4J5KA

Crystal structure analysis of streptomyces aureofaciens ribonuclease sa y51f mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGFYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Contribution of hydrogen bonds to protein stability.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4j5kA00
2C4BA 4J5GA 1BSAA 2F4YA 1B2UA 1DETA 1I0XA 1JBSA 2ZA4A 1RNBA 1HYFA 2HOHA 1BSDA 3WHOA 4HAAA 1BNIA 1BVIA 2RBIA 3D4AA 2RNTA 1BSEA 1BIRA 1X1UA 1I2GA 1TRQA 3WR2A 4BIRA 1FYSA 1RGHA 1BNSA 2KF6A 1T2IA 1RCKA 1I2FA 3BU4A 1B2MA 1BRGA 1C54A 1I2EA 1RMSA 2AAEA 3A5EA 1GSPA 1BU4A 1UCLA 3D5GA 1AQZA 7RNTA 1YVSA 1GMPA 2KF4A 3BIRA 3SYUA 1RGAA 1I3IA 1TTOA 4RNTA 1BNRA 1JBRA 1AY7A 1BRIA 1BOXA 2KF3A 1YGWA 4BU4A 3RNTA 2BIRA 1B2ZA 1MGRA 1LOWA 1PY3A 1BRJA 1RGCA 2F5WA 3DGYA 3DH2A 5HOHA 1BRHA 3GSPA 1UCJA 1JBTA 1UCIA 1YNVX 3KCHA 1Q9EA 1SARA 1X1WA 4J5KA 1RNTA 1IYYA 3HOHA 1BNGA 1RN4A 1FW7A 6GSPA 1BANA 1BUJA 1LOVA 1BRSA 1B3SA 1MGWA 1T2HA 3URPA 3AGNA 4HOHA 1B21A 3D5IA 1CH0A 1I8VA 1FZUA 5BU4A 1B2XA 1B2SA 1FUSA 3Q3FA 1B20A 1A2PA 2SARA 1GOUA 8RNTA 1RGFA 1RGKA 1BRKA 1RLSA 1ZGXA 4GHOA 2BU4A 1LOYA 1BGSA 1GOYA 1RTUA 1BAOA 1BNFA 2F5MA 3AHSA 1RGGA 1RHLA 1BNJA 2KAAA 1LRAA 1X1XA 1BNEA 7GSPA 1RCLA 1GMRA 3AGOA 1RDSA 1RSNA 1GOVA 1RGLA 1I0VA 1X1YA 2KF5A 1R4YA 1LNIA 1BRNL 9RNTA 1RGEA 1DE3A 1RN1A 5BIRA 2AADA 1G02A 1HZ1A 1I70A 1BSCA 1BSBA 1UCKA 1B27A 1PYLA 3AHWA 2GSPA 5RNTA 4GSPA 1GMQA 6RNTA 1FUTA 5GSPA 1I3FA 2F56A 1TRPA
chains in the Genus database with same CATH superfamily
4WHAA 2C4BA 1K8A4 4WWUC 3NQZA 4R9LA 1GD3A 1A90A 3WOEB 3JVCA 1Q864 3EX9A 3V92A 5AYSC 1OCVA 5FW5A 1RNBA 1A67A 3HIIA 1HYFA 1UI7A 3ZG0A 2HMOB 4EYCA 4IT7A 3MSOA 1BSEA 1BIRA 1Y4KA 1V74A 4MEIA 1IVVA 1FYSA 4EXRA 3NM2A 2OWPA 2KF6A 3IJEB 5IENA 3Q2PA 2ZHXB 4KZ1A 3WOFB 1SQWA 1W2B2 1B2MA 1BRGA 4RNYA 2P38A 3CC43 1IV9A 4BTWA 1QAKA 5M19A 1MWRA 3D5GA 3EQQB 2K3DA 3FF0A 4K61A 4LYLB 3I553 2B1XB 3K5TA 1Q824 1NU3A 1GYBA 1M1XB 1E97A 4HM3B 3CPOA 4RNTA 5G1LA 5HGRA 3D3LA 3LYGA 1US1A 2XGNA 1BRIA 2CW9A 5CXOA 2QIYA 3S28A 4BTXA 5DRVA 2W56A 4XBYA 1YI23 2YFJB 2P0XA 4NHFA 3S5CA 3NBJA 4U13A 1OH0A 2O9UX 2YX9A 1VZZA 1O7NB 2CWUA 4HBRA 4R4KA 4I5QA 3FZWA 3PS8A 1UCIA 2K0MA 2CFDA 1OUNA 2OTL3 3KCHA 3OV4A 1SARA 5IERA 2W56B 1W6GA 3KSED 2L1SA 5LC6A 1JB4A 3HOHA 3SOAA 1BNGA 1OGZA 4QWTA 3T0UA 1S723 3H51A 3T8UA 1YHQ3 1IT7A 2CKFB 2CK3H 2GU1A 3GWRA 3LTAA 2QGUA 3DUKA 1BRSA 2BNGA 2W03A 2ZL8A 4HZBB 2JQ5A 3SX1A 5JPPA 3AGNA 3KZTA 1GY7A 1FGOA 3D5IA 1CH0A 2UUGC 3ALAA 1JB2A 1I8VA 3QK9A 3V98A 1DVDA 2CFLA 1YIT3 1WQLB 2IA7A 2SARA 4EC6A 8RNTA 3CC73 2R41A 3LT8A 1RLSA 4G1MB 4GHOA 2BU4A 4HJLB 5AI1A 1VQK3 1RTUA 5G1KA 5LC7A 3X40A 1PU4A 1CYUA 1IQYA 1ZS7A 2E2VA 3AHSA 1NO3A 4L7KA 2IUJA 1AR0A 3HZPA 3SLUA 5D83A 3CCE3 3VF1A 1JZDA 1TFOA 2OOVC 1K41A 1GMRA 1MWTA 1ULJB 1RSNA 4XBXA 1VQ43 2BT3A 4AKYA 2V1LA 1GOVA 5ELJA 3CC23 1I0VA 2WGQA 4N6V0 2CFGA 3VGNA 1TP6A 1ROAA 1UI8A 3X3YA 3WA2X 4R9KA 1V57A 4MJDA 1G0TA 1BRNL 3EN8A 1U8CB 5CF2A 1SIIA 2YFLB 1K734 2WOHA 5DREA 1OHOA 3BNBA 1M9GA 1BSBA 5BXQA 4LZIA 1LQGC 2HMNB 3NUVA 1Q7Y4 1NJI4 1C7HA 3NBRA 1FUTA 1I3FA 1SIHA 4HM0B 1JKGA 3CCR3 2FXTA 1FA3A 4H3UA 4L8PA 4O3VA 1BUQA 3HIGA 5IG3A 3HK4A 2GBXB 1D6YA 3OWYA 3X42A 3U1WA 4IPBA 5IG5A 3WA3A 4HM6B 2F4YA 1WNHA 3GRDA 1DETA 3G16A 1VQQA 3GAXA 4NPBA 1O7WB 2HOHA 3DXOA 1LXEA 5AIGA 1JKGB 1O7MB 3NQYA 1BNIA 1BVIA 2H0HA 3D4AA 4O8SA 1W2ZA 2RNTA 1W02A 3LTBA 4FMDA 4HKVB 4KFEA 5AIIA 3RDEA 3WR2A 1JB5A 3K9MC 4PEJA 3FG1A 2QEX3 3JUOA 5BVBA 3STDA 5IF6A 2CFKA 1JV2B 1J2BA 3CNMA 4BTYA 1EKMA 4HM4B 2BMQB 1JNQA 5M1AA 3SOYA 2AAEA 3CCJ3 3A5EA 1GSPA 1VQ93 3MWZA 1IK3A 1YVSA 1GMPA 2KF4A 2BMOB 1JZOA 1TIJA 3QRDA 3D9RA 1I3IA 2KCDA 3ER7A 2XEPA 3FLJA 5TGNA 3FG3A 3EHCA 2W0QA 5JPUA 3B7CA 4L8OA 2KF3A 1AVLA 3NM7A 4OUQA 4BU4A 5AEWB 2CIUA 1Q40A 4KFDA 2F98A 1UGHI 1VQP3 2W2CA 1WMPA 1MGRA 1QVF2 1TJDA 3HX8A 3CCV3 1W00A 5HOHA 4CPKA 3V99A 3GSPA 3NHXA 2HMKB 4HM7B 1DVCA 2OQEC 5AEUB 3NBBA 3LXUX 1YNVX 1JBTA 1RRLA 3N54B 4X2HA 1Q9EA 5AIFA 1FGRA 4TX4A 4HZ9B 1Q40B 1IYYA 1OHPA 1MNLA 1IQXA 5AYRB 1CYVA 3G4S3 1HU9A 1ROVA 3N8BA 3FH1A 1JRQA 4KFFA 3O8YA 3MYTA 3F14A 3URPA 2BHMA 2F86B 4LSOA 4MMXB 1YVBI 3EJVA 3PCRA 4LGQA 2JDIH 1CEWI 4ORLA 1NNVA 3BNDA 3OWSA 5BU4A 3BNEA 1GOUA 3U97A 4ZM8A 1GS3A 4N3VA 2XFSA 1RGKA 4O02B 1NB5I 1YJ93 3EBTA 1BRKA 1W4NA 5KP4A 2IUKA 1GOYA 1LNHA 1O7HB 2XRXB 3DGOA 3DY5A 3KE7A 3KN4A 2F5MA 3MG2A 4XBTA 5EQLA 4J9AA 1RGGA 1RHLA 2ML5A 3ZFZA 2KAAA 1OF5A 7STDA 1X1XA 1QAFA 3CMA3 2A15A 3SVAA 1V58A 4STDA 1TU5A 1D6ZA 3AGOA 3OX9A 3ECFA 3GZYB 3OXAA 4N6UA 3SXXA 3X3XA 2P09A 4FMAA 2MC8A 4EV2A 3WMDA 2CG0A 2W9QA 3KSPA 1R4YA 1OF5B 5FGOA 1YGEA 9RNTA 1DE3A 1RN1A 5BIRA 3CCS3 1G02A 2CH9A 1VQM3 4R80A 1RJOA 2Z7AA 1KQS2 1IVXA 1MOLA 3S27A 2P0MA 3AHWA 4XDVA 1PYLA 1WMNA 3KFQC 6RNTA 3H3HA 2CX1A 3UL6A 2WGOA 4N6LA 3NX0A 2KXGA 1OPYA 1NDOB 1S5AA 2GEXA 5STDA 4BL2A 1Q42A 3EC9A 3CXC2 1E3VA 1Q7HA 1FUWA 1B2UA 1KD14 5AIHA 1I0XA 4I4KA 1JBSA 4Q53A 1JJ22 1G96A 3MHEA 1MWSA 4HM8B 1FGTA 4JF8A 4MMZB 3F7SA 1W7CA 3WHOA 4KVHA 3M8CA 3DGMA 2D1WA 2Q07A 1X1UA 4J8TA 1I2GA 1TRQA 1UGIA 1GY6A 2R4IA 3JUPA 1BNSA 3B4PA 1T2IA 2RCDA 3A76A 1I2FA 2WO0A 4N6MA 3PGBA 3BU4A 2OOVA 1C54A 1W6CA 1BU4A 2W9PA 4AKZA 1AQZA 4FCZA 3WDGB 5A0OB 1O7PB 1VQL3 2PZVA 3UJMA 2IYJA 4GL6A 1RGAA 1TTOA 3F40A 1BNRA 3FKAA 1AY7A 3CCM3 1OHSA 1EUIC 1N9JA 1QJGA 2Z76A 1N5PA 1YGWA 3F8HA 1DMQA 1JN5A 2XH9A 1LQMB 2BIRA 2UX0A 3DMCA 1LVNA 3BLZA 5IG0A 5KP1A 1B2ZA 2F5WA 1A2VA 1IVUA 1PY3A 1RGCA 3DGYA 1AVKA 4K1UA 4AEQA 3B8LA 1BRHA 1VQN3 3F9SA 1KSIA 2IY2A 3PXMA 1VQ73 1X1WA 4FMCA 3G713 4KT3B 3MG1A 4J5KA 1JN5B 1RNTA 2BMRB 3G0KA 3T8NA 2BO9B 3ZG5A 2IMJA 1RN4A 4EBGA 6GSPA 1FW7A 4RNZA 1N5HA 1YIJ3 2GBWB 2I9WA 1YJW3 1IV7A 4HOHA 1B21A 2M7OA 3I0YA 2E2UA 4HVNA 1FUSA 1M904 4RZMA 3Q3FA 5EVHA 4BL3A 4FMBA 3ROBA 5IEPA 4EW5A 1PFPA 1SPUA 4XB5A 5IEOA 8CHOA 1QMAA 1ZGXA 3LT9A 1W5ZA 1YJN3 1LOYA 3CNXA 2RSXA 3TDGA 1KWIA 1BAOA 2CFWA 2GXFA 4GB5A 2KRTA 1T3BA 1Z1SA 3CU3A 1BNJA 1LRAA 1SJWA 7GSPA 1HKXA 2INXA 4OVMA 3LMLA 2Z77A 1RDSA 3FF2A 3EB8A 3S67A 1IT8A 3FSDA 1STDA 3Q1CA 4CCVA 1EQKA 1K28A 1IVWA 5ELUA 2L4VA 1RN7A 1X1YA 1ISKA 3NXJA 2UGIA 1W01A 3JUNA 1HZ1A 2OQEA 2XR8B 1K9M4 1VQ53 1AV4A 3X3ZA 2STDA 1BSCA 1UCKA 1B27A 4NREA 3FG4A 4ILFA 4X2OA 4GSPA 1GMQA 4XM4A 5CLKA 3DZLA 5RNTA 2XGLA 1IQ8A 1UUWB 3K7CA 1TRPA 3MG3A 4OK0A 3I563 2Y73A 2HMJB 4J5GA 1BSAA 1VQO3 2W04A 2C11A 3JUQA 3KKGA 4MMYB 3F8XA 3LTCA 1E3RA 3NV0A 5IG4A 3B4OA 4HM2B 2CG1A 1GY5A 2ZA4A 2O3OA 3LZAA 4RBNA 1BSDA 1TFKA 2D42A 2W6JH 3CME3 4HAAA 2HMMB 1CQSA 4K90B 2RBIA 4CDLA 2B24B 3CCU3 1STFI 3IMAB 5EEOA 2E2TA 4FCMA 4BIRA 1RGHA 1FGQA 2WOFA 3NV0B 4LEHA 5CF1A 1RRHA 2C10A 1N8QA 1ULIB 3WODG 1RCKA 3VSYA 2OTJ3 2FNQA 3K63A 1WTHA 1I2EA 1NWWA 1RMSA 2K54A 2XSOB 4N6TA 1A2KA 4WFOA 1UCLA 3HI7A 7RNTA 2F99A 3BIRA 3G6E3 4FCJA 3SYUA 2GU3A 3PCSA 6STDA 3BNCA 1JBRA 4EV5A 4DKIA 2HMLB 2GEYA 1BOXA 1N9EA 1EEJA 3N9HA 4O2HA 1VQ63 5IW9A 1DMMA 4HM1B 3X41A 5G2GA 3RNTA 4N6NB 3S29A 2XFTA 2PNCA 1IDPA 1T5YA 2OCTA 3DM8A 3GZXB 1N8R4 2J8XB 1LOWA 3DH2A 1DYUA 1BRJA 5M18A 3MPHA 2XF3A 2RGQA 2P05A 1UCJA 1Q814 3EE1A 3RGAA 2ZDJA 5KP3A 1L5GB 1F8NA 1UUVB 3J7Yd 1DMNA 3DGNA 3PZWA 3EBYA 1WMOA 1R4CA 1W6YA 3CCL3 2CX0A 3F7XA 1BANA 1UDII 3L0RA 2Y74A 1BUJA 1OGXA 5JBSA 1LOVA 5D81A 1B3SA 1MGWA 1T2HA 4R1KA 4N6OB 4XDWA 1GD4A 1QALA 3IPTA 1LOXA 3LTDA 3LH4A 3AMOA 1EA2A 3K0ZA 3MKIA 5D82A 1FZUA 1MWUA 2FGTA 3DGLA 1B2XA 1B2SA 1ZX2A 3CPW2 1A2PA 1B20A 3Q90A 3SEDA 1RGFA 2H0GA 2CHCA 2H0IA 1QVG2 1RKYA 3CD63 3GZBA 1BGSA 4LMIA 4FR9A 3OWUA 1IU7A 1EG9B 1BNFA 3FCSB 3D79A 4H61A 3BB9A 2XSHB 3AMOB 3JUMA 2CWVA 2LQVA 1VQ83 1BNEA 2RFRA 3E99A 2ML6A 1RCLA 3EF8A 5I97A 1FGMA 1KC84 3G8ZA 2CC3A 4HM5B 1OACA 1M1K4 4CJNA 1UW1A 2MF7A 3KIIA 1ASKA 4IIAA 4WYKA 2Z6BA 2QA43 1RGLA 1U5OA 3PYJA 3GZRA 4WP5A 2KF5A 4HYZA 1LNIA 2YFIB 3RGRA 1RGEA 1TUHA 3LOYA 1D6UA 2AADA 2CWTA 2SBLA 3UNLA 5CK6A 1O7GB 1I70A 1ZO2A 3UB1A 3UL5A 4WYKB 4JRFA 2GSPA 1UUGB 3CCQ3 1NB3I 4K1VA 5GSPA 2LYXA 2F56A 3OW22 3EN1B 3FGYA
chains in the Genus database with same CATH topology
2C4BA 4J5GA 1BSAA 2F4YA 1B2UA 1DETA 1I0XA 1JBSA 2ZA4A 1RNBA 1HYFA 2HOHA 1BSDA 3WHOA 4HAAA 1BNIA 1BVIA 2RBIA 3D4AA 2RNTA 1BSEA 1BIRA 1X1UA 1I2GA 1TRQA 3WR2A 4BIRA 1FYSA 1RGHA 1BNSA 2KF6A 1T2IA 1RCKA 1I2FA 3BU4A 1B2MA 1BRGA 1C54A 1I2EA 1RMSA 2AAEA 3A5EA 1GSPA 1BU4A 1UCLA 3D5GA 1AQZA 7RNTA 1YVSA 1GMPA 2KF4A 3BIRA 3SYUA 1RGAA 1I3IA 1TTOA 4RNTA 1BNRA 1JBRA 1AY7A 1BRIA 1BOXA 2KF3A 1YGWA 4BU4A 3RNTA 2BIRA 1B2ZA 1MGRA 1LOWA 1PY3A 1BRJA 1RGCA 2F5WA 3DGYA 3DH2A 5HOHA 1BRHA 3GSPA 1UCJA 1JBTA 1UCIA 1YNVX 3KCHA 1Q9EA 1SARA 1X1WA 4J5KA 1RNTA 1IYYA 3HOHA 1BNGA 1RN4A 1FW7A 6GSPA 1BANA 1BUJA 1LOVA 1BRSA 1B3SA 1MGWA 1T2HA 3URPA 3AGNA 4HOHA 1B21A 3D5IA 1CH0A 1I8VA 1FZUA 5BU4A 1B2XA 1B2SA 1FUSA 3Q3FA 1B20A 1A2PA 2SARA 1GOUA 8RNTA 1RGFA 1RGKA 1BRKA 1RLSA 1ZGXA 4GHOA 2BU4A 1LOYA 1BGSA 1GOYA 1RTUA 1BAOA 1BNFA 2F5MA 3AHSA 1RGGA 1RHLA 1BNJA 2KAAA 1LRAA 1X1XA 1BNEA 7GSPA 1RCLA 1GMRA 3AGOA 1RDSA 1RSNA 1GOVA 1RGLA 1I0VA 1X1YA 2KF5A 1R4YA 1LNIA 1BRNL 9RNTA 1RGEA 1DE3A 1RN1A 5BIRA 2AADA 1G02A 1HZ1A 1I70A 1BSCA 1BSBA 1UCKA 1B27A 1PYLA 3AHWA 2GSPA 5RNTA 4GSPA 1GMQA 6RNTA 1FUTA 5GSPA 1I3FA 2F56A 1TRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C4B A;  4J5G A;  1BSA A;  2F4Y A;  1B2U A;  1DET A;  1I0X A;  1JBS A;  2ZA4 A;  1RNB A;  1HYF A;  2HOH A;  1BSD A;  3WHO A;  4HAA A;  1BNI A;  1BVI A;  2RBI A;  3D4A A;  2RNT A;  1BSE A;  1BIR A;  1X1U A;  1I2G A;  1TRQ A;  3WR2 A;  4BIR A;  1FYS A;  1RGH A;  1BNS A;  2KF6 A;  1T2I A;  1RCK A;  1I2F A;  3BU4 A;  1B2M A;  1BRG A;  1C54 A;  1I2E A;  1RMS A;  2AAE A;  3A5E A;  1GSP A;  1BU4 A;  1UCL A;  3D5G A;  1AQZ A;  7RNT A;  1YVS A;  1GMP A;  2KF4 A;  3BIR A;  3SYU A;  1RGA A;  1I3I A;  1TTO A;  4RNT A;  1BNR A;  1JBR A;  1AY7 A;  1BRI A;  1BOX A;  2KF3 A;  1YGW A;  4BU4 A;  3RNT A;  2BIR A;  1B2Z A;  1MGR A;  1LOW A;  1PY3 A;  1BRJ A;  1RGC A;  2F5W A;  3DGY A;  3DH2 A;  5HOH A;  1BRH A;  3GSP A;  1UCJ A;  1JBT A;  1UCI A;  1YNV X;  3KCH A;  1Q9E A;  1SAR A;  1X1W A;  4J5K A;  1RNT A;  1IYY A;  3HOH A;  1BNG A;  1RN4 A;  1FW7 A;  6GSP A;  1BAN A;  1BUJ A;  1LOV A;  1BRS A;  1B3S A;  1MGW A;  1T2H A;  3URP A;  3AGN A;  4HOH A;  1B21 A;  3D5I A;  1CH0 A;  1I8V A;  1FZU A;  5BU4 A;  1B2X A;  1B2S A;  1FUS A;  3Q3F A;  1B20 A;  1A2P A;  2SAR A;  1GOU A;  8RNT A;  1RGF A;  1RGK A;  1BRK A;  1RLS A;  1ZGX A;  4GHO A;  2BU4 A;  1LOY A;  1BGS A;  1GOY A;  1RTU A;  1BAO A;  1BNF A;  2F5M A;  3AHS A;  1RGG A;  1RHL A;  1BNJ A;  2KAA A;  1LRA A;  1X1X A;  1BNE A;  7GSP A;  1RCL A;  1GMR A;  3AGO A;  1RDS A;  1RSN A;  1GOV A;  1RGL A;  1I0V A;  1X1Y A;  2KF5 A;  1R4Y A;  1LNI A;  1BRN L;  9RNT A;  1RGE A;  1DE3 A;  1RN1 A;  5BIR A;  2AAD A;  1G02 A;  1HZ1 A;  1I70 A;  1BSC A;  1BSB A;  1UCK A;  1B27 A;  1PYL A;  3AHW A;  2GSP A;  5RNT A;  4GSP A;  1GMQ A;  6RNT A;  1FUT A;  5GSP A;  1I3F A;  2F56 A;  1TRP A; 
#chains in the Genus database with same CATH topology
 4WHA A;  2C4B A;  1K8A 4;  4WWU C;  3NQZ A;  4R9L A;  1GD3 A;  1A90 A;  3WOE B;  3JVC A;  1Q86 4;  3EX9 A;  3V92 A;  5AYS C;  1OCV A;  5FW5 A;  1RNB A;  1A67 A;  3HII A;  1HYF A;  1UI7 A;  3ZG0 A;  2HMO B;  4EYC A;  4IT7 A;  3MSO A;  1BSE A;  1BIR A;  1Y4K A;  1V74 A;  4MEI A;  1IVV A;  1FYS A;  4EXR A;  3NM2 A;  2OWP A;  2KF6 A;  3IJE B;  5IEN A;  3Q2P A;  2ZHX B;  4KZ1 A;  3WOF B;  1SQW A;  1W2B 2;  1B2M A;  1BRG A;  4RNY A;  2P38 A;  3CC4 3;  1IV9 A;  4BTW A;  1QAK A;  5M19 A;  1MWR A;  3D5G A;  3EQQ B;  2K3D A;  3FF0 A;  4K61 A;  4LYL B;  3I55 3;  2B1X B;  3K5T A;  1Q82 4;  1NU3 A;  1GYB A;  1M1X B;  1E97 A;  4HM3 B;  3CPO A;  4RNT A;  5G1L A;  5HGR A;  3D3L A;  3LYG A;  1US1 A;  2XGN A;  1BRI A;  2CW9 A;  5CXO A;  2QIY A;  3S28 A;  4BTX A;  5DRV A;  2W56 A;  4XBY A;  1YI2 3;  2YFJ B;  2P0X A;  4NHF A;  3S5C A;  3NBJ A;  4U13 A;  1OH0 A;  2O9U X;  2YX9 A;  1VZZ A;  1O7N B;  2CWU A;  4HBR A;  4R4K A;  4I5Q A;  3FZW A;  3PS8 A;  1UCI A;  2K0M A;  2CFD A;  1OUN A;  2OTL 3;  3KCH A;  3OV4 A;  1SAR A;  5IER A;  2W56 B;  1W6G A;  3KSE D;  2L1S A;  5LC6 A;  1JB4 A;  3HOH A;  3SOA A;  1BNG A;  1OGZ A;  4QWT A;  3T0U A;  1S72 3;  3H51 A;  3T8U A;  1YHQ 3;  1IT7 A;  2CKF B;  2CK3 H;  2GU1 A;  3GWR A;  3LTA A;  2QGU A;  3DUK A;  1BRS A;  2BNG A;  2W03 A;  2ZL8 A;  4HZB B;  2JQ5 A;  3SX1 A;  5JPP A;  3AGN A;  3KZT A;  1GY7 A;  1FGO A;  3D5I A;  1CH0 A;  2UUG C;  3ALA A;  1JB2 A;  1I8V A;  3QK9 A;  3V98 A;  1DVD A;  2CFL A;  1YIT 3;  1WQL B;  2IA7 A;  2SAR A;  4EC6 A;  8RNT A;  3CC7 3;  2R41 A;  3LT8 A;  1RLS A;  4G1M B;  4GHO A;  2BU4 A;  4HJL B;  5AI1 A;  1VQK 3;  1RTU A;  5G1K A;  5LC7 A;  3X40 A;  1PU4 A;  1CYU A;  1IQY A;  1ZS7 A;  2E2V A;  3AHS A;  1NO3 A;  4L7K A;  2IUJ A;  1AR0 A;  3HZP A;  3SLU A;  5D83 A;  3CCE 3;  3VF1 A;  1JZD A;  1TFO A;  2OOV C;  1K41 A;  1GMR A;  1MWT A;  1ULJ B;  1RSN A;  4XBX A;  1VQ4 3;  2BT3 A;  4AKY A;  2V1L A;  1GOV A;  5ELJ A;  3CC2 3;  1I0V A;  2WGQ A;  4N6V 0;  2CFG A;  3VGN A;  1TP6 A;  1ROA A;  1UI8 A;  3X3Y A;  3WA2 X;  4R9K A;  1V57 A;  4MJD A;  1G0T A;  1BRN L;  3EN8 A;  1U8C B;  5CF2 A;  1SII A;  2YFL B;  1K73 4;  2WOH A;  5DRE A;  1OHO A;  3BNB A;  1M9G A;  1BSB A;  5BXQ A;  4LZI A;  1LQG C;  2HMN B;  3NUV A;  1Q7Y 4;  1NJI 4;  1C7H A;  3NBR A;  1FUT A;  1I3F A;  1SIH A;  4HM0 B;  1JKG A;  3CCR 3;  2FXT A;  1FA3 A;  4H3U A;  4L8P A;  4O3V A;  1BUQ A;  3HIG A;  5IG3 A;  3HK4 A;  2GBX B;  1D6Y A;  3OWY A;  3X42 A;  3U1W A;  4IPB A;  5IG5 A;  3WA3 A;  4HM6 B;  2F4Y A;  1WNH A;  3GRD A;  1DET A;  3G16 A;  1VQQ A;  3GAX A;  4NPB A;  1O7W B;  2HOH A;  3DXO A;  1LXE A;  5AIG A;  1JKG B;  1O7M B;  3NQY A;  1BNI A;  1BVI A;  2H0H A;  3D4A A;  4O8S A;  1W2Z A;  2RNT A;  1W02 A;  3LTB A;  4FMD A;  4HKV B;  4KFE A;  5AII A;  3RDE A;  3WR2 A;  1JB5 A;  3K9M C;  4PEJ A;  3FG1 A;  2QEX 3;  3JUO A;  5BVB A;  3STD A;  5IF6 A;  2CFK A;  1JV2 B;  1J2B A;  3CNM A;  4BTY A;  1EKM A;  4HM4 B;  2BMQ B;  1JNQ A;  5M1A A;  3SOY A;  2AAE A;  3CCJ 3;  3A5E A;  1GSP A;  1VQ9 3;  3MWZ A;  1IK3 A;  1YVS A;  1GMP A;  2KF4 A;  2BMO B;  1JZO A;  1TIJ A;  3QRD A;  3D9R A;  1I3I A;  2KCD A;  3ER7 A;  2XEP A;  3FLJ A;  5TGN A;  3FG3 A;  3EHC A;  2W0Q A;  5JPU A;  3B7C A;  4L8O A;  2KF3 A;  1AVL A;  3NM7 A;  4OUQ A;  4BU4 A;  5AEW B;  2CIU A;  1Q40 A;  4KFD A;  2F98 A;  1UGH I;  1VQP 3;  2W2C A;  1WMP A;  1MGR A;  1QVF 2;  1TJD A;  3HX8 A;  3CCV 3;  1W00 A;  5HOH A;  4CPK A;  3V99 A;  3GSP A;  3NHX A;  2HMK B;  4HM7 B;  1DVC A;  2OQE C;  5AEU B;  3NBB A;  3LXU X;  1YNV X;  1JBT A;  1RRL A;  3N54 B;  4X2H A;  1Q9E A;  5AIF A;  1FGR A;  4TX4 A;  4HZ9 B;  1Q40 B;  1IYY A;  1OHP A;  1MNL A;  1IQX A;  5AYR B;  1CYV A;  3G4S 3;  1HU9 A;  1ROV A;  3N8B A;  3FH1 A;  1JRQ A;  4KFF A;  3O8Y A;  3MYT A;  3F14 A;  3URP A;  2BHM A;  2F86 B;  4LSO A;  4MMX B;  1YVB I;  3EJV A;  3PCR A;  4LGQ A;  2JDI H;  1CEW I;  4ORL A;  1NNV A;  3BND A;  3OWS A;  5BU4 A;  3BNE A;  1GOU A;  3U97 A;  4ZM8 A;  1GS3 A;  4N3V A;  2XFS A;  1RGK A;  4O02 B;  1NB5 I;  1YJ9 3;  3EBT A;  1BRK A;  1W4N A;  5KP4 A;  2IUK A;  1GOY A;  1LNH A;  1O7H B;  2XRX B;  3DGO A;  3DY5 A;  3KE7 A;  3KN4 A;  2F5M A;  3MG2 A;  4XBT A;  5EQL A;  4J9A A;  1RGG A;  1RHL A;  2ML5 A;  3ZFZ A;  2KAA A;  1OF5 A;  7STD A;  1X1X A;  1QAF A;  3CMA 3;  2A15 A;  3SVA A;  1V58 A;  4STD A;  1TU5 A;  1D6Z A;  3AGO A;  3OX9 A;  3ECF A;  3GZY B;  3OXA A;  4N6U A;  3SXX A;  3X3X A;  2P09 A;  4FMA A;  2MC8 A;  4EV2 A;  3WMD A;  2CG0 A;  2W9Q A;  3KSP A;  1R4Y A;  1OF5 B;  5FGO A;  1YGE A;  9RNT A;  1DE3 A;  1RN1 A;  5BIR A;  3CCS 3;  1G02 A;  2CH9 A;  1VQM 3;  4R80 A;  1RJO A;  2Z7A A;  1KQS 2;  1IVX A;  1MOL A;  3S27 A;  2P0M A;  3AHW A;  4XDV A;  1PYL A;  1WMN A;  3KFQ C;  6RNT A;  3H3H A;  2CX1 A;  3UL6 A;  2WGO A;  4N6L A;  3NX0 A;  2KXG A;  1OPY A;  1NDO B;  1S5A A;  2GEX A;  5STD A;  4BL2 A;  1Q42 A;  3EC9 A;  3CXC 2;  1E3V A;  1Q7H A;  1FUW A;  1B2U A;  1KD1 4;  5AIH A;  1I0X A;  4I4K A;  1JBS A;  4Q53 A;  1JJ2 2;  1G96 A;  3MHE A;  1MWS A;  4HM8 B;  1FGT A;  4JF8 A;  4MMZ B;  3F7S A;  1W7C A;  3WHO A;  4KVH A;  3M8C A;  3DGM A;  2D1W A;  2Q07 A;  1X1U A;  4J8T A;  1I2G A;  1TRQ A;  1UGI A;  1GY6 A;  2R4I A;  3JUP A;  1BNS A;  3B4P A;  1T2I A;  2RCD A;  3A76 A;  1I2F A;  2WO0 A;  4N6M A;  3PGB A;  3BU4 A;  2OOV A;  1C54 A;  1W6C A;  1BU4 A;  2W9P A;  4AKZ A;  1AQZ A;  4FCZ A;  3WDG B;  5A0O B;  1O7P B;  1VQL 3;  2PZV A;  3UJM A;  2IYJ A;  4GL6 A;  1RGA A;  1TTO A;  3F40 A;  1BNR A;  3FKA A;  1AY7 A;  3CCM 3;  1OHS A;  1EUI C;  1N9J A;  1QJG A;  2Z76 A;  1N5P A;  1YGW A;  3F8H A;  1DMQ A;  1JN5 A;  2XH9 A;  1LQM B;  2BIR A;  2UX0 A;  3DMC A;  1LVN A;  3BLZ A;  5IG0 A;  5KP1 A;  1B2Z A;  2F5W A;  1A2V A;  1IVU A;  1PY3 A;  1RGC A;  3DGY A;  1AVK A;  4K1U A;  4AEQ A;  3B8L A;  1BRH A;  1VQN 3;  3F9S A;  1KSI A;  2IY2 A;  3PXM A;  1VQ7 3;  1X1W A;  4FMC A;  3G71 3;  4KT3 B;  3MG1 A;  4J5K A;  1JN5 B;  1RNT A;  2BMR B;  3G0K A;  3T8N A;  2BO9 B;  3ZG5 A;  2IMJ A;  1RN4 A;  4EBG A;  6GSP A;  1FW7 A;  4RNZ A;  1N5H A;  1YIJ 3;  2GBW B;  2I9W A;  1YJW 3;  1IV7 A;  4HOH A;  1B21 A;  2M7O A;  3I0Y A;  2E2U A;  4HVN A;  1FUS A;  1M90 4;  4RZM A;  3Q3F A;  5EVH A;  4BL3 A;  4FMB A;  3ROB A;  5IEP A;  4EW5 A;  1PFP A;  1SPU A;  4XB5 A;  5IEO A;  8CHO A;  1QMA A;  1ZGX A;  3LT9 A;  1W5Z A;  1YJN 3;  1LOY A;  3CNX A;  2RSX A;  3TDG A;  1KWI A;  1BAO A;  2CFW A;  2GXF A;  4GB5 A;  2KRT A;  1T3B A;  1Z1S A;  3CU3 A;  1BNJ A;  1LRA A;  1SJW A;  7GSP A;  1HKX A;  2INX A;  4OVM A;  3LML A;  2Z77 A;  1RDS A;  3FF2 A;  3EB8 A;  3S67 A;  1IT8 A;  3FSD A;  1STD A;  3Q1C A;  4CCV A;  1EQK A;  1K28 A;  1IVW A;  5ELU A;  2L4V A;  1RN7 A;  1X1Y A;  1ISK A;  3NXJ A;  2UGI A;  1W01 A;  3JUN A;  1HZ1 A;  2OQE A;  2XR8 B;  1K9M 4;  1VQ5 3;  1AV4 A;  3X3Z A;  2STD A;  1BSC A;  1UCK A;  1B27 A;  4NRE A;  3FG4 A;  4ILF A;  4X2O A;  4GSP A;  1GMQ A;  4XM4 A;  5CLK A;  3DZL A;  5RNT A;  2XGL A;  1IQ8 A;  1UUW B;  3K7C A;  1TRP A;  3MG3 A;  4OK0 A;  3I56 3;  2Y73 A;  2HMJ B;  4J5G A;  1BSA A;  1VQO 3;  2W04 A;  2C11 A;  3JUQ A;  3KKG A;  4MMY B;  3F8X A;  3LTC A;  1E3R A;  3NV0 A;  5IG4 A;  3B4O A;  4HM2 B;  2CG1 A;  1GY5 A;  2ZA4 A;  2O3O A;  3LZA A;  4RBN A;  1BSD A;  1TFK A;  2D42 A;  2W6J H;  3CME 3;  4HAA A;  2HMM B;  1CQS A;  4K90 B;  2RBI A;  4CDL A;  2B24 B;  3CCU 3;  1STF I;  3IMA B;  5EEO A;  2E2T A;  4FCM A;  4BIR A;  1RGH A;  1FGQ A;  2WOF A;  3NV0 B;  4LEH A;  5CF1 A;  1RRH A;  2C10 A;  1N8Q A;  1ULI B;  3WOD G;  1RCK A;  3VSY A;  2OTJ 3;  2FNQ A;  3K63 A;  1WTH A;  1I2E A;  1NWW A;  1RMS A;  2K54 A;  2XSO B;  4N6T A;  1A2K A;  4WFO A;  1UCL A;  3HI7 A;  7RNT A;  2F99 A;  3BIR A;  3G6E 3;  4FCJ A;  3SYU A;  2GU3 A;  3PCS A;  6STD A;  3BNC A;  1JBR A;  4EV5 A;  4DKI A;  2HML B;  2GEY A;  1BOX A;  1N9E A;  1EEJ A;  3N9H A;  4O2H A;  1VQ6 3;  5IW9 A;  1DMM A;  4HM1 B;  3X41 A;  5G2G A;  3RNT A;  4N6N B;  3S29 A;  2XFT A;  2PNC A;  1IDP A;  1T5Y A;  2OCT A;  3DM8 A;  3GZX B;  1N8R 4;  2J8X B;  1LOW A;  3DH2 A;  1DYU A;  1BRJ A;  5M18 A;  3MPH A;  2XF3 A;  2RGQ A;  2P05 A;  1UCJ A;  1Q81 4;  3EE1 A;  3RGA A;  2ZDJ A;  5KP3 A;  1L5G B;  1F8N A;  1UUV B;  3J7Y d;  1DMN A;  3DGN A;  3PZW A;  3EBY A;  1WMO A;  1R4C A;  1W6Y A;  3CCL 3;  2CX0 A;  3F7X A;  1BAN A;  1UDI I;  3L0R A;  2Y74 A;  1BUJ A;  1OGX A;  5JBS A;  1LOV A;  5D81 A;  1B3S A;  1MGW A;  1T2H A;  4R1K A;  4N6O B;  4XDW A;  1GD4 A;  1QAL A;  3IPT A;  1LOX A;  3LTD A;  3LH4 A;  3AMO A;  1EA2 A;  3K0Z A;  3MKI A;  5D82 A;  1FZU A;  1MWU A;  2FGT A;  3DGL A;  1B2X A;  1B2S A;  1ZX2 A;  3CPW 2;  1A2P A;  1B20 A;  3Q90 A;  3SED A;  1RGF A;  2H0G A;  2CHC A;  2H0I A;  1QVG 2;  1RKY A;  3CD6 3;  3GZB A;  1BGS A;  4LMI A;  4FR9 A;  3OWU A;  1IU7 A;  1EG9 B;  1BNF A;  3FCS B;  3D79 A;  4H61 A;  3BB9 A;  2XSH B;  3AMO B;  3JUM A;  2CWV A;  2LQV A;  1VQ8 3;  1BNE A;  2RFR A;  3E99 A;  2ML6 A;  1RCL A;  3EF8 A;  5I97 A;  1FGM A;  1KC8 4;  3G8Z A;  2CC3 A;  4HM5 B;  1OAC A;  1M1K 4;  4CJN A;  1UW1 A;  2MF7 A;  3KII A;  1ASK A;  4IIA A;  4WYK A;  2Z6B A;  2QA4 3;  1RGL A;  1U5O A;  3PYJ A;  3GZR A;  4WP5 A;  2KF5 A;  4HYZ A;  1LNI A;  2YFI B;  3RGR A;  1RGE A;  1TUH A;  3LOY A;  1D6U A;  2AAD A;  2CWT A;  2SBL A;  3UNL A;  5CK6 A;  1O7G B;  1I70 A;  1ZO2 A;  3UB1 A;  3UL5 A;  4WYK B;  4JRF A;  2GSP A;  1UUG B;  3CCQ 3;  1NB3 I;  4K1V A;  5GSP A;  2LYX A;  2F56 A;  3OW2 2;  3EN1 B;  3FGY A; 
#chains in the Genus database with same CATH homology
 2C4B A;  4J5G A;  1BSA A;  2F4Y A;  1B2U A;  1DET A;  1I0X A;  1JBS A;  2ZA4 A;  1RNB A;  1HYF A;  2HOH A;  1BSD A;  3WHO A;  4HAA A;  1BNI A;  1BVI A;  2RBI A;  3D4A A;  2RNT A;  1BSE A;  1BIR A;  1X1U A;  1I2G A;  1TRQ A;  3WR2 A;  4BIR A;  1FYS A;  1RGH A;  1BNS A;  2KF6 A;  1T2I A;  1RCK A;  1I2F A;  3BU4 A;  1B2M A;  1BRG A;  1C54 A;  1I2E A;  1RMS A;  2AAE A;  3A5E A;  1GSP A;  1BU4 A;  1UCL A;  3D5G A;  1AQZ A;  7RNT A;  1YVS A;  1GMP A;  2KF4 A;  3BIR A;  3SYU A;  1RGA A;  1I3I A;  1TTO A;  4RNT A;  1BNR A;  1JBR A;  1AY7 A;  1BRI A;  1BOX A;  2KF3 A;  1YGW A;  4BU4 A;  3RNT A;  2BIR A;  1B2Z A;  1MGR A;  1LOW A;  1PY3 A;  1BRJ A;  1RGC A;  2F5W A;  3DGY A;  3DH2 A;  5HOH A;  1BRH A;  3GSP A;  1UCJ A;  1JBT A;  1UCI A;  1YNV X;  3KCH A;  1Q9E A;  1SAR A;  1X1W A;  4J5K A;  1RNT A;  1IYY A;  3HOH A;  1BNG A;  1RN4 A;  1FW7 A;  6GSP A;  1BAN A;  1BUJ A;  1LOV A;  1BRS A;  1B3S A;  1MGW A;  1T2H A;  3URP A;  3AGN A;  4HOH A;  1B21 A;  3D5I A;  1CH0 A;  1I8V A;  1FZU A;  5BU4 A;  1B2X A;  1B2S A;  1FUS A;  3Q3F A;  1B20 A;  1A2P A;  2SAR A;  1GOU A;  8RNT A;  1RGF A;  1RGK A;  1BRK A;  1RLS A;  1ZGX A;  4GHO A;  2BU4 A;  1LOY A;  1BGS A;  1GOY A;  1RTU A;  1BAO A;  1BNF A;  2F5M A;  3AHS A;  1RGG A;  1RHL A;  1BNJ A;  2KAA A;  1LRA A;  1X1X A;  1BNE A;  7GSP A;  1RCL A;  1GMR A;  3AGO A;  1RDS A;  1RSN A;  1GOV A;  1RGL A;  1I0V A;  1X1Y A;  2KF5 A;  1R4Y A;  1LNI A;  1BRN L;  9RNT A;  1RGE A;  1DE3 A;  1RN1 A;  5BIR A;  2AAD A;  1G02 A;  1HZ1 A;  1I70 A;  1BSC A;  1BSB A;  1UCK A;  1B27 A;  1PYL A;  3AHW A;  2GSP A;  5RNT A;  4GSP A;  1GMQ A;  6RNT A;  1FUT A;  5GSP A;  1I3F A;  2F56 A;  1TRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...