1Q7Y4

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q7y400
2QA43 3CCS3 3CPW2 1W2B2 3CCL3 1YI23 1VQ53 3CC43 1QVF2 1QVG2 1KD14 1VQP3 1M904 1VQ43 3CME3 1S723 3I553 1KC84 2OTL3 2QEX3 3CCU3 3CCV3 1YHQ3 1VQ93 1Q864 3CMA3 1VQ63 3G713 1Q814 3CC23 3CXC2 1VQM3 3CCM3 3CC73 1VQK3 1YJ93 3G4S3 1VQO3 3CCR3 1Q824 1K734 1YIT3 3OW22 3G6E3 3CCE3 1K8A4 1M1K4 1VQ83 1K9M4 1N8R4 1VQL3 1VQN3 1YIJ3 1KQS2 3CCJ3 1JJ22 3CCQ3 3CD63 1Q7Y4 2OTJ3 1NJI4 1VQ73 3I563 1YJN3 1YJW3
chains in the Genus database with same CATH superfamily
4R9LA 3V99A 4NPBA 3LXUX 1MWTA 2W03A 2M7OA 1R4CA 1BNSA 3CNMA 1AR0A 4STDA 1HKXA 2QGUA 2STDA 3CMA3 4KT3B 2J8XB 4ZM8A 3NXJA 4WWUC 1HZ1A 2O3OA 5RNTA 5EQLA 2F5MA 3KZTA 1B20A 1A67A 4LYLB 1UUWB 3T0UA 4XDWA 1M1K4 4KZ1A 3WDGB 1MWSA 4CDLA 1QALA 2P09A 4HM8B 4BIRA 1JJ22 4KFFA 1OGXA 3GZBA 1UCIA 1OF5B 1VQ83 1W6GA 3M8CA 1YJW3 2F4YA 1RCKA 2RSXA 3MSOA 2CG1A 2YFJB 1ZX2A 1BNJA 1QVF2 3WA3A 3MG3A 4EC6A 3Q1CA 3N54B 3J7Yd 1A90A 1B2MA 3JVCA 1B27A 4CPKA 1QAFA 1BU4A 1I2GA 1U8CB 3SYUA 2XFTA 3ZG0A 2BMOB 1BSEA 2CFLA 3UB1A 3G4S3 2KF3A 3EX9A 2CWTA 1RGKA 1JB2A 1AVLA 2W9PA 1UCJA 3FG1A 3VF1A 3X3ZA 2IYJA 4H61A 3MPHA 1B2UA 1NU3A 5G1KA 1IVWA 3F7SA 4KFEA 3BNDA 1Q40B 1T3BA 2BMRB 1O7HB 3NM7A 1W01A 3B4PA 3ECFA 5CLKA 4AEQA 4XB5A 1CYUA 2QEX3 3CCU3 3PYJA 5EEOA 1YHQ3 1SJWA 5G1LA 2BHMA 1YGWA 3UL6A 4J8TA 4WFOA 3G8ZA 1NO3A 3D3LA 3URPA 2KAAA 2BIRA 4K61A 2KXGA 4RNYA 3E99A 3GZRA 3JUOA 3OXAA 1OH0A 3AHSA 2WO0A 1RHLA 4WYKA 1TJDA 7GSPA 1VQN3 1ZS7A 3HIGA 2XGLA 5D81A 4AKZA 3GZXB 1I0XA 4HM6B 1I70A 3WOFB 3NBJA 3CCQ3 3EF8A 1LXEA 3I563 1ROVA 1A2VA 4Q53A 3ALAA 1BGSA 4K1UA 5JPUA 1V57A 3CCL3 1W2B2 3JUMA 3RGRA 1BVIA 1TRQA 1DVCA 4OUQA 1FGOA 1I3FA 1MGRA 4GL6A 4R9KA 5IG0A 1OPYA 2IA7A 5D83A 5EVHA 3G0KA 2LQVA 4IPBA 4XBTA 2XSOB 3UL5A 4O3VA 3F40A 2KRTA 4FMCA 3S67A 5HOHA 3PCRA 3MYTA 3BU4A 4N6OB 1K9M4 6RNTA 3KKGA 5AI1A 2SBLA 2ZHXB 3PGBA 1UGIA 2INXA 1RN1A 2R41A 1K28A 3BNBA 4HZ9B 3NBRA 1I0VA 3X3YA 3Q90A 3EE1A 3TDGA 1T2HA 2Z7AA 1LQMB 5DREA 1RN4A 1STFI 1K41A 1AY7A 1GS3A 1R4YA 2P38A 1D6UA 1WMPA 2CX0A 3BLZA 1N9JA 4R80A 3SEDA 3S27A 2PNCA 3CCV3 1VQ63 1RNTA 1ZO2A 4MEIA 3ER7A 1WMNA 4HAAA 2W56B 3CNXA 1W00A 4L8PA 2HOHA 3K9MC 1BRHA 1NNVA 1VQO3 1F8NA 4XDVA 5KP3A 1B2ZA 1RMSA 3SOYA 1X1UA 2SARA 3X3XA 1YGEA 3EN1B 1IYYA 1UCLA 2CIUA 3HOHA 5IW9A 3DGYA 5JPPA 4N3VA 5TGNA 4O2HA 5M1AA 1LOXA 2ML5A 3DXOA 3QRDA 4MMXB 4O02B 9RNTA 3JUQA 1DMQA 3FF0A 4TX4A 2QA43 5IERA 1ZGXA 1I2EA 3D9RA 3FG3A 4BU4A 3PS8A 1VQ43 5A0OB 1I3IA 2Z76A 1GD3A 1C7HA 1JN5B 2HMLB 5CXOA 1FZUA 1LNIA 1SARA 3G16A 1HU9A 1UCKA 3MKIA 3OX9A 4HM0B 3OWSA 5IG3A 1JZDA 1O7WB 2GXFA 1B2SA 2I9WA 1UUGB 4GSPA 4WHAA 2RCDA 1QAKA 5KP4A 5ELJA 1IT8A 1BRJA 1W4NA 3T8UA 1PU4A 3WOEB 2CH9A 3LTBA 2LYXA 3HK4A 2CK3H 3FG4A 4HJLB 1B21A 2MF7A 3H51A 3EC9A 5DRVA 1VQ73 1STDA 1E3VA 2F99A 1EG9B 2XRXB 1GMRA 1OF5A 1Y4KA 1NDOB 4HM5B 5AIGA 3AHWA 5CK6A 1NB5I 3CME3 4IT7A 1BRNL 1JKGB 4N6V0 2Y74A 3CC23 1G0TA 1VQM3 1FGTA 5STDA 1MWRA 1GOYA 3DGNA 3F9SA 2CG0A 3PCSA 5D82A 3CCR3 4BL3A 1CH0A 1CQSA 4NHFA 1ULJB 2W2CA 1LOYA 1RGHA 4JF8A 1PYLA 3LYGA 4I4KA 3NHXA 3U1WA 3SVAA 3KIIA 1JNQA 3CD63 5BXQA 2E2VA 3UJMA 1S5AA 1FW7A 4U13A 2CX1A 2E2TA 2Z6BA 2CFDA 2YFLB 3F8HA 4HVNA 3WHOA 1B3SA 4EYCA 5BIRA 2MC8A 1JRQA 1O7PB 1RJOA 1IK3A 1Q40A 1Z1SA 2F86B 1GMQA 1JB4A 5AIHA 1GOVA 2HMNB 1DETA 2XEPA 2IUKA 2XH9A 4HM7B 1BRIA 3KE7A 5M19A 4J5KA 3JUPA 2A15A 3LT9A 4RZMA 2D1WA 1RCLA 5IEPA 4XBXA 3UNLA 2O9UX 4J5GA 5LC6A 1OUNA 1IT7A 2WOHA 1RLSA 3EJVA 3RGAA 3Q2PA 4XBYA 2BU4A 3HZPA 3STDA 1X1WA 3KFQC 3N8BA 3AMOB 4DKIA 1Q7Y4 4CJNA 2BNGA 5AYRB 1QMAA 2BMQB 2HMJB 1I8VA 5GSPA 5ELUA 1WQLB 2RNTA 2P05A 2GBWB 2Z77A 3S29A 1BRGA 2CFWA 1VQP3 6GSPA 5BU4A 1BSDA 1BANA 1BNEA 1SIHA 3FCSB 3HX8A 4EXRA 5JBSA 2GBXB 3MWZA 1UI7A 1A2KA 3IMAB 4X2HA 2YFIB 3WMDA 1PFPA 3L0RA 1T5YA 2F98A 3EN8A 1MWUA 1BSCA 2K0MA 4OVMA 2BO9B 1RGCA 1TRPA 3DGLA 2WGQA 3SX1A 2OWPA 3GRDA 2FNQA 3N9HA 4OK0A 2W0QA 3V92A 1TUHA 4HM2B 1TP6A 2JDIH 2AAEA 3BB9A 3HIIA 1A2PA 1JB5A 4RNZA 1FA3A 5I97A 3D4AA 1IDPA 4MMYB 1M9GA 4XM4A 3S5CA 1UI8A 5AYSC 4N6LA 3DM8A 1N8QA 3EBTA 1YI23 3CC43 1D6ZA 4BL2A 4ILFA 1SQWA 1W2ZA 3Q3FA 3I0YA 1RRLA 4FR9A 4I5QA 1N9EA 2IMJA 2KF6A 1HYFA 1WMOA 3QK9A 1VZZA 1BNIA 2FGTA 3X40A 3ZFZA 3NV0B 4LGQA 3LMLA 3CXC2 1AV4A 1RSNA 3IJEB 2P0MA 2RBIA 3LT8A 1W5ZA 2ZDJA 1IQYA 4CCVA 2W56A 3HI7A 1JBRA 5M18A 3CCE3 4N6UA 1X1YA 1FYSA 2R4IA 3D79A 1IVXA 3NBBA 4GHOA 1E97A 2D42A 1BUQA 1NJI4 1EQKA 2PZVA 1BRKA 5G2GA 3DGMA 4FCMA 3V98A 1IU7A 3D5GA 1FGQA 2OCTA 4K90B 4QWTA 5BVBA 4FCJA 1OCVA 1G96A 2C10A 3MG2A 4N6NB 1KD14 1YVSA 4EBGA 2KF4A 3BNEA 1S723 1DVDA 5IG5A 3B4OA 2IUJA 1NWWA 5KP1A 1RTUA 1LQGC 1VQ93 5CF1A 2B24B 1Q864 2H0HA 3NX0A 1Q9EA 1WTHA 5AIIA 3WR2A 1Q814 4H3UA 3LOYA 2BT3A 1RGAA 3SXXA 4EW5A 3DGOA 5IENA 1RDSA 2CHCA 1BSBA 1GD4A 1MGWA 2Q07A 3ZG5A 2W9QA 3OW22 1YIT3 1EKMA 1X1XA 2XGNA 3PZWA 3SOAA 5AEWB 4N6TA 1K8A4 1VQL3 2WOFA 3F14A 1KWIA 1V58A 3DMCA 1O7MB 1FGRA 1LNHA 4O8SA 1TFOA 1BAOA 3EBYA 1NB3I 8RNTA 2QIYA 3ROBA 8CHOA 1BRSA 1VQQA 1BOXA 1QJGA 3B7CA 3LZAA 3K0ZA 4EV2A 1SPUA 1BNFA 1OHOA 1G02A 3OWYA 4GB5A 1RGLA 1U5OA 4N6MA 3G713 3LH4A 3MHEA 3FGYA 3CC73 1RNBA 1OHPA 1DYUA 1W6YA 3IPTA 3O8YA 1JKGA 1VQK3 3SLUA 1LOWA 3FF2A 1TIJA 1YNVX 2GU1A 3RDEA 2Y73A 3X42A 1K734 1W02A 3KSED 2L4VA 3BIRA 4KVHA 5IG4A 1TU5A 1RRHA 1B2XA 6STDA 2XSHB 1KQS2 3NM2A 1OHSA 2V1LA 1O7GB 1I2FA 1EA2A 3B8LA 5AEUB 2CC3A 1T2IA 1JZOA 5CF2A 1IVUA 3F7XA 1E3RA 2H0GA 3T8NA 2UGIA 1VQ53 3GAXA 2GEYA 1M904 4J9AA 3I553 3DUKA 1EEJA 2HMOB 3NUVA 3A76A 1C54A 3OWUA 2RFRA 4X2OA 3D5IA 4FMAA 1N5PA 4HYZA 2OQEA 1ASKA 1IVVA 4RBNA 4L7KA 1EUIC 2C11A 2XF3A 3EHCA 1TFKA 1Q824 2OOVA 1BSAA 4HBRA 3G6E3 1KSIA 2FXTA 7STDA 1RGEA 1JBSA 3K5TA 1GYBA 3CCJ3 2UUGC 4FMBA 4WP5A 1L5GB 3FH1A 1JBTA 1WNHA 3F8XA 3JUNA 2CFKA 4R4KA 3A5EA 3AMOA 3CCS3 3CPW2 3S28A 2B1XB 2KF5A 3K7CA 1ULIB 3NQZA 1W7CA 2E2UA 2YX9A 1FUTA 2WGOA 3WA2X 3VGNA 1TTOA 1O7NB 2H0IA 2ZL8A 2AADA 4JRFA 4WYKB 2CWUA 1RGFA 1YJ93 2XFSA 1UW1A 4LMIA 4RNTA 1IQ8A 4K1VA 1US1A 5IEOA 1M1XB 1OACA 4EV5A 1UDII 4G1MB 3AGOA 4FMDA 1YIJ3 3KCHA 7RNTA 4HZBB 1CYVA 1IV9A 1BIRA 2HMKB 1FUSA 2UX0A 2ML6A 1AQZA 1RN7A 1LRAA 4MJDA 5FGOA 2IY2A 2P0XA 1FUWA 3GZYB 2L1SA 3BNCA 3NQYA 3DH2A 4HM3B 1W6CA 1IQXA 1SIIA 3FSDA 3FLJA 3KSPA 2F56A 4FCZA 2OTL3 1V74A 2GEXA 2OQEC 1OGZA 1J2BA 1MOLA 1DE3A 5LC7A 4AKYA 4LSOA 1DMMA 2OOVC 1Q7HA 2CFGA 5FW5A 1DMNA 3NV0A 3FKAA 5IF6A 3EB8A 3FZWA 3CPOA 1GY5A 1YVBI 1GMPA 1BNGA 1GY6A 3LTCA 4HKVB 1GSPA 1LVNA 3K63A 3LTDA 1PY3A 1ROAA 2C4BA 1FGMA 3PXMA 1KC84 1AVKA 1RGGA 1CEWI 1JV2B 4HM4B 4HOHA 4LZIA 2ZA4A 5HGRA 3CU3A 4ORLA 1GY7A 2CKFB 2W6JH 1Q42A 2GU3A 4LEHA 4MMZB 4R1KA 1QVG2 1BUJA 1BNRA 2XR8B 2CW9A 2K3DA 2K54A 1GOUA 3EQQB 1LOVA 3VSYA 4BTYA 1N5HA 4KFDA 4L8OA 3GWRA 4PEJA 2JQ5A 1RKYA 3CCM3 1D6YA 1ISKA 3DY5A 3MG1A 3AGNA 3OV4A 3DZLA 1UUVB 2GSPA 3GSPA 3LTAA 1JN5A 3KN4A 4HM1B 3U97A 2KCDA 2W04A 1UGHI 5AIFA 4IIAA 1MNLA 2CWVA 2HMMB 4NREA 3RNTA 4BTWA 1IV7A 3H3HA 2RGQA 1N8R4 3WODG 4BTXA 2OTJ3 2F5WA 1YJN3 3X41A
chains in the Genus database with same CATH topology
4R9LA 3LXUX 2W03A 2M7OA 1R4CA 3CNMA 1AR0A 4STDA 1HKXA 2QGUA 2STDA 3CMA3 4ZM8A 3NXJA 4WWUC 2O3OA 5EQLA 3KZTA 1A67A 1UUWB 3T0UA 4XDWA 1M1K4 4KZ1A 3WDGB 4CDLA 1QALA 2P09A 4HM8B 1JJ22 4KFFA 1OGXA 3GZBA 1OF5B 1VQ83 1W6GA 3M8CA 1YJW3 2RSXA 3MSOA 2CG1A 2YFJB 1ZX2A 1QVF2 3WA3A 3MG3A 4EC6A 3Q1CA 3N54B 3J7Yd 1A90A 3JVCA 1QAFA 1U8CB 2XFTA 2BMOB 2CFLA 3UB1A 3G4S3 3EX9A 2CWTA 1JB2A 1AVLA 2W9PA 3FG1A 3VF1A 3X3ZA 4H61A 3MPHA 1NU3A 1IVWA 3F7SA 4KFEA 3BNDA 1Q40B 2BMRB 1O7HB 3NM7A 1W01A 3B4PA 3ECFA 5CLKA 4AEQA 4XB5A 1CYUA 2QEX3 3CCU3 3PYJA 5EEOA 1YHQ3 1SJWA 2BHMA 3UL6A 4J8TA 4WFOA 3G8ZA 1NO3A 3D3LA 4K61A 2KXGA 4RNYA 3E99A 3GZRA 3JUOA 3OXAA 1OH0A 2WO0A 4WYKA 1VQN3 3HIGA 2XGLA 5D81A 4AKZA 3GZXB 3CCQ3 4HM6B 3WOFB 3NBJA 3EF8A 1LXEA 3I563 1ROVA 1A2VA 4Q53A 3ALAA 4K1UA 5JPUA 1W2B2 3CCL3 3JUMA 3RGRA 1DVCA 4OUQA 1FGOA 4GL6A 4R9KA 5IG0A 1OPYA 2IA7A 5D83A 5EVHA 3G0KA 2LQVA 4IPBA 4XBTA 2XSOB 3UL5A 4O3VA 3F40A 2KRTA 4FMCA 3S67A 3PCRA 3MYTA 4N6OB 1K9M4 3KKGA 5AI1A 2SBLA 3PGBA 3BNBA 2INXA 1K28A 4HZ9B 3NBRA 3X3YA 3Q90A 3EE1A 3TDGA 2Z7AA 5DREA 1STFI 1K41A 1GS3A 2P38A 3BLZA 1D6UA 1WMPA 4R80A 3SEDA 1N9JA 3CCV3 3S27A 2PNCA 1VQ63 1ZO2A 4MEIA 3ER7A 1WMNA 2W56B 3CNXA 1W00A 4L8PA 3K9MC 1VQO3 1F8NA 4XDVA 5KP3A 3X3XA 3SOYA 1YGEA 3EN1B 2CIUA 5IW9A 5JPPA 4N3VA 5TGNA 4O2HA 1LOXA 2ML5A 3DXOA 3QRDA 4MMXB 4O02B 3JUQA 1DMQA 3FF0A 4TX4A 2QA43 5IERA 3D9RA 3FG3A 3PS8A 1VQ43 5A0OB 2Z76A 1GD3A 1C7HA 1JN5B 2HMLB 5CXOA 3MKIA 3G16A 3V99A 3OX9A 1HU9A 4HM0B 3OWSA 5IG3A 1O7WB 2GXFA 2I9WA 4WHAA 2RCDA 1QAKA 5KP4A 5ELJA 1IT8A 3T8UA 1W4NA 1PU4A 3WOEB 2CH9A 3LTBA 2LYXA 3HK4A 2CK3H 3FG4A 4HJLB 2MF7A 3H51A 3EC9A 5DRVA 1VQ73 1STDA 1E3VA 2F99A 1EG9B 2XRXB 1Y4KA 1OF5A 4HM5B 1NDOB 5AIGA 1NB5I 5CK6A 3CME3 4IT7A 1JKGB 4N6V0 2Y74A 3CC23 1VQM3 1FGTA 5STDA 3F9SA 3DGNA 2CG0A 3PCSA 5D82A 3CCR3 1CQSA 4NHFA 1ULJB 2W2CA 4JF8A 3LYGA 4I4KA 3NHXA 3U1WA 3SVAA 3KIIA 1JNQA 3CD63 5BXQA 2E2VA 3UJMA 1S5AA 4U13A 2E2TA 2Z6BA 2CFDA 2YFLB 3F8HA 4HVNA 4EYCA 2MC8A 1JRQA 1O7PB 1RJOA 1IK3A 1Q40A 1Z1SA 2F86B 1JB4A 5AIHA 2HMNB 2XEPA 2XH9A 4HM7B 2IUKA 3KE7A 3JUPA 2A15A 3LT9A 4RZMA 2D1WA 5IEPA 4XBXA 3UNLA 2O9UX 5LC6A 1OUNA 1IT7A 2WOHA 3EJVA 3RGAA 3Q2PA 4XBYA 3HZPA 3STDA 3KFQC 3N8BA 3AMOB 1Q7Y4 2BNGA 5AYRB 1QMAA 2BMQB 2HMJB 5ELUA 1WQLB 3S29A 2P05A 2GBWB 2Z77A 2CFWA 1VQP3 3HX8A 5JBSA 1SIHA 3FCSB 4EXRA 2GBXB 3MWZA 1UI7A 1A2KA 3IMAB 4X2HA 2YFIB 3WMDA 1PFPA 3L0RA 1T5YA 2F98A 3EN8A 2K0MA 4OVMA 2BO9B 3DGLA 2WGQA 3SX1A 2OWPA 3GRDA 2FNQA 3N9HA 4OK0A 2W0QA 3V92A 1TUHA 4HM2B 1TP6A 2JDIH 3BB9A 3HIIA 1JB5A 4RNZA 1FA3A 5I97A 1IDPA 4MMYB 1M9GA 4XM4A 3S5CA 1UI8A 5AYSC 4N6LA 3DM8A 1N8QA 3EBTA 1YI23 3CC43 1D6ZA 1SQWA 1W2ZA 4FR9A 3I0YA 1RRLA 1N9EA 2IMJA 1WMOA 3QK9A 1VZZA 2FGTA 3X40A 3NV0B 4LGQA 3LMLA 3CXC2 1AV4A 3IJEB 2P0MA 3LT8A 1W5ZA 2ZDJA 1IQYA 4CCVA 2W56A 3HI7A 3CCE3 4N6UA 2R4IA 3NBBA 1IVXA 1E97A 2D42A 1BUQA 1NJI4 1EQKA 2PZVA 5G2GA 3DGMA 4FCMA 3V98A 1IU7A 1FGQA 2OCTA 4K90B 4QWTA 5BVBA 4FCJA 1OCVA 1G96A 2C10A 3MG2A 4N6NB 1KD14 4EBGA 3BNEA 1DVDA 1S723 5IG5A 3B4OA 2IUJA 1NWWA 5KP1A 1VQ93 5CF1A 2B24B 1Q864 3NX0A 5AIIA 1WTHA 1Q814 4H3UA 3LOYA 2BT3A 3SXXA 3DGOA 5IENA 2CHCA 1GD4A 2Q07A 1YIT3 3OW22 2W9QA 1EKMA 2XGNA 3PZWA 3SOAA 5AEWB 1K8A4 4N6TA 1VQL3 2WOFA 3F14A 1KWIA 3DMCA 1O7MB 1FGRA 1LNHA 4O8SA 1TFOA 3EBYA 1NB3I 2QIYA 3ROBA 3B7CA 1QJGA 3LZAA 3K0ZA 4EV2A 1SPUA 1OHOA 3OWYA 4GB5A 4N6MA 1U5OA 3G713 3LH4A 3MHEA 3FGYA 3CC73 1OHPA 1DYUA 1W6YA 3IPTA 3O8YA 1JKGA 1VQK3 3SLUA 3FF2A 1TIJA 2GU1A 3RDEA 2Y73A 3X42A 1K734 1W02A 3KSED 2L4VA 4KVHA 5IG4A 1TU5A 1RRHA 6STDA 2XSHB 1KQS2 3NM2A 1OHSA 2V1LA 1O7GB 3B8LA 1EA2A 5AEUB 2CC3A 5CF2A 1IVUA 3F7XA 1E3RA 3T8NA 1VQ53 3GAXA 2GEYA 4J9AA 3I553 3DUKA 2HMOB 3NUVA 3A76A 3OWUA 2RFRA 4X2OA 4FMAA 1N5PA 4HYZA 2OQEA 1ASKA 1IVVA 4RBNA 4L7KA 2C11A 2XF3A 3EHCA 1TFKA 1Q824 2OOVA 4HBRA 3G6E3 1KSIA 2FXTA 7STDA 3K5TA 1GYBA 3CCJ3 4FMBA 4WP5A 1L5GB 3FH1A 1WNHA 3F8XA 3JUNA 2CFKA 4R4KA 3CCS3 3AMOA 3CPW2 3S28A 2B1XB 3K7CA 1ULIB 3NQZA 1W7CA 2E2UA 2YX9A 2WGOA 3WA2X 3VGNA 2ZL8A 1O7NB 4JRFA 4WYKB 2CWUA 1YJ93 2XFSA 1UW1A 4LMIA 1IQ8A 4K1VA 1US1A 5IEOA 1M1XB 1OACA 4EV5A 4G1MB 4FMDA 1YIJ3 4HZBB 1CYVA 1IV9A 2HMKB 2UX0A 2ML6A 1RN7A 5FGOA 4MJDA 2P0XA 1FUWA 3GZYB 3BNCA 3NQYA 4HM3B 1W6CA 1IQXA 1SIIA 3FSDA 3FLJA 3KSPA 4FCZA 2OTL3 1V74A 2GEXA 2OQEC 1OGZA 1J2BA 1MOLA 5LC7A 4AKYA 4LSOA 1DMMA 2OOVC 2CFGA 5FW5A 1DMNA 3NV0A 3FKAA 5IF6A 3EB8A 3FZWA 3CPOA 1GY5A 1YVBI 3LTCA 1GY6A 4HKVB 1LVNA 3K63A 3LTDA 1ROAA 3PXMA 1FGMA 1KC84 1AVKA 1CEWI 1JV2B 4HM4B 4LZIA 5HGRA 3CU3A 4ORLA 1GY7A 2CKFB 2W6JH 1Q42A 2GU3A 4LEHA 4MMZB 4R1KA 1QVG2 2XR8B 2CW9A 3EQQB 2K54A 4BTYA 3VSYA 1N5HA 4KFDA 4L8OA 3GWRA 4PEJA 2JQ5A 1RKYA 3CCM3 1D6YA 1ISKA 3DY5A 3MG1A 3OV4A 3DZLA 1UUVB 3LTAA 1JN5A 3KN4A 4HM1B 3U97A 2KCDA 2W04A 5AIFA 4IIAA 1MNLA 2CWVA 2HMMB 4NREA 4BTWA 8CHOA 1IV7A 3H3HA 2RGQA 1N8R4 3WODG 4BTXA 2OTJ3 1YJN3 1M904 3X41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 3;  3CCS 3;  3CPW 2;  1W2B 2;  3CCL 3;  1YI2 3;  1VQ5 3;  3CC4 3;  1QVF 2;  1QVG 2;  1KD1 4;  1VQP 3;  1M90 4;  1VQ4 3;  3CME 3;  1S72 3;  3I55 3;  1KC8 4;  2OTL 3;  2QEX 3;  3CCU 3;  3CCV 3;  1YHQ 3;  1VQ9 3;  1Q86 4;  3CMA 3;  1VQ6 3;  3G71 3;  1Q81 4;  3CC2 3;  3CXC 2;  1VQM 3;  3CCM 3;  3CC7 3;  1VQK 3;  1YJ9 3;  3G4S 3;  1VQO 3;  3CCR 3;  1Q82 4;  1K73 4;  1YIT 3;  3OW2 2;  3G6E 3;  3CCE 3;  1K8A 4;  1M1K 4;  1VQ8 3;  1K9M 4;  1N8R 4;  1VQL 3;  1VQN 3;  1YIJ 3;  1KQS 2;  3CCJ 3;  1JJ2 2;  3CCQ 3;  3CD6 3;  1Q7Y 4;  2OTJ 3;  1NJI 4;  1VQ7 3;  3I56 3;  1YJN 3;  1YJW 3; 
#chains in the Genus database with same CATH topology
 4R9L A;  3V99 A;  4NPB A;  3LXU X;  1MWT A;  2W03 A;  2M7O A;  1R4C A;  1BNS A;  3CNM A;  1AR0 A;  4STD A;  1HKX A;  2QGU A;  2STD A;  3CMA 3;  4KT3 B;  2J8X B;  4ZM8 A;  3NXJ A;  4WWU C;  1HZ1 A;  2O3O A;  5RNT A;  5EQL A;  2F5M A;  3KZT A;  1B20 A;  1A67 A;  4LYL B;  1UUW B;  3T0U A;  4XDW A;  1M1K 4;  4KZ1 A;  3WDG B;  1MWS A;  4CDL A;  1QAL A;  2P09 A;  4HM8 B;  4BIR A;  1JJ2 2;  4KFF A;  1OGX A;  3GZB A;  1UCI A;  1OF5 B;  1VQ8 3;  1W6G A;  3M8C A;  1YJW 3;  2F4Y A;  1RCK A;  2RSX A;  3MSO A;  2CG1 A;  2YFJ B;  1ZX2 A;  1BNJ A;  1QVF 2;  3WA3 A;  3MG3 A;  4EC6 A;  3Q1C A;  3N54 B;  3J7Y d;  1A90 A;  1B2M A;  3JVC A;  1B27 A;  4CPK A;  1QAF A;  1BU4 A;  1I2G A;  1U8C B;  3SYU A;  2XFT A;  3ZG0 A;  2BMO B;  1BSE A;  2CFL A;  3UB1 A;  3G4S 3;  2KF3 A;  3EX9 A;  2CWT A;  1RGK A;  1JB2 A;  1AVL A;  2W9P A;  1UCJ A;  3FG1 A;  3VF1 A;  3X3Z A;  2IYJ A;  4H61 A;  3MPH A;  1B2U A;  1NU3 A;  5G1K A;  1IVW A;  3F7S A;  4KFE A;  3BND A;  1Q40 B;  1T3B A;  2BMR B;  1O7H B;  3NM7 A;  1W01 A;  3B4P A;  3ECF A;  5CLK A;  4AEQ A;  4XB5 A;  1CYU A;  2QEX 3;  3CCU 3;  3PYJ A;  5EEO A;  1YHQ 3;  1SJW A;  5G1L A;  2BHM A;  1YGW A;  3UL6 A;  4J8T A;  4WFO A;  3G8Z A;  1NO3 A;  3D3L A;  3URP A;  2KAA A;  2BIR A;  4K61 A;  2KXG A;  4RNY A;  3E99 A;  3GZR A;  3JUO A;  3OXA A;  1OH0 A;  3AHS A;  2WO0 A;  1RHL A;  4WYK A;  1TJD A;  7GSP A;  1VQN 3;  1ZS7 A;  3HIG A;  2XGL A;  5D81 A;  4AKZ A;  3GZX B;  1I0X A;  4HM6 B;  1I70 A;  3WOF B;  3NBJ A;  3CCQ 3;  3EF8 A;  1LXE A;  3I56 3;  1ROV A;  1A2V A;  4Q53 A;  3ALA A;  1BGS A;  4K1U A;  5JPU A;  1V57 A;  3CCL 3;  1W2B 2;  3JUM A;  3RGR A;  1BVI A;  1TRQ A;  1DVC A;  4OUQ A;  1FGO A;  1I3F A;  1MGR A;  4GL6 A;  4R9K A;  5IG0 A;  1OPY A;  2IA7 A;  5D83 A;  5EVH A;  3G0K A;  2LQV A;  4IPB A;  4XBT A;  2XSO B;  3UL5 A;  4O3V A;  3F40 A;  2KRT A;  4FMC A;  3S67 A;  5HOH A;  3PCR A;  3MYT A;  3BU4 A;  4N6O B;  1K9M 4;  6RNT A;  3KKG A;  5AI1 A;  2SBL A;  2ZHX B;  3PGB A;  1UGI A;  2INX A;  1RN1 A;  2R41 A;  1K28 A;  3BNB A;  4HZ9 B;  3NBR A;  1I0V A;  3X3Y A;  3Q90 A;  3EE1 A;  3TDG A;  1T2H A;  2Z7A A;  1LQM B;  5DRE A;  1RN4 A;  1STF I;  1K41 A;  1AY7 A;  1GS3 A;  1R4Y A;  2P38 A;  1D6U A;  1WMP A;  2CX0 A;  3BLZ A;  1N9J A;  4R80 A;  3SED A;  3S27 A;  2PNC A;  3CCV 3;  1VQ6 3;  1RNT A;  1ZO2 A;  4MEI A;  3ER7 A;  1WMN A;  4HAA A;  2W56 B;  3CNX A;  1W00 A;  4L8P A;  2HOH A;  3K9M C;  1BRH A;  1NNV A;  1VQO 3;  1F8N A;  4XDV A;  5KP3 A;  1B2Z A;  1RMS A;  3SOY A;  1X1U A;  2SAR A;  3X3X A;  1YGE A;  3EN1 B;  1IYY A;  1UCL A;  2CIU A;  3HOH A;  5IW9 A;  3DGY A;  5JPP A;  4N3V A;  5TGN A;  4O2H A;  5M1A A;  1LOX A;  2ML5 A;  3DXO A;  3QRD A;  4MMX B;  4O02 B;  9RNT A;  3JUQ A;  1DMQ A;  3FF0 A;  4TX4 A;  2QA4 3;  5IER A;  1ZGX A;  1I2E A;  3D9R A;  3FG3 A;  4BU4 A;  3PS8 A;  1VQ4 3;  5A0O B;  1I3I A;  2Z76 A;  1GD3 A;  1C7H A;  1JN5 B;  2HML B;  5CXO A;  1FZU A;  1LNI A;  1SAR A;  3G16 A;  1HU9 A;  1UCK A;  3MKI A;  3OX9 A;  4HM0 B;  3OWS A;  5IG3 A;  1JZD A;  1O7W B;  2GXF A;  1B2S A;  2I9W A;  1UUG B;  4GSP A;  4WHA A;  2RCD A;  1QAK A;  5KP4 A;  5ELJ A;  1IT8 A;  1BRJ A;  1W4N A;  3T8U A;  1PU4 A;  3WOE B;  2CH9 A;  3LTB A;  2LYX A;  3HK4 A;  2CK3 H;  3FG4 A;  4HJL B;  1B21 A;  2MF7 A;  3H51 A;  3EC9 A;  5DRV A;  1VQ7 3;  1STD A;  1E3V A;  2F99 A;  1EG9 B;  2XRX B;  1GMR A;  1OF5 A;  1Y4K A;  1NDO B;  4HM5 B;  5AIG A;  3AHW A;  5CK6 A;  1NB5 I;  3CME 3;  4IT7 A;  1BRN L;  1JKG B;  4N6V 0;  2Y74 A;  3CC2 3;  1G0T A;  1VQM 3;  1FGT A;  5STD A;  1MWR A;  1GOY A;  3DGN A;  3F9S A;  2CG0 A;  3PCS A;  5D82 A;  3CCR 3;  4BL3 A;  1CH0 A;  1CQS A;  4NHF A;  1ULJ B;  2W2C A;  1LOY A;  1RGH A;  4JF8 A;  1PYL A;  3LYG A;  4I4K A;  3NHX A;  3U1W A;  3SVA A;  3KII A;  1JNQ A;  3CD6 3;  5BXQ A;  2E2V A;  3UJM A;  1S5A A;  1FW7 A;  4U13 A;  2CX1 A;  2E2T A;  2Z6B A;  2CFD A;  2YFL B;  3F8H A;  4HVN A;  3WHO A;  1B3S A;  4EYC A;  5BIR A;  2MC8 A;  1JRQ A;  1O7P B;  1RJO A;  1IK3 A;  1Q40 A;  1Z1S A;  2F86 B;  1GMQ A;  1JB4 A;  5AIH A;  1GOV A;  2HMN B;  1DET A;  2XEP A;  2IUK A;  2XH9 A;  4HM7 B;  1BRI A;  3KE7 A;  5M19 A;  4J5K A;  3JUP A;  2A15 A;  3LT9 A;  4RZM A;  2D1W A;  1RCL A;  5IEP A;  4XBX A;  3UNL A;  2O9U X;  4J5G A;  5LC6 A;  1OUN A;  1IT7 A;  2WOH A;  1RLS A;  3EJV A;  3RGA A;  3Q2P A;  4XBY A;  2BU4 A;  3HZP A;  3STD A;  1X1W A;  3KFQ C;  3N8B A;  3AMO B;  4DKI A;  1Q7Y 4;  4CJN A;  2BNG A;  5AYR B;  1QMA A;  2BMQ B;  2HMJ B;  1I8V A;  5GSP A;  5ELU A;  1WQL B;  2RNT A;  2P05 A;  2GBW B;  2Z77 A;  3S29 A;  1BRG A;  2CFW A;  1VQP 3;  6GSP A;  5BU4 A;  1BSD A;  1BAN A;  1BNE A;  1SIH A;  3FCS B;  3HX8 A;  4EXR A;  5JBS A;  2GBX B;  3MWZ A;  1UI7 A;  1A2K A;  3IMA B;  4X2H A;  2YFI B;  3WMD A;  1PFP A;  3L0R A;  1T5Y A;  2F98 A;  3EN8 A;  1MWU A;  1BSC A;  2K0M A;  4OVM A;  2BO9 B;  1RGC A;  1TRP A;  3DGL A;  2WGQ A;  3SX1 A;  2OWP A;  3GRD A;  2FNQ A;  3N9H A;  4OK0 A;  2W0Q A;  3V92 A;  1TUH A;  4HM2 B;  1TP6 A;  2JDI H;  2AAE A;  3BB9 A;  3HII A;  1A2P A;  1JB5 A;  4RNZ A;  1FA3 A;  5I97 A;  3D4A A;  1IDP A;  4MMY B;  1M9G A;  4XM4 A;  3S5C A;  1UI8 A;  5AYS C;  4N6L A;  3DM8 A;  1N8Q A;  3EBT A;  1YI2 3;  3CC4 3;  1D6Z A;  4BL2 A;  4ILF A;  1SQW A;  1W2Z A;  3Q3F A;  3I0Y A;  1RRL A;  4FR9 A;  4I5Q A;  1N9E A;  2IMJ A;  2KF6 A;  1HYF A;  1WMO A;  3QK9 A;  1VZZ A;  1BNI A;  2FGT A;  3X40 A;  3ZFZ A;  3NV0 B;  4LGQ A;  3LML A;  3CXC 2;  1AV4 A;  1RSN A;  3IJE B;  2P0M A;  2RBI A;  3LT8 A;  1W5Z A;  2ZDJ A;  1IQY A;  4CCV A;  2W56 A;  3HI7 A;  1JBR A;  5M18 A;  3CCE 3;  4N6U A;  1X1Y A;  1FYS A;  2R4I A;  3D79 A;  1IVX A;  3NBB A;  4GHO A;  1E97 A;  2D42 A;  1BUQ A;  1NJI 4;  1EQK A;  2PZV A;  1BRK A;  5G2G A;  3DGM A;  4FCM A;  3V98 A;  1IU7 A;  3D5G A;  1FGQ A;  2OCT A;  4K90 B;  4QWT A;  5BVB A;  4FCJ A;  1OCV A;  1G96 A;  2C10 A;  3MG2 A;  4N6N B;  1KD1 4;  1YVS A;  4EBG A;  2KF4 A;  3BNE A;  1S72 3;  1DVD A;  5IG5 A;  3B4O A;  2IUJ A;  1NWW A;  5KP1 A;  1RTU A;  1LQG C;  1VQ9 3;  5CF1 A;  2B24 B;  1Q86 4;  2H0H A;  3NX0 A;  1Q9E A;  1WTH A;  5AII A;  3WR2 A;  1Q81 4;  4H3U A;  3LOY A;  2BT3 A;  1RGA A;  3SXX A;  4EW5 A;  3DGO A;  5IEN A;  1RDS A;  2CHC A;  1BSB A;  1GD4 A;  1MGW A;  2Q07 A;  3ZG5 A;  2W9Q A;  3OW2 2;  1YIT 3;  1EKM A;  1X1X A;  2XGN A;  3PZW A;  3SOA A;  5AEW B;  4N6T A;  1K8A 4;  1VQL 3;  2WOF A;  3F14 A;  1KWI A;  1V58 A;  3DMC A;  1O7M B;  1FGR A;  1LNH A;  4O8S A;  1TFO A;  1BAO A;  3EBY A;  1NB3 I;  8RNT A;  2QIY A;  3ROB A;  8CHO A;  1BRS A;  1VQQ A;  1BOX A;  1QJG A;  3B7C A;  3LZA A;  3K0Z A;  4EV2 A;  1SPU A;  1BNF A;  1OHO A;  1G02 A;  3OWY A;  4GB5 A;  1RGL A;  1U5O A;  4N6M A;  3G71 3;  3LH4 A;  3MHE A;  3FGY A;  3CC7 3;  1RNB A;  1OHP A;  1DYU A;  1W6Y A;  3IPT A;  3O8Y A;  1JKG A;  1VQK 3;  3SLU A;  1LOW A;  3FF2 A;  1TIJ A;  1YNV X;  2GU1 A;  3RDE A;  2Y73 A;  3X42 A;  1K73 4;  1W02 A;  3KSE D;  2L4V A;  3BIR A;  4KVH A;  5IG4 A;  1TU5 A;  1RRH A;  1B2X A;  6STD A;  2XSH B;  1KQS 2;  3NM2 A;  1OHS A;  2V1L A;  1O7G B;  1I2F A;  1EA2 A;  3B8L A;  5AEU B;  2CC3 A;  1T2I A;  1JZO A;  5CF2 A;  1IVU A;  3F7X A;  1E3R A;  2H0G A;  3T8N A;  2UGI A;  1VQ5 3;  3GAX A;  2GEY A;  1M90 4;  4J9A A;  3I55 3;  3DUK A;  1EEJ A;  2HMO B;  3NUV A;  3A76 A;  1C54 A;  3OWU A;  2RFR A;  4X2O A;  3D5I A;  4FMA A;  1N5P A;  4HYZ A;  2OQE A;  1ASK A;  1IVV A;  4RBN A;  4L7K A;  1EUI C;  2C11 A;  2XF3 A;  3EHC A;  1TFK A;  1Q82 4;  2OOV A;  1BSA A;  4HBR A;  3G6E 3;  1KSI A;  2FXT A;  7STD A;  1RGE A;  1JBS A;  3K5T A;  1GYB A;  3CCJ 3;  2UUG C;  4FMB A;  4WP5 A;  1L5G B;  3FH1 A;  1JBT A;  1WNH A;  3F8X A;  3JUN A;  2CFK A;  4R4K A;  3A5E A;  3AMO A;  3CCS 3;  3CPW 2;  3S28 A;  2B1X B;  2KF5 A;  3K7C A;  1ULI B;  3NQZ A;  1W7C A;  2E2U A;  2YX9 A;  1FUT A;  2WGO A;  3WA2 X;  3VGN A;  1TTO A;  1O7N B;  2H0I A;  2ZL8 A;  2AAD A;  4JRF A;  4WYK B;  2CWU A;  1RGF A;  1YJ9 3;  2XFS A;  1UW1 A;  4LMI A;  4RNT A;  1IQ8 A;  4K1V A;  1US1 A;  5IEO A;  1M1X B;  1OAC A;  4EV5 A;  1UDI I;  4G1M B;  3AGO A;  4FMD A;  1YIJ 3;  3KCH A;  7RNT A;  4HZB B;  1CYV A;  1IV9 A;  1BIR A;  2HMK B;  1FUS A;  2UX0 A;  2ML6 A;  1AQZ A;  1RN7 A;  1LRA A;  4MJD A;  5FGO A;  2IY2 A;  2P0X A;  1FUW A;  3GZY B;  2L1S A;  3BNC A;  3NQY A;  3DH2 A;  4HM3 B;  1W6C A;  1IQX A;  1SII A;  3FSD A;  3FLJ A;  3KSP A;  2F56 A;  4FCZ A;  2OTL 3;  1V74 A;  2GEX A;  2OQE C;  1OGZ A;  1J2B A;  1MOL A;  1DE3 A;  5LC7 A;  4AKY A;  4LSO A;  1DMM A;  2OOV C;  1Q7H A;  2CFG A;  5FW5 A;  1DMN A;  3NV0 A;  3FKA A;  5IF6 A;  3EB8 A;  3FZW A;  3CPO A;  1GY5 A;  1YVB I;  1GMP A;  1BNG A;  1GY6 A;  3LTC A;  4HKV B;  1GSP A;  1LVN A;  3K63 A;  3LTD A;  1PY3 A;  1ROA A;  2C4B A;  1FGM A;  3PXM A;  1KC8 4;  1AVK A;  1RGG A;  1CEW I;  1JV2 B;  4HM4 B;  4HOH A;  4LZI A;  2ZA4 A;  5HGR A;  3CU3 A;  4ORL A;  1GY7 A;  2CKF B;  2W6J H;  1Q42 A;  2GU3 A;  4LEH A;  4MMZ B;  4R1K A;  1QVG 2;  1BUJ A;  1BNR A;  2XR8 B;  2CW9 A;  2K3D A;  2K54 A;  1GOU A;  3EQQ B;  1LOV A;  3VSY A;  4BTY A;  1N5H A;  4KFD A;  4L8O A;  3GWR A;  4PEJ A;  2JQ5 A;  1RKY A;  3CCM 3;  1D6Y A;  1ISK A;  3DY5 A;  3MG1 A;  3AGN A;  3OV4 A;  3DZL A;  1UUV B;  2GSP A;  3GSP A;  3LTA A;  1JN5 A;  3KN4 A;  4HM1 B;  3U97 A;  2KCD A;  2W04 A;  1UGH I;  5AIF A;  4IIA A;  1MNL A;  2CWV A;  2HMM B;  4NRE A;  3RNT A;  4BTW A;  1IV7 A;  3H3H A;  2RGQ A;  1N8R 4;  3WOD G;  4BTX A;  2OTJ 3;  2F5W A;  1YJN 3;  3X41 A; 
#chains in the Genus database with same CATH homology
 4R9L A;  3LXU X;  2W03 A;  2M7O A;  1R4C A;  3CNM A;  1AR0 A;  4STD A;  1HKX A;  2QGU A;  2STD A;  3CMA 3;  4ZM8 A;  3NXJ A;  4WWU C;  2O3O A;  5EQL A;  3KZT A;  1A67 A;  1UUW B;  3T0U A;  4XDW A;  1M1K 4;  4KZ1 A;  3WDG B;  4CDL A;  1QAL A;  2P09 A;  4HM8 B;  1JJ2 2;  4KFF A;  1OGX A;  3GZB A;  1OF5 B;  1VQ8 3;  1W6G A;  3M8C A;  1YJW 3;  2RSX A;  3MSO A;  2CG1 A;  2YFJ B;  1ZX2 A;  1QVF 2;  3WA3 A;  3MG3 A;  4EC6 A;  3Q1C A;  3N54 B;  3J7Y d;  1A90 A;  3JVC A;  1QAF A;  1U8C B;  2XFT A;  2BMO B;  2CFL A;  3UB1 A;  3G4S 3;  3EX9 A;  2CWT A;  1JB2 A;  1AVL A;  2W9P A;  3FG1 A;  3VF1 A;  3X3Z A;  4H61 A;  3MPH A;  1NU3 A;  1IVW A;  3F7S A;  4KFE A;  3BND A;  1Q40 B;  2BMR B;  1O7H B;  3NM7 A;  1W01 A;  3B4P A;  3ECF A;  5CLK A;  4AEQ A;  4XB5 A;  1CYU A;  2QEX 3;  3CCU 3;  3PYJ A;  5EEO A;  1YHQ 3;  1SJW A;  2BHM A;  3UL6 A;  4J8T A;  4WFO A;  3G8Z A;  1NO3 A;  3D3L A;  4K61 A;  2KXG A;  4RNY A;  3E99 A;  3GZR A;  3JUO A;  3OXA A;  1OH0 A;  2WO0 A;  4WYK A;  1VQN 3;  3HIG A;  2XGL A;  5D81 A;  4AKZ A;  3GZX B;  3CCQ 3;  4HM6 B;  3WOF B;  3NBJ A;  3EF8 A;  1LXE A;  3I56 3;  1ROV A;  1A2V A;  4Q53 A;  3ALA A;  4K1U A;  5JPU A;  1W2B 2;  3CCL 3;  3JUM A;  3RGR A;  1DVC A;  4OUQ A;  1FGO A;  4GL6 A;  4R9K A;  5IG0 A;  1OPY A;  2IA7 A;  5D83 A;  5EVH A;  3G0K A;  2LQV A;  4IPB A;  4XBT A;  2XSO B;  3UL5 A;  4O3V A;  3F40 A;  2KRT A;  4FMC A;  3S67 A;  3PCR A;  3MYT A;  4N6O B;  1K9M 4;  3KKG A;  5AI1 A;  2SBL A;  3PGB A;  3BNB A;  2INX A;  1K28 A;  4HZ9 B;  3NBR A;  3X3Y A;  3Q90 A;  3EE1 A;  3TDG A;  2Z7A A;  5DRE A;  1STF I;  1K41 A;  1GS3 A;  2P38 A;  3BLZ A;  1D6U A;  1WMP A;  4R80 A;  3SED A;  1N9J A;  3CCV 3;  3S27 A;  2PNC A;  1VQ6 3;  1ZO2 A;  4MEI A;  3ER7 A;  1WMN A;  2W56 B;  3CNX A;  1W00 A;  4L8P A;  3K9M C;  1VQO 3;  1F8N A;  4XDV A;  5KP3 A;  3X3X A;  3SOY A;  1YGE A;  3EN1 B;  2CIU A;  5IW9 A;  5JPP A;  4N3V A;  5TGN A;  4O2H A;  1LOX A;  2ML5 A;  3DXO A;  3QRD A;  4MMX B;  4O02 B;  3JUQ A;  1DMQ A;  3FF0 A;  4TX4 A;  2QA4 3;  5IER A;  3D9R A;  3FG3 A;  3PS8 A;  1VQ4 3;  5A0O B;  2Z76 A;  1GD3 A;  1C7H A;  1JN5 B;  2HML B;  5CXO A;  3MKI A;  3G16 A;  3V99 A;  3OX9 A;  1HU9 A;  4HM0 B;  3OWS A;  5IG3 A;  1O7W B;  2GXF A;  2I9W A;  4WHA A;  2RCD A;  1QAK A;  5KP4 A;  5ELJ A;  1IT8 A;  3T8U A;  1W4N A;  1PU4 A;  3WOE B;  2CH9 A;  3LTB A;  2LYX A;  3HK4 A;  2CK3 H;  3FG4 A;  4HJL B;  2MF7 A;  3H51 A;  3EC9 A;  5DRV A;  1VQ7 3;  1STD A;  1E3V A;  2F99 A;  1EG9 B;  2XRX B;  1Y4K A;  1OF5 A;  4HM5 B;  1NDO B;  5AIG A;  1NB5 I;  5CK6 A;  3CME 3;  4IT7 A;  1JKG B;  4N6V 0;  2Y74 A;  3CC2 3;  1VQM 3;  1FGT A;  5STD A;  3F9S A;  3DGN A;  2CG0 A;  3PCS A;  5D82 A;  3CCR 3;  1CQS A;  4NHF A;  1ULJ B;  2W2C A;  4JF8 A;  3LYG A;  4I4K A;  3NHX A;  3U1W A;  3SVA A;  3KII A;  1JNQ A;  3CD6 3;  5BXQ A;  2E2V A;  3UJM A;  1S5A A;  4U13 A;  2E2T A;  2Z6B A;  2CFD A;  2YFL B;  3F8H A;  4HVN A;  4EYC A;  2MC8 A;  1JRQ A;  1O7P B;  1RJO A;  1IK3 A;  1Q40 A;  1Z1S A;  2F86 B;  1JB4 A;  5AIH A;  2HMN B;  2XEP A;  2XH9 A;  4HM7 B;  2IUK A;  3KE7 A;  3JUP A;  2A15 A;  3LT9 A;  4RZM A;  2D1W A;  5IEP A;  4XBX A;  3UNL A;  2O9U X;  5LC6 A;  1OUN A;  1IT7 A;  2WOH A;  3EJV A;  3RGA A;  3Q2P A;  4XBY A;  3HZP A;  3STD A;  3KFQ C;  3N8B A;  3AMO B;  1Q7Y 4;  2BNG A;  5AYR B;  1QMA A;  2BMQ B;  2HMJ B;  5ELU A;  1WQL B;  3S29 A;  2P05 A;  2GBW B;  2Z77 A;  2CFW A;  1VQP 3;  3HX8 A;  5JBS A;  1SIH A;  3FCS B;  4EXR A;  2GBX B;  3MWZ A;  1UI7 A;  1A2K A;  3IMA B;  4X2H A;  2YFI B;  3WMD A;  1PFP A;  3L0R A;  1T5Y A;  2F98 A;  3EN8 A;  2K0M A;  4OVM A;  2BO9 B;  3DGL A;  2WGQ A;  3SX1 A;  2OWP A;  3GRD A;  2FNQ A;  3N9H A;  4OK0 A;  2W0Q A;  3V92 A;  1TUH A;  4HM2 B;  1TP6 A;  2JDI H;  3BB9 A;  3HII A;  1JB5 A;  4RNZ A;  1FA3 A;  5I97 A;  1IDP A;  4MMY B;  1M9G A;  4XM4 A;  3S5C A;  1UI8 A;  5AYS C;  4N6L A;  3DM8 A;  1N8Q A;  3EBT A;  1YI2 3;  3CC4 3;  1D6Z A;  1SQW A;  1W2Z A;  4FR9 A;  3I0Y A;  1RRL A;  1N9E A;  2IMJ A;  1WMO A;  3QK9 A;  1VZZ A;  2FGT A;  3X40 A;  3NV0 B;  4LGQ A;  3LML A;  3CXC 2;  1AV4 A;  3IJE B;  2P0M A;  3LT8 A;  1W5Z A;  2ZDJ A;  1IQY A;  4CCV A;  2W56 A;  3HI7 A;  3CCE 3;  4N6U A;  2R4I A;  3NBB A;  1IVX A;  1E97 A;  2D42 A;  1BUQ A;  1NJI 4;  1EQK A;  2PZV A;  5G2G A;  3DGM A;  4FCM A;  3V98 A;  1IU7 A;  1FGQ A;  2OCT A;  4K90 B;  4QWT A;  5BVB A;  4FCJ A;  1OCV A;  1G96 A;  2C10 A;  3MG2 A;  4N6N B;  1KD1 4;  4EBG A;  3BNE A;  1DVD A;  1S72 3;  5IG5 A;  3B4O A;  2IUJ A;  1NWW A;  5KP1 A;  1VQ9 3;  5CF1 A;  2B24 B;  1Q86 4;  3NX0 A;  5AII A;  1WTH A;  1Q81 4;  4H3U A;  3LOY A;  2BT3 A;  3SXX A;  3DGO A;  5IEN A;  2CHC A;  1GD4 A;  2Q07 A;  1YIT 3;  3OW2 2;  2W9Q A;  1EKM A;  2XGN A;  3PZW A;  3SOA A;  5AEW B;  1K8A 4;  4N6T A;  1VQL 3;  2WOF A;  3F14 A;  1KWI A;  3DMC A;  1O7M B;  1FGR A;  1LNH A;  4O8S A;  1TFO A;  3EBY A;  1NB3 I;  2QIY A;  3ROB A;  3B7C A;  1QJG A;  3LZA A;  3K0Z A;  4EV2 A;  1SPU A;  1OHO A;  3OWY A;  4GB5 A;  4N6M A;  1U5O A;  3G71 3;  3LH4 A;  3MHE A;  3FGY A;  3CC7 3;  1OHP A;  1DYU A;  1W6Y A;  3IPT A;  3O8Y A;  1JKG A;  1VQK 3;  3SLU A;  3FF2 A;  1TIJ A;  2GU1 A;  3RDE A;  2Y73 A;  3X42 A;  1K73 4;  1W02 A;  3KSE D;  2L4V A;  4KVH A;  5IG4 A;  1TU5 A;  1RRH A;  6STD A;  2XSH B;  1KQS 2;  3NM2 A;  1OHS A;  2V1L A;  1O7G B;  3B8L A;  1EA2 A;  5AEU B;  2CC3 A;  5CF2 A;  1IVU A;  3F7X A;  1E3R A;  3T8N A;  1VQ5 3;  3GAX A;  2GEY A;  4J9A A;  3I55 3;  3DUK A;  2HMO B;  3NUV A;  3A76 A;  3OWU A;  2RFR A;  4X2O A;  4FMA A;  1N5P A;  4HYZ A;  2OQE A;  1ASK A;  1IVV A;  4RBN A;  4L7K A;  2C11 A;  2XF3 A;  3EHC A;  1TFK A;  1Q82 4;  2OOV A;  4HBR A;  3G6E 3;  1KSI A;  2FXT A;  7STD A;  3K5T A;  1GYB A;  3CCJ 3;  4FMB A;  4WP5 A;  1L5G B;  3FH1 A;  1WNH A;  3F8X A;  3JUN A;  2CFK A;  4R4K A;  3CCS 3;  3AMO A;  3CPW 2;  3S28 A;  2B1X B;  3K7C A;  1ULI B;  3NQZ A;  1W7C A;  2E2U A;  2YX9 A;  2WGO A;  3WA2 X;  3VGN A;  2ZL8 A;  1O7N B;  4JRF A;  4WYK B;  2CWU A;  1YJ9 3;  2XFS A;  1UW1 A;  4LMI A;  1IQ8 A;  4K1V A;  1US1 A;  5IEO A;  1M1X B;  1OAC A;  4EV5 A;  4G1M B;  4FMD A;  1YIJ 3;  4HZB B;  1CYV A;  1IV9 A;  2HMK B;  2UX0 A;  2ML6 A;  1RN7 A;  5FGO A;  4MJD A;  2P0X A;  1FUW A;  3GZY B;  3BNC A;  3NQY A;  4HM3 B;  1W6C A;  1IQX A;  1SII A;  3FSD A;  3FLJ A;  3KSP A;  4FCZ A;  2OTL 3;  1V74 A;  2GEX A;  2OQE C;  1OGZ A;  1J2B A;  1MOL A;  5LC7 A;  4AKY A;  4LSO A;  1DMM A;  2OOV C;  2CFG A;  5FW5 A;  1DMN A;  3NV0 A;  3FKA A;  5IF6 A;  3EB8 A;  3FZW A;  3CPO A;  1GY5 A;  1YVB I;  3LTC A;  1GY6 A;  4HKV B;  1LVN A;  3K63 A;  3LTD A;  1ROA A;  3PXM A;  1FGM A;  1KC8 4;  1AVK A;  1CEW I;  1JV2 B;  4HM4 B;  4LZI A;  5HGR A;  3CU3 A;  4ORL A;  1GY7 A;  2CKF B;  2W6J H;  1Q42 A;  2GU3 A;  4LEH A;  4MMZ B;  4R1K A;  1QVG 2;  2XR8 B;  2CW9 A;  3EQQ B;  2K54 A;  4BTY A;  3VSY A;  1N5H A;  4KFD A;  4L8O A;  3GWR A;  4PEJ A;  2JQ5 A;  1RKY A;  3CCM 3;  1D6Y A;  1ISK A;  3DY5 A;  3MG1 A;  3OV4 A;  3DZL A;  1UUV B;  3LTA A;  1JN5 A;  3KN4 A;  4HM1 B;  3U97 A;  2KCD A;  2W04 A;  5AIF A;  4IIA A;  1MNL A;  2CWV A;  2HMM B;  4NRE A;  4BTW A;  8CHO A;  1IV7 A;  3H3H A;  2RGQ A;  1N8R 4;  3WOD G;  4BTX A;  2OTJ 3;  1YJN 3;  1M90 4;  3X41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...