2ML6A

Nmr structure of protein zp_02069618.1 from bacteroides uniformis atcc 8492
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
148
structure length
148
Chain Sequence
GAEEEDFKTFLQKFTSSASFQYSRIKFPLKSPIALLKDDGETEQTFPFTREKWALLDEETLKEGRTTEEEGGTYISHFTVNEPAHKEFEAGYDESEPSLRVVFELTDGKWYVTDCYNDWYNFDLPINELEETIQAVQEENKAFEELHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title NMR structure of protein ZP_02069618.1 from Bacteroides uniformis ATCC 8492.
rcsb
source organism Bacteroides uniformis
total genus 28
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.410 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ml6A00
2ML5A 2ML6A 4R4KA
chains in the Genus database with same CATH superfamily
1G96A 2LYXA 1LOYA 3HX8A 1RCKA 3EC9A 1BAOA 1JRQA 5AIFA 3J7Yd 2KF6A 1V58A 1V74A 4ZM8A 3HOHA 3WR2A 1YVBI 4FCZA 1MOLA 2GU3A 3G6E3 2ZHXB 2QIYA 1ROAA 1Q814 2IY2A 4X2HA 1J2BA 1NWWA 3DY5A 5AIGA 2K3DA 4RBNA 1Q824 1RMSA 1IT7A 1B3SA 1GOVA 5IEOA 5CF1A 1MWTA 8CHOA 1BRSA 1BSEA 4HAAA 1YIT3 1OH0A 5G2GA 1VQ73 1F8NA 1OHSA 3ECFA 5EVHA 5I97A 3CCV3 5G1KA 2HMMB 2XFSA 2XSOB 3PCRA 4H3UA 4NHFA 1FYSA 4O02B 2RFRA 3MG2A 1VQ43 1W7CA 3OXAA 4EV5A 2K0MA 3F9SA 1BNGA 3E99A 3Q3FA 1RKYA 4LYLB 1SIHA 3CCU3 1HU9A 1OGXA 1BU4A 3URPA 4EW5A 5M1AA 3EX9A 1TTOA 2P05A 2CG0A 1A2PA 1OF5A 4XDVA 1N9EA 4N3VA 4BTWA 5HOHA 4STDA 4J5GA 4HM1B 2HMJB 1QVG2 1SQWA 4HM5B 3FG1A 1EEJA 2RCDA 3CCE3 1D6YA 3CCM3 1EQKA 1WQLB 3G4S3 2B24B 3S28A 2GSPA 3WOEB 4I5QA 1D6ZA 1AY7A 1IQYA 3LMLA 3DH2A 1KSIA 3ZG5A 2CFLA 3VGNA 1FGQA 1TJDA 2CW9A 2LQVA 5CF2A 2C4BA 2IYJA 2D1WA 4OK0A 1YJN3 4J5KA 2Q07A 3H3HA 1NNVA 5D82A 3WA3A 5AYRB 3JUNA 2O9UX 4N6OB 1IVWA 1LXEA 1UCIA 2ZDJA 1GOYA 4HM6B 4RNYA 3B4OA 3ROBA 2P38A 3U1WA 1YGEA 1FGRA 1OUNA 2GBWB 4CJNA 1I2EA 2B1XB 4KVHA 2CFDA 1ASKA 1D6UA 4PEJA 1RGEA 1GY6A 1RGCA 2HMNB 2IA7A 4KFEA 5BVBA 3ALAA 3NHXA 3UNLA 1IK3A 1TUHA 1VQ53 1RGAA 2QGUA 1VQN3 3LYGA 1QALA 4N6TA 1LOVA 4WWUC 3DZLA 2WGQA 3CCR3 2WOFA 1BIRA 1BOXA 2HOHA 3OWYA 3X3ZA 1I3FA 3MPHA 3CC43 3KN4A 3BNEA 3LTDA 3NBRA 3NUVA 2BIRA 1AVKA 2XRXB 3V99A 5JPUA 1JZOA 2K54A 3SYUA 2MC8A 1CQSA 1BNIA 1Q40A 2YFJB 1BVIA 3D3LA 3Q1CA 1E3RA 2CFKA 3DGLA 3FLJA 3OWSA 2AADA 4FMAA 4I4KA 3UL5A 5JPPA 2RNTA 4IPBA 3KE7A 3GZXB 4JRFA 1LVNA 4WHAA 4IIAA 5IERA 3EQQB 2GEXA 5IW9A 2BMRB 4DKIA 1YIJ3 1WMNA 1WNHA 3PXMA 1Q7HA 1RGHA 1UI7A 5STDA 2AAEA 5BIRA 4RZMA 1E3VA 1B2SA 1LRAA 1NB5I 1NJI4 2YFIB 4N6LA 4O8SA 2XR8B 1RN1A 1IDPA 1T5YA 1IVXA 4K90B 3DM8A 1TRPA 3GWRA 7STDA 1YHQ3 3G8ZA 3CU3A 4N6UA 3I563 2L1SA 1Q7Y4 1C54A 4HKVB 2WO0A 1KWIA 3N9HA 1VQM3 1FA3A 5KP1A 1EG9B 1RN7A 3FF2A 4MEIA 1BNRA 1OHOA 2CFGA 3SOAA 4EBGA 1NDOB 2IUJA 1PY3A 2A15A 2ZL8A 4L8PA 4AKZA 5IENA 1GYBA 4KT3B 1TU5A 3CCL3 3N54B 1LOWA 3X3XA 2Y74A 5A0OB 3WA2X 1UCKA 1K9M4 2OTL3 3GZBA 3KCHA 1CYVA 4ILFA 1KQS2 1U8CB 2CKFB 4BL2A 1M1XB 3NQYA 4U13A 2GEYA 4WP5A 4CCVA 1M904 2W0QA 4OUQA 1FUTA 5EEOA 4BTYA 4KFDA 3NXJA 1FGOA 5AIHA 3OV4A 5G1LA 5BU4A 1B2MA 4K1UA 1I0XA 1RGKA 1TRQA 2OQEC 3EN1B 2WOHA 4LSOA 4LZIA 4N6V0 1I8VA 3O8YA 1GSPA 1RJOA 2OQEA 1IVUA 5DREA 2OTJ3 3ZFZA 1UUGB 5AI1A 4G1MB 3IJEB 1IV9A 1BRJA 4OVMA 3DXOA 1MWRA 2IUKA 3OWUA 2CWUA 3WDGB 3U97A 1SPUA 2V1LA 5D83A 1UDII 1CYUA 1AR0A 2PZVA 1BSDA 1HKXA 4RNZA 3FSDA 1B2UA 1RRHA 1MWSA 1WMPA 1I70A 2M7OA 1Y4KA 1S5AA 2XF3A 3KFQC 2CFWA 3JUPA 2BHMA 1E97A 1YJW3 1ISKA 2FXTA 3DUKA 1SARA 3KIIA 1OHPA 1VQK3 1AVLA 3D5GA 3T8NA 1DVCA 1VQ93 1B2ZA 3GZYB 2RGQA 1GD4A 1BRIA 3NM2A 1RCLA 3Q2PA 3JUOA 3SEDA 4GSPA 1N8QA 1JB5A 3LTBA 2F5WA 2CHCA 1RN4A 1JB4A 1BNJA 5IG5A 6GSPA 3CXC2 1FGMA 1LOXA 4HM0B 2CK3H 2YFLB 4WYKA 3LH4A 4XM4A 4MMZB 7GSPA 2C11A 5DRVA 2UX0A 2F98A 1W01A 3FCSB 1C7HA 2P0XA 3V92A 2XGNA 1W2B2 3CPW2 1ZS7A 3PYJA 5IG4A 3F14A 4L7KA 1I0VA 1IYYA 1O7PB 2XGLA 3SOYA 1GOUA 3WHOA 1IT8A 1O7HB 3NV0B 3WODG 1JJ22 4J8TA 3CD63 4MMYB 3BNCA 1W6GA 3CNXA 1OCVA 2XEPA 2H0GA 2BU4A 2CWVA 1IQ8A 5LC6A 2FGTA 3AGNA 1O7MB 1BNSA 4IT7A 1WTHA 2H0HA 5CLKA 3CC23 3KSED 5FGOA 2R41A 1YVSA 3IMAB 4WFOA 1GD3A 3FF0A 1QAFA 3CCJ3 1ZO2A 1IVVA 1JBTA 3RNTA 1T2HA 3CCS3 3S27A 3RDEA 2RBIA 1JKGB 2E2TA 1VQQA 3OX9A 3MSOA 3F40A 3FG4A 1TFOA 1ZGXA 4R4KA 2YX9A 1RTUA 1X1XA 2W56B 2BO9B 3I553 3BNDA 7RNTA 3LTAA 3FGYA 3KZTA 5HGRA 4LEHA 1RLSA 1ROVA 2BMQB 1V57A 2CWTA 2GXFA 1PYLA 1WMOA 3PGBA 3PCSA 5D81A 5AYSC 1I2FA 2E2VA 1S723 1I2GA 2UUGC 3AHSA 2J8XB 1US1A 4Q53A 4K1VA 5FW5A 2KF5A 3L0RA 3EHCA 4HZBB 3RGAA 1N8R4 4BU4A 9RNTA 1VQL3 1QAKA 1FGTA 2HMLB 3LT8A 1X1WA 1RHLA 1DMMA 3NV0A 3K9MC 1K28A 1GMPA 1DMQA 3KSPA 4JF8A 3BIRA 3STDA 1SJWA 3K5TA 1UI8A 1BSCA 1B2XA 2ML6A 4HOHA 3ZG0A 1T3BA 4HJLB 1M1K4 4HM7B 3QRDA 1AV4A 1BNEA 2P0MA 2MF7A 3M8CA 2OCTA 3VSYA 5KP4A 3LTCA 5M19A 1M9GA 4XDWA 3GSPA 1VQ83 3EBTA 3JUMA 1ULIB 3B7CA 1VQ63 4R9KA 1NU3A 1VZZA 4XBXA 1JKGA 1FUWA 3A76A 1R4CA 3DGYA 3EB8A 1A67A 1BRHA 4XBTA 4R80A 1O7GB 5ELJA 3T0UA 4CDLA 3IPTA 2W56A 4MJDA 1RGGA 1RNTA 4AEQA 2GBXB 2F5MA 4XBYA 3S29A 4BIRA 2F4YA 4HM2B 3OW22 1UCLA 1N9JA 2P09A 1UUWB 1Q9EA 2JQ5A 2W2CA 3MG3A 1STFI 2CIUA 1PFPA 2W03A 4LGQA 5AIIA 3CCQ3 1KC84 2Z77A 5LC7A 2SARA 3MG1A 1IQXA 2BNGA 2E2UA 2Z76A 1LNIA 1MGWA 1OF5B 2OOVC 3NM7A 5IEPA 1QJGA 3H51A 3CPOA 3EF8A 1OACA 1W02A 4J9AA 1U5OA 1GMQA 4XB5A 3X42A 3CMA3 2KXGA 1BUJA 3D79A 2QA43 1Q864 1BRGA 1UGIA 3BU4A 2UGIA 3X40A 1JZDA 1T2IA 3MHEA 3AMOB 4GB5A 4QWTA 2KRTA 1VQO3 1YJ93 1LQGC 1PU4A 4R1KA 5RNTA 1QVF2 2KCDA 3LOYA 1HZ1A 1RDSA 3SXXA 4L8OA 3MYTA 3NBJA 3BLZA 2KF3A 3FG3A 1RRLA 2W9PA 5TGNA 1K8A4 2XH9A 1O7NB 3JUQA 3ER7A 1BANA 4BL3A 1DETA 1JN5B 3D9RA 5CXOA 4AKYA 1NO3A 3DGOA 4X2OA 4TX4A 3DMCA 1SIIA 3AGOA 1VQP3 3X41A 4MMXB 3KKGA 1RGFA 3HIIA 1W6CA 4KZ1A 1BSAA 1IV7A 2RSXA 1GS3A 5CK6A 1AQZA 2D42A 4LMIA 3EJVA 1L5GB 5M18A 1BNFA 1Q42A 3F7SA 2WGOA 4HM8B 3WOFB 2SBLA 4FCMA 3PS8A 4CPKA 2QEX3 2O3OA 1EUIC 2HMOB 2R4IA 3LZAA 4HBRA 2CG1A 2I9WA 3VF1A 1TIJA 3B4PA 1A2KA 3D4AA 2F99A 3A5EA 3NBBA 1JBRA 4EC6A 1BUQA 1Q40B 2Y73A 2Z6BA 2XSHB 4EYCA 1UW1A 2C10A 2PNCA 1ZX2A 2Z7AA 3SLUA 1X1YA 1OGZA 5AEWB 1LQMB 3AMOA 1GMRA 3B8LA 4HYZA 4ORLA 4EXRA 1OPYA 4R9LA 3AHWA 3MWZA 3F8HA 3SVAA 3WMDA 3LT9A 1A90A 4HM4B 4RNTA 4N6NB 1CH0A 1YNVX 1UUVB 4GL6A 1DYUA 1K41A 1JV2B 1O7WB 3RGRA 3PZWA 3HI7A 4O3VA 3Q90A 5ELUA 1IU7A 3FH1A 1W00A 4H61A 1GY5A 1EKMA 3UB1A 1FUSA 1JN5A 1RGLA 2HMKB 2F86B 1N5PA 5IF6A 1DVDA 1CEWI 2L4VA 3D5IA 2XFTA 4HVNA 1MGRA 3K7CA 1FW7A 1R4YA 1W6YA 2BMOB 3JVCA 4HZ9B 4FMDA 3HZPA 1KD14 1FZUA 1ULJB 2OWPA 1K734 4KFFA 3G16A 5GSPA 6RNTA 3F8XA 3GAXA 2IMJA 3MKIA 1W5ZA 3HK4A 3NQZA 3GRDA 2W6JH 1BRNL 1QMAA 2CX0A 3N8BA 2CC3A 3DGMA 3LXUX 4GHOA 3TDGA 3DGNA 1G0TA 1EA2A 4N6MA 1B27A 3GZRA 5EQLA 8RNTA 1JBSA 1W2ZA 1BGSA 4O2HA 1STDA 1MWUA 2ZA4A 3NX0A 1JB2A 2STDA 2KF4A 3CC73 1BRKA 4NREA 4EV2A 5BXQA 5JBSA 2GU1A 4BTXA 2KAAA 5AEUB 1JNQA 1YGWA 2W04A 3EE1A 1G02A 3EBYA 2BT3A 3BNBA 5KP3A 1N5HA 1MNLA 2JDIH 3FZWA 6STDA 1I3IA 3CME3 5IG3A 1RSNA 3T8UA 1NB3I 3S67A 1DMNA 1TFKA 5IG0A 3G713 3I0YA 4FR9A 1LNHA 1X1UA 3UJMA 3S5CA 1DE3A 4FMCA 1UCJA 3V98A 2INXA 4HM3B 1YI23 1HYFA 1B21A 1A2VA 1W4NA 1BSBA 3CNMA 2CH9A 2CX1A 3EN8A 1GY7A 4FMBA 4FCJA 2H0IA 4K61A 1UGHI 3UL6A 1RNBA 4NPBA 2W9QA 2F56A 3BB9A 1Z1SA 2ML5A 3K0ZA 3QK9A 2OOVA 3SX1A 3HIGA 4WYKB 1TP6A 3X3YA 3F7XA 1B20A 3FKAA 2FNQA 3G0KA 3K63A
chains in the Genus database with same CATH topology
1G96A 2LYXA 3HX8A 3EC9A 1JRQA 5AIFA 3J7Yd 1V74A 4ZM8A 1YVBI 4FCZA 1MOLA 2GU3A 3G6E3 2QIYA 1ROAA 1Q814 4X2HA 1J2BA 1NWWA 3DY5A 5AIGA 4RBNA 1Q824 1IT7A 5IEOA 5CF1A 8CHOA 1YIT3 1OH0A 5G2GA 1VQ73 1F8NA 1OHSA 3ECFA 5EVHA 5I97A 3CCV3 2HMMB 2XFSA 2XSOB 3PCRA 4H3UA 4NHFA 4O02B 2RFRA 3MG2A 1VQ43 1W7CA 3OXAA 4EV5A 2K0MA 3F9SA 3E99A 1RKYA 1SIHA 3CCU3 1HU9A 1OGXA 3EX9A 2P05A 2CG0A 1OF5A 4XDVA 1N9EA 4N3VA 4BTWA 4STDA 4HM1B 2HMJB 1QVG2 1SQWA 4HM5B 3FG1A 2RCDA 3CCE3 1D6YA 3CCM3 1EQKA 1WQLB 3G4S3 2B24B 3S28A 3WOEB 1D6ZA 1IQYA 3LMLA 1KSIA 2CFLA 3VGNA 1FGQA 2LQVA 2CW9A 2D1WA 4OK0A 1YJN3 2Q07A 3H3HA 5D82A 3WA3A 5AYRB 3JUNA 2O9UX 4N6OB 1IVWA 1LXEA 2ZDJA 4HM6B 4RNYA 3ROBA 3B4OA 2P38A 3U1WA 1YGEA 1FGRA 1OUNA 2GBWB 2B1XB 4KVHA 2CFDA 1ASKA 1D6UA 4PEJA 4KFEA 1GY6A 2HMNB 2IA7A 5BVBA 3ALAA 3NHXA 3UNLA 1IK3A 1TUHA 1VQ53 2QGUA 1VQN3 3LYGA 1QALA 4N6TA 4WWUC 3DZLA 2WGQA 3CCR3 2WOFA 3OWYA 3X3ZA 3MPHA 3CC43 3KN4A 3BNEA 3LTDA 3NBRA 3NUVA 1AVKA 2XRXB 3V99A 5JPUA 2K54A 2MC8A 1CQSA 1Q40A 2YFJB 3D3LA 3Q1CA 5CF2A 4I4KA 1E3RA 2CFKA 3DGLA 3FLJA 3OWSA 4FMAA 3UL5A 5JPPA 4IPBA 3KE7A 3GZXB 4JRFA 1LVNA 4WHAA 4IIAA 5IERA 3EQQB 2GEXA 5IW9A 2BMRB 1YIJ3 1WMNA 1WNHA 3PXMA 1UI7A 5STDA 4RZMA 1E3VA 1NB5I 1NJI4 2YFIB 4N6LA 4O8SA 2XR8B 1IDPA 1T5YA 1IVXA 4K90B 3DM8A 3GWRA 7STDA 1YHQ3 3G8ZA 3CU3A 4N6UA 3I563 1Q7Y4 4HKVB 2WO0A 1KWIA 3N9HA 1VQM3 1FA3A 5KP1A 1EG9B 1RN7A 3FF2A 4MEIA 1OHOA 2CFGA 3SOAA 4EBGA 1NDOB 2IUJA 2A15A 4L8PA 2ZL8A 4AKZA 5IENA 1TU5A 1GYBA 3CCL3 3N54B 3X3XA 2Y74A 5A0OB 3WA2X 1K9M4 2OTL3 3GZBA 1CYVA 1KQS2 1U8CB 2CKFB 1M1XB 3NQYA 4U13A 2GEYA 4WP5A 4CCVA 1M904 2W0QA 4OUQA 5EEOA 4BTYA 4KFDA 3NXJA 1FGOA 5AIHA 3OV4A 4K1UA 2OQEC 3EN1B 2WOHA 4LSOA 4LZIA 4N6V0 3O8YA 2OQEA 1RJOA 1IVUA 5DREA 2OTJ3 5AI1A 4G1MB 3IJEB 1IV9A 4OVMA 3DXOA 3OWUA 2IUKA 2CWUA 3WDGB 3U97A 1SPUA 2V1LA 5D83A 1CYUA 1AR0A 2PZVA 1HKXA 4RNZA 3FSDA 1WMPA 1RRHA 2M7OA 1Y4KA 1S5AA 2XF3A 3KFQC 2CFWA 3JUPA 2BHMA 1E97A 1YJW3 1ISKA 2FXTA 3DUKA 3KIIA 1OHPA 1VQK3 1AVLA 3T8NA 1DVCA 3GZYB 2RGQA 1GD4A 3NM2A 3Q2PA 3JUOA 3SEDA 1N8QA 1JB5A 3LTBA 2CHCA 1JB4A 5IG5A 3CXC2 1FGMA 1LOXA 4HM0B 2CK3H 2YFLB 4WYKA 3LH4A 4XM4A 4MMZB 2C11A 5DRVA 2UX0A 2F98A 1W01A 3FCSB 1C7HA 2P0XA 3V92A 2XGNA 1W2B2 3CPW2 3PYJA 5IG4A 3F14A 4L7KA 1O7PB 2XGLA 3SOYA 1IT8A 1O7HB 3NV0B 3WODG 1JJ22 4J8TA 3CD63 4MMYB 3BNCA 1W6GA 3CNXA 1OCVA 2XEPA 2CWVA 1IQ8A 5LC6A 2FGTA 1O7MB 4IT7A 3CC23 1WTHA 5CLKA 3KSED 5FGOA 3IMAB 4WFOA 1GD3A 3FF0A 1QAFA 3CCJ3 1ZO2A 1IVVA 3CCS3 3S27A 3RDEA 1JKGB 2E2TA 3OX9A 3MSOA 3F40A 3FG4A 1TFOA 4R4KA 2YX9A 2W56B 3I553 2BO9B 3BNDA 3LTAA 3FGYA 3KZTA 5HGRA 4LEHA 1ROVA 2BMQB 2CWTA 2GXFA 1WMOA 3PGBA 3PCSA 5D81A 5AYSC 2E2VA 1S723 1US1A 4Q53A 4K1VA 5FW5A 3L0RA 3EHCA 4HZBB 3RGAA 1N8R4 1VQL3 1QAKA 1FGTA 2HMLB 3LT8A 1DMMA 3NV0A 3K9MC 1K28A 1DMQA 3KSPA 4JF8A 3STDA 1SJWA 3K5TA 1UI8A 2ML6A 4HJLB 1M1K4 4HM7B 3QRDA 1AV4A 2P0MA 3M8CA 2MF7A 2OCTA 3VSYA 5KP4A 3LTCA 1M9GA 4XDWA 1VQ83 3EBTA 3JUMA 1ULIB 3B7CA 1VQ63 4R9KA 1NU3A 1VZZA 4XBXA 1JKGA 1FUWA 3A76A 1R4CA 3EB8A 1A67A 4XBTA 4R80A 1O7GB 5ELJA 3T0UA 4CDLA 3IPTA 2W56A 4MJDA 4AEQA 2GBXB 4XBYA 3S29A 4HM2B 3OW22 1N9JA 2P09A 1UUWB 2JQ5A 2W2CA 3MG3A 1STFI 2CIUA 1PFPA 2W03A 4LGQA 5AIIA 3CCQ3 1KC84 2Z77A 5LC7A 3MG1A 1VQ93 1IQXA 2BNGA 2E2UA 2Z76A 1OF5B 2OOVC 3NM7A 5IEPA 1QJGA 3H51A 3CPOA 3EF8A 1OACA 1W02A 4J9AA 1U5OA 4XB5A 3X42A 3CMA3 2KXGA 2QA43 1Q864 3X40A 3MHEA 4QWTA 3AMOB 4GB5A 2KRTA 1VQO3 1YJ93 1PU4A 1QVF2 4R1KA 2KCDA 3LOYA 3SXXA 4L8OA 3MYTA 3NBJA 3BLZA 3FG3A 1RRLA 2W9PA 5TGNA 1K8A4 2XH9A 1O7NB 3JUQA 3ER7A 3D9RA 1JN5B 5CXOA 4AKYA 1NO3A 3DGOA 4X2OA 4TX4A 3DMCA 1SIIA 1VQP3 3X41A 4MMXB 3KKGA 3HIIA 1W6CA 4KZ1A 1IV7A 2RSXA 1GS3A 5CK6A 2D42A 4LMIA 3EJVA 1L5GB 1Q42A 3F7SA 2WGOA 4HM8B 3WOFB 2SBLA 4FCMA 3PS8A 2QEX3 2O3OA 2HMOB 2R4IA 3LZAA 4HBRA 3VF1A 2CG1A 2I9WA 1TIJA 3B4PA 1A2KA 2F99A 3NBBA 4EC6A 1BUQA 1Q40B 2Y73A 2Z6BA 2XSHB 4EYCA 1UW1A 2C10A 2PNCA 1ZX2A 2Z7AA 3SLUA 1OGZA 5AEWB 3AMOA 3B8LA 4HYZA 4ORLA 4EXRA 1OPYA 4R9LA 3MWZA 3F8HA 3SVAA 3WMDA 3LT9A 1A90A 4HM4B 4N6NB 1UUVB 4GL6A 1DYUA 1K41A 1JV2B 1O7WB 3RGRA 3PZWA 3HI7A 4O3VA 3Q90A 5ELUA 1IU7A 3FH1A 1W00A 4H61A 1GY5A 1EKMA 3UB1A 1JN5A 2HMKB 2F86B 1N5PA 5IF6A 1DVDA 1CEWI 2L4VA 2XFTA 4HVNA 3K7CA 1W6YA 2BMOB 3JVCA 4HZ9B 4FMDA 3HZPA 1KD14 1ULJB 2OWPA 1K734 4KFFA 3G16A 3F8XA 3GAXA 2IMJA 3MKIA 1W5ZA 3HK4A 3NQZA 3GRDA 2W6JH 1QMAA 3N8BA 2CC3A 3DGMA 3LXUX 3TDGA 3DGNA 1EA2A 4N6MA 5EQLA 3GZRA 1W2ZA 4O2HA 1STDA 3NX0A 1JB2A 2STDA 3CC73 4NREA 4EV2A 5BXQA 5JBSA 2GU1A 4BTXA 5AEUB 1JNQA 2W04A 3EE1A 3EBYA 2BT3A 3BNBA 5KP3A 1N5HA 1MNLA 2JDIH 3FZWA 6STDA 3CME3 5IG3A 3T8UA 1NB3I 3S67A 1DMNA 1TFKA 5IG0A 3G713 3I0YA 4FR9A 1LNHA 3UJMA 3S5CA 4FMCA 3V98A 2INXA 4HM3B 1YI23 1A2VA 1W4NA 3CNMA 3EN8A 2CH9A 4FMBA 4K61A 1GY7A 4FCJA 3UL6A 2W9QA 3BB9A 3K0ZA 1Z1SA 2ML5A 3QK9A 2OOVA 3SX1A 3HIGA 4WYKB 1TP6A 3X3YA 3F7XA 3FKAA 2FNQA 3G0KA 3K63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ML5 A;  2ML6 A;  4R4K A; 
#chains in the Genus database with same CATH topology
 1G96 A;  2LYX A;  1LOY A;  3HX8 A;  1RCK A;  3EC9 A;  1BAO A;  1JRQ A;  5AIF A;  3J7Y d;  2KF6 A;  1V58 A;  1V74 A;  4ZM8 A;  3HOH A;  3WR2 A;  1YVB I;  4FCZ A;  1MOL A;  2GU3 A;  3G6E 3;  2ZHX B;  2QIY A;  1ROA A;  1Q81 4;  2IY2 A;  4X2H A;  1J2B A;  1NWW A;  3DY5 A;  5AIG A;  2K3D A;  4RBN A;  1Q82 4;  1RMS A;  1IT7 A;  1B3S A;  1GOV A;  5IEO A;  5CF1 A;  1MWT A;  8CHO A;  1BRS A;  1BSE A;  4HAA A;  1YIT 3;  1OH0 A;  5G2G A;  1VQ7 3;  1F8N A;  1OHS A;  3ECF A;  5EVH A;  5I97 A;  3CCV 3;  5G1K A;  2HMM B;  2XFS A;  2XSO B;  3PCR A;  4H3U A;  4NHF A;  1FYS A;  4O02 B;  2RFR A;  3MG2 A;  1VQ4 3;  1W7C A;  3OXA A;  4EV5 A;  2K0M A;  3F9S A;  1BNG A;  3E99 A;  3Q3F A;  1RKY A;  4LYL B;  1SIH A;  3CCU 3;  1HU9 A;  1OGX A;  1BU4 A;  3URP A;  4EW5 A;  5M1A A;  3EX9 A;  1TTO A;  2P05 A;  2CG0 A;  1A2P A;  1OF5 A;  4XDV A;  1N9E A;  4N3V A;  4BTW A;  5HOH A;  4STD A;  4J5G A;  4HM1 B;  2HMJ B;  1QVG 2;  1SQW A;  4HM5 B;  3FG1 A;  1EEJ A;  2RCD A;  3CCE 3;  1D6Y A;  3CCM 3;  1EQK A;  1WQL B;  3G4S 3;  2B24 B;  3S28 A;  2GSP A;  3WOE B;  4I5Q A;  1D6Z A;  1AY7 A;  1IQY A;  3LML A;  3DH2 A;  1KSI A;  3ZG5 A;  2CFL A;  3VGN A;  1FGQ A;  1TJD A;  2CW9 A;  2LQV A;  5CF2 A;  2C4B A;  2IYJ A;  2D1W A;  4OK0 A;  1YJN 3;  4J5K A;  2Q07 A;  3H3H A;  1NNV A;  5D82 A;  3WA3 A;  5AYR B;  3JUN A;  2O9U X;  4N6O B;  1IVW A;  1LXE A;  1UCI A;  2ZDJ A;  1GOY A;  4HM6 B;  4RNY A;  3B4O A;  3ROB A;  2P38 A;  3U1W A;  1YGE A;  1FGR A;  1OUN A;  2GBW B;  4CJN A;  1I2E A;  2B1X B;  4KVH A;  2CFD A;  1ASK A;  1D6U A;  4PEJ A;  1RGE A;  1GY6 A;  1RGC A;  2HMN B;  2IA7 A;  4KFE A;  5BVB A;  3ALA A;  3NHX A;  3UNL A;  1IK3 A;  1TUH A;  1VQ5 3;  1RGA A;  2QGU A;  1VQN 3;  3LYG A;  1QAL A;  4N6T A;  1LOV A;  4WWU C;  3DZL A;  2WGQ A;  3CCR 3;  2WOF A;  1BIR A;  1BOX A;  2HOH A;  3OWY A;  3X3Z A;  1I3F A;  3MPH A;  3CC4 3;  3KN4 A;  3BNE A;  3LTD A;  3NBR A;  3NUV A;  2BIR A;  1AVK A;  2XRX B;  3V99 A;  5JPU A;  1JZO A;  2K54 A;  3SYU A;  2MC8 A;  1CQS A;  1BNI A;  1Q40 A;  2YFJ B;  1BVI A;  3D3L A;  3Q1C A;  1E3R A;  2CFK A;  3DGL A;  3FLJ A;  3OWS A;  2AAD A;  4FMA A;  4I4K A;  3UL5 A;  5JPP A;  2RNT A;  4IPB A;  3KE7 A;  3GZX B;  4JRF A;  1LVN A;  4WHA A;  4IIA A;  5IER A;  3EQQ B;  2GEX A;  5IW9 A;  2BMR B;  4DKI A;  1YIJ 3;  1WMN A;  1WNH A;  3PXM A;  1Q7H A;  1RGH A;  1UI7 A;  5STD A;  2AAE A;  5BIR A;  4RZM A;  1E3V A;  1B2S A;  1LRA A;  1NB5 I;  1NJI 4;  2YFI B;  4N6L A;  4O8S A;  2XR8 B;  1RN1 A;  1IDP A;  1T5Y A;  1IVX A;  4K90 B;  3DM8 A;  1TRP A;  3GWR A;  7STD A;  1YHQ 3;  3G8Z A;  3CU3 A;  4N6U A;  3I56 3;  2L1S A;  1Q7Y 4;  1C54 A;  4HKV B;  2WO0 A;  1KWI A;  3N9H A;  1VQM 3;  1FA3 A;  5KP1 A;  1EG9 B;  1RN7 A;  3FF2 A;  4MEI A;  1BNR A;  1OHO A;  2CFG A;  3SOA A;  4EBG A;  1NDO B;  2IUJ A;  1PY3 A;  2A15 A;  2ZL8 A;  4L8P A;  4AKZ A;  5IEN A;  1GYB A;  4KT3 B;  1TU5 A;  3CCL 3;  3N54 B;  1LOW A;  3X3X A;  2Y74 A;  5A0O B;  3WA2 X;  1UCK A;  1K9M 4;  2OTL 3;  3GZB A;  3KCH A;  1CYV A;  4ILF A;  1KQS 2;  1U8C B;  2CKF B;  4BL2 A;  1M1X B;  3NQY A;  4U13 A;  2GEY A;  4WP5 A;  4CCV A;  1M90 4;  2W0Q A;  4OUQ A;  1FUT A;  5EEO A;  4BTY A;  4KFD A;  3NXJ A;  1FGO A;  5AIH A;  3OV4 A;  5G1L A;  5BU4 A;  1B2M A;  4K1U A;  1I0X A;  1RGK A;  1TRQ A;  2OQE C;  3EN1 B;  2WOH A;  4LSO A;  4LZI A;  4N6V 0;  1I8V A;  3O8Y A;  1GSP A;  1RJO A;  2OQE A;  1IVU A;  5DRE A;  2OTJ 3;  3ZFZ A;  1UUG B;  5AI1 A;  4G1M B;  3IJE B;  1IV9 A;  1BRJ A;  4OVM A;  3DXO A;  1MWR A;  2IUK A;  3OWU A;  2CWU A;  3WDG B;  3U97 A;  1SPU A;  2V1L A;  5D83 A;  1UDI I;  1CYU A;  1AR0 A;  2PZV A;  1BSD A;  1HKX A;  4RNZ A;  3FSD A;  1B2U A;  1RRH A;  1MWS A;  1WMP A;  1I70 A;  2M7O A;  1Y4K A;  1S5A A;  2XF3 A;  3KFQ C;  2CFW A;  3JUP A;  2BHM A;  1E97 A;  1YJW 3;  1ISK A;  2FXT A;  3DUK A;  1SAR A;  3KII A;  1OHP A;  1VQK 3;  1AVL A;  3D5G A;  3T8N A;  1DVC A;  1VQ9 3;  1B2Z A;  3GZY B;  2RGQ A;  1GD4 A;  1BRI A;  3NM2 A;  1RCL A;  3Q2P A;  3JUO A;  3SED A;  4GSP A;  1N8Q A;  1JB5 A;  3LTB A;  2F5W A;  2CHC A;  1RN4 A;  1JB4 A;  1BNJ A;  5IG5 A;  6GSP A;  3CXC 2;  1FGM A;  1LOX A;  4HM0 B;  2CK3 H;  2YFL B;  4WYK A;  3LH4 A;  4XM4 A;  4MMZ B;  7GSP A;  2C11 A;  5DRV A;  2UX0 A;  2F98 A;  1W01 A;  3FCS B;  1C7H A;  2P0X A;  3V92 A;  2XGN A;  1W2B 2;  3CPW 2;  1ZS7 A;  3PYJ A;  5IG4 A;  3F14 A;  4L7K A;  1I0V A;  1IYY A;  1O7P B;  2XGL A;  3SOY A;  1GOU A;  3WHO A;  1IT8 A;  1O7H B;  3NV0 B;  3WOD G;  1JJ2 2;  4J8T A;  3CD6 3;  4MMY B;  3BNC A;  1W6G A;  3CNX A;  1OCV A;  2XEP A;  2H0G A;  2BU4 A;  2CWV A;  1IQ8 A;  5LC6 A;  2FGT A;  3AGN A;  1O7M B;  1BNS A;  4IT7 A;  1WTH A;  2H0H A;  5CLK A;  3CC2 3;  3KSE D;  5FGO A;  2R41 A;  1YVS A;  3IMA B;  4WFO A;  1GD3 A;  3FF0 A;  1QAF A;  3CCJ 3;  1ZO2 A;  1IVV A;  1JBT A;  3RNT A;  1T2H A;  3CCS 3;  3S27 A;  3RDE A;  2RBI A;  1JKG B;  2E2T A;  1VQQ A;  3OX9 A;  3MSO A;  3F40 A;  3FG4 A;  1TFO A;  1ZGX A;  4R4K A;  2YX9 A;  1RTU A;  1X1X A;  2W56 B;  2BO9 B;  3I55 3;  3BND A;  7RNT A;  3LTA A;  3FGY A;  3KZT A;  5HGR A;  4LEH A;  1RLS A;  1ROV A;  2BMQ B;  1V57 A;  2CWT A;  2GXF A;  1PYL A;  1WMO A;  3PGB A;  3PCS A;  5D81 A;  5AYS C;  1I2F A;  2E2V A;  1S72 3;  1I2G A;  2UUG C;  3AHS A;  2J8X B;  1US1 A;  4Q53 A;  4K1V A;  5FW5 A;  2KF5 A;  3L0R A;  3EHC A;  4HZB B;  3RGA A;  1N8R 4;  4BU4 A;  9RNT A;  1VQL 3;  1QAK A;  1FGT A;  2HML B;  3LT8 A;  1X1W A;  1RHL A;  1DMM A;  3NV0 A;  3K9M C;  1K28 A;  1GMP A;  1DMQ A;  3KSP A;  4JF8 A;  3BIR A;  3STD A;  1SJW A;  3K5T A;  1UI8 A;  1BSC A;  1B2X A;  2ML6 A;  4HOH A;  3ZG0 A;  1T3B A;  4HJL B;  1M1K 4;  4HM7 B;  3QRD A;  1AV4 A;  1BNE A;  2P0M A;  2MF7 A;  3M8C A;  2OCT A;  3VSY A;  5KP4 A;  3LTC A;  5M19 A;  1M9G A;  4XDW A;  3GSP A;  1VQ8 3;  3EBT A;  3JUM A;  1ULI B;  3B7C A;  1VQ6 3;  4R9K A;  1NU3 A;  1VZZ A;  4XBX A;  1JKG A;  1FUW A;  3A76 A;  1R4C A;  3DGY A;  3EB8 A;  1A67 A;  1BRH A;  4XBT A;  4R80 A;  1O7G B;  5ELJ A;  3T0U A;  4CDL A;  3IPT A;  2W56 A;  4MJD A;  1RGG A;  1RNT A;  4AEQ A;  2GBX B;  2F5M A;  4XBY A;  3S29 A;  4BIR A;  2F4Y A;  4HM2 B;  3OW2 2;  1UCL A;  1N9J A;  2P09 A;  1UUW B;  1Q9E A;  2JQ5 A;  2W2C A;  3MG3 A;  1STF I;  2CIU A;  1PFP A;  2W03 A;  4LGQ A;  5AII A;  3CCQ 3;  1KC8 4;  2Z77 A;  5LC7 A;  2SAR A;  3MG1 A;  1IQX A;  2BNG A;  2E2U A;  2Z76 A;  1LNI A;  1MGW A;  1OF5 B;  2OOV C;  3NM7 A;  5IEP A;  1QJG A;  3H51 A;  3CPO A;  3EF8 A;  1OAC A;  1W02 A;  4J9A A;  1U5O A;  1GMQ A;  4XB5 A;  3X42 A;  3CMA 3;  2KXG A;  1BUJ A;  3D79 A;  2QA4 3;  1Q86 4;  1BRG A;  1UGI A;  3BU4 A;  2UGI A;  3X40 A;  1JZD A;  1T2I A;  3MHE A;  3AMO B;  4GB5 A;  4QWT A;  2KRT A;  1VQO 3;  1YJ9 3;  1LQG C;  1PU4 A;  4R1K A;  5RNT A;  1QVF 2;  2KCD A;  3LOY A;  1HZ1 A;  1RDS A;  3SXX A;  4L8O A;  3MYT A;  3NBJ A;  3BLZ A;  2KF3 A;  3FG3 A;  1RRL A;  2W9P A;  5TGN A;  1K8A 4;  2XH9 A;  1O7N B;  3JUQ A;  3ER7 A;  1BAN A;  4BL3 A;  1DET A;  1JN5 B;  3D9R A;  5CXO A;  4AKY A;  1NO3 A;  3DGO A;  4X2O A;  4TX4 A;  3DMC A;  1SII A;  3AGO A;  1VQP 3;  3X41 A;  4MMX B;  3KKG A;  1RGF A;  3HII A;  1W6C A;  4KZ1 A;  1BSA A;  1IV7 A;  2RSX A;  1GS3 A;  5CK6 A;  1AQZ A;  2D42 A;  4LMI A;  3EJV A;  1L5G B;  5M18 A;  1BNF A;  1Q42 A;  3F7S A;  2WGO A;  4HM8 B;  3WOF B;  2SBL A;  4FCM A;  3PS8 A;  4CPK A;  2QEX 3;  2O3O A;  1EUI C;  2HMO B;  2R4I A;  3LZA A;  4HBR A;  2CG1 A;  2I9W A;  3VF1 A;  1TIJ A;  3B4P A;  1A2K A;  3D4A A;  2F99 A;  3A5E A;  3NBB A;  1JBR A;  4EC6 A;  1BUQ A;  1Q40 B;  2Y73 A;  2Z6B A;  2XSH B;  4EYC A;  1UW1 A;  2C10 A;  2PNC A;  1ZX2 A;  2Z7A A;  3SLU A;  1X1Y A;  1OGZ A;  5AEW B;  1LQM B;  3AMO A;  1GMR A;  3B8L A;  4HYZ A;  4ORL A;  4EXR A;  1OPY A;  4R9L A;  3AHW A;  3MWZ A;  3F8H A;  3SVA A;  3WMD A;  3LT9 A;  1A90 A;  4HM4 B;  4RNT A;  4N6N B;  1CH0 A;  1YNV X;  1UUV B;  4GL6 A;  1DYU A;  1K41 A;  1JV2 B;  1O7W B;  3RGR A;  3PZW A;  3HI7 A;  4O3V A;  3Q90 A;  5ELU A;  1IU7 A;  3FH1 A;  1W00 A;  4H61 A;  1GY5 A;  1EKM A;  3UB1 A;  1FUS A;  1JN5 A;  1RGL A;  2HMK B;  2F86 B;  1N5P A;  5IF6 A;  1DVD A;  1CEW I;  2L4V A;  3D5I A;  2XFT A;  4HVN A;  1MGR A;  3K7C A;  1FW7 A;  1R4Y A;  1W6Y A;  2BMO B;  3JVC A;  4HZ9 B;  4FMD A;  3HZP A;  1KD1 4;  1FZU A;  1ULJ B;  2OWP A;  1K73 4;  4KFF A;  3G16 A;  5GSP A;  6RNT A;  3F8X A;  3GAX A;  2IMJ A;  3MKI A;  1W5Z A;  3HK4 A;  3NQZ A;  3GRD A;  2W6J H;  1BRN L;  1QMA A;  2CX0 A;  3N8B A;  2CC3 A;  3DGM A;  3LXU X;  4GHO A;  3TDG A;  3DGN A;  1G0T A;  1EA2 A;  4N6M A;  1B27 A;  3GZR A;  5EQL A;  8RNT A;  1JBS A;  1W2Z A;  1BGS A;  4O2H A;  1STD A;  1MWU A;  2ZA4 A;  3NX0 A;  1JB2 A;  2STD A;  2KF4 A;  3CC7 3;  1BRK A;  4NRE A;  4EV2 A;  5BXQ A;  5JBS A;  2GU1 A;  4BTX A;  2KAA A;  5AEU B;  1JNQ A;  1YGW A;  2W04 A;  3EE1 A;  1G02 A;  3EBY A;  2BT3 A;  3BNB A;  5KP3 A;  1N5H A;  1MNL A;  2JDI H;  3FZW A;  6STD A;  1I3I A;  3CME 3;  5IG3 A;  1RSN A;  3T8U A;  1NB3 I;  3S67 A;  1DMN A;  1TFK A;  5IG0 A;  3G71 3;  3I0Y A;  4FR9 A;  1LNH A;  1X1U A;  3UJM A;  3S5C A;  1DE3 A;  4FMC A;  1UCJ A;  3V98 A;  2INX A;  4HM3 B;  1YI2 3;  1HYF A;  1B21 A;  1A2V A;  1W4N A;  1BSB A;  3CNM A;  2CH9 A;  2CX1 A;  3EN8 A;  1GY7 A;  4FMB A;  4FCJ A;  2H0I A;  4K61 A;  1UGH I;  3UL6 A;  1RNB A;  4NPB A;  2W9Q A;  2F56 A;  3BB9 A;  1Z1S A;  2ML5 A;  3K0Z A;  3QK9 A;  2OOV A;  3SX1 A;  3HIG A;  4WYK B;  1TP6 A;  3X3Y A;  3F7X A;  1B20 A;  3FKA A;  2FNQ A;  3G0K A;  3K63 A; 
#chains in the Genus database with same CATH homology
 1G96 A;  2LYX A;  3HX8 A;  3EC9 A;  1JRQ A;  5AIF A;  3J7Y d;  1V74 A;  4ZM8 A;  1YVB I;  4FCZ A;  1MOL A;  2GU3 A;  3G6E 3;  2QIY A;  1ROA A;  1Q81 4;  4X2H A;  1J2B A;  1NWW A;  3DY5 A;  5AIG A;  4RBN A;  1Q82 4;  1IT7 A;  5IEO A;  5CF1 A;  8CHO A;  1YIT 3;  1OH0 A;  5G2G A;  1VQ7 3;  1F8N A;  1OHS A;  3ECF A;  5EVH A;  5I97 A;  3CCV 3;  2HMM B;  2XFS A;  2XSO B;  3PCR A;  4H3U A;  4NHF A;  4O02 B;  2RFR A;  3MG2 A;  1VQ4 3;  1W7C A;  3OXA A;  4EV5 A;  2K0M A;  3F9S A;  3E99 A;  1RKY A;  1SIH A;  3CCU 3;  1HU9 A;  1OGX A;  3EX9 A;  2P05 A;  2CG0 A;  1OF5 A;  4XDV A;  1N9E A;  4N3V A;  4BTW A;  4STD A;  4HM1 B;  2HMJ B;  1QVG 2;  1SQW A;  4HM5 B;  3FG1 A;  2RCD A;  3CCE 3;  1D6Y A;  3CCM 3;  1EQK A;  1WQL B;  3G4S 3;  2B24 B;  3S28 A;  3WOE B;  1D6Z A;  1IQY A;  3LML A;  1KSI A;  2CFL A;  3VGN A;  1FGQ A;  2LQV A;  2CW9 A;  2D1W A;  4OK0 A;  1YJN 3;  2Q07 A;  3H3H A;  5D82 A;  3WA3 A;  5AYR B;  3JUN A;  2O9U X;  4N6O B;  1IVW A;  1LXE A;  2ZDJ A;  4HM6 B;  4RNY A;  3ROB A;  3B4O A;  2P38 A;  3U1W A;  1YGE A;  1FGR A;  1OUN A;  2GBW B;  2B1X B;  4KVH A;  2CFD A;  1ASK A;  1D6U A;  4PEJ A;  4KFE A;  1GY6 A;  2HMN B;  2IA7 A;  5BVB A;  3ALA A;  3NHX A;  3UNL A;  1IK3 A;  1TUH A;  1VQ5 3;  2QGU A;  1VQN 3;  3LYG A;  1QAL A;  4N6T A;  4WWU C;  3DZL A;  2WGQ A;  3CCR 3;  2WOF A;  3OWY A;  3X3Z A;  3MPH A;  3CC4 3;  3KN4 A;  3BNE A;  3LTD A;  3NBR A;  3NUV A;  1AVK A;  2XRX B;  3V99 A;  5JPU A;  2K54 A;  2MC8 A;  1CQS A;  1Q40 A;  2YFJ B;  3D3L A;  3Q1C A;  5CF2 A;  4I4K A;  1E3R A;  2CFK A;  3DGL A;  3FLJ A;  3OWS A;  4FMA A;  3UL5 A;  5JPP A;  4IPB A;  3KE7 A;  3GZX B;  4JRF A;  1LVN A;  4WHA A;  4IIA A;  5IER A;  3EQQ B;  2GEX A;  5IW9 A;  2BMR B;  1YIJ 3;  1WMN A;  1WNH A;  3PXM A;  1UI7 A;  5STD A;  4RZM A;  1E3V A;  1NB5 I;  1NJI 4;  2YFI B;  4N6L A;  4O8S A;  2XR8 B;  1IDP A;  1T5Y A;  1IVX A;  4K90 B;  3DM8 A;  3GWR A;  7STD A;  1YHQ 3;  3G8Z A;  3CU3 A;  4N6U A;  3I56 3;  1Q7Y 4;  4HKV B;  2WO0 A;  1KWI A;  3N9H A;  1VQM 3;  1FA3 A;  5KP1 A;  1EG9 B;  1RN7 A;  3FF2 A;  4MEI A;  1OHO A;  2CFG A;  3SOA A;  4EBG A;  1NDO B;  2IUJ A;  2A15 A;  4L8P A;  2ZL8 A;  4AKZ A;  5IEN A;  1TU5 A;  1GYB A;  3CCL 3;  3N54 B;  3X3X A;  2Y74 A;  5A0O B;  3WA2 X;  1K9M 4;  2OTL 3;  3GZB A;  1CYV A;  1KQS 2;  1U8C B;  2CKF B;  1M1X B;  3NQY A;  4U13 A;  2GEY A;  4WP5 A;  4CCV A;  1M90 4;  2W0Q A;  4OUQ A;  5EEO A;  4BTY A;  4KFD A;  3NXJ A;  1FGO A;  5AIH A;  3OV4 A;  4K1U A;  2OQE C;  3EN1 B;  2WOH A;  4LSO A;  4LZI A;  4N6V 0;  3O8Y A;  2OQE A;  1RJO A;  1IVU A;  5DRE A;  2OTJ 3;  5AI1 A;  4G1M B;  3IJE B;  1IV9 A;  4OVM A;  3DXO A;  3OWU A;  2IUK A;  2CWU A;  3WDG B;  3U97 A;  1SPU A;  2V1L A;  5D83 A;  1CYU A;  1AR0 A;  2PZV A;  1HKX A;  4RNZ A;  3FSD A;  1WMP A;  1RRH A;  2M7O A;  1Y4K A;  1S5A A;  2XF3 A;  3KFQ C;  2CFW A;  3JUP A;  2BHM A;  1E97 A;  1YJW 3;  1ISK A;  2FXT A;  3DUK A;  3KII A;  1OHP A;  1VQK 3;  1AVL A;  3T8N A;  1DVC A;  3GZY B;  2RGQ A;  1GD4 A;  3NM2 A;  3Q2P A;  3JUO A;  3SED A;  1N8Q A;  1JB5 A;  3LTB A;  2CHC A;  1JB4 A;  5IG5 A;  3CXC 2;  1FGM A;  1LOX A;  4HM0 B;  2CK3 H;  2YFL B;  4WYK A;  3LH4 A;  4XM4 A;  4MMZ B;  2C11 A;  5DRV A;  2UX0 A;  2F98 A;  1W01 A;  3FCS B;  1C7H A;  2P0X A;  3V92 A;  2XGN A;  1W2B 2;  3CPW 2;  3PYJ A;  5IG4 A;  3F14 A;  4L7K A;  1O7P B;  2XGL A;  3SOY A;  1IT8 A;  1O7H B;  3NV0 B;  3WOD G;  1JJ2 2;  4J8T A;  3CD6 3;  4MMY B;  3BNC A;  1W6G A;  3CNX A;  1OCV A;  2XEP A;  2CWV A;  1IQ8 A;  5LC6 A;  2FGT A;  1O7M B;  4IT7 A;  3CC2 3;  1WTH A;  5CLK A;  3KSE D;  5FGO A;  3IMA B;  4WFO A;  1GD3 A;  3FF0 A;  1QAF A;  3CCJ 3;  1ZO2 A;  1IVV A;  3CCS 3;  3S27 A;  3RDE A;  1JKG B;  2E2T A;  3OX9 A;  3MSO A;  3F40 A;  3FG4 A;  1TFO A;  4R4K A;  2YX9 A;  2W56 B;  3I55 3;  2BO9 B;  3BND A;  3LTA A;  3FGY A;  3KZT A;  5HGR A;  4LEH A;  1ROV A;  2BMQ B;  2CWT A;  2GXF A;  1WMO A;  3PGB A;  3PCS A;  5D81 A;  5AYS C;  2E2V A;  1S72 3;  1US1 A;  4Q53 A;  4K1V A;  5FW5 A;  3L0R A;  3EHC A;  4HZB B;  3RGA A;  1N8R 4;  1VQL 3;  1QAK A;  1FGT A;  2HML B;  3LT8 A;  1DMM A;  3NV0 A;  3K9M C;  1K28 A;  1DMQ A;  3KSP A;  4JF8 A;  3STD A;  1SJW A;  3K5T A;  1UI8 A;  2ML6 A;  4HJL B;  1M1K 4;  4HM7 B;  3QRD A;  1AV4 A;  2P0M A;  3M8C A;  2MF7 A;  2OCT A;  3VSY A;  5KP4 A;  3LTC A;  1M9G A;  4XDW A;  1VQ8 3;  3EBT A;  3JUM A;  1ULI B;  3B7C A;  1VQ6 3;  4R9K A;  1NU3 A;  1VZZ A;  4XBX A;  1JKG A;  1FUW A;  3A76 A;  1R4C A;  3EB8 A;  1A67 A;  4XBT A;  4R80 A;  1O7G B;  5ELJ A;  3T0U A;  4CDL A;  3IPT A;  2W56 A;  4MJD A;  4AEQ A;  2GBX B;  4XBY A;  3S29 A;  4HM2 B;  3OW2 2;  1N9J A;  2P09 A;  1UUW B;  2JQ5 A;  2W2C A;  3MG3 A;  1STF I;  2CIU A;  1PFP A;  2W03 A;  4LGQ A;  5AII A;  3CCQ 3;  1KC8 4;  2Z77 A;  5LC7 A;  3MG1 A;  1VQ9 3;  1IQX A;  2BNG A;  2E2U A;  2Z76 A;  1OF5 B;  2OOV C;  3NM7 A;  5IEP A;  1QJG A;  3H51 A;  3CPO A;  3EF8 A;  1OAC A;  1W02 A;  4J9A A;  1U5O A;  4XB5 A;  3X42 A;  3CMA 3;  2KXG A;  2QA4 3;  1Q86 4;  3X40 A;  3MHE A;  4QWT A;  3AMO B;  4GB5 A;  2KRT A;  1VQO 3;  1YJ9 3;  1PU4 A;  1QVF 2;  4R1K A;  2KCD A;  3LOY A;  3SXX A;  4L8O A;  3MYT A;  3NBJ A;  3BLZ A;  3FG3 A;  1RRL A;  2W9P A;  5TGN A;  1K8A 4;  2XH9 A;  1O7N B;  3JUQ A;  3ER7 A;  3D9R A;  1JN5 B;  5CXO A;  4AKY A;  1NO3 A;  3DGO A;  4X2O A;  4TX4 A;  3DMC A;  1SII A;  1VQP 3;  3X41 A;  4MMX B;  3KKG A;  3HII A;  1W6C A;  4KZ1 A;  1IV7 A;  2RSX A;  1GS3 A;  5CK6 A;  2D42 A;  4LMI A;  3EJV A;  1L5G B;  1Q42 A;  3F7S A;  2WGO A;  4HM8 B;  3WOF B;  2SBL A;  4FCM A;  3PS8 A;  2QEX 3;  2O3O A;  2HMO B;  2R4I A;  3LZA A;  4HBR A;  3VF1 A;  2CG1 A;  2I9W A;  1TIJ A;  3B4P A;  1A2K A;  2F99 A;  3NBB A;  4EC6 A;  1BUQ A;  1Q40 B;  2Y73 A;  2Z6B A;  2XSH B;  4EYC A;  1UW1 A;  2C10 A;  2PNC A;  1ZX2 A;  2Z7A A;  3SLU A;  1OGZ A;  5AEW B;  3AMO A;  3B8L A;  4HYZ A;  4ORL A;  4EXR A;  1OPY A;  4R9L A;  3MWZ A;  3F8H A;  3SVA A;  3WMD A;  3LT9 A;  1A90 A;  4HM4 B;  4N6N B;  1UUV B;  4GL6 A;  1DYU A;  1K41 A;  1JV2 B;  1O7W B;  3RGR A;  3PZW A;  3HI7 A;  4O3V A;  3Q90 A;  5ELU A;  1IU7 A;  3FH1 A;  1W00 A;  4H61 A;  1GY5 A;  1EKM A;  3UB1 A;  1JN5 A;  2HMK B;  2F86 B;  1N5P A;  5IF6 A;  1DVD A;  1CEW I;  2L4V A;  2XFT A;  4HVN A;  3K7C A;  1W6Y A;  2BMO B;  3JVC A;  4HZ9 B;  4FMD A;  3HZP A;  1KD1 4;  1ULJ B;  2OWP A;  1K73 4;  4KFF A;  3G16 A;  3F8X A;  3GAX A;  2IMJ A;  3MKI A;  1W5Z A;  3HK4 A;  3NQZ A;  3GRD A;  2W6J H;  1QMA A;  3N8B A;  2CC3 A;  3DGM A;  3LXU X;  3TDG A;  3DGN A;  1EA2 A;  4N6M A;  5EQL A;  3GZR A;  1W2Z A;  4O2H A;  1STD A;  3NX0 A;  1JB2 A;  2STD A;  3CC7 3;  4NRE A;  4EV2 A;  5BXQ A;  5JBS A;  2GU1 A;  4BTX A;  5AEU B;  1JNQ A;  2W04 A;  3EE1 A;  3EBY A;  2BT3 A;  3BNB A;  5KP3 A;  1N5H A;  1MNL A;  2JDI H;  3FZW A;  6STD A;  3CME 3;  5IG3 A;  3T8U A;  1NB3 I;  3S67 A;  1DMN A;  1TFK A;  5IG0 A;  3G71 3;  3I0Y A;  4FR9 A;  1LNH A;  3UJM A;  3S5C A;  4FMC A;  3V98 A;  2INX A;  4HM3 B;  1YI2 3;  1A2V A;  1W4N A;  3CNM A;  3EN8 A;  2CH9 A;  4FMB A;  4K61 A;  1GY7 A;  4FCJ A;  3UL6 A;  2W9Q A;  3BB9 A;  3K0Z A;  1Z1S A;  2ML5 A;  3QK9 A;  2OOV A;  3SX1 A;  3HIG A;  4WYK B;  1TP6 A;  3X3Y A;  3F7X A;  3FKA A;  2FNQ A;  3G0K A;  3K63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...