1Q7Y4

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q7y400
1NJI4 3CMA3 3CCL3 1VQO3 1YI23 3CC73 3I553 3G4S3 3CCM3 2OTL3 3CME3 1VQN3 1VQ83 2OTJ3 1KQS2 1Q824 1VQ93 1VQL3 3CPW2 1Q814 1K9M4 1JJ22 3CCJ3 1VQ43 1YJ93 3CCR3 2QA43 3CCV3 1VQM3 1VQ63 3CCE3 1YIJ3 1M904 1KC84 1M1K4 1QVG2 1VQ73 3G6E3 3OW22 1VQK3 1YJW3 1QVF2 1YIT3 1S723 1W2B2 1YHQ3 3CXC2 1N8R4 1YJN3 1Q864 3CCQ3 2QEX3 1K8A4 1VQP3 3I563 3G713 3CC43 3CD63 1VQ53 3CCU3 3CC23 1Q7Y4 1K734 1KD14 3CCS3
chains in the Genus database with same CATH superfamily
3LXUX 4WP5A 1MWRA 3ER7A 3BLZA 3FG1A 3ZFZA 2XR8B 5IW9A 1VQ93 3CPW2 3NV0A 1I2FA 2XH9A 5IG5A 1RTUA 3D3LA 4FMBA 1Q40B 1RLSA 2P38A 3Q90A 4HM4B 3CCV3 1BVIA 3G0KA 3U97A 1DETA 1OF5A 2A15A 3CNXA 2XGLA 3F8XA 5JPUA 1LRAA 1UCJA 1UI7A 2ML5A 1V74A 4FCJA 1RRLA 5IENA 1QAKA 3OXAA 5HOHA 3KSPA 2IUJA 3DXOA 5M1AA 1MWSA 3X41A 3UL5A 1A2PA 3FH1A 3LMLA 3KIIA 2HMOB 3KZTA 4LYLB 1RGLA 2FGTA 1GOYA 1YI23 4EW5A 2XRXB 3CC73 1BSEA 1VQN3 3BNBA 5AYRB 1K9M4 1UCLA 2P09A 1JBTA 3SOAA 4BTWA 3H3HA 2F4YA 3G16A 1VZZA 1RCLA 4LGQA 1BANA 3OWSA 4H61A 2P0MA 1JZOA 2RNTA 7GSPA 2YFJB 1SJWA 2OQEA 1RHLA 1BSAA 4K1UA 1IVXA 3HK4A 3IPTA 3EQQB 4CPKA 1TFOA 1AVLA 1UDII 4I5QA 1GD4A 1BNRA 1BOXA 3SVAA 1OGZA 1ASKA 3CPOA 3NBBA 1B20A 2CW9A 1R4YA 3V99A 1RDSA 1WMPA 1UUVB 3LTDA 1RN1A 2ZA4A 5CXOA 5BXQA 2HMMB 3G4S3 1GY7A 3B8LA 4X2HA 2C4BA 1Q42A 5TGNA 3EN8A 3D5GA 1BRSA 1SIIA 2FNQA 5EQLA 1RRHA 2QA43 1T3BA 5GSPA 3JUNA 1IDPA 1AQZA 1Z1SA 2E2TA 1BAOA 1J2BA 3QK9A 1G96A 4MMZB 3X42A 4HYZA 3SOYA 4NREA 2BO9B 1UUGB 3AHSA 4QWTA 5IG3A 3MHEA 2P0XA 3GWRA 5EEOA 1YVSA 1F8NA 1YNVX 1RN7A 2D1WA 1UCIA 1N8QA 4FMAA 1K8A4 3CC23 4R1KA 2B1XB 1DMQA 1CQSA 3V98A 1IQYA 3CMA3 4WYKB 3PZWA 3NM7A 4TX4A 1TFKA 1VQ83 3MG2A 1B27A 1O7MB 4L8OA 1B2XA 2XSHB 1Q814 3CCJ3 1RGKA 3LT8A 1BRJA 2W03A 2LQVA 2QIYA 2MF7A 1KC84 1FW7A 3KN4A 1YJW3 1MOLA 2IUKA 2O9UX 2OQEC 2D42A 1NB3I 4H3UA 4MJDA 1X1UA 1DYUA 1YJN3 2GBWB 2CG0A 1O7GB 1BU4A 1X1YA 1YGEA 1I2GA 2J8XB 1OF5B 3F8HA 4XDVA 1D6YA 1ISKA 1V58A 4HM1B 1TUHA 4PEJA 2H0GA 2AADA 3GZRA 8CHOA 1IK3A 4O2HA 5AIIA 1CH0A 4HOHA 3RGRA 3VGNA 3PS8A 3I553 3URPA 4KZ1A 1VQL3 1BNIA 1Q7HA 1STDA 3DGYA 3E99A 3OWYA 1T2IA 3D5IA 4KFFA 2H0HA 3WDGB 5M18A 1LOWA 1YJ93 1HZ1A 2W9PA 3B4OA 1RKYA 2E2VA 1GSPA 3NM2A 3WMDA 5BVBA 1X1WA 1MNLA 4RNYA 3WR2A 3K63A 3NQZA 1YHQ3 3EBYA 3AMOB 6STDA 5DREA 2C10A 1MWUA 4N6UA 3N9HA 4N6NB 3DM8A 4L7KA 3FZWA 4GL6A 3G713 3JUPA 5JBSA 1W5ZA 1A90A 1JV2B 2YX9A 3I0YA 4RNTA 4XBXA 1LQGC 1OUNA 4BL2A 1FGRA 3UB1A 4OK0A 5KP1A 1I3FA 3B4PA 3DZLA 3MKIA 1RNTA 1ZO2A 2UX0A 1SARA 3K5TA 1D6UA 4CDLA 3RDEA 1JRQA 3CCE3 3ALAA 6RNTA 5KP3A 1W7CA 2Q07A 1ZS7A 2HMLB 2SARA 5CLKA 1VQK3 4HM6B 1US1A 1OHOA 2CWUA 3LTBA 3CXC2 3FF0A 3RNTA 1SQWA 1IU7A 2W56A 1BNJA 1WTHA 4EV2A 4HM3B 1B3SA 2XGNA 4Q53A 1OCVA 1BIRA 4RNZA 1VQP3 4K61A 3OWUA 1PY3A 3A76A 3ZG0A 4BTYA 5RNTA 2RBIA 3V92A 8RNTA 1NJI4 1CYVA 1QALA 1A2KA 3HI7A 3JVCA 4HZBB 5AEWB 1BNSA 1KWIA 1C7HA 3PYJA 4K1VA 1IV7A 4R9KA 1KQS2 2E2UA 2L4VA 4ZM8A 1VQ43 3NUVA 2OOVC 1BRHA 3NXJA 3ROBA 1N9JA 1S5AA 4JRFA 3WOEB 4HBRA 1B21A 1M1XB 4BL3A 4KT3B 5AIHA 1UCKA 3M8CA 4EC6A 4KFDA 3EB8A 5ELJA 3D9RA 1GYBA 3DGLA 3CC43 3CD63 3FG4A 1Q7Y4 3CNMA 2RCDA 2WGOA 2F86B 2GEYA 2JDIH 1I0VA 1UUWB 2KAAA 2KF3A 3EF8A 3NBJA 3Q3FA 5STDA 3GSPA 4BU4A 2CWVA 2W9QA 1PYLA 2OCTA 3Q2PA 2RGQA 1GMPA 2I9WA 1JN5A 4N6MA 2C11A 2MC8A 4X2OA 1BUJA 3LTAA 1B2SA 3DUKA 1NWWA 3S27A 1VQ63 5AIFA 4N3VA 1ROAA 2BU4A 4XB5A 1E97A 5LC7A 1TU5A 2Z7AA 1N8R4 3STDA 1I8VA 1DVCA 3J7Yd 3FG3A 1SIHA 1BNFA 2INXA 3HZPA 4RBNA 1JBRA 3G8ZA 2ZDJA 1VQ53 1SPUA 1DMNA 2GU3A 1QAFA 3AGOA 2BT3A 4XBTA 3S28A 3DGOA 1WQLB 4HM2B 6GSPA 4GHOA 2W6JH 5D83A 1RJOA 1ULJB 1EEJA 2Z6BA 1RMSA 5M19A 3X3YA 3OV4A 2LYXA 4WFOA 2KF4A 5HGRA 2F98A 2K3DA 1Y4KA 4AKZA 4LSOA 2CFDA 3PCRA 3EHCA 4R4KA 3LT9A 3L0RA 3OX9A 1YIT3 3UL6A 1BNGA 4NHFA 2W2CA 4XDWA 1W2B2 1MGWA 4CCVA 5IEPA 2PZVA 3NV0B 1G0TA 1EUIC 1U8CB 3T0UA 4STDA 2O3OA 1RSNA 4NPBA 2JQ5A 2UGIA 1T5YA 9RNTA 3F7SA 1MGRA 4WWUC 3IJEB 3JUOA 3LZAA 2CG1A 1G02A 3SEDA 4BTXA 5CF1A 3NX0A 1Q9EA 3MPHA 1BGSA 3D4AA 2F5MA 3BNCA 1IT7A 2WO0A 1GMQA 1M9GA 1JB2A 1OGXA 1KD14 1A2VA 2XFSA 5IG4A 3WA3A 2IMJA 1BNEA 3FF2A 4FR9A 1GY5A 3RGAA 1QVG2 1B2MA 2W0QA 1JNQA 1U5OA 3VSYA 5KP4A 1GY6A 1WMOA 2CKFB 5DRVA 1NNVA 2XFTA 5FGOA 1I70A 1FUTA 1GD3A 3KFQC 3K0ZA 4G1MB 5BIRA 1GS3A 1FYSA 4HM5B 1EG9B 2H0IA 4LMIA 1W2ZA 1EQKA 1BSBA 4EV5A 5G1KA 5AIGA 4MMXB 1TP6A 2WOFA 2XF3A 1W02A 3FKAA 3DGNA 3T8UA 3S67A 4JF8A 4I4KA 1Q824 2M7OA 2Z77A 3SX1A 3DGMA 1FGOA 5IEOA 3X3ZA 4CJNA 1RGEA 1IQXA 3MG1A 2AAEA 1BUQA 3FSDA 3KE7A 2F5WA 1QVF2 2WGQA 4L8PA 1UGIA 1JN5B 3GZBA 3AHWA 3KSED 2GXFA 4LEHA 1L5GB 4WYKA 1EKMA 3GZYB 3GAXA 2ML6A 1DE3A 1LOVA 1AY7A 1BRGA 1LNIA 5D82A 2K0MA 3B7CA 2GEXA 2HMKB 3T8NA 3BIRA 3I563 1HKXA 1FUSA 2B24B 5CK6A 3TDGA 4OUQA 5EVHA 1K734 1LNHA 3PXMA 2KXGA 3Q1CA 4IIAA 2BMRB 1VQO3 3ZG5A 2OTL3 2CX0A 3CME3 2IYJA 1RNBA 2CH9A 2FXTA 1OPYA 2XEPA 1OHSA 1PFPA 1TRPA 2BMQB 4KFEA 3EE1A 1FGTA 1LQMB 3NBRA 1JKGA 4MEIA 3UNLA 1LOYA 1VQ73 1OHPA 1JBSA 1ZGXA 3WODG 4EYCA 3FGYA 4XBYA 1UGHI 2KRTA 5AI1A 2GSPA 1D6ZA 1NU3A 3CU3A 2QEX3 4HM0B 3EBTA 1OACA 2KF5A 4GB5A 1C54A 1UW1A 1CEWI 1RGGA 2RFRA 5JPPA 3CCU3 3JUQA 1X1XA 1IVWA 1GOVA 4HZ9B 3CCS3 1TJDA 2WOHA 3MWZA 1HU9A 7STDA 1RGAA 2CFLA 3LH4A 1FGMA 1O7HB 3AMOA 3KCHA 3F14A 2P05A 3EC9A 4MMYB 4ORLA 4RZMA 1IV9A 3SXXA 1VQQA 1RN4A 2CIUA 1IQ8A 5G2GA 4J5KA 5LC6A 4HVNA 3CCR3 1NB5I 1I3IA 1WNHA 1LXEA 3DH2A 1E3RA 4HM8B 2CWTA 1FUWA 3N8BA 1ULIB 3G6E3 1YGWA 1IT8A 2BIRA 3OW22 3LOYA 1RGFA 3LYGA 1O7PB 2BNGA 2CFGA 3PCSA 4EXRA 1Q864 4O3VA 3S29A 3CCQ3 2XSOB 1BRKA 3NHXA 2BMOB 2IY2A 1DVDA 2CC3A 1FGQA 3GRDA 2ZHXB 1O7WB 3MG3A 3QRDA 3SYUA 1BRIA 1TIJA 2F99A 2IA7A 2W04A 1LOXA 4GSPA 3A5EA 1Q40A 1MWTA 1W00A 3BNEA 3WHOA 4AKYA 1DMMA 2STDA 3FCSB 1BRNL 3F9SA 1K41A 4K90B 1W6CA 1AVKA 1BSDA 1IVVA 1W4NA 3U1WA 2BHMA 1RGHA 1ROVA 1E3VA 4HJLB 1ZX2A 4J5GA 4ILFA 1RGCA 5AYSC 3WOFB 4BIRA 2Y74A 1W6GA 3VF1A 1YIJ3 4N6V0 2GBXB 2ZL8A 4OVMA 1KSIA 1GMRA 4O8SA 4U13A 2CFWA 3K9MC 5FW5A 5CF2A 3F40A 4O02B 1AV4A 4FCMA 5IERA 4J9AA 4HM7B 1FA3A 2KF6A 2GU1A 2HMNB 3BB9A 1JZDA 3ECFA 5ELUA 3X3XA 5AEUB 2W56B 3H51A 3CCL3 1LVNA 1T2HA 2OWPA 3FLJA 2OTJ3 3SLUA 1EA2A 3DY5A 1R4CA 4WHAA 3MSOA 2Z76A 1QMAA 4FCZA 2CX1A 2K54A 2QGUA 1FZUA 2UUGC 1TTOA 3EN1B 2HMJB 1K28A 1PU4A 1VQM3 2CHCA 3O8YA 4DKIA 1WMNA 1M1K4 3BNDA 4AEQA 3HX8A 1NDOB 4N6LA 4R9LA 1IYYA 1BSCA 1W6YA 2Y73A 4XM4A 3S5CA 3HIGA 4FMCA 5IG0A 1A67A 1I0XA 1O7NB 2CK3H 2PNCA 2RSXA 3EJVA 1JKGB 3NQYA 1V57A 1N5HA 5IF6A 3BU4A 3F7XA 5D81A 3IMAB 1NO3A 3AGNA 2KCDA 2SBLA 3WA2X 4KVHA 1QJGA 4FMDA 2HOHA 3JUMA 3HIIA 4N6TA 3CCM3 1UI8A 2R41A 3D79A 3EX9A 2V1LA 1N5PA 2OOVA 1JJ22 1JB5A 1N9EA 3GZXB 1B2ZA 1CYUA 3X40A 4IT7A 4R80A 7RNTA 3K7CA 2YFLB 1B2UA 5BU4A 2YFIB 4EBGA 4HKVB 1I2EA 2F56A 1M904 1GOUA 3LTCA 4N6OB 2R4IA 1S723 2L1SA 5G1LA 3HOHA 5I97A 4IPBA 3MYTA 3N54B 4HAAA 1W01A 2CFKA 1OH0A 1STFI 3UJMA 1RCKA 3DMCA 1JB4A 1YVBI 1AR0A 3PGBA 1HYFA 4J8TA 1TRQA 4LZIA 5A0OB 1IVUA 3KKGA
chains in the Genus database with same CATH topology
3LXUX 4WP5A 3ER7A 3BLZA 3FG1A 5IW9A 2XR8B 1VQ93 3CPW2 3NV0A 2XH9A 5IG5A 3D3LA 4FMBA 1Q40B 2P38A 3Q90A 4HM4B 3CCV3 3G0KA 3U97A 1OF5A 2A15A 3CNXA 2XGLA 3F8XA 5JPUA 1UI7A 2ML5A 1V74A 4FCJA 1RRLA 5IENA 1QAKA 3OXAA 3KSPA 2IUJA 3DXOA 3X41A 3UL5A 3FH1A 3LMLA 3KIIA 2HMOB 3KZTA 2FGTA 1YI23 3CC73 2XRXB 1VQN3 3BNBA 5AYRB 1K9M4 2P09A 3SOAA 4BTWA 3H3HA 3G16A 1VZZA 4LGQA 3OWSA 4H61A 2P0MA 2YFJB 1SJWA 2OQEA 4K1UA 1IVXA 3HK4A 3IPTA 3EQQB 1TFOA 1AVLA 1GD4A 3SVAA 1OGZA 1ASKA 3CPOA 3NBBA 2CW9A 3V99A 1WMPA 1UUVB 3LTDA 5BXQA 5CXOA 2HMMB 3G4S3 1GY7A 3B8LA 4X2HA 5TGNA 1Q42A 3EN8A 1SIIA 2FNQA 5EQLA 1RRHA 2QA43 3JUNA 1IDPA 1Z1SA 2E2TA 1J2BA 3QK9A 1G96A 4MMZB 3X42A 4HYZA 3SOYA 4NREA 2BO9B 4QWTA 5IG3A 3MHEA 2P0XA 3GWRA 5EEOA 1F8NA 2D1WA 1RN7A 1N8QA 4FMAA 1K8A4 3CC23 4R1KA 2B1XB 1DMQA 1CQSA 3V98A 1IQYA 3CMA3 4WYKB 3PZWA 3NM7A 4TX4A 1TFKA 1VQ83 3MG2A 1O7MB 4L8OA 2XSHB 1Q814 3CCJ3 3LT8A 2W03A 2LQVA 2QIYA 2MF7A 1KC84 3KN4A 1YJW3 1MOLA 2IUKA 2O9UX 2OQEC 2D42A 1NB3I 4H3UA 4MJDA 1DYUA 1YJN3 2GBWB 2CG0A 1O7GB 1YGEA 1OF5B 3F8HA 4XDVA 1D6YA 1ISKA 4HM1B 1TUHA 4PEJA 3GZRA 8CHOA 1IK3A 4O2HA 5AIIA 3RGRA 3VGNA 3PS8A 3I553 1VQL3 4KZ1A 1STDA 3E99A 3OWYA 4KFFA 3WDGB 1YJ93 2W9PA 3B4OA 1RKYA 2E2VA 3WMDA 3NM2A 5BVBA 1MNLA 4RNYA 1YHQ3 3K63A 3NQZA 3EBYA 3AMOB 6STDA 5DREA 2C10A 4N6UA 3N9HA 4N6NB 3DM8A 4L7KA 3FZWA 4GL6A 3G713 3JUPA 5JBSA 1W5ZA 1A90A 1JV2B 2YX9A 3I0YA 4XBXA 1OUNA 1FGRA 3UB1A 4OK0A 5KP1A 3B4PA 3DZLA 3MKIA 1ZO2A 2UX0A 3K5TA 1D6UA 4CDLA 3RDEA 1JRQA 3CCE3 3ALAA 5KP3A 1W7CA 2Q07A 2HMLB 5CLKA 1VQK3 4HM6B 1US1A 1OHOA 2CWUA 3LTBA 3CXC2 3FF0A 1SQWA 1IU7A 2W56A 1WTHA 4EV2A 4HM3B 2XGNA 4Q53A 1OCVA 4RNZA 1VQP3 4K61A 3OWUA 4BTYA 3A76A 3V92A 1NJI4 1CYVA 1QALA 1A2KA 3HI7A 3JVCA 4HZBB 5AEWB 1KWIA 1C7HA 3PYJA 4K1VA 1IV7A 4R9KA 1KQS2 2E2UA 2L4VA 4ZM8A 1VQ43 3NUVA 2OOVC 3NXJA 3ROBA 1N9JA 1S5AA 4JRFA 3WOEB 4HBRA 1M1XB 5AIHA 3M8CA 4EC6A 4KFDA 3EB8A 5ELJA 3D9RA 1GYBA 3DGLA 3CC43 3CD63 3FG4A 1Q7Y4 3CNMA 2RCDA 2WGOA 2F86B 2GEYA 2JDIH 3EF8A 1UUWB 3NBJA 5STDA 2CWVA 2W9QA 3Q2PA 2OCTA 2RGQA 2I9WA 1JN5A 4N6MA 2C11A 2MC8A 4X2OA 3LTAA 3DUKA 1NWWA 3S27A 1VQ63 5AIFA 4N3VA 1ROAA 4XB5A 1E97A 5LC7A 1TU5A 2Z7AA 1N8R4 3STDA 1DVCA 3J7Yd 3FG3A 1SIHA 2INXA 3HZPA 4RBNA 3G8ZA 2ZDJA 1VQ53 1SPUA 1DMNA 2GU3A 1QAFA 2BT3A 4XBTA 3S28A 3DGOA 1WQLB 4HM2B 2W6JH 5D83A 1RJOA 1ULJB 2Z6BA 3X3YA 3OV4A 2LYXA 4WFOA 5HGRA 2F98A 1Y4KA 4AKZA 4LSOA 2CFDA 3PCRA 3EHCA 4R4KA 3LT9A 3L0RA 3OX9A 1YIT3 3UL6A 4NHFA 4XDWA 2W2CA 1W2B2 4CCVA 5IEPA 2PZVA 3NV0B 1U8CB 3T0UA 4STDA 2O3OA 2JQ5A 1T5YA 3F7SA 4WWUC 3SEDA 3IJEB 3JUOA 3LZAA 2CG1A 4BTXA 5CF1A 3NX0A 3MPHA 3BNCA 1IT7A 2WO0A 1M9GA 1OGXA 1JB2A 1KD14 1A2VA 2XFSA 5IG4A 3WA3A 2IMJA 3FF2A 4FR9A 1GY5A 3RGAA 1QVG2 2W0QA 1JNQA 1U5OA 3VSYA 5KP4A 1GY6A 1WMOA 2CKFB 5DRVA 5FGOA 2XFTA 1GD3A 3KFQC 3K0ZA 4G1MB 1GS3A 4HM5B 4LMIA 1EG9B 1W2ZA 1EQKA 4EV5A 5AIGA 4MMXB 1TP6A 2WOFA 2XF3A 1W02A 3FKAA 3DGNA 3T8UA 3S67A 4JF8A 4I4KA 1Q824 2M7OA 2Z77A 3SX1A 3DGMA 1FGOA 5IEOA 3X3ZA 1IQXA 3MG1A 1BUQA 3FSDA 3KE7A 1QVF2 2WGQA 4L8PA 1JN5B 3GZBA 4LEHA 3KSED 2GXFA 1L5GB 4WYKA 1EKMA 3GZYB 3GAXA 2ML6A 5D82A 2K0MA 3B7CA 2GEXA 2HMKB 3T8NA 3I563 1HKXA 2B24B 5CK6A 3TDGA 4OUQA 5EVHA 1K734 1LNHA 3PXMA 2KXGA 3Q1CA 4IIAA 2BMRB 1VQO3 2OTL3 3CME3 2CH9A 2FXTA 1OPYA 2XEPA 1OHSA 1PFPA 2BMQB 4KFEA 3EE1A 1FGTA 3NBRA 1JKGA 4MEIA 3UNLA 1VQ73 1OHPA 3WODG 4EYCA 3FGYA 4XBYA 2KRTA 5AI1A 1D6ZA 1NU3A 3CU3A 2QEX3 4HM0B 3EBTA 1OACA 4GB5A 1UW1A 1CEWI 2RFRA 5JPPA 3CCU3 3JUQA 4HZ9B 1IVWA 3CCS3 2WOHA 3MWZA 1HU9A 7STDA 2CFLA 3LH4A 1FGMA 1O7HB 3AMOA 4MMYB 3F14A 2P05A 3EC9A 4ORLA 4RZMA 3SXXA 1IV9A 2CIUA 1IQ8A 5G2GA 5LC6A 3CCR3 4HVNA 1NB5I 1WNHA 1LXEA 1E3RA 4HM8B 2CWTA 1FUWA 3N8BA 1ULIB 3G6E3 3OW22 1IT8A 3LOYA 3LYGA 1O7PB 2BNGA 2CFGA 3PCSA 4EXRA 1Q864 4O3VA 3S29A 3CCQ3 2XSOB 3NHXA 2BMOB 1DVDA 2CC3A 1FGQA 3GRDA 1O7WB 3MG3A 3QRDA 1TIJA 2F99A 2IA7A 2W04A 1LOXA 1Q40A 3BNEA 1W00A 4AKYA 1DMMA 2STDA 3FCSB 3F9SA 1K41A 4K90B 1W6CA 1AVKA 3U1WA 1IVVA 1W4NA 2BHMA 1ROVA 1E3VA 4HJLB 1ZX2A 5AYSC 3WOFB 2Y74A 1W6GA 3VF1A 1YIJ3 4N6V0 2GBXB 2ZL8A 4OVMA 1KSIA 4O8SA 4U13A 2CFWA 3K9MC 5FW5A 5CF2A 3F40A 4O02B 1AV4A 4FCMA 5IERA 4J9AA 4HM7B 1FA3A 2GU1A 2HMNB 3BB9A 3ECFA 5ELUA 3X3XA 5AEUB 2W56B 3H51A 3CCL3 1LVNA 2OWPA 2OTJ3 3FLJA 3SLUA 1EA2A 3DY5A 1R4CA 4WHAA 3MSOA 2Z76A 1QMAA 4FCZA 2K54A 2QGUA 3EN1B 1PU4A 2HMJB 1K28A 1VQM3 2CHCA 3O8YA 1WMNA 1M1K4 3BNDA 4AEQA 3HX8A 1NDOB 4N6LA 4R9LA 1W6YA 2Y73A 4XM4A 3S5CA 3HIGA 4FMCA 5IG0A 1A67A 1O7NB 2CK3H 2PNCA 2RSXA 3EJVA 1JKGB 3NQYA 1N5HA 5IF6A 3F7XA 5D81A 3IMAB 1NO3A 2KCDA 2SBLA 3WA2X 4KVHA 1QJGA 4FMDA 3JUMA 3HIIA 4N6TA 3CCM3 1UI8A 3EX9A 2V1LA 1N5PA 2OOVA 1JJ22 1JB5A 1N9EA 3GZXB 1CYUA 3X40A 4IT7A 4R80A 3K7CA 2YFLB 2YFIB 4EBGA 4HKVB 1M904 3LTCA 4N6OB 2R4IA 1S723 5I97A 4IPBA 3MYTA 3N54B 1W01A 2CFKA 1OH0A 1STFI 3UJMA 3DMCA 1JB4A 1YVBI 1AR0A 3PGBA 4J8TA 4LZIA 5A0OB 1IVUA 3KKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI 4;  3CMA 3;  3CCL 3;  1VQO 3;  1YI2 3;  3CC7 3;  3I55 3;  3G4S 3;  3CCM 3;  2OTL 3;  3CME 3;  1VQN 3;  1VQ8 3;  2OTJ 3;  1KQS 2;  1Q82 4;  1VQ9 3;  1VQL 3;  3CPW 2;  1Q81 4;  1K9M 4;  1JJ2 2;  3CCJ 3;  1VQ4 3;  1YJ9 3;  3CCR 3;  2QA4 3;  3CCV 3;  1VQM 3;  1VQ6 3;  3CCE 3;  1YIJ 3;  1M90 4;  1KC8 4;  1M1K 4;  1QVG 2;  1VQ7 3;  3G6E 3;  3OW2 2;  1VQK 3;  1YJW 3;  1QVF 2;  1YIT 3;  1S72 3;  1W2B 2;  1YHQ 3;  3CXC 2;  1N8R 4;  1YJN 3;  1Q86 4;  3CCQ 3;  2QEX 3;  1K8A 4;  1VQP 3;  3I56 3;  3G71 3;  3CC4 3;  3CD6 3;  1VQ5 3;  3CCU 3;  3CC2 3;  1Q7Y 4;  1K73 4;  1KD1 4;  3CCS 3; 
#chains in the Genus database with same CATH topology
 3LXU X;  4WP5 A;  1MWR A;  3ER7 A;  3BLZ A;  3FG1 A;  3ZFZ A;  2XR8 B;  5IW9 A;  1VQ9 3;  3CPW 2;  3NV0 A;  1I2F A;  2XH9 A;  5IG5 A;  1RTU A;  3D3L A;  4FMB A;  1Q40 B;  1RLS A;  2P38 A;  3Q90 A;  4HM4 B;  3CCV 3;  1BVI A;  3G0K A;  3U97 A;  1DET A;  1OF5 A;  2A15 A;  3CNX A;  2XGL A;  3F8X A;  5JPU A;  1LRA A;  1UCJ A;  1UI7 A;  2ML5 A;  1V74 A;  4FCJ A;  1RRL A;  5IEN A;  1QAK A;  3OXA A;  5HOH A;  3KSP A;  2IUJ A;  3DXO A;  5M1A A;  1MWS A;  3X41 A;  3UL5 A;  1A2P A;  3FH1 A;  3LML A;  3KII A;  2HMO B;  3KZT A;  4LYL B;  1RGL A;  2FGT A;  1GOY A;  1YI2 3;  4EW5 A;  2XRX B;  3CC7 3;  1BSE A;  1VQN 3;  3BNB A;  5AYR B;  1K9M 4;  1UCL A;  2P09 A;  1JBT A;  3SOA A;  4BTW A;  3H3H A;  2F4Y A;  3G16 A;  1VZZ A;  1RCL A;  4LGQ A;  1BAN A;  3OWS A;  4H61 A;  2P0M A;  1JZO A;  2RNT A;  7GSP A;  2YFJ B;  1SJW A;  2OQE A;  1RHL A;  1BSA A;  4K1U A;  1IVX A;  3HK4 A;  3IPT A;  3EQQ B;  4CPK A;  1TFO A;  1AVL A;  1UDI I;  4I5Q A;  1GD4 A;  1BNR A;  1BOX A;  3SVA A;  1OGZ A;  1ASK A;  3CPO A;  3NBB A;  1B20 A;  2CW9 A;  1R4Y A;  3V99 A;  1RDS A;  1WMP A;  1UUV B;  3LTD A;  1RN1 A;  2ZA4 A;  5CXO A;  5BXQ A;  2HMM B;  3G4S 3;  1GY7 A;  3B8L A;  4X2H A;  2C4B A;  1Q42 A;  5TGN A;  3EN8 A;  3D5G A;  1BRS A;  1SII A;  2FNQ A;  5EQL A;  1RRH A;  2QA4 3;  1T3B A;  5GSP A;  3JUN A;  1IDP A;  1AQZ A;  1Z1S A;  2E2T A;  1BAO A;  1J2B A;  3QK9 A;  1G96 A;  4MMZ B;  3X42 A;  4HYZ A;  3SOY A;  4NRE A;  2BO9 B;  1UUG B;  3AHS A;  4QWT A;  5IG3 A;  3MHE A;  2P0X A;  3GWR A;  5EEO A;  1YVS A;  1F8N A;  1YNV X;  1RN7 A;  2D1W A;  1UCI A;  1N8Q A;  4FMA A;  1K8A 4;  3CC2 3;  4R1K A;  2B1X B;  1DMQ A;  1CQS A;  3V98 A;  1IQY A;  3CMA 3;  4WYK B;  3PZW A;  3NM7 A;  4TX4 A;  1TFK A;  1VQ8 3;  3MG2 A;  1B27 A;  1O7M B;  4L8O A;  1B2X A;  2XSH B;  1Q81 4;  3CCJ 3;  1RGK A;  3LT8 A;  1BRJ A;  2W03 A;  2LQV A;  2QIY A;  2MF7 A;  1KC8 4;  1FW7 A;  3KN4 A;  1YJW 3;  1MOL A;  2IUK A;  2O9U X;  2OQE C;  2D42 A;  1NB3 I;  4H3U A;  4MJD A;  1X1U A;  1DYU A;  1YJN 3;  2GBW B;  2CG0 A;  1O7G B;  1BU4 A;  1X1Y A;  1YGE A;  1I2G A;  2J8X B;  1OF5 B;  3F8H A;  4XDV A;  1D6Y A;  1ISK A;  1V58 A;  4HM1 B;  1TUH A;  4PEJ A;  2H0G A;  2AAD A;  3GZR A;  8CHO A;  1IK3 A;  4O2H A;  5AII A;  1CH0 A;  4HOH A;  3RGR A;  3VGN A;  3PS8 A;  3I55 3;  3URP A;  4KZ1 A;  1VQL 3;  1BNI A;  1Q7H A;  1STD A;  3DGY A;  3E99 A;  3OWY A;  1T2I A;  3D5I A;  4KFF A;  2H0H A;  3WDG B;  5M18 A;  1LOW A;  1YJ9 3;  1HZ1 A;  2W9P A;  3B4O A;  1RKY A;  2E2V A;  1GSP A;  3NM2 A;  3WMD A;  5BVB A;  1X1W A;  1MNL A;  4RNY A;  3WR2 A;  3K63 A;  3NQZ A;  1YHQ 3;  3EBY A;  3AMO B;  6STD A;  5DRE A;  2C10 A;  1MWU A;  4N6U A;  3N9H A;  4N6N B;  3DM8 A;  4L7K A;  3FZW A;  4GL6 A;  3G71 3;  3JUP A;  5JBS A;  1W5Z A;  1A90 A;  1JV2 B;  2YX9 A;  3I0Y A;  4RNT A;  4XBX A;  1LQG C;  1OUN A;  4BL2 A;  1FGR A;  3UB1 A;  4OK0 A;  5KP1 A;  1I3F A;  3B4P A;  3DZL A;  3MKI A;  1RNT A;  1ZO2 A;  2UX0 A;  1SAR A;  3K5T A;  1D6U A;  4CDL A;  3RDE A;  1JRQ A;  3CCE 3;  3ALA A;  6RNT A;  5KP3 A;  1W7C A;  2Q07 A;  1ZS7 A;  2HML B;  2SAR A;  5CLK A;  1VQK 3;  4HM6 B;  1US1 A;  1OHO A;  2CWU A;  3LTB A;  3CXC 2;  3FF0 A;  3RNT A;  1SQW A;  1IU7 A;  2W56 A;  1BNJ A;  1WTH A;  4EV2 A;  4HM3 B;  1B3S A;  2XGN A;  4Q53 A;  1OCV A;  1BIR A;  4RNZ A;  1VQP 3;  4K61 A;  3OWU A;  1PY3 A;  3A76 A;  3ZG0 A;  4BTY A;  5RNT A;  2RBI A;  3V92 A;  8RNT A;  1NJI 4;  1CYV A;  1QAL A;  1A2K A;  3HI7 A;  3JVC A;  4HZB B;  5AEW B;  1BNS A;  1KWI A;  1C7H A;  3PYJ A;  4K1V A;  1IV7 A;  4R9K A;  1KQS 2;  2E2U A;  2L4V A;  4ZM8 A;  1VQ4 3;  3NUV A;  2OOV C;  1BRH A;  3NXJ A;  3ROB A;  1N9J A;  1S5A A;  4JRF A;  3WOE B;  4HBR A;  1B21 A;  1M1X B;  4BL3 A;  4KT3 B;  5AIH A;  1UCK A;  3M8C A;  4EC6 A;  4KFD A;  3EB8 A;  5ELJ A;  3D9R A;  1GYB A;  3DGL A;  3CC4 3;  3CD6 3;  3FG4 A;  1Q7Y 4;  3CNM A;  2RCD A;  2WGO A;  2F86 B;  2GEY A;  2JDI H;  1I0V A;  1UUW B;  2KAA A;  2KF3 A;  3EF8 A;  3NBJ A;  3Q3F A;  5STD A;  3GSP A;  4BU4 A;  2CWV A;  2W9Q A;  1PYL A;  2OCT A;  3Q2P A;  2RGQ A;  1GMP A;  2I9W A;  1JN5 A;  4N6M A;  2C11 A;  2MC8 A;  4X2O A;  1BUJ A;  3LTA A;  1B2S A;  3DUK A;  1NWW A;  3S27 A;  1VQ6 3;  5AIF A;  4N3V A;  1ROA A;  2BU4 A;  4XB5 A;  1E97 A;  5LC7 A;  1TU5 A;  2Z7A A;  1N8R 4;  3STD A;  1I8V A;  1DVC A;  3J7Y d;  3FG3 A;  1SIH A;  1BNF A;  2INX A;  3HZP A;  4RBN A;  1JBR A;  3G8Z A;  2ZDJ A;  1VQ5 3;  1SPU A;  1DMN A;  2GU3 A;  1QAF A;  3AGO A;  2BT3 A;  4XBT A;  3S28 A;  3DGO A;  1WQL B;  4HM2 B;  6GSP A;  4GHO A;  2W6J H;  5D83 A;  1RJO A;  1ULJ B;  1EEJ A;  2Z6B A;  1RMS A;  5M19 A;  3X3Y A;  3OV4 A;  2LYX A;  4WFO A;  2KF4 A;  5HGR A;  2F98 A;  2K3D A;  1Y4K A;  4AKZ A;  4LSO A;  2CFD A;  3PCR A;  3EHC A;  4R4K A;  3LT9 A;  3L0R A;  3OX9 A;  1YIT 3;  3UL6 A;  1BNG A;  4NHF A;  2W2C A;  4XDW A;  1W2B 2;  1MGW A;  4CCV A;  5IEP A;  2PZV A;  3NV0 B;  1G0T A;  1EUI C;  1U8C B;  3T0U A;  4STD A;  2O3O A;  1RSN A;  4NPB A;  2JQ5 A;  2UGI A;  1T5Y A;  9RNT A;  3F7S A;  1MGR A;  4WWU C;  3IJE B;  3JUO A;  3LZA A;  2CG1 A;  1G02 A;  3SED A;  4BTX A;  5CF1 A;  3NX0 A;  1Q9E A;  3MPH A;  1BGS A;  3D4A A;  2F5M A;  3BNC A;  1IT7 A;  2WO0 A;  1GMQ A;  1M9G A;  1JB2 A;  1OGX A;  1KD1 4;  1A2V A;  2XFS A;  5IG4 A;  3WA3 A;  2IMJ A;  1BNE A;  3FF2 A;  4FR9 A;  1GY5 A;  3RGA A;  1QVG 2;  1B2M A;  2W0Q A;  1JNQ A;  1U5O A;  3VSY A;  5KP4 A;  1GY6 A;  1WMO A;  2CKF B;  5DRV A;  1NNV A;  2XFT A;  5FGO A;  1I70 A;  1FUT A;  1GD3 A;  3KFQ C;  3K0Z A;  4G1M B;  5BIR A;  1GS3 A;  1FYS A;  4HM5 B;  1EG9 B;  2H0I A;  4LMI A;  1W2Z A;  1EQK A;  1BSB A;  4EV5 A;  5G1K A;  5AIG A;  4MMX B;  1TP6 A;  2WOF A;  2XF3 A;  1W02 A;  3FKA A;  3DGN A;  3T8U A;  3S67 A;  4JF8 A;  4I4K A;  1Q82 4;  2M7O A;  2Z77 A;  3SX1 A;  3DGM A;  1FGO A;  5IEO A;  3X3Z A;  4CJN A;  1RGE A;  1IQX A;  3MG1 A;  2AAE A;  1BUQ A;  3FSD A;  3KE7 A;  2F5W A;  1QVF 2;  2WGQ A;  4L8P A;  1UGI A;  1JN5 B;  3GZB A;  3AHW A;  3KSE D;  2GXF A;  4LEH A;  1L5G B;  4WYK A;  1EKM A;  3GZY B;  3GAX A;  2ML6 A;  1DE3 A;  1LOV A;  1AY7 A;  1BRG A;  1LNI A;  5D82 A;  2K0M A;  3B7C A;  2GEX A;  2HMK B;  3T8N A;  3BIR A;  3I56 3;  1HKX A;  1FUS A;  2B24 B;  5CK6 A;  3TDG A;  4OUQ A;  5EVH A;  1K73 4;  1LNH A;  3PXM A;  2KXG A;  3Q1C A;  4IIA A;  2BMR B;  1VQO 3;  3ZG5 A;  2OTL 3;  2CX0 A;  3CME 3;  2IYJ A;  1RNB A;  2CH9 A;  2FXT A;  1OPY A;  2XEP A;  1OHS A;  1PFP A;  1TRP A;  2BMQ B;  4KFE A;  3EE1 A;  1FGT A;  1LQM B;  3NBR A;  1JKG A;  4MEI A;  3UNL A;  1LOY A;  1VQ7 3;  1OHP A;  1JBS A;  1ZGX A;  3WOD G;  4EYC A;  3FGY A;  4XBY A;  1UGH I;  2KRT A;  5AI1 A;  2GSP A;  1D6Z A;  1NU3 A;  3CU3 A;  2QEX 3;  4HM0 B;  3EBT A;  1OAC A;  2KF5 A;  4GB5 A;  1C54 A;  1UW1 A;  1CEW I;  1RGG A;  2RFR A;  5JPP A;  3CCU 3;  3JUQ A;  1X1X A;  1IVW A;  1GOV A;  4HZ9 B;  3CCS 3;  1TJD A;  2WOH A;  3MWZ A;  1HU9 A;  7STD A;  1RGA A;  2CFL A;  3LH4 A;  1FGM A;  1O7H B;  3AMO A;  3KCH A;  3F14 A;  2P05 A;  3EC9 A;  4MMY B;  4ORL A;  4RZM A;  1IV9 A;  3SXX A;  1VQQ A;  1RN4 A;  2CIU A;  1IQ8 A;  5G2G A;  4J5K A;  5LC6 A;  4HVN A;  3CCR 3;  1NB5 I;  1I3I A;  1WNH A;  1LXE A;  3DH2 A;  1E3R A;  4HM8 B;  2CWT A;  1FUW A;  3N8B A;  1ULI B;  3G6E 3;  1YGW A;  1IT8 A;  2BIR A;  3OW2 2;  3LOY A;  1RGF A;  3LYG A;  1O7P B;  2BNG A;  2CFG A;  3PCS A;  4EXR A;  1Q86 4;  4O3V A;  3S29 A;  3CCQ 3;  2XSO B;  1BRK A;  3NHX A;  2BMO B;  2IY2 A;  1DVD A;  2CC3 A;  1FGQ A;  3GRD A;  2ZHX B;  1O7W B;  3MG3 A;  3QRD A;  3SYU A;  1BRI A;  1TIJ A;  2F99 A;  2IA7 A;  2W04 A;  1LOX A;  4GSP A;  3A5E A;  1Q40 A;  1MWT A;  1W00 A;  3BNE A;  3WHO A;  4AKY A;  1DMM A;  2STD A;  3FCS B;  1BRN L;  3F9S A;  1K41 A;  4K90 B;  1W6C A;  1AVK A;  1BSD A;  1IVV A;  1W4N A;  3U1W A;  2BHM A;  1RGH A;  1ROV A;  1E3V A;  4HJL B;  1ZX2 A;  4J5G A;  4ILF A;  1RGC A;  5AYS C;  3WOF B;  4BIR A;  2Y74 A;  1W6G A;  3VF1 A;  1YIJ 3;  4N6V 0;  2GBX B;  2ZL8 A;  4OVM A;  1KSI A;  1GMR A;  4O8S A;  4U13 A;  2CFW A;  3K9M C;  5FW5 A;  5CF2 A;  3F40 A;  4O02 B;  1AV4 A;  4FCM A;  5IER A;  4J9A A;  4HM7 B;  1FA3 A;  2KF6 A;  2GU1 A;  2HMN B;  3BB9 A;  1JZD A;  3ECF A;  5ELU A;  3X3X A;  5AEU B;  2W56 B;  3H51 A;  3CCL 3;  1LVN A;  1T2H A;  2OWP A;  3FLJ A;  2OTJ 3;  3SLU A;  1EA2 A;  3DY5 A;  1R4C A;  4WHA A;  3MSO A;  2Z76 A;  1QMA A;  4FCZ A;  2CX1 A;  2K54 A;  2QGU A;  1FZU A;  2UUG C;  1TTO A;  3EN1 B;  2HMJ B;  1K28 A;  1PU4 A;  1VQM 3;  2CHC A;  3O8Y A;  4DKI A;  1WMN A;  1M1K 4;  3BND A;  4AEQ A;  3HX8 A;  1NDO B;  4N6L A;  4R9L A;  1IYY A;  1BSC A;  1W6Y A;  2Y73 A;  4XM4 A;  3S5C A;  3HIG A;  4FMC A;  5IG0 A;  1A67 A;  1I0X A;  1O7N B;  2CK3 H;  2PNC A;  2RSX A;  3EJV A;  1JKG B;  3NQY A;  1V57 A;  1N5H A;  5IF6 A;  3BU4 A;  3F7X A;  5D81 A;  3IMA B;  1NO3 A;  3AGN A;  2KCD A;  2SBL A;  3WA2 X;  4KVH A;  1QJG A;  4FMD A;  2HOH A;  3JUM A;  3HII A;  4N6T A;  3CCM 3;  1UI8 A;  2R41 A;  3D79 A;  3EX9 A;  2V1L A;  1N5P A;  2OOV A;  1JJ2 2;  1JB5 A;  1N9E A;  3GZX B;  1B2Z A;  1CYU A;  3X40 A;  4IT7 A;  4R80 A;  7RNT A;  3K7C A;  2YFL B;  1B2U A;  5BU4 A;  2YFI B;  4EBG A;  4HKV B;  1I2E A;  2F56 A;  1M90 4;  1GOU A;  3LTC A;  4N6O B;  2R4I A;  1S72 3;  2L1S A;  5G1L A;  3HOH A;  5I97 A;  4IPB A;  3MYT A;  3N54 B;  4HAA A;  1W01 A;  2CFK A;  1OH0 A;  1STF I;  3UJM A;  1RCK A;  3DMC A;  1JB4 A;  1YVB I;  1AR0 A;  3PGB A;  1HYF A;  4J8T A;  1TRQ A;  4LZI A;  5A0O B;  1IVU A;  3KKG A; 
#chains in the Genus database with same CATH homology
 3LXU X;  4WP5 A;  3ER7 A;  3BLZ A;  3FG1 A;  5IW9 A;  2XR8 B;  1VQ9 3;  3CPW 2;  3NV0 A;  2XH9 A;  5IG5 A;  3D3L A;  4FMB A;  1Q40 B;  2P38 A;  3Q90 A;  4HM4 B;  3CCV 3;  3G0K A;  3U97 A;  1OF5 A;  2A15 A;  3CNX A;  2XGL A;  3F8X A;  5JPU A;  1UI7 A;  2ML5 A;  1V74 A;  4FCJ A;  1RRL A;  5IEN A;  1QAK A;  3OXA A;  3KSP A;  2IUJ A;  3DXO A;  3X41 A;  3UL5 A;  3FH1 A;  3LML A;  3KII A;  2HMO B;  3KZT A;  2FGT A;  1YI2 3;  3CC7 3;  2XRX B;  1VQN 3;  3BNB A;  5AYR B;  1K9M 4;  2P09 A;  3SOA A;  4BTW A;  3H3H A;  3G16 A;  1VZZ A;  4LGQ A;  3OWS A;  4H61 A;  2P0M A;  2YFJ B;  1SJW A;  2OQE A;  4K1U A;  1IVX A;  3HK4 A;  3IPT A;  3EQQ B;  1TFO A;  1AVL A;  1GD4 A;  3SVA A;  1OGZ A;  1ASK A;  3CPO A;  3NBB A;  2CW9 A;  3V99 A;  1WMP A;  1UUV B;  3LTD A;  5BXQ A;  5CXO A;  2HMM B;  3G4S 3;  1GY7 A;  3B8L A;  4X2H A;  5TGN A;  1Q42 A;  3EN8 A;  1SII A;  2FNQ A;  5EQL A;  1RRH A;  2QA4 3;  3JUN A;  1IDP A;  1Z1S A;  2E2T A;  1J2B A;  3QK9 A;  1G96 A;  4MMZ B;  3X42 A;  4HYZ A;  3SOY A;  4NRE A;  2BO9 B;  4QWT A;  5IG3 A;  3MHE A;  2P0X A;  3GWR A;  5EEO A;  1F8N A;  2D1W A;  1RN7 A;  1N8Q A;  4FMA A;  1K8A 4;  3CC2 3;  4R1K A;  2B1X B;  1DMQ A;  1CQS A;  3V98 A;  1IQY A;  3CMA 3;  4WYK B;  3PZW A;  3NM7 A;  4TX4 A;  1TFK A;  1VQ8 3;  3MG2 A;  1O7M B;  4L8O A;  2XSH B;  1Q81 4;  3CCJ 3;  3LT8 A;  2W03 A;  2LQV A;  2QIY A;  2MF7 A;  1KC8 4;  3KN4 A;  1YJW 3;  1MOL A;  2IUK A;  2O9U X;  2OQE C;  2D42 A;  1NB3 I;  4H3U A;  4MJD A;  1DYU A;  1YJN 3;  2GBW B;  2CG0 A;  1O7G B;  1YGE A;  1OF5 B;  3F8H A;  4XDV A;  1D6Y A;  1ISK A;  4HM1 B;  1TUH A;  4PEJ A;  3GZR A;  8CHO A;  1IK3 A;  4O2H A;  5AII A;  3RGR A;  3VGN A;  3PS8 A;  3I55 3;  1VQL 3;  4KZ1 A;  1STD A;  3E99 A;  3OWY A;  4KFF A;  3WDG B;  1YJ9 3;  2W9P A;  3B4O A;  1RKY A;  2E2V A;  3WMD A;  3NM2 A;  5BVB A;  1MNL A;  4RNY A;  1YHQ 3;  3K63 A;  3NQZ A;  3EBY A;  3AMO B;  6STD A;  5DRE A;  2C10 A;  4N6U A;  3N9H A;  4N6N B;  3DM8 A;  4L7K A;  3FZW A;  4GL6 A;  3G71 3;  3JUP A;  5JBS A;  1W5Z A;  1A90 A;  1JV2 B;  2YX9 A;  3I0Y A;  4XBX A;  1OUN A;  1FGR A;  3UB1 A;  4OK0 A;  5KP1 A;  3B4P A;  3DZL A;  3MKI A;  1ZO2 A;  2UX0 A;  3K5T A;  1D6U A;  4CDL A;  3RDE A;  1JRQ A;  3CCE 3;  3ALA A;  5KP3 A;  1W7C A;  2Q07 A;  2HML B;  5CLK A;  1VQK 3;  4HM6 B;  1US1 A;  1OHO A;  2CWU A;  3LTB A;  3CXC 2;  3FF0 A;  1SQW A;  1IU7 A;  2W56 A;  1WTH A;  4EV2 A;  4HM3 B;  2XGN A;  4Q53 A;  1OCV A;  4RNZ A;  1VQP 3;  4K61 A;  3OWU A;  4BTY A;  3A76 A;  3V92 A;  1NJI 4;  1CYV A;  1QAL A;  1A2K A;  3HI7 A;  3JVC A;  4HZB B;  5AEW B;  1KWI A;  1C7H A;  3PYJ A;  4K1V A;  1IV7 A;  4R9K A;  1KQS 2;  2E2U A;  2L4V A;  4ZM8 A;  1VQ4 3;  3NUV A;  2OOV C;  3NXJ A;  3ROB A;  1N9J A;  1S5A A;  4JRF A;  3WOE B;  4HBR A;  1M1X B;  5AIH A;  3M8C A;  4EC6 A;  4KFD A;  3EB8 A;  5ELJ A;  3D9R A;  1GYB A;  3DGL A;  3CC4 3;  3CD6 3;  3FG4 A;  1Q7Y 4;  3CNM A;  2RCD A;  2WGO A;  2F86 B;  2GEY A;  2JDI H;  3EF8 A;  1UUW B;  3NBJ A;  5STD A;  2CWV A;  2W9Q A;  3Q2P A;  2OCT A;  2RGQ A;  2I9W A;  1JN5 A;  4N6M A;  2C11 A;  2MC8 A;  4X2O A;  3LTA A;  3DUK A;  1NWW A;  3S27 A;  1VQ6 3;  5AIF A;  4N3V A;  1ROA A;  4XB5 A;  1E97 A;  5LC7 A;  1TU5 A;  2Z7A A;  1N8R 4;  3STD A;  1DVC A;  3J7Y d;  3FG3 A;  1SIH A;  2INX A;  3HZP A;  4RBN A;  3G8Z A;  2ZDJ A;  1VQ5 3;  1SPU A;  1DMN A;  2GU3 A;  1QAF A;  2BT3 A;  4XBT A;  3S28 A;  3DGO A;  1WQL B;  4HM2 B;  2W6J H;  5D83 A;  1RJO A;  1ULJ B;  2Z6B A;  3X3Y A;  3OV4 A;  2LYX A;  4WFO A;  5HGR A;  2F98 A;  1Y4K A;  4AKZ A;  4LSO A;  2CFD A;  3PCR A;  3EHC A;  4R4K A;  3LT9 A;  3L0R A;  3OX9 A;  1YIT 3;  3UL6 A;  4NHF A;  4XDW A;  2W2C A;  1W2B 2;  4CCV A;  5IEP A;  2PZV A;  3NV0 B;  1U8C B;  3T0U A;  4STD A;  2O3O A;  2JQ5 A;  1T5Y A;  3F7S A;  4WWU C;  3SED A;  3IJE B;  3JUO A;  3LZA A;  2CG1 A;  4BTX A;  5CF1 A;  3NX0 A;  3MPH A;  3BNC A;  1IT7 A;  2WO0 A;  1M9G A;  1OGX A;  1JB2 A;  1KD1 4;  1A2V A;  2XFS A;  5IG4 A;  3WA3 A;  2IMJ A;  3FF2 A;  4FR9 A;  1GY5 A;  3RGA A;  1QVG 2;  2W0Q A;  1JNQ A;  1U5O A;  3VSY A;  5KP4 A;  1GY6 A;  1WMO A;  2CKF B;  5DRV A;  5FGO A;  2XFT A;  1GD3 A;  3KFQ C;  3K0Z A;  4G1M B;  1GS3 A;  4HM5 B;  4LMI A;  1EG9 B;  1W2Z A;  1EQK A;  4EV5 A;  5AIG A;  4MMX B;  1TP6 A;  2WOF A;  2XF3 A;  1W02 A;  3FKA A;  3DGN A;  3T8U A;  3S67 A;  4JF8 A;  4I4K A;  1Q82 4;  2M7O A;  2Z77 A;  3SX1 A;  3DGM A;  1FGO A;  5IEO A;  3X3Z A;  1IQX A;  3MG1 A;  1BUQ A;  3FSD A;  3KE7 A;  1QVF 2;  2WGQ A;  4L8P A;  1JN5 B;  3GZB A;  4LEH A;  3KSE D;  2GXF A;  1L5G B;  4WYK A;  1EKM A;  3GZY B;  3GAX A;  2ML6 A;  5D82 A;  2K0M A;  3B7C A;  2GEX A;  2HMK B;  3T8N A;  3I56 3;  1HKX A;  2B24 B;  5CK6 A;  3TDG A;  4OUQ A;  5EVH A;  1K73 4;  1LNH A;  3PXM A;  2KXG A;  3Q1C A;  4IIA A;  2BMR B;  1VQO 3;  2OTL 3;  3CME 3;  2CH9 A;  2FXT A;  1OPY A;  2XEP A;  1OHS A;  1PFP A;  2BMQ B;  4KFE A;  3EE1 A;  1FGT A;  3NBR A;  1JKG A;  4MEI A;  3UNL A;  1VQ7 3;  1OHP A;  3WOD G;  4EYC A;  3FGY A;  4XBY A;  2KRT A;  5AI1 A;  1D6Z A;  1NU3 A;  3CU3 A;  2QEX 3;  4HM0 B;  3EBT A;  1OAC A;  4GB5 A;  1UW1 A;  1CEW I;  2RFR A;  5JPP A;  3CCU 3;  3JUQ A;  4HZ9 B;  1IVW A;  3CCS 3;  2WOH A;  3MWZ A;  1HU9 A;  7STD A;  2CFL A;  3LH4 A;  1FGM A;  1O7H B;  3AMO A;  4MMY B;  3F14 A;  2P05 A;  3EC9 A;  4ORL A;  4RZM A;  3SXX A;  1IV9 A;  2CIU A;  1IQ8 A;  5G2G A;  5LC6 A;  3CCR 3;  4HVN A;  1NB5 I;  1WNH A;  1LXE A;  1E3R A;  4HM8 B;  2CWT A;  1FUW A;  3N8B A;  1ULI B;  3G6E 3;  3OW2 2;  1IT8 A;  3LOY A;  3LYG A;  1O7P B;  2BNG A;  2CFG A;  3PCS A;  4EXR A;  1Q86 4;  4O3V A;  3S29 A;  3CCQ 3;  2XSO B;  3NHX A;  2BMO B;  1DVD A;  2CC3 A;  1FGQ A;  3GRD A;  1O7W B;  3MG3 A;  3QRD A;  1TIJ A;  2F99 A;  2IA7 A;  2W04 A;  1LOX A;  1Q40 A;  3BNE A;  1W00 A;  4AKY A;  1DMM A;  2STD A;  3FCS B;  3F9S A;  1K41 A;  4K90 B;  1W6C A;  1AVK A;  3U1W A;  1IVV A;  1W4N A;  2BHM A;  1ROV A;  1E3V A;  4HJL B;  1ZX2 A;  5AYS C;  3WOF B;  2Y74 A;  1W6G A;  3VF1 A;  1YIJ 3;  4N6V 0;  2GBX B;  2ZL8 A;  4OVM A;  1KSI A;  4O8S A;  4U13 A;  2CFW A;  3K9M C;  5FW5 A;  5CF2 A;  3F40 A;  4O02 B;  1AV4 A;  4FCM A;  5IER A;  4J9A A;  4HM7 B;  1FA3 A;  2GU1 A;  2HMN B;  3BB9 A;  3ECF A;  5ELU A;  3X3X A;  5AEU B;  2W56 B;  3H51 A;  3CCL 3;  1LVN A;  2OWP A;  2OTJ 3;  3FLJ A;  3SLU A;  1EA2 A;  3DY5 A;  1R4C A;  4WHA A;  3MSO A;  2Z76 A;  1QMA A;  4FCZ A;  2K54 A;  2QGU A;  3EN1 B;  1PU4 A;  2HMJ B;  1K28 A;  1VQM 3;  2CHC A;  3O8Y A;  1WMN A;  1M1K 4;  3BND A;  4AEQ A;  3HX8 A;  1NDO B;  4N6L A;  4R9L A;  1W6Y A;  2Y73 A;  4XM4 A;  3S5C A;  3HIG A;  4FMC A;  5IG0 A;  1A67 A;  1O7N B;  2CK3 H;  2PNC A;  2RSX A;  3EJV A;  1JKG B;  3NQY A;  1N5H A;  5IF6 A;  3F7X A;  5D81 A;  3IMA B;  1NO3 A;  2KCD A;  2SBL A;  3WA2 X;  4KVH A;  1QJG A;  4FMD A;  3JUM A;  3HII A;  4N6T A;  3CCM 3;  1UI8 A;  3EX9 A;  2V1L A;  1N5P A;  2OOV A;  1JJ2 2;  1JB5 A;  1N9E A;  3GZX B;  1CYU A;  3X40 A;  4IT7 A;  4R80 A;  3K7C A;  2YFL B;  2YFI B;  4EBG A;  4HKV B;  1M90 4;  3LTC A;  4N6O B;  2R4I A;  1S72 3;  5I97 A;  4IPB A;  3MYT A;  3N54 B;  1W01 A;  2CFK A;  1OH0 A;  1STF I;  3UJM A;  3DMC A;  1JB4 A;  1YVB I;  1AR0 A;  3PGB A;  4J8T A;  4LZI A;  5A0O B;  1IVU A;  3KKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...