5FGO A;  4CCV A;  2KAA A;  1FGO A;  4EC6 A;  4HBR A;  1CH0 A;  1LVN A;  1VQ7 3;  3CCQ 3;  1Q42 A;  1ZO2 A;  1FW7 A;  1UCK A;  1STF I;  1UUG B;  1G0T A;  2C4B A;  2D1W A;  2HMO B;  3EQQ B;  1IDP A;  2J8X B;  2B24 B;  3K5T A;  5M1A A;  2OWP A;  1BSC A;  4HM1 B;  1K73 4;  1W01 A;  5IG5 A;  1K8A 4;  4PEJ A;  2H0H A;  4H3U A;  2HMK B;  2XFS A;  1BRJ A;  3MYT A;  1K41 A;  1BRS A;  1AVL A;  1SIH A;  2I9W A;  2XRX B;  3PGB A;  2IY2 A;  1D6U A;  2K54 A;  3N8B A;  4XB5 A;  1OH0 A;  2IUK A;  3AHS A;  3G16 A;  1W6C A;  1M1K 4;  1I0V A;  3JUN A;  4FCJ A;  1I3F A;  4BL2 A;  2YFL B;  1Q81 4;  2OOV A;  1ULJ B;  1FUW A;  3Q2P A;  4GL6 A;  2WGO A;  1GOV A;  1C7H A;  1GOY A;  3NM2 A;  3V99 A;  1MWT A;  3GZB A;  4U13 A;  5AEW B;  2Z77 A;  1AR0 A;  3V92 A;  9RNT A;  3EF8 A;  1PU4 A;  3HZP A;  1PYL A;  3JVC A;  1BSD A;  4G1M B;  1RJO A;  1E97 A;  4LZI A;  2BU4 A;  3STD A;  5M19 A;  1IK3 A;  1V57 A;  3PYJ A;  1ZX2 A;  1CYU A;  5LC7 A;  3UL5 A;  1IV9 A;  4RNT A;  3T8N A;  3ZFZ A;  1GD4 A;  3K9M C;  3WHO A;  1PY3 A;  3S5C A;  3CCV 3;  1UCJ A;  4GSP A;  3BU4 A;  1RN7 A;  1BGS A;  5AIG A;  1RHL A;  1BSE A;  3X3Z A;  1JZD A;  1IQ8 A;  1GOU A;  2O3O A;  1B2U A;  1FYS A;  1RN1 A;  4HZ9 B;  4Q53 A;  1IQX A;  2XF3 A;  4HM2 B;  4HYZ A;  5HOH A;  2L4V A;  1BRN L;  1W5Z A;  1BOX A;  1E3R A;  2W56 A;  5TGN A;  1D6Y A;  1QAF A;  1VQ9 3;  5AII A;  3S28 A;  2RNT A;  3HIG A;  3OW2 2;  3LH4 A;  1Q9E A;  3NBJ A;  2OQE A;  6GSP A;  2Z7A A;  3FF2 A;  4LSO A;  3M8C A;  5JBS A;  3MPH A;  3UNL A;  2RCD A;  1YGW A;  1CQS A;  3Q3F A;  2XR8 B;  3CCR 3;  1RGK A;  2XGN A;  5A0O B;  1IVV A;  1NDO B;  2IMJ A;  2PZV A;  3H3H A;  4N3V A;  4BTW A;  4N6T A;  4IPB A;  1B2M A;  4KFD A;  4XBY A;  1W2B 2;  3LOY A;  3GRD A;  4H61 A;  1DVD A;  1MNL A;  3DH2 A;  2CX1 A;  3MG1 A;  3MG3 A;  1T3B A;  3X42 A;  8RNT A;  3NQY A;  5ELU A;  3N54 B;  1HYF A;  3AMO A;  4O8S A;  5HGR A;  5KP1 A;  1RKY A;  1ISK A;  3CC2 3;  1B21 A;  3ZG0 A;  2P0X A;  2CX0 A;  3MWZ A;  4ORL A;  4LGQ A;  3D79 A;  2RSX A;  2IA7 A;  2Y74 A;  4N6N B;  7STD A;  3DM8 A;  3LTB A;  2W9Q A;  2ZL8 A;  2HMM B;  1BAN A;  1ZGX A;  3KCH A;  2WGQ A;  1IT8 A;  3CCE 3;  3RGA A;  4HM5 B;  5KP3 A;  3AGO A;  4ILF A;  1A2P A;  1O7P B;  2P09 A;  2XGL A;  4STD A;  4BTY A;  3HK4 A;  1BUJ A;  2XFT A;  2Q07 A;  4HM7 B;  1WTH A;  1X1X A;  1TRQ A;  1W6Y A;  2GBX B;  4FCM A;  5IG4 A;  4K90 B;  2IYJ A;  3CC4 3;  1S72 3;  3IJE B;  5AEU B;  1LNI A;  1DYU A;  4WFO A;  1BSA A;  1A67 A;  1NWW A;  3D3L A;  4I5Q A;  4R4K A;  1YJ9 3;  2BHM A;  3V98 A;  1LQG C;  3MSO A;  2OCT A;  3ZG5 A;  2OTJ 3;  1FA3 A;  3MKI A;  1DET A;  2CG0 A;  1GSP A;  1N8R 4;  1E3V A;  4FR9 A;  1RGF A;  1GMP A;  1RSN A;  4OUQ A;  3FF0 A;  3WR2 A;  3G71 3;  2XSH B;  1VQ8 3;  3PXM A;  1VQ6 3;  2HOH A;  3B7C A;  1LOX A;  3S29 A;  3WMD A;  3F14 A;  1IT7 A;  4JF8 A;  1KC8 4;  3F8X A;  2KXG A;  1RGL A;  2P38 A;  4I4K A;  3JUP A;  3EN8 A;  3EJV A;  3T0U A;  2GBW B;  5JPP A;  3EBY A;  2KF3 A;  1JBR A;  5DRV A;  3J7Y d;  3BLZ A;  4LEH A;  4QWT A;  1YHQ 3;  5JPU A;  3LXU X;  3WA2 X;  4EBG A;  3ROB A;  3KZT A;  1JB4 A;  2F56 A;  3HX8 A;  4TX4 A;  1BNJ A;  3FH1 A;  1FGM A;  4RNZ A;  3CXC 2;  2XEP A;  2OOV C;  2YX9 A;  3GZY B;  1WQL B;  1I2G A;  1A2K A;  1FZU A;  4CDL A;  3PZW A;  3GZX B;  2BO9 B;  4XDV A;  2QA4 3;  3EN1 B;  1KD1 4;  3LML A;  4HAA A;  3MG2 A;  2Y73 A;  4K1U A;  4LYL B;  1YVB I;  2WO0 A;  4HZB B;  1RMS A;  2F4Y A;  1LXE A;  1JB5 A;  2BT3 A;  2E2U A;  1BVI A;  1N8Q A;  2WOH A;  2QIY A;  2R4I A;  3DGO A;  5IEO A;  1FGR A;  3OX9 A;  1UGI A;  1JN5 B;  4GHO A;  2E2V A;  4FMB A;  1Q40 B;  2RGQ A;  3PCR A;  2KCD A;  1FUT A; 
#chains in the Genus database with same CATH homology
 1SJW A;  1TUH A;  2W03 A;  3T8U A;  1W00 A;  2ZDJ A;  2BNG A;  4HM6 B;  2C10 A;  2CC3 A;  3S27 A;  2OTL 3;  3EC9 A;  3EX9 A;  3BNB A;  3LYG A;  1JKG B;  1OHP A;  2A15 A;  2OQE C;  1JB2 A;  2RFR A;  1KWI A;  3CCL 3;  4MJD A;  3KSE D;  4EYC A;  4RBN A;  1IVU A;  3FG4 A;  3NX0 A;  3RDE A;  1SPU A;  2GEY A;  2FGT A;  1WMN A;  1IVX A;  1DMM A;  1GY6 A;  1S5A A;  1W7C A;  1YJN 3;  1BUQ A;  1YIJ 3;  3OWY A;  3LTD A;  2GXF A;  2Z76 A;  4HVN A;  4FCZ A;  4FMA A;  5D82 A;  1OUN A;  2C11 A;  3CNX A;  3CMA 3;  1VQP 3;  2MF7 A;  3DZL A;  5CXO A;  3WOF B;  2YFI B;  1EA2 A;  5IEP A;  3OXA A;  1O7W B;  3FG1 A;  3ALA A;  1W2B 2;  2SBL A;  3DUK A;  5DRE A;  2D42 A;  3K63 A;  3KKG A;  4WYK B;  1Q86 4;  1STD A;  4HM3 B;  3G4S 3;  3KSP A;  4GB5 A;  4KFF A;  2JQ5 A;  1D6Z A;  2CHC A;  1DMQ A;  3K7C A;  1SQW A;  2F86 B;  3VF1 A;  3DGN A;  1V74 A;  3CCS 3;  3F8H A;  1TIJ A;  1OPY A;  3KII A;  3BNE A;  3HI7 A;  4BTX A;  2CWU A;  3I56 3;  3SXX A;  3HII A;  1W02 A;  1TP6 A;  1A90 A;  2HMN B;  4FMD A;  3B4P A;  3ECF A;  4FMC A;  4L8O A;  3QRD A;  5AIF A;  4XM4 A;  5CF1 A;  1IU7 A;  2MC8 A;  3F7S A;  1WMP A;  1GYB A;  3CPO A;  3LT9 A;  4ZM8 A;  1YIT 3;  5IER A;  1UW1 A;  1EG9 B;  1N9E A;  2M7O A;  2Z6B A;  3OV4 A;  3B8L A;  3NV0 B;  3UJM A;  5G2G A;  5IG3 A;  3O8Y A;  2CFG A;  2CWT A;  4MMX B;  5EEO A;  1F8N A;  2W0Q A;  3VGN A;  3X3Y A;  1KSI A;  2BMR B;  2CIU A;  1NB3 I;  3NBB A;  3CC7 3;  1TFK A;  3IMA B;  4N6U A;  5AYS C;  1VZZ A;  3LTC A;  1JN5 A;  4L7K A;  3PS8 A;  1DVC A;  3U97 A;  1SII A;  1Q40 A;  2KRT A;  1OHS A;  3DXO A;  3EE1 A;  1JRQ A;  2W2C A;  3E99 A;  3FLJ A;  1G96 A;  1VQM 3;  1N5P A;  2ML5 A;  4X2O A;  1JJ2 2;  2JDI H;  5ELJ A;  1QJG A;  1YGE A;  3SVA A;  1HKX A;  1UUW B;  1Y4K A;  4EXR A;  1Z1S A;  1U5O A;  1NO3 A;  1TU5 A;  1IVW A;  1OHO A;  3LT8 A;  4EV5 A;  1CYV A;  3VSY A;  1JKG A;  3Q1C A;  3U1W A;  1OCV A;  3DY5 A;  1CEW I;  3GZR A;  3LZA A;  1QVF 2;  3EB8 A;  5AYR B;  2W6J H;  5BVB A;  1YJW 3;  1WMO A;  3KFQ C;  4LMI A;  8CHO A;  3NQZ A;  1IQY A;  1UI7 A;  2P05 A;  3G0K A;  1O7G B;  3QK9 A;  1NJI 4;  1A2V A;  4HKV B;  2HMJ B;  1VQN 3;  4R9K A;  1VQK 3;  1UI8 A;  3F7X A;  5AIH A;  4WWU C;  3X40 A;  2GU3 A;  1AVK A;  4AKY A;  4X2H A;  4WHA A;  2QGU A;  3X41 A;  5D81 A;  2HML B;  4K1V A;  1EQK A;  2GEX A;  4J9A A;  4R80 A;  4WYK A;  1O7M B;  3JUM A;  5IEN A;  5EVH A;  3F9S A;  3SOY A;  4KZ1 A;  4JRF A;  2CKF B;  3CU3 A;  5STD A;  1ROA A;  1OF5 B;  3RGR A;  2BMQ B;  4K61 A;  1VQ4 3;  3WOD G;  3I55 3;  3OWU A;  4HJL B;  3F40 A;  1JV2 B;  4XBX A;  5IG0 A;  2GU1 A;  1NU3 A;  1VQO 3;  2LYX A;  3WA3 A;  3JUO A;  1O7H B;  1W2Z A;  2W04 A;  3G8Z A;  4RZM A;  4N6M A;  3EBT A;  1FGQ A;  1L5G B;  4NHF A;  3GAX A;  2QEX 3;  2UX0 A;  3NHX A;  3PCS A;  4XDW A;  2IUJ A;  4N6L A;  6STD A;  4HM4 B;  4MMY B;  3BNC A;  4AEQ A;  3KN4 A;  2E2T A;  3SX1 A;  4IT7 A;  2CWV A;  3NV0 A;  1GD3 A;  1U8C B;  4KVH A;  4R1K A;  4IIA A;  1Q7Y 4;  2XSO B;  1ULI B;  5FW5 A;  1AV4 A;  1Q82 4;  1FGT A;  1K9M 4;  2FNQ A;  3X3X A;  2YFJ B;  5LC6 A;  1N9J A;  2XH9 A;  1GY5 A;  2V1L A;  3NBR A;  4L8P A;  1K28 A;  1RRL A;  1N5H A;  3NM7 A;  3FCS B;  1UUV B;  3UL6 A;  2CW9 A;  1M1X B;  3DMC A;  3CNM A;  2LQV A;  3I0Y A;  1J2B A;  3ER7 A;  1IV7 A;  5CF2 A;  1DMN A;  1RRH A;  1W4N A;  4N6V 0;  3S67 A;  1O7N B;  3A76 A;  1QAK A;  1YI2 3;  3TDG A;  3WDG B;  3LTA A;  2CG1 A;  4HM8 B;  3WOE B;  1M9G A;  3MHE A;  3Q90 A;  4J8T A;  3FGY A;  5D83 A;  3H51 A;  2BMO B;  2CFL A;  3BB9 A;  2CFD A;  3CME 3;  1MOL A;  5CLK A;  4MMZ B;  1ROV A;  4RNY A;  2F98 A;  4MEI A;  1GS3 A;  4KFE A;  3CPW 2;  1R4C A;  1ASK A;  3DGM A;  2P0M A;  1W6G A;  1QMA A;  1TFO A;  4HM0 B;  1T5Y A;  4EV2 A;  4O3V A;  3SED A;  3CCM 3;  1VQL 3;  5IF6 A;  3OWS A;  5BXQ A;  1VQ5 3;  2CFK A;  4R9L A;  2K0M A;  5IW9 A;  4O2H A;  2W56 B;  1OGZ A;  1GY7 A;  2F99 A;  3CCJ 3;  4OVM A;  5EQL A;  3BND A;  1NB5 I;  4AKZ A;  3IPT A;  3EHC A;  2INX A;  1OGX A;  3K0Z A;  1QAL A;  3FG3 A;  3N9H A;  3GWR A;  1OF5 A;  4OK0 A;  3UB1 A;  1EKM A;  5CK6 A;  1M90 4;  1LNH A;  5AI1 A;  5I97 A;  2FXT A;  2W9P A;  4XBT A;  2CK3 H;  3B4O A;  3FZW A;  1HU9 A;  3G6E 3;  2CFW A;  1US1 A;  2O9U X;  1KQS 2;  3SLU A;  3AMO B;  3SOA A;  4O02 B;  1WNH A;  1JNQ A;  2PNC A;  2STD A;  3D9R A;  3NXJ A;  3KE7 A;  4N6O B;  4WP5 A;  3FKA A;  3DGL A;  5KP4 A;  3L0R A;  2B1X B;  3FSD A;  3JUQ A;  3NUV A;  3CCU 3;  1PFP A;  4NRE A;  3CD6 3;  1OAC A;  2CH9 A;  2WOF A;  5FGO A;  4CCV A;  1FGO A;  4EC6 A;  4HBR A;  1LVN A;  1VQ7 3;  3CCQ 3;  1Q42 A;  1ZO2 A;  1STF I;  2D1W A;  2HMO B;  3EQQ B;  1IDP A;  3K5T A;  2B24 B;  2OWP A;  4HM1 B;  1K73 4;  1W01 A;  5IG5 A;  1K8A 4;  4PEJ A;  4H3U A;  2HMK B;  2XFS A;  3MYT A;  1K41 A;  3PGB A;  1AVL A;  1SIH A;  2I9W A;  2XRX B;  1D6U A;  2K54 A;  3N8B A;  4XB5 A;  1OH0 A;  2IUK A;  1M1K 4;  3G16 A;  1W6C A;  3JUN A;  4FCJ A;  2YFL B;  1Q81 4;  2OOV A;  1ULJ B;  1FUW A;  3Q2P A;  4GL6 A;  2WGO A;  1C7H A;  3V99 A;  3NM2 A;  3GZB A;  4U13 A;  5AEW B;  1PU4 A;  2Z77 A;  1AR0 A;  3V92 A;  1QVG 2;  3EF8 A;  3HZP A;  3JVC A;  4G1M B;  1RJO A;  1E97 A;  4LZI A;  3STD A;  1IK3 A;  3PYJ A;  1ZX2 A;  1CYU A;  5LC7 A;  3UL5 A;  1IV9 A;  3T8N A;  1GD4 A;  3K9M C;  3S5C A;  3CCV 3;  1RN7 A;  5AIG A;  3X3Z A;  1IQ8 A;  2O3O A;  4Q53 A;  4HZ9 B;  1IQX A;  2XF3 A;  4HM2 B;  4HYZ A;  2L4V A;  1W5Z A;  1E3R A;  2W56 A;  5TGN A;  1D6Y A;  1QAF A;  1VQ9 3;  5AII A;  3S28 A;  3HIG A;  3OW2 2;  3LH4 A;  3NBJ A;  2OQE A;  5JBS A;  2Z7A A;  3FF2 A;  4LSO A;  3M8C A;  3MPH A;  3UNL A;  2RCD A;  1CQS A;  2XR8 B;  3CCR 3;  2XGN A;  5A0O B;  1IVV A;  1NDO B;  2IMJ A;  2PZV A;  3H3H A;  4N3V A;  4BTW A;  4N6T A;  4IPB A;  4KFD A;  4XBY A;  3LOY A;  3GRD A;  4H61 A;  1DVD A;  1MNL A;  3MG1 A;  3MG3 A;  3X42 A;  3NQY A;  5ELU A;  3N54 B;  3AMO A;  4O8S A;  1RKY A;  5HGR A;  5KP1 A;  1ISK A;  3CC2 3;  2P0X A;  4ORL A;  3MWZ A;  4LGQ A;  2RSX A;  2IA7 A;  2Y74 A;  4N6N B;  7STD A;  3DM8 A;  3LTB A;  2W9Q A;  2ZL8 A;  2HMM B;  2WGQ A;  1IT8 A;  3CCE 3;  3RGA A;  4HM5 B;  5KP3 A;  2P09 A;  1O7P B;  2XGL A;  4STD A;  4BTY A;  3HK4 A;  2XFT A;  2Q07 A;  4HM7 B;  1WTH A;  1W6Y A;  2GBX B;  4FCM A;  5IG4 A;  4K90 B;  3CC4 3;  1S72 3;  3IJE B;  5AEU B;  4WFO A;  1DYU A;  1A67 A;  1NWW A;  3D3L A;  1YJ9 3;  4R4K A;  2BHM A;  3V98 A;  3MSO A;  2OCT A;  2OTJ 3;  1FA3 A;  3MKI A;  2CG0 A;  1N8R 4;  1E3V A;  4FR9 A;  4OUQ A;  3FF0 A;  3G71 3;  2XSH B;  1VQ8 3;  3PXM A;  1VQ6 3;  3B7C A;  1LOX A;  3S29 A;  3WMD A;  3F14 A;  1IT7 A;  4JF8 A;  1KC8 4;  3F8X A;  2KXG A;  2P38 A;  4I4K A;  3JUP A;  3EN8 A;  3EJV A;  3T0U A;  2GBW B;  5JPP A;  3EBY A;  5DRV A;  3J7Y d;  3BLZ A;  4LEH A;  4QWT A;  1YHQ 3;  5JPU A;  3LXU X;  3WA2 X;  4EBG A;  3ROB A;  3KZT A;  1JB4 A;  3HX8 A;  4TX4 A;  3FH1 A;  1FGM A;  4RNZ A;  3CXC 2;  2XEP A;  2OOV C;  2YX9 A;  3GZY B;  1WQL B;  4CDL A;  1A2K A;  3PZW A;  3GZX B;  2BO9 B;  4XDV A;  2QA4 3;  3EN1 B;  1KD1 4;  3LML A;  4K1U A;  3MG2 A;  2Y73 A;  1YVB I;  2WO0 A;  4HZB B;  1LXE A;  1JB5 A;  2BT3 A;  2E2U A;  1N8Q A;  2WOH A;  2QIY A;  2R4I A;  3DGO A;  5IEO A;  1FGR A;  3OX9 A;  1JN5 B;  2E2V A;  4FMB A;  1Q40 B;  2RGQ A;  3PCR A;  2KCD A;  2ML6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...