2ML6A

Nmr structure of protein zp_02069618.1 from bacteroides uniformis atcc 8492
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
148
structure length
148
Chain Sequence
GAEEEDFKTFLQKFTSSASFQYSRIKFPLKSPIALLKDDGETEQTFPFTREKWALLDEETLKEGRTTEEEGGTYISHFTVNEPAHKEFEAGYDESEPSLRVVFELTDGKWYVTDCYNDWYNFDLPINELEETIQAVQEENKAFEELHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of protein ZP_02069618.1 from Bacteroides uniformis ATCC 8492.
rcsb
source organism Bacteroides uniformis
molecule tags Structural genomics, unknown function
total genus 28
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.410 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ml6A00
2ML6A 4R4KA 2ML5A
chains in the Genus database with same CATH superfamily
4XDVA 1LQMB 1TFKA 1RGHA 1BRJA 1VQ63 2B24B 1TRPA 1DMNA 1W4NA 2GEYA 3HIGA 3LTCA 1B2XA 1NU3A 1QAFA 5AIFA 1WNHA 3G0KA 3LT9A 1EA2A 1SIHA 3AGNA 4FMBA 1K41A 3WA2X 1LOWA 1M1K4 1DVDA 1B20A 3U1WA 3SX1A 5A0OB 3EN8A 2P38A 2CX1A 2GU3A 3X41A 3OWUA 3ZG5A 2KF6A 1VQM3 2BMQB 5DREA 1U8CB 1TRQA 1IV7A 1QMAA 3FKAA 1SQWA 4I4KA 5ELUA 3LOYA 8RNTA 1RGFA 3CC73 1MNLA 3VSYA 3QK9A 5CF1A 4IIAA 1GOVA 3WODG 1GSPA 4HM8B 1N5HA 1BSDA 1LOYA 1IQ8A 1RRLA 2M7OA 1IVVA 3EN1B 3I553 5AI1A 1UCLA 1I2FA 5CF2A 3PYJA 1KC84 5AEWB 3U97A 3EJVA 1EKMA 4LEHA 5D83A 3JUPA 7RNTA 3AHSA 3RGRA 2IYJA 4WHAA 3FG4A 1OUNA 4N6V0 1LOVA 3MHEA 4RZMA 1RLSA 2CFWA 2JQ5A 3HOHA 2YFIB 3BNCA 1J2BA 3GZYB 2OWPA 4KFFA 1A90A 3UL6A 5M18A 3OWSA 3HIIA 3E99A 1CEWI 1GS3A 1GD3A 1NNVA 3DGOA 2W9QA 1A2PA 1BANA 1T2HA 3FG3A 3CME3 1VQN3 4XB5A 1EEJA 3MYTA 3M8CA 1B2SA 3GAXA 3MG2A 2P0MA 1VQ43 1BSBA 2C11A 3LZAA 3K63A 4STDA 1BRNL 3DGYA 3G16A 1NB5I 1M9GA 3LT8A 3B8LA 3WDGB 1W5ZA 4N6TA 4O3VA 2RBIA 5AIGA 3MWZA 1BRHA 3AHWA 1GYBA 5IG3A 4HM3B 2YX9A 2CKFB 4GB5A 3X3ZA 1GY5A 1K734 3CXC2 1BNSA 1RN7A 4H3UA 1JB2A 2F5MA 3ROBA 3OXAA 1YJW3 3CCV3 3OV4A 5G1KA 3DXOA 1B2MA 4WP5A 2UGIA 4NHFA 5LC7A 1D6UA 2KXGA 2RSXA 4GSPA 1MGWA 3UB1A 3HI7A 2Y74A 4U13A 3URPA 5IF6A 2CWTA 3AGOA 3IMAB 1FZUA 1X1WA 3NM2A 3Q90A 2GBXB 4IPBA 4KVHA 1LNHA 3LTAA 3SOYA 1NB3I 4LYLB 8CHOA 5M19A 1VQK3 1Q824 1IVXA 2XH9A 1ZGXA 5KP1A 3D5IA 1N9JA 3G4S3 1JJ22 1IK3A 1C54A 3DZLA 1SPUA 2CX0A 5AIHA 5JPUA 3PCSA 3MKIA 2WGOA 3BNBA 1SJWA 3PS8A 1RDSA 2XEPA 3PCRA 4N6MA 1PY3A 4ZM8A 1O7GB 2E2TA 4IT7A 1W2B2 1W02A 1PFPA 3DMCA 2CFLA 2BHMA 1T5YA 1UI8A 1UW1A 1BAOA 2HMJB 1YNVX 3GZRA 4O2HA 1LQGC 2KF5A 3KFQC 4X2HA 5RNTA 3IJEB 1IU7A 1CYUA 3JUNA 3IPTA 2KAAA 3BB9A 3KSED 3ZFZA 1ULJB 2MF7A 2RFRA 1BNGA 3B7CA 1TFOA 2H0GA 1JB4A 3EX9A 4OVMA 2Z7AA 3MG1A 1Q814 2SARA 1AR0A 2XR8B 5D82A 4BU4A 2Y73A 5IEOA 1OPYA 1G0TA 5AIIA 4EXRA 1RSNA 2XF3A 3NV0A 4KFEA 1RRHA 2W2CA 1GY7A 1BVIA 3K7CA 5BU4A 1KQS2 3I0YA 1PU4A 2INXA 2W04A 3JUQA 1TTOA 3NX0A 1LRAA 2CK3H 1AV4A 2CH9A 4K61A 1TP6A 4HJLB 4QWTA 3JUOA 1OHPA 4RNZA 1BRSA 1HZ1A 1I0VA 2WGQA 1VQQA 3F14A 4EYCA 1OHOA 2HMLB 4FMCA 2STDA 4MMYB 1VQ73 4BL3A 6GSPA 1JBRA 2CC3A 3PGBA 3SXXA 1MOLA 1FGTA 4J9AA 4O8SA 3D5GA 3BLZA 1IQYA 1BGSA 4CJNA 1UUWB 4HYZA 2CWUA 3S5CA 1K8A4 1JN5B 2B1XB 3JUMA 2WOFA 1FA3A 3NBBA 4CDLA 3H51A 1KSIA 1NJI4 2OTJ3 1W01A 1ISKA 1OGZA 2E2UA 1I2GA 4Q53A 2ZA4A 2F5WA 3A76A 5G2GA 4L8OA 5HGRA 1QVF2 3A5EA 2F86B 5IG4A 3HK4A 1O7PB 1Q42A 1GMRA 3NV0B 1N9EA 2F99A 3F7XA 4HM4B 4MJDA 5EEOA 7GSPA 5HOHA 2ML5A 1STDA 4EV2A 1OGXA 2YFLB 1Z1SA 2KF4A 2F98A 5CK6A 1QJGA 1B2UA 2FNQA 2HMOB 3WMDA 2P0XA 3KE7A 5KP3A 3DH2A 1UCJA 1QALA 1R4CA 3X3XA 3K0ZA 1L5GB 3T8NA 1ZO2A 4RNTA 4G1MB 1E3RA 7STDA 2HMNB 1BNJA 3V92A 3NM7A 4BIRA 3WA3A 2CFGA 2CWVA 2KCDA 4FCZA 4EC6A 2R41A 2XRXB 3NHXA 4XBYA 2V1LA 1GY6A 3F9SA 1GD4A 2XGNA 1UCIA 1S723 3DGMA 1Q7Y4 3BNDA 1KWIA 3D9RA 1EQKA 4HBRA 1WMNA 2CG0A 5IG5A 4L7KA 2FXTA 4HOHA 3EF8A 1JV2B 1HYFA 4BL2A 3H3HA 3F40A 1RKYA 1SARA 5ELJA 5IERA 1X1YA 2W0QA 3K5TA 2CFKA 1IT7A 4FCJA 1DETA 1EUIC 1FYSA 2XSOB 1DYUA 1YI23 2L1SA 3SOAA 5EQLA 1JZDA 3CMA3 2XSHB 3EQQB 1IYYA 3OX9A 2W03A 2ZDJA 2Q07A 3EBYA 3GWRA 4HM6B 1UGHI 3EB8A 5EVHA 1O7HB 1Q40A 2QGUA 2RCDA 3MPHA 2ZL8A 1ROVA 4N6OB 5G1LA 4HM7B 3Q2PA 3BU4A 5IENA 1W2ZA 4BTXA 3G713 3LTDA 1LVNA 4XBTA 1MWTA 1FGMA 3D79A 1WQLB 3EE1A 4FCMA 3UL5A 2D42A 1A2VA 3CCL3 2JDIH 4GL6A 1ROAA 3BIRA 4HM2B 5IEPA 1JB5A 3FG1A 4WYKB 2MC8A 1KD14 3ALAA 2IA7A 3V99A 3KIIA 2Z76A 4XM4A 1FUSA 1BOXA 1B3SA 1V58A 3FLJA 2Z77A 4R1KA 2KF3A 3N8BA 2RNTA 4AKZA 2H0HA 2BO9B 4HZ9B 1MWSA 2AAEA 1UUVB 4KZ1A 1RTUA 4WFOA 3SLUA 1TU5A 1TUHA 1BSEA 2D1WA 3MSOA 5BVBA 5KP4A 2BMOB 3EBTA 4EW5A 1LNIA 3NQYA 1YVSA 2E2VA 1UI7A 4FMDA 1YIT3 2AADA 1Q40B 3I563 2W56A 2IY2A 2WO0A 3CPW2 1A67A 4EV5A 1AVLA 3UJMA 1JN5A 1M904 2W9PA 1RCLA 1N5PA 1RGKA 3FF2A 1RCKA 2BIRA 3F8HA 3WR2A 2CHCA 4MEIA 5LC6A 3ECFA 5IW9A 2O3OA 1W6GA 2IUKA 2O9UX 3CCE3 1W6CA 3FSDA 4GHOA 1BSCA 1K28A 1I2EA 1NDOB 3SEDA 5JBSA 4RBNA 3K9MC 5FGOA 3AMOB 1E97A 5FW5A 5JPPA 1VQO3 3CC43 4EBGA 1WMPA 3FH1A 3BNEA 3EHCA 1S5AA 5TGNA 1GMPA 2OTL3 1RN4A 1AQZA 4MMXB 1RGEA 2IMJA 5AEUB 1BUJA 1RNTA 1IV9A 3CCR3 2RGQA 3L0RA 1BRGA 2YFJB 1YHQ3 2K54A 4PEJA 1VQ93 3O8YA 3CCU3 1IQXA 4MMZB 1D6ZA 3WOEB 2W56B 1UCKA 1T2IA 1W00A 2R4IA 1QVG2 1B27A 1FUTA 5GSPA 1BU4A 1IT8A 1DMQA 3NBRA 4J8TA 4N6NB 4XBXA 3VGNA 1IVWA 1MWUA 1Y4KA 4X2OA 1W6YA 1CYVA 1JNQA 1HU9A 4RNYA 1BNIA 1LOXA 2HOHA 2P09A 2CW9A 3OWYA 1RGCA 1BNEA 2UUGC 3CU3A 1DE3A 1X1XA 9RNTA 2C10A 3DUKA 2QA43 1O7MB 3Q1CA 4O02B 5BIRA 3F7SA 1RNBA 1NO3A 1M1XB 3PXMA 1D6YA 1I70A 1NWWA 1EG9B 3KSPA 3DM8A 3GRDA 5I97A 3LXUX 1VQL3 3V98A 2CG1A 1B21A 4LGQA 4HM1B 2W6JH 4FR9A 4ILFA 3FZWA 1US1A 1JBTA 1CH0A 1BUQA 1ZS7A 3HX8A 4OK0A 4R4KA 3NUVA 3S27A 3T8UA 3F8XA 1X1UA 3X42A 3KN4A 3GZXB 1GOUA 3OW22 1RGLA 1F8NA 3CPOA 1BRKA 1YVBI 3B4PA 1BNFA 1MGRA 4K1VA 1JKGA 1OF5A 2K3DA 3DY5A 1JRQA 4OUQA 3Q3FA 1LXEA 3ER7A 1IVUA 1BIRA 1O7NB 2OCTA 3CC23 1FGRA 2PZVA 3PZWA 3CCM3 1FUWA 3LYGA 2GEXA 4H61A 5AYRB 3X3YA 1YJN3 2GU1A 3CNXA 4N3VA 3D4AA 1B2ZA 1OACA 1YJ93 3DGLA 2LYXA 4AKYA 3N9HA 4JF8A 4WYKA 1WTHA 4N6UA 3CNMA 4N6LA 3CCS3 1RJOA 3MG3A 2BU4A 1PYLA 2BT3A 4BTWA 1Q7HA 3RNTA 2XFSA 2BNGA 1Q9EA 1GMQA 2I9WA 4BTYA 1BRIA 1AVKA 1DVCA 3UNLA 2QEX3 1BNRA 1RGGA 1ULIB 3J7Yd 1G02A 5BXQA 3S67A 6STDA 3FCSB 1OCVA 1VZZA 1U5OA 5CXOA 3B4OA 4L8PA 1UUGB 2GSPA 2LQVA 4HZBB 1R4YA 4WWUC 2F4YA 1JKGB 1OF5B 2BMRB 4LSOA 4R80A 3D3LA 1MWRA 1N8QA 1JBSA 2H0IA 3QRDA 1E3VA 1UGIA 2F56A 1ASKA 1V74A 1I0XA 1BSAA 4TX4A 1WMOA 3NQZA 4K90B 4NPBA 4DKIA 3RDEA 4J5KA 2KRTA 4KT3B 1YGWA 2ML6A 1N8R4 5STDA 3T0UA 3S28A 4LMIA 5AYSC 3CCQ3 3AMOA 3LMLA 3VF1A 1G96A 2XGLA 3SYUA 1RMSA 4JRFA 3SVAA 3CD63 2GBWB 2WOHA 1Q864 1I3FA 4HM0B 1I8VA 1AY7A 4HVNA 1OH0A 1SIIA 4R9KA 2P05A 2UX0A 3HZPA 4KFDA 4LZIA 5M1AA 1OHSA 3X40A 2A15A 2HMMB 4R9LA 3STDA 4CCVA 4XDWA 3KCHA 3KZTA 4HM5B 3G6E3 1TIJA 3EC9A 2SBLA 4FMAA 1FW7A 2Z6BA 4HAAA 3S29A 2OOVA 3RGAA 1VQ83 1ZX2A 1A2KA 2L4VA 1UDII 1VQP3 1O7WB 1FGOA 1HKXA 1RHLA 1YGEA 4AEQA 4CPKA 3DGNA 1RN1A 3CCJ3 2ZHXB 4J5GA 1C7HA 6RNTA 1K9M4 2QIYA 4ORLA 2OQEA 5IG0A 2OOVC 2J8XB 1IDPA 3FF0A 3KKGA 5CLKA 3N54B 1QAKA 3ZG0A 3NBJA 2K0MA 1STFI 1V57A 1TJDA 3GSPA 2PNCA 3JVCA 2HMKB 3WOFB 1I3IA 2XFTA 2IUJA 1DMMA 2OQEC 3LH4A 1CQSA 2C4BA 4I5QA 3TDGA 3WHOA 3NXJA 1FGQA 1GOYA 1YIJ3 4HKVB 1T3BA 4K1UA 4NREA 5DRVA 2GXFA 1JZOA 1VQ53 3GZBA 2FGTA 3FGYA 1RGAA 3LTBA 5D81A 1W7CA 2CFDA 3G8ZA 2CIUA
chains in the Genus database with same CATH topology
4XDVA 1TFKA 1VQ63 2B24B 1W4NA 1DMNA 2GEYA 3HIGA 3LTCA 1NU3A 1QAFA 5AIFA 1WNHA 3G0KA 3LT9A 1EA2A 1SIHA 4FMBA 1K41A 3WA2X 1M1K4 1DVDA 3U1WA 3SX1A 5A0OB 3EN8A 2P38A 2GU3A 3X41A 3OWUA 1VQM3 2BMQB 5DREA 1U8CB 1IV7A 1QMAA 3FKAA 1SQWA 4I4KA 5ELUA 3LOYA 3CC73 1MNLA 3VSYA 3QK9A 5CF1A 4IIAA 3WODG 4HM8B 1N5HA 1IQ8A 1RRLA 2M7OA 1IVVA 3EN1B 3I553 5AI1A 5CF2A 3PYJA 1KC84 5AEWB 3U97A 3EJVA 1EKMA 4LEHA 5D83A 3JUPA 3RGRA 4WHAA 3FG4A 1OUNA 4N6V0 3MHEA 4RZMA 2CFWA 2JQ5A 2YFIB 3BNCA 1J2BA 3GZYB 2OWPA 4KFFA 1A90A 3UL6A 3OWSA 3HIIA 3E99A 1CEWI 1GS3A 1GD3A 3DGOA 2W9QA 3FG3A 3CME3 1VQN3 4XB5A 3MYTA 3M8CA 3GAXA 3MG2A 2P0MA 1VQ43 2C11A 3LZAA 3K63A 4STDA 3G16A 1NB5I 1M9GA 3LT8A 3B8LA 3WDGB 1W5ZA 4N6TA 4O3VA 5AIGA 3MWZA 5IG3A 1GYBA 4HM3B 2YX9A 2CKFB 4GB5A 3X3ZA 1GY5A 1K734 3CXC2 1RN7A 4H3UA 1JB2A 3ROBA 3OXAA 1YJW3 3CCV3 3OV4A 3DXOA 4WP5A 4NHFA 5LC7A 1D6UA 2KXGA 2RSXA 3UB1A 3HI7A 2Y74A 4U13A 5IF6A 2CWTA 3IMAB 3NM2A 3Q90A 4IPBA 2GBXB 4KVHA 1LNHA 3LTAA 3SOYA 1NB3I 8CHOA 1VQK3 1Q824 1IVXA 2XH9A 5KP1A 1N9JA 3G4S3 1JJ22 1IK3A 3DZLA 1SPUA 5AIHA 5JPUA 3PCSA 3MKIA 2WGOA 3BNBA 1SJWA 3PS8A 2XEPA 3PCRA 4N6MA 4ZM8A 2E2TA 1O7GB 4IT7A 1W2B2 1W02A 1PFPA 3DMCA 2CFLA 2BHMA 1T5YA 1UI8A 1UW1A 2HMJB 3GZRA 4O2HA 5FW5A 4X2HA 3KFQC 3IJEB 1IU7A 1CYUA 3JUNA 3IPTA 3BB9A 3KSED 1ULJB 2MF7A 2RFRA 3B7CA 1TFOA 1JB4A 3EX9A 4OVMA 2Z7AA 3MG1A 1Q814 1AR0A 2XR8B 5D82A 2Y73A 5IEOA 1OPYA 4EXRA 5AIIA 2XF3A 3NV0A 4KFEA 1RRHA 2W2CA 1GY7A 3K7CA 1KQS2 3I0YA 1PU4A 2INXA 2W04A 3JUQA 3NX0A 2CK3H 1AV4A 2CH9A 4K61A 1TP6A 4HJLB 4QWTA 3JUOA 1OHPA 4RNZA 2WGQA 3F14A 4EYCA 1OHOA 2HMLB 4FMCA 2STDA 4MMYB 2CC3A 3PGBA 3SXXA 1MOLA 1FGTA 4J9AA 4O8SA 3BLZA 1IQYA 1UUWB 4HYZA 2CWUA 3S5CA 1K8A4 1JN5B 2B1XB 3JUMA 2WOFA 1FA3A 3NBBA 4CDLA 3H51A 1KSIA 1NJI4 2OTJ3 1W01A 1ISKA 1OGZA 2E2UA 4Q53A 5G2GA 3A76A 4L8OA 5HGRA 1QVF2 2F86B 5IG4A 3HK4A 1O7PB 1Q42A 3NV0B 1N9EA 2F99A 3F7XA 4HM4B 4MJDA 5EEOA 2ML5A 1STDA 4EV2A 1OGXA 2YFLB 1Z1SA 2F98A 5CK6A 1QJGA 2HMOB 2FNQA 3WMDA 2P0XA 3KE7A 5KP3A 1QALA 1R4CA 3X3XA 3K0ZA 1L5GB 3T8NA 1ZO2A 4G1MB 1E3RA 7STDA 2HMNB 3V92A 3NM7A 3WA3A 2CFGA 2CWVA 2KCDA 4FCZA 4EC6A 3NHXA 2XRXB 4XBYA 2V1LA 1GY6A 3F9SA 1GD4A 2XGNA 1S723 3DGMA 1Q7Y4 3BNDA 1KWIA 3D9RA 1EQKA 4HBRA 1WMNA 2CG0A 5IG5A 4L7KA 2FXTA 3EF8A 1JV2B 3H3HA 3F40A 1RKYA 5ELJA 5IERA 2W0QA 3K5TA 2CFKA 1IT7A 4FCJA 1YI23 2XSOB 1DYUA 3SOAA 5EQLA 3CMA3 2XSHB 3EQQB 3OX9A 2W03A 2ZDJA 2Q07A 3EBYA 3GWRA 4HM6B 5EVHA 3EB8A 1O7HB 1Q40A 2QGUA 2RCDA 3MPHA 2ZL8A 1ROVA 4N6OB 4HM7B 3Q2PA 5IENA 1W2ZA 4BTXA 2CIUA 3G713 3LTDA 1LVNA 4XBTA 1FGMA 3EE1A 1WQLB 3CCL3 4FCMA 3UL5A 2D42A 1A2VA 2JDIH 4GL6A 1ROAA 4HM2B 5IEPA 1JB5A 3FG1A 4WYKB 2MC8A 1KD14 3ALAA 2IA7A 3V99A 3KIIA 2Z76A 4XM4A 3FLJA 2Z77A 4R1KA 3N8BA 4AKZA 2BO9B 4HZ9B 4KZ1A 1UUVB 4WFOA 3SLUA 1TU5A 1TUHA 2D1WA 5BVBA 3MSOA 5KP4A 2BMOB 3EBTA 3NQYA 2E2VA 1UI7A 4FMDA 1YIT3 1Q40B 3I563 2W56A 2WO0A 3CPW2 1A67A 4EV5A 1AVLA 3UJMA 1JN5A 1M904 2W9PA 1N5PA 3FF2A 3F8HA 2CHCA 4MEIA 5LC6A 3ECFA 5IW9A 2O3OA 1W6GA 2IUKA 2O9UX 3CCE3 1W6CA 3FSDA 1K28A 1NDOB 3SEDA 5JBSA 4RBNA 3K9MC 5FGOA 3AMOB 1E97A 5JPPA 1VQO3 3CC43 4EBGA 1WMPA 3FH1A 3BNEA 3EHCA 1S5AA 5TGNA 2OTL3 4MMXB 2IMJA 5AEUB 1IV9A 3CCR3 2RGQA 3L0RA 2YFJB 1YHQ3 2K54A 4PEJA 1VQ93 3O8YA 3CCU3 1IQXA 4MMZB 1D6ZA 3WOEB 2W56B 1W00A 2R4IA 1QVG2 4N6NB 1IT8A 1DMQA 3NBRA 4J8TA 4XBXA 3VGNA 1IVWA 1Y4KA 4X2OA 1W6YA 1CYVA 1JNQA 1HU9A 4RNYA 1LOXA 2P09A 2CW9A 3OWYA 3CU3A 2C10A 3DUKA 2QA43 1O7MB 3Q1CA 4O02B 3F7SA 1NO3A 1M1XB 3PXMA 1D6YA 3KSPA 1NWWA 1EG9B 5I97A 3DM8A 3GRDA 3LXUX 1VQL3 3V98A 2CG1A 4LGQA 4HM1B 2W6JH 4FR9A 1BUQA 3FZWA 1US1A 3HX8A 4OK0A 4R4KA 3NUVA 3S27A 3T8UA 3F8XA 3X42A 3KN4A 3GZXB 3OW22 1F8NA 3CPOA 4K1VA 1YVBI 3B4PA 1JKGA 1OF5A 3DY5A 1JRQA 4OUQA 1LXEA 3ER7A 1IVUA 2OCTA 1O7NB 3CC23 1FGRA 2PZVA 3PZWA 3CCM3 1FUWA 3LYGA 2GEXA 4H61A 5AYRB 3X3YA 1YJN3 2GU1A 3CNXA 4N3VA 1OACA 1YJ93 3DGLA 2LYXA 4AKYA 3N9HA 4JF8A 4WYKA 1WTHA 4N6UA 3CNMA 4N6LA 3CCS3 1RJOA 3MG3A 2BT3A 4BTWA 2XFSA 2BNGA 2I9WA 4BTYA 2QEX3 1AVKA 1DVCA 3UNLA 1ULIB 3J7Yd 5BXQA 3S67A 6STDA 3FCSB 1OCVA 1VZZA 1U5OA 5CXOA 3B4OA 4L8PA 2LQVA 4HZBB 4WWUC 1JKGB 1OF5B 2BMRB 4LSOA 4R80A 3D3LA 1N8QA 3QRDA 1E3VA 1ASKA 1V74A 4TX4A 1WMOA 3NQZA 4K90B 3RDEA 2KRTA 1N8R4 2ML6A 5STDA 3T0UA 3S28A 4LMIA 5AYSC 3CCQ3 3AMOA 3LMLA 3VF1A 1G96A 2XGLA 4JRFA 3SVAA 3CD63 2GBWB 2WOHA 1Q864 4HM0B 4HVNA 1OH0A 1SIIA 4R9KA 2P05A 2UX0A 3HZPA 4KFDA 4LZIA 1OHSA 3X40A 2A15A 2HMMB 4R9LA 3STDA 4CCVA 4XDWA 3KZTA 4HM5B 3G6E3 1TIJA 3EC9A 2SBLA 4FMAA 2Z6BA 3S29A 2OOVA 3RGAA 1VQ83 1ZX2A 1A2KA 2L4VA 1VQP3 1O7WB 1FGOA 1HKXA 1YGEA 4AEQA 3DGNA 3CCJ3 1C7HA 1K9M4 2QIYA 4ORLA 2OQEA 5IG0A 2OOVC 5CLKA 1IDPA 3FF0A 3KKGA 3N54B 1QAKA 3NBJA 2K0MA 1STFI 3JVCA 3WOFB 1VQ73 2PNCA 2HMKB 2XFTA 2IUJA 1DMMA 2OQEC 3LH4A 1CQSA 3TDGA 3NXJA 1FGQA 1YIJ3 4HKVB 4K1UA 4NREA 5DRVA 2GXFA 1VQ53 3GZBA 2FGTA 3FGYA 3LTBA 5D81A 1W7CA 3G8ZA 2CFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ML6 A;  4R4K A;  2ML5 A; 
#chains in the Genus database with same CATH topology
 4XDV A;  1LQM B;  1TFK A;  1RGH A;  1BRJ A;  1VQ6 3;  2B24 B;  1TRP A;  1DMN A;  1W4N A;  2GEY A;  3HIG A;  3LTC A;  1B2X A;  1NU3 A;  1QAF A;  5AIF A;  1WNH A;  3G0K A;  3LT9 A;  1EA2 A;  1SIH A;  3AGN A;  4FMB A;  1K41 A;  3WA2 X;  1LOW A;  1M1K 4;  1DVD A;  1B20 A;  3U1W A;  3SX1 A;  5A0O B;  3EN8 A;  2P38 A;  2CX1 A;  2GU3 A;  3X41 A;  3OWU A;  3ZG5 A;  2KF6 A;  1VQM 3;  2BMQ B;  5DRE A;  1U8C B;  1TRQ A;  1IV7 A;  1QMA A;  3FKA A;  1SQW A;  4I4K A;  5ELU A;  3LOY A;  8RNT A;  1RGF A;  3CC7 3;  1MNL A;  3VSY A;  3QK9 A;  5CF1 A;  4IIA A;  1GOV A;  3WOD G;  1GSP A;  4HM8 B;  1N5H A;  1BSD A;  1LOY A;  1IQ8 A;  1RRL A;  2M7O A;  1IVV A;  3EN1 B;  3I55 3;  5AI1 A;  1UCL A;  1I2F A;  5CF2 A;  3PYJ A;  1KC8 4;  5AEW B;  3U97 A;  3EJV A;  1EKM A;  4LEH A;  5D83 A;  3JUP A;  7RNT A;  3AHS A;  3RGR A;  2IYJ A;  4WHA A;  3FG4 A;  1OUN A;  4N6V 0;  1LOV A;  3MHE A;  4RZM A;  1RLS A;  2CFW A;  2JQ5 A;  3HOH A;  2YFI B;  3BNC A;  1J2B A;  3GZY B;  2OWP A;  4KFF A;  1A90 A;  3UL6 A;  5M18 A;  3OWS A;  3HII A;  3E99 A;  1CEW I;  1GS3 A;  1GD3 A;  1NNV A;  3DGO A;  2W9Q A;  1A2P A;  1BAN A;  1T2H A;  3FG3 A;  3CME 3;  1VQN 3;  4XB5 A;  1EEJ A;  3MYT A;  3M8C A;  1B2S A;  3GAX A;  3MG2 A;  2P0M A;  1VQ4 3;  1BSB A;  2C11 A;  3LZA A;  3K63 A;  4STD A;  1BRN L;  3DGY A;  3G16 A;  1NB5 I;  1M9G A;  3LT8 A;  3B8L A;  3WDG B;  1W5Z A;  4N6T A;  4O3V A;  2RBI A;  5AIG A;  3MWZ A;  1BRH A;  3AHW A;  1GYB A;  5IG3 A;  4HM3 B;  2YX9 A;  2CKF B;  4GB5 A;  3X3Z A;  1GY5 A;  1K73 4;  3CXC 2;  1BNS A;  1RN7 A;  4H3U A;  1JB2 A;  2F5M A;  3ROB A;  3OXA A;  1YJW 3;  3CCV 3;  3OV4 A;  5G1K A;  3DXO A;  1B2M A;  4WP5 A;  2UGI A;  4NHF A;  5LC7 A;  1D6U A;  2KXG A;  2RSX A;  4GSP A;  1MGW A;  3UB1 A;  3HI7 A;  2Y74 A;  4U13 A;  3URP A;  5IF6 A;  2CWT A;  3AGO A;  3IMA B;  1FZU A;  1X1W A;  3NM2 A;  3Q90 A;  2GBX B;  4IPB A;  4KVH A;  1LNH A;  3LTA A;  3SOY A;  1NB3 I;  4LYL B;  8CHO A;  5M19 A;  1VQK 3;  1Q82 4;  1IVX A;  2XH9 A;  1ZGX A;  5KP1 A;  3D5I A;  1N9J A;  3G4S 3;  1JJ2 2;  1IK3 A;  1C54 A;  3DZL A;  1SPU A;  2CX0 A;  5AIH A;  5JPU A;  3PCS A;  3MKI A;  2WGO A;  3BNB A;  1SJW A;  3PS8 A;  1RDS A;  2XEP A;  3PCR A;  4N6M A;  1PY3 A;  4ZM8 A;  1O7G B;  2E2T A;  4IT7 A;  1W2B 2;  1W02 A;  1PFP A;  3DMC A;  2CFL A;  2BHM A;  1T5Y A;  1UI8 A;  1UW1 A;  1BAO A;  2HMJ B;  1YNV X;  3GZR A;  4O2H A;  1LQG C;  2KF5 A;  3KFQ C;  4X2H A;  5RNT A;  3IJE B;  1IU7 A;  1CYU A;  3JUN A;  3IPT A;  2KAA A;  3BB9 A;  3KSE D;  3ZFZ A;  1ULJ B;  2MF7 A;  2RFR A;  1BNG A;  3B7C A;  1TFO A;  2H0G A;  1JB4 A;  3EX9 A;  4OVM A;  2Z7A A;  3MG1 A;  1Q81 4;  2SAR A;  1AR0 A;  2XR8 B;  5D82 A;  4BU4 A;  2Y73 A;  5IEO A;  1OPY A;  1G0T A;  5AII A;  4EXR A;  1RSN A;  2XF3 A;  3NV0 A;  4KFE A;  1RRH A;  2W2C A;  1GY7 A;  1BVI A;  3K7C A;  5BU4 A;  1KQS 2;  3I0Y A;  1PU4 A;  2INX A;  2W04 A;  3JUQ A;  1TTO A;  3NX0 A;  1LRA A;  2CK3 H;  1AV4 A;  2CH9 A;  4K61 A;  1TP6 A;  4HJL B;  4QWT A;  3JUO A;  1OHP A;  4RNZ A;  1BRS A;  1HZ1 A;  1I0V A;  2WGQ A;  1VQQ A;  3F14 A;  4EYC A;  1OHO A;  2HML B;  4FMC A;  2STD A;  4MMY B;  1VQ7 3;  4BL3 A;  6GSP A;  1JBR A;  2CC3 A;  3PGB A;  3SXX A;  1MOL A;  1FGT A;  4J9A A;  4O8S A;  3D5G A;  3BLZ A;  1IQY A;  1BGS A;  4CJN A;  1UUW B;  4HYZ A;  2CWU A;  3S5C A;  1K8A 4;  1JN5 B;  2B1X B;  3JUM A;  2WOF A;  1FA3 A;  3NBB A;  4CDL A;  3H51 A;  1KSI A;  1NJI 4;  2OTJ 3;  1W01 A;  1ISK A;  1OGZ A;  2E2U A;  1I2G A;  4Q53 A;  2ZA4 A;  2F5W A;  3A76 A;  5G2G A;  4L8O A;  5HGR A;  1QVF 2;  3A5E A;  2F86 B;  5IG4 A;  3HK4 A;  1O7P B;  1Q42 A;  1GMR A;  3NV0 B;  1N9E A;  2F99 A;  3F7X A;  4HM4 B;  4MJD A;  5EEO A;  7GSP A;  5HOH A;  2ML5 A;  1STD A;  4EV2 A;  1OGX A;  2YFL B;  1Z1S A;  2KF4 A;  2F98 A;  5CK6 A;  1QJG A;  1B2U A;  2FNQ A;  2HMO B;  3WMD A;  2P0X A;  3KE7 A;  5KP3 A;  3DH2 A;  1UCJ A;  1QAL A;  1R4C A;  3X3X A;  3K0Z A;  1L5G B;  3T8N A;  1ZO2 A;  4RNT A;  4G1M B;  1E3R A;  7STD A;  2HMN B;  1BNJ A;  3V92 A;  3NM7 A;  4BIR A;  3WA3 A;  2CFG A;  2CWV A;  2KCD A;  4FCZ A;  4EC6 A;  2R41 A;  2XRX B;  3NHX A;  4XBY A;  2V1L A;  1GY6 A;  3F9S A;  1GD4 A;  2XGN A;  1UCI A;  1S72 3;  3DGM A;  1Q7Y 4;  3BND A;  1KWI A;  3D9R A;  1EQK A;  4HBR A;  1WMN A;  2CG0 A;  5IG5 A;  4L7K A;  2FXT A;  4HOH A;  3EF8 A;  1JV2 B;  1HYF A;  4BL2 A;  3H3H A;  3F40 A;  1RKY A;  1SAR A;  5ELJ A;  5IER A;  1X1Y A;  2W0Q A;  3K5T A;  2CFK A;  1IT7 A;  4FCJ A;  1DET A;  1EUI C;  1FYS A;  2XSO B;  1DYU A;  1YI2 3;  2L1S A;  3SOA A;  5EQL A;  1JZD A;  3CMA 3;  2XSH B;  3EQQ B;  1IYY A;  3OX9 A;  2W03 A;  2ZDJ A;  2Q07 A;  3EBY A;  3GWR A;  4HM6 B;  1UGH I;  3EB8 A;  5EVH A;  1O7H B;  1Q40 A;  2QGU A;  2RCD A;  3MPH A;  2ZL8 A;  1ROV A;  4N6O B;  5G1L A;  4HM7 B;  3Q2P A;  3BU4 A;  5IEN A;  1W2Z A;  4BTX A;  3G71 3;  3LTD A;  1LVN A;  4XBT A;  1MWT A;  1FGM A;  3D79 A;  1WQL B;  3EE1 A;  4FCM A;  3UL5 A;  2D42 A;  1A2V A;  3CCL 3;  2JDI H;  4GL6 A;  1ROA A;  3BIR A;  4HM2 B;  5IEP A;  1JB5 A;  3FG1 A;  4WYK B;  2MC8 A;  1KD1 4;  3ALA A;  2IA7 A;  3V99 A;  3KII A;  2Z76 A;  4XM4 A;  1FUS A;  1BOX A;  1B3S A;  1V58 A;  3FLJ A;  2Z77 A;  4R1K A;  2KF3 A;  3N8B A;  2RNT A;  4AKZ A;  2H0H A;  2BO9 B;  4HZ9 B;  1MWS A;  2AAE A;  1UUV B;  4KZ1 A;  1RTU A;  4WFO A;  3SLU A;  1TU5 A;  1TUH A;  1BSE A;  2D1W A;  3MSO A;  5BVB A;  5KP4 A;  2BMO B;  3EBT A;  4EW5 A;  1LNI A;  3NQY A;  1YVS A;  2E2V A;  1UI7 A;  4FMD A;  1YIT 3;  2AAD A;  1Q40 B;  3I56 3;  2W56 A;  2IY2 A;  2WO0 A;  3CPW 2;  1A67 A;  4EV5 A;  1AVL A;  3UJM A;  1JN5 A;  1M90 4;  2W9P A;  1RCL A;  1N5P A;  1RGK A;  3FF2 A;  1RCK A;  2BIR A;  3F8H A;  3WR2 A;  2CHC A;  4MEI A;  5LC6 A;  3ECF A;  5IW9 A;  2O3O A;  1W6G A;  2IUK A;  2O9U X;  3CCE 3;  1W6C A;  3FSD A;  4GHO A;  1BSC A;  1K28 A;  1I2E A;  1NDO B;  3SED A;  5JBS A;  4RBN A;  3K9M C;  5FGO A;  3AMO B;  1E97 A;  5FW5 A;  5JPP A;  1VQO 3;  3CC4 3;  4EBG A;  1WMP A;  3FH1 A;  3BNE A;  3EHC A;  1S5A A;  5TGN A;  1GMP A;  2OTL 3;  1RN4 A;  1AQZ A;  4MMX B;  1RGE A;  2IMJ A;  5AEU B;  1BUJ A;  1RNT A;  1IV9 A;  3CCR 3;  2RGQ A;  3L0R A;  1BRG A;  2YFJ B;  1YHQ 3;  2K54 A;  4PEJ A;  1VQ9 3;  3O8Y A;  3CCU 3;  1IQX A;  4MMZ B;  1D6Z A;  3WOE B;  2W56 B;  1UCK A;  1T2I A;  1W00 A;  2R4I A;  1QVG 2;  1B27 A;  1FUT A;  5GSP A;  1BU4 A;  1IT8 A;  1DMQ A;  3NBR A;  4J8T A;  4N6N B;  4XBX A;  3VGN A;  1IVW A;  1MWU A;  1Y4K A;  4X2O A;  1W6Y A;  1CYV A;  1JNQ A;  1HU9 A;  4RNY A;  1BNI A;  1LOX A;  2HOH A;  2P09 A;  2CW9 A;  3OWY A;  1RGC A;  1BNE A;  2UUG C;  3CU3 A;  1DE3 A;  1X1X A;  9RNT A;  2C10 A;  3DUK A;  2QA4 3;  1O7M B;  3Q1C A;  4O02 B;  5BIR A;  3F7S A;  1RNB A;  1NO3 A;  1M1X B;  3PXM A;  1D6Y A;  1I70 A;  1NWW A;  1EG9 B;  3KSP A;  3DM8 A;  3GRD A;  5I97 A;  3LXU X;  1VQL 3;  3V98 A;  2CG1 A;  1B21 A;  4LGQ A;  4HM1 B;  2W6J H;  4FR9 A;  4ILF A;  3FZW A;  1US1 A;  1JBT A;  1CH0 A;  1BUQ A;  1ZS7 A;  3HX8 A;  4OK0 A;  4R4K A;  3NUV A;  3S27 A;  3T8U A;  3F8X A;  1X1U A;  3X42 A;  3KN4 A;  3GZX B;  1GOU A;  3OW2 2;  1RGL A;  1F8N A;  3CPO A;  1BRK A;  1YVB I;  3B4P A;  1BNF A;  1MGR A;  4K1V A;  1JKG A;  1OF5 A;  2K3D A;  3DY5 A;  1JRQ A;  4OUQ A;  3Q3F A;  1LXE A;  3ER7 A;  1IVU A;  1BIR A;  1O7N B;  2OCT A;  3CC2 3;  1FGR A;  2PZV A;  3PZW A;  3CCM 3;  1FUW A;  3LYG A;  2GEX A;  4H61 A;  5AYR B;  3X3Y A;  1YJN 3;  2GU1 A;  3CNX A;  4N3V A;  3D4A A;  1B2Z A;  1OAC A;  1YJ9 3;  3DGL A;  2LYX A;  4AKY A;  3N9H A;  4JF8 A;  4WYK A;  1WTH A;  4N6U A;  3CNM A;  4N6L A;  3CCS 3;  1RJO A;  3MG3 A;  2BU4 A;  1PYL A;  2BT3 A;  4BTW A;  1Q7H A;  3RNT A;  2XFS A;  2BNG A;  1Q9E A;  1GMQ A;  2I9W A;  4BTY A;  1BRI A;  1AVK A;  1DVC A;  3UNL A;  2QEX 3;  1BNR A;  1RGG A;  1ULI B;  3J7Y d;  1G02 A;  5BXQ A;  3S67 A;  6STD A;  3FCS B;  1OCV A;  1VZZ A;  1U5O A;  5CXO A;  3B4O A;  4L8P A;  1UUG B;  2GSP A;  2LQV A;  4HZB B;  1R4Y A;  4WWU C;  2F4Y A;  1JKG B;  1OF5 B;  2BMR B;  4LSO A;  4R80 A;  3D3L A;  1MWR A;  1N8Q A;  1JBS A;  2H0I A;  3QRD A;  1E3V A;  1UGI A;  2F56 A;  1ASK A;  1V74 A;  1I0X A;  1BSA A;  4TX4 A;  1WMO A;  3NQZ A;  4K90 B;  4NPB A;  4DKI A;  3RDE A;  4J5K A;  2KRT A;  4KT3 B;  1YGW A;  2ML6 A;  1N8R 4;  5STD A;  3T0U A;  3S28 A;  4LMI A;  5AYS C;  3CCQ 3;  3AMO A;  3LML A;  3VF1 A;  1G96 A;  2XGL A;  3SYU A;  1RMS A;  4JRF A;  3SVA A;  3CD6 3;  2GBW B;  2WOH A;  1Q86 4;  1I3F A;  4HM0 B;  1I8V A;  1AY7 A;  4HVN A;  1OH0 A;  1SII A;  4R9K A;  2P05 A;  2UX0 A;  3HZP A;  4KFD A;  4LZI A;  5M1A A;  1OHS A;  3X40 A;  2A15 A;  2HMM B;  4R9L A;  3STD A;  4CCV A;  4XDW A;  3KCH A;  3KZT A;  4HM5 B;  3G6E 3;  1TIJ A;  3EC9 A;  2SBL A;  4FMA A;  1FW7 A;  2Z6B A;  4HAA A;  3S29 A;  2OOV A;  3RGA A;  1VQ8 3;  1ZX2 A;  1A2K A;  2L4V A;  1UDI I;  1VQP 3;  1O7W B;  1FGO A;  1HKX A;  1RHL A;  1YGE A;  4AEQ A;  4CPK A;  3DGN A;  1RN1 A;  3CCJ 3;  2ZHX B;  4J5G A;  1C7H A;  6RNT A;  1K9M 4;  2QIY A;  4ORL A;  2OQE A;  5IG0 A;  2OOV C;  2J8X B;  1IDP A;  3FF0 A;  3KKG A;  5CLK A;  3N54 B;  1QAK A;  3ZG0 A;  3NBJ A;  2K0M A;  1STF I;  1V57 A;  1TJD A;  3GSP A;  2PNC A;  3JVC A;  2HMK B;  3WOF B;  1I3I A;  2XFT A;  2IUJ A;  1DMM A;  2OQE C;  3LH4 A;  1CQS A;  2C4B A;  4I5Q A;  3TDG A;  3WHO A;  3NXJ A;  1FGQ A;  1GOY A;  1YIJ 3;  4HKV B;  1T3B A;  4K1U A;  4NRE A;  5DRV A;  2GXF A;  1JZO A;  1VQ5 3;  3GZB A;  2FGT A;  3FGY A;  1RGA A;  3LTB A;  5D81 A;  1W7C A;  2CFD A;  3G8Z A;  2CIU A; 
#chains in the Genus database with same CATH homology
 4XDV A;  1TFK A;  1VQ6 3;  2B24 B;  1W4N A;  1DMN A;  2GEY A;  3HIG A;  3LTC A;  1NU3 A;  1QAF A;  5AIF A;  1WNH A;  3G0K A;  3LT9 A;  1EA2 A;  1SIH A;  4FMB A;  1K41 A;  3WA2 X;  1M1K 4;  1DVD A;  3U1W A;  3SX1 A;  5A0O B;  3EN8 A;  2P38 A;  2GU3 A;  3X41 A;  3OWU A;  1VQM 3;  2BMQ B;  5DRE A;  1U8C B;  1IV7 A;  1QMA A;  3FKA A;  1SQW A;  4I4K A;  5ELU A;  3LOY A;  3CC7 3;  1MNL A;  3VSY A;  3QK9 A;  5CF1 A;  4IIA A;  3WOD G;  4HM8 B;  1N5H A;  1IQ8 A;  1RRL A;  2M7O A;  1IVV A;  3EN1 B;  3I55 3;  5AI1 A;  5CF2 A;  3PYJ A;  1KC8 4;  5AEW B;  3U97 A;  3EJV A;  1EKM A;  4LEH A;  5D83 A;  3JUP A;  3RGR A;  4WHA A;  3FG4 A;  1OUN A;  4N6V 0;  3MHE A;  4RZM A;  2CFW A;  2JQ5 A;  2YFI B;  3BNC A;  1J2B A;  3GZY B;  2OWP A;  4KFF A;  1A90 A;  3UL6 A;  3OWS A;  3HII A;  3E99 A;  1CEW I;  1GS3 A;  1GD3 A;  3DGO A;  2W9Q A;  3FG3 A;  3CME 3;  1VQN 3;  4XB5 A;  3MYT A;  3M8C A;  3GAX A;  3MG2 A;  2P0M A;  1VQ4 3;  2C11 A;  3LZA A;  3K63 A;  4STD A;  3G16 A;  1NB5 I;  1M9G A;  3LT8 A;  3B8L A;  3WDG B;  1W5Z A;  4N6T A;  4O3V A;  5AIG A;  3MWZ A;  5IG3 A;  1GYB A;  4HM3 B;  2YX9 A;  2CKF B;  4GB5 A;  3X3Z A;  1GY5 A;  1K73 4;  3CXC 2;  1RN7 A;  4H3U A;  1JB2 A;  3ROB A;  3OXA A;  1YJW 3;  3CCV 3;  3OV4 A;  3DXO A;  4WP5 A;  4NHF A;  5LC7 A;  1D6U A;  2KXG A;  2RSX A;  3UB1 A;  3HI7 A;  2Y74 A;  4U13 A;  5IF6 A;  2CWT A;  3IMA B;  3NM2 A;  3Q90 A;  4IPB A;  2GBX B;  4KVH A;  1LNH A;  3LTA A;  3SOY A;  1NB3 I;  8CHO A;  1VQK 3;  1Q82 4;  1IVX A;  2XH9 A;  5KP1 A;  1N9J A;  3G4S 3;  1JJ2 2;  1IK3 A;  3DZL A;  1SPU A;  5AIH A;  5JPU A;  3PCS A;  3MKI A;  2WGO A;  3BNB A;  1SJW A;  3PS8 A;  2XEP A;  3PCR A;  4N6M A;  4ZM8 A;  2E2T A;  1O7G B;  4IT7 A;  1W2B 2;  1W02 A;  1PFP A;  3DMC A;  2CFL A;  2BHM A;  1T5Y A;  1UI8 A;  1UW1 A;  2HMJ B;  3GZR A;  4O2H A;  5FW5 A;  4X2H A;  3KFQ C;  3IJE B;  1IU7 A;  1CYU A;  3JUN A;  3IPT A;  3BB9 A;  3KSE D;  1ULJ B;  2MF7 A;  2RFR A;  3B7C A;  1TFO A;  1JB4 A;  3EX9 A;  4OVM A;  2Z7A A;  3MG1 A;  1Q81 4;  1AR0 A;  2XR8 B;  5D82 A;  2Y73 A;  5IEO A;  1OPY A;  4EXR A;  5AII A;  2XF3 A;  3NV0 A;  4KFE A;  1RRH A;  2W2C A;  1GY7 A;  3K7C A;  1KQS 2;  3I0Y A;  1PU4 A;  2INX A;  2W04 A;  3JUQ A;  3NX0 A;  2CK3 H;  1AV4 A;  2CH9 A;  4K61 A;  1TP6 A;  4HJL B;  4QWT A;  3JUO A;  1OHP A;  4RNZ A;  2WGQ A;  3F14 A;  4EYC A;  1OHO A;  2HML B;  4FMC A;  2STD A;  4MMY B;  2CC3 A;  3PGB A;  3SXX A;  1MOL A;  1FGT A;  4J9A A;  4O8S A;  3BLZ A;  1IQY A;  1UUW B;  4HYZ A;  2CWU A;  3S5C A;  1K8A 4;  1JN5 B;  2B1X B;  3JUM A;  2WOF A;  1FA3 A;  3NBB A;  4CDL A;  3H51 A;  1KSI A;  1NJI 4;  2OTJ 3;  1W01 A;  1ISK A;  1OGZ A;  2E2U A;  4Q53 A;  5G2G A;  3A76 A;  4L8O A;  5HGR A;  1QVF 2;  2F86 B;  5IG4 A;  3HK4 A;  1O7P B;  1Q42 A;  3NV0 B;  1N9E A;  2F99 A;  3F7X A;  4HM4 B;  4MJD A;  5EEO A;  2ML5 A;  1STD A;  4EV2 A;  1OGX A;  2YFL B;  1Z1S A;  2F98 A;  5CK6 A;  1QJG A;  2HMO B;  2FNQ A;  3WMD A;  2P0X A;  3KE7 A;  5KP3 A;  1QAL A;  1R4C A;  3X3X A;  3K0Z A;  1L5G B;  3T8N A;  1ZO2 A;  4G1M B;  1E3R A;  7STD A;  2HMN B;  3V92 A;  3NM7 A;  3WA3 A;  2CFG A;  2CWV A;  2KCD A;  4FCZ A;  4EC6 A;  3NHX A;  2XRX B;  4XBY A;  2V1L A;  1GY6 A;  3F9S A;  1GD4 A;  2XGN A;  1S72 3;  3DGM A;  1Q7Y 4;  3BND A;  1KWI A;  3D9R A;  1EQK A;  4HBR A;  1WMN A;  2CG0 A;  5IG5 A;  4L7K A;  2FXT A;  3EF8 A;  1JV2 B;  3H3H A;  3F40 A;  1RKY A;  5ELJ A;  5IER A;  2W0Q A;  3K5T A;  2CFK A;  1IT7 A;  4FCJ A;  1YI2 3;  2XSO B;  1DYU A;  3SOA A;  5EQL A;  3CMA 3;  2XSH B;  3EQQ B;  3OX9 A;  2W03 A;  2ZDJ A;  2Q07 A;  3EBY A;  3GWR A;  4HM6 B;  5EVH A;  3EB8 A;  1O7H B;  1Q40 A;  2QGU A;  2RCD A;  3MPH A;  2ZL8 A;  1ROV A;  4N6O B;  4HM7 B;  3Q2P A;  5IEN A;  1W2Z A;  4BTX A;  2CIU A;  3G71 3;  3LTD A;  1LVN A;  4XBT A;  1FGM A;  3EE1 A;  1WQL B;  3CCL 3;  4FCM A;  3UL5 A;  2D42 A;  1A2V A;  2JDI H;  4GL6 A;  1ROA A;  4HM2 B;  5IEP A;  1JB5 A;  3FG1 A;  4WYK B;  2MC8 A;  1KD1 4;  3ALA A;  2IA7 A;  3V99 A;  3KII A;  2Z76 A;  4XM4 A;  3FLJ A;  2Z77 A;  4R1K A;  3N8B A;  4AKZ A;  2BO9 B;  4HZ9 B;  4KZ1 A;  1UUV B;  4WFO A;  3SLU A;  1TU5 A;  1TUH A;  2D1W A;  5BVB A;  3MSO A;  5KP4 A;  2BMO B;  3EBT A;  3NQY A;  2E2V A;  1UI7 A;  4FMD A;  1YIT 3;  1Q40 B;  3I56 3;  2W56 A;  2WO0 A;  3CPW 2;  1A67 A;  4EV5 A;  1AVL A;  3UJM A;  1JN5 A;  1M90 4;  2W9P A;  1N5P A;  3FF2 A;  3F8H A;  2CHC A;  4MEI A;  5LC6 A;  3ECF A;  5IW9 A;  2O3O A;  1W6G A;  2IUK A;  2O9U X;  3CCE 3;  1W6C A;  3FSD A;  1K28 A;  1NDO B;  3SED A;  5JBS A;  4RBN A;  3K9M C;  5FGO A;  3AMO B;  1E97 A;  5JPP A;  1VQO 3;  3CC4 3;  4EBG A;  1WMP A;  3FH1 A;  3BNE A;  3EHC A;  1S5A A;  5TGN A;  2OTL 3;  4MMX B;  2IMJ A;  5AEU B;  1IV9 A;  3CCR 3;  2RGQ A;  3L0R A;  2YFJ B;  1YHQ 3;  2K54 A;  4PEJ A;  1VQ9 3;  3O8Y A;  3CCU 3;  1IQX A;  4MMZ B;  1D6Z A;  3WOE B;  2W56 B;  1W00 A;  2R4I A;  1QVG 2;  4N6N B;  1IT8 A;  1DMQ A;  3NBR A;  4J8T A;  4XBX A;  3VGN A;  1IVW A;  1Y4K A;  4X2O A;  1W6Y A;  1CYV A;  1JNQ A;  1HU9 A;  4RNY A;  1LOX A;  2P09 A;  2CW9 A;  3OWY A;  3CU3 A;  2C10 A;  3DUK A;  2QA4 3;  1O7M B;  3Q1C A;  4O02 B;  3F7S A;  1NO3 A;  1M1X B;  3PXM A;  1D6Y A;  3KSP A;  1NWW A;  1EG9 B;  5I97 A;  3DM8 A;  3GRD A;  3LXU X;  1VQL 3;  3V98 A;  2CG1 A;  4LGQ A;  4HM1 B;  2W6J H;  4FR9 A;  1BUQ A;  3FZW A;  1US1 A;  3HX8 A;  4OK0 A;  4R4K A;  3NUV A;  3S27 A;  3T8U A;  3F8X A;  3X42 A;  3KN4 A;  3GZX B;  3OW2 2;  1F8N A;  3CPO A;  4K1V A;  1YVB I;  3B4P A;  1JKG A;  1OF5 A;  3DY5 A;  1JRQ A;  4OUQ A;  1LXE A;  3ER7 A;  1IVU A;  2OCT A;  1O7N B;  3CC2 3;  1FGR A;  2PZV A;  3PZW A;  3CCM 3;  1FUW A;  3LYG A;  2GEX A;  4H61 A;  5AYR B;  3X3Y A;  1YJN 3;  2GU1 A;  3CNX A;  4N3V A;  1OAC A;  1YJ9 3;  3DGL A;  2LYX A;  4AKY A;  3N9H A;  4JF8 A;  4WYK A;  1WTH A;  4N6U A;  3CNM A;  4N6L A;  3CCS 3;  1RJO A;  3MG3 A;  2BT3 A;  4BTW A;  2XFS A;  2BNG A;  2I9W A;  4BTY A;  2QEX 3;  1AVK A;  1DVC A;  3UNL A;  1ULI B;  3J7Y d;  5BXQ A;  3S67 A;  6STD A;  3FCS B;  1OCV A;  1VZZ A;  1U5O A;  5CXO A;  3B4O A;  4L8P A;  2LQV A;  4HZB B;  4WWU C;  1JKG B;  1OF5 B;  2BMR B;  4LSO A;  4R80 A;  3D3L A;  1N8Q A;  3QRD A;  1E3V A;  1ASK A;  1V74 A;  4TX4 A;  1WMO A;  3NQZ A;  4K90 B;  3RDE A;  2KRT A;  1N8R 4;  2ML6 A;  5STD A;  3T0U A;  3S28 A;  4LMI A;  5AYS C;  3CCQ 3;  3AMO A;  3LML A;  3VF1 A;  1G96 A;  2XGL A;  4JRF A;  3SVA A;  3CD6 3;  2GBW B;  2WOH A;  1Q86 4;  4HM0 B;  4HVN A;  1OH0 A;  1SII A;  4R9K A;  2P05 A;  2UX0 A;  3HZP A;  4KFD A;  4LZI A;  1OHS A;  3X40 A;  2A15 A;  2HMM B;  4R9L A;  3STD A;  4CCV A;  4XDW A;  3KZT A;  4HM5 B;  3G6E 3;  1TIJ A;  3EC9 A;  2SBL A;  4FMA A;  2Z6B A;  3S29 A;  2OOV A;  3RGA A;  1VQ8 3;  1ZX2 A;  1A2K A;  2L4V A;  1VQP 3;  1O7W B;  1FGO A;  1HKX A;  1YGE A;  4AEQ A;  3DGN A;  3CCJ 3;  1C7H A;  1K9M 4;  2QIY A;  4ORL A;  2OQE A;  5IG0 A;  2OOV C;  5CLK A;  1IDP A;  3FF0 A;  3KKG A;  3N54 B;  1QAK A;  3NBJ A;  2K0M A;  1STF I;  3JVC A;  3WOF B;  1VQ7 3;  2PNC A;  2HMK B;  2XFT A;  2IUJ A;  1DMM A;  2OQE C;  3LH4 A;  1CQS A;  3TDG A;  3NXJ A;  1FGQ A;  1YIJ 3;  4HKV B;  4K1U A;  4NRE A;  5DRV A;  2GXF A;  1VQ5 3;  3GZB A;  2FGT A;  3FGY A;  3LTB A;  5D81 A;  1W7C A;  3G8Z A;  2CFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...