4J5KA

Crystal structure analysis of streptomyces aureofaciens ribonuclease sa y51f mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGFYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
publication title Contribution of hydrogen bonds to protein stability.
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4j5kA00
1RLSA 8RNTA 1MGRA 2F56A 1JBSA 2AADA 3BIRA 2KF5A 1TRPA 1UCJA 3HOHA 3D4AA 3URPA 1BRJA 3A5EA 4J5KA 2RBIA 1T2IA 1RGKA 1YGWA 1SARA 3AGOA 5GSPA 9RNTA 1BRIA 1AY7A 1BSCA 3D5IA 1A2PA 1X1UA 3KCHA 1BU4A 3RNTA 1B3SA 1CH0A 1GSPA 4GHOA 1BUJA 5BU4A 4BU4A 1BNFA 1BNSA 1RGLA 1RN1A 1TTOA 1BSDA 1MGWA 1G02A 1I2GA 1RGEA 1FUSA 1GOYA 1B21A 2BIRA 1ZGXA 1BSAA 1LRAA 7GSPA 2F5WA 1RGFA 1T2HA 1LOVA 1BNIA 1X1WA 2KF6A 1IYYA 1BIRA 1TRQA 1RGAA 1RNTA 1AQZA 1BRKA 1HZ1A 2RNTA 1GMRA 1BANA 2ZA4A 1BNRA 3AHSA 5BIRA 4HAAA 1B2SA 1BNEA 2F5MA 3Q3FA 1GMPA 1RHLA 1BRGA 1BOXA 1LOYA 1FUTA 2BU4A 2KAAA 1I8VA 1BAOA 1BVIA 1BRSA 1JBRA 2HOHA 1GOVA 1UCKA 5RNTA 2GSPA 1LNIA 1RGCA 3AHWA 3D5GA 3WR2A 3DH2A 1X1XA 1C54A 1RMSA 3WHOA 1YNVX 3BU4A 1B2MA 4RNTA 2F4YA 1RDSA 1I2EA 1BRHA 1UCIA 1B20A 1UCLA 1I0VA 1Q9EA 1DE3A 2AAEA 1PY3A 1RGHA 1RCLA 1YVSA 2KF3A 1JBTA 1BNJA 1RSNA 1FYSA 1RN4A 3GSPA 4GSPA 4BIRA 1GMQA 1I70A 6RNTA 1B27A 1LOWA 1I2FA 2C4BA 1I0XA 7RNTA 1GOUA 1FZUA 3DGYA 1PYLA 1HYFA 1B2UA 1RNBA 1BNGA 1I3IA 5HOHA 3SYUA 6GSPA 1RCKA 2SARA 4HOHA 4J5GA 1B2ZA 1R4YA 1BGSA 1RGGA 1BSEA 1RTUA 2KF4A 1I3FA 1B2XA 1X1YA 1DETA 1BSBA 3AGNA 1FW7A 1BRNL
chains in the Genus database with same CATH superfamily
3LTAA 3LOYA 2BO9B 1VQ43 1STDA 3D3LA 2UGIA 2E2UA 2F56A 3DGLA 5G2GA 5IF6A 4RNZA 3KSPA 2H0IA 2P38A 1FGRA 2RBIA 3F14A 4KVHA 5KP1A 3AGOA 1JRQA 2B1XB 4HM7B 1AY7A 3Q2PA 5IG3A 4QWTA 3MHEA 3F40A 1O7HB 3AMOA 2CWTA 2CG0A 1Y4KA 1GSPA 3DXOA 4AKYA 1BUJA 3JUOA 4N6NB 4BU4A 4O8SA 3LT8A 4EV2A 1SPUA 3CC43 1MWRA 2HMJB 1EUIC 3SOYA 2RGQA 1MGWA 1W2ZA 4N6LA 1I2GA 2XF3A 1FUSA 1MWSA 3EJVA 3MPHA 2BIRA 3V98A 3PZWA 2C10A 1RKYA 5ELUA 3NBBA 1WMOA 3F7XA 2IA7A 1RGFA 4XBTA 2CFWA 3HIGA 1IDPA 1X1WA 5IW9A 3FG1A 4FCMA 4O02B 4ZM8A 4G1MB 2GEYA 3IJEB 1O7MB 1K8A4 2K3DA 3X3YA 1BANA 1VQ63 1QAKA 3U1WA 2D1WA 5BIRA 2XSOB 1JNQA 4WP5A 1W01A 1BNEA 2MF7A 1GMPA 4XBYA 2JDIH 1VQ73 4ILFA 1JV2B 5AIGA 2OQEA 1IVXA 5D82A 1W2B2 4KFDA 1T5YA 1KQS2 5AEUB 3RGAA 1KWIA 1NB5I 4BL2A 1RN7A 2YFIB 1K9M4 4STDA 3CCS3 2R4IA 3B7CA 3AHWA 1FA3A 1IQ8A 3OWUA 1WNHA 2XFTA 4FR9A 3X40A 3NUVA 4FMCA 2W03A 3ZFZA 4R9KA 1W00A 2E2VA 1KD14 3F9SA 3BU4A 4RBNA 2UX0A 4HVNA 2QEX3 3MG3A 1AR0A 1I2EA 2KRTA 3NBJA 4MJDA 5AYSC 1UCIA 1I0VA 1Q9EA 3CCU3 1RCLA 2XGNA 3EN1B 4HJLB 1JBTA 3SX1A 1RSNA 3EX9A 1GD3A 3DMCA 3S5CA 1LVNA 2CFLA 2BMQB 2FNQA 6RNTA 1GMQA 1I70A 1JKGA 1UGHI 3D79A 1B27A 3BB9A 3BNBA 3G713 1JN5B 3QK9A 2C4BA 3B8LA 3NM7A 4EYCA 3G16A 1YJN3 1TU5A 3CC23 1E97A 2XFSA 3NV0A 3PCSA 1GY5A 3ECFA 3ROBA 3JUQA 3JUNA 2HMOB 1DMMA 3MG1A 2UUGC 3IPTA 2SARA 1MNLA 5CF2A 2W56B 2ZHXB 1GYBA 3OX9A 4BTXA 1AVLA 3UL6A 1UGIA 1RJOA 3HX8A 3M8CA 3EQQB 2STDA 3CNXA 5EEOA 1TJDA 1SIIA 8RNTA 3GRDA 2BHMA 1JB2A 3N9HA 1FGTA 1JBSA 2AADA 2RFRA 5HGRA 3SXXA 2Y74A 1UCJA 4U13A 1A2KA 2BMRB 4HM5B 1OF5A 1BRJA 1JJ22 2ZL8A 1IVUA 4CCVA 3RDEA 1YGWA 2JQ5A 3ZG5A 1CYVA 1QALA 3G6E3 2INXA 5EVHA 1K41A 1A2PA 1C7HA 1X1UA 3WA3A 3CCL3 4XDWA 1N9JA 3DGOA 1R4CA 2PNCA 2P0XA 1B3SA 4R80A 1VQL3 3SLUA 1BNSA 1RGLA 3WOFB 4OK0A 3WODG 4ORLA 1RN1A 1S5AA 1YJ93 4LYLB 1ZO2A 1S723 1GOYA 2OWPA 3I553 3WOEB 3LTBA 4IT7A 2CFGA 1UI8A 1BSAA 2YX9A 5AI1A 7GSPA 1N8R4 3GZYB 1JZOA 2XSHB 1EQKA 3CPOA 4X2OA 4HM2B 1Q42A 3GZXB 1LOVA 4HM3B 4IPBA 3FSDA 3MKIA 1M1K4 2XR8B 5AIIA 2GU3A 1IYYA 2Z76A 1BIRA 6STDA 3X42A 4TX4A 2ZA4A 1BNRA 3IMAB 3T8NA 2WGOA 1LQMB 4KT3B 4N6OB 5STDA 1M1XB 2BNGA 3ER7A 1QVG2 2D42A 3Q3FA 5JPUA 2B24B 4CJNA 2WO0A 1V58A 1BOXA 2F98A 2ZDJA 1LOYA 4L8OA 2GBXB 1KC84 3K9MC 1O7PB 1SQWA 2BU4A 2KAAA 4IIAA 1I8VA 3CCR3 3LH4A 3OXAA 3CCM3 2HOHA 1UCKA 4X2HA 4EC6A 2IUKA 1TFOA 3OWSA 5BVBA 4MMXB 1Q40A 4N6TA 1MWTA 3GAXA 3B4OA 4I5QA 2HMNB 3LTCA 3STDA 3EHCA 4N6V0 1CEWI 2J8XB 4BL3A 4LSOA 3H51A 4OUQA 3WHOA 4I4KA 3DGMA 3GZRA 5IERA 1YHQ3 3G8ZA 1ULJB 2FXTA 4MMYB 1ROAA 2GEXA 2CW9A 4NHFA 4RNTA 1RDSA 1RRLA 2Z7AA 5KP3A 1GY7A 1UW1A 1BRHA 1NDOB 1UCLA 1IT7A 5BXQA 1W5ZA 1STFI 2KF3A 3F8HA 3SOAA 4EV5A 3NM2A 2RSXA 3FF0A 3KZTA 3NV0B 1A90A 1RN4A 2BMOB 1WTHA 1MWUA 3FGYA 4WYKB 4BIRA 1K734 3LZAA 1VQP3 2GXFA 1I2FA 3PS8A 3K63A 3S67A 1I0XA 4LMIA 3OWYA 3L0RA 3I563 3BNEA 3DGYA 3V99A 1VQ53 1DVCA 2OOVC 5IENA 1OACA 1F8NA 3CU3A 5AEWB 1RNBA 3WA2X 1BNGA 1I3IA 5HOHA 1RCKA 5JPPA 2IMJA 2HMLB 1B2ZA 1R4YA 1UUGB 1BGSA 1RGGA 2KF4A 3H3HA 4HOHA 4J5GA 5G1KA 3OW22 1T3BA 2W9PA 1OF5B 1BSBA 2OTJ3 5JBSA 1FW7A 1IV9A 1BRNL 1N9EA 4HM8B 5AIFA 5AYRB 5CXOA 3S28A 3X3XA 1JB4A 1W02A 3LMLA 1SIHA 3BIRA 4N6MA 1U5OA 1WMPA 2CFDA 1SJWA 1DMNA 1WQLB 3D4AA 3HOHA 3DZLA 1UUWB 1W7CA 3D9RA 5KP4A 1HU9A 1Q7HA 1W6CA 3KN4A 2W6JH 3NX0A 4XDVA 2CFKA 3A5EA 4MEIA 1T2IA 1PU4A 3NHXA 3UJMA 1SARA 4FMAA 5GSPA 9RNTA 1BRIA 4DKIA 5CK6A 3D5IA 2K54A 3WMDA 3CXC2 1W6YA 2QGUA 1BU4A 3EF8A 2F99A 3HK4A 1ULIB 3K7CA 2KXGA 4H3UA 1VQK3 1VQ83 1ASKA 1OUNA 4HM6B 2CHCA 1CH0A 5FW5A 3T8UA 5DRVA 1EA2A 4CPKA 1M904 3MYTA 2HMKB 1IQXA 2H0HA 1U8CB 3ALAA 1TTOA 1BSDA 3HZPA 3N54B 1EEJA 1G02A 2CH9A 4R9LA 4FMDA 1AV4A 2H0GA 1ZGXA 4FCZA 3V92A 2ML6A 1LRAA 2O9UX 3EN8A 4NPBA 2F5WA 4GB5A 1DVDA 5M1AA 1OHOA 3AMOB 1NNVA 4BTWA 1TIJA 3S27A 1LNHA 1UUVB 1TRQA 4HZBB 1GD4A 1BRKA 1HZ1A 3JUPA 2I9WA 1FGQA 3ZG0A 1HKXA 3AHSA 1LXEA 2BT3A 2IY2A 1YIJ3 5ELJA 4WHAA 1IU7A 5AIHA 1RHLA 4XB5A 1Q40B 3K0ZA 1L5GB 3CCQ3 3EB8A 1VQM3 3PYJA 1TFKA 1YGEA 4FCJA 1JBRA 3E99A 2ML5A 1Q7Y4 1GOVA 1ZS7A 5D83A 2XGLA 1CQSA 2GSPA 1OH0A 7STDA 2XH9A 4FMBA 5CLKA 3DH2A 2A15A 1D6ZA 1OPYA 1X1XA 2YFJB 1C54A 1E3VA 1RMSA 4AKZA 1D6UA 3JUMA 1QMAA 2XRXB 4XM4A 1IK3A 1YNVX 1A2VA 1JN5A 3EE1A 4EW5A 2O3OA 2K0MA 2LYXA 3DM8A 4PEJA 2W0QA 5LC6A 1B2MA 1A67A 1IVWA 4JRFA 1VQN3 2OCTA 4H61A 2HMMB 1GS3A 3NQZA 1QJGA 1PY3A 1RGHA 2WGQA 3EBTA 1YVSA 3KSED 2QIYA 1BNJA 3BNDA 5IG0A 3Q1CA 1TP6A 3KE7A 3GSPA 5IG5A 1IVVA 4GL6A 4EXRA 4R1KA 2W56A 1LOWA 3B4PA 3FKAA 4KFEA 3PXMA 3CCE3 4BTYA 3UL5A 1GOUA 4HZ9B 1FZUA 1FGMA 1UI7A 4NREA 1PYLA 4OVMA 1DMQA 4R4KA 5LC7A 1HYFA 1ZX2A 1B2UA 3RGRA 2XEPA 3GZBA 1OGXA 2V1LA 3KKGA 4HM4B 3SVAA 1JKGB 3UB1A 2GBWB 1I3FA 1US1A 1B2XA 1KSIA 1MOLA 1OCVA 3QRDA 4L8PA 4LEHA 3AGNA 1NJI4 3X41A 1LQGC 4WWUC 2P0MA 1JZDA 1DYUA 1RLSA 4O2HA 3EBYA 1MGRA 3CPW2 1EKMA 3UNLA 2KF5A 1TRPA 2CWUA 3BNCA 3URPA 3CCJ3 2Z77A 3LTDA 1VQQA 1FUWA 1UDII 4HKVB 2MC8A 4J5KA 2OTL3 1RGKA 3DY5A 3DGNA 4HM0B 1V74A 4WFOA 1BSCA 2OQEC 4RNYA 3KCHA 4K1UA 2LQVA 5EQLA 3VGNA 1JB5A 3FCSB 3LYGA 4LGQA 3A76A 2QA43 2WOHA 3RNTA 1VQ93 3CNMA 5DREA 2IYJA 1V57A 3G0KA 4GHOA 2OOVA 3OV4A 5BU4A 4KZ1A 1BNFA 3T0UA 2P09A 4HBRA 3U97A 1YVBI 1IQYA 1TUHA 2Z6BA 1QAFA 2E2TA 4N6UA 4RZMA 1QVF2 1RGEA 1B21A 1ROVA 1FGOA 2Q07A 3X3ZA 1O7GB 2CG1A 3LT9A 3WDGB 2P05A 2R41A 2W9QA 1VQO3 1Q864 1T2HA 4J9AA 5IEOA 4AEQA 2CKFB 2GU1A 1BNIA 3FG3A 1EG9B 1YIT3 2KF6A 2PZVA 2M7OA 3FF2A 4JF8A 4O3VA 1RGAA 1RNTA 1AQZA 2RNTA 4HYZA 3CME3 1GMRA 2WOFA 3HI7A 3S29A 1Q824 3NQYA 1IT8A 4HAAA 1B2SA 2RCDA 1NO3A 3DUKA 2F5MA 4HM1B 4K1VA 1WMNA 2CIUA 4J8TA 4Q53A 1BRGA 5D81A 3HIIA 1OHSA 3NXJA 4K90B 3VF1A 5TGNA 3PGBA 1FUTA 1K28A 3F8XA 1N8QA 2CWVA 5M18A 1BAOA 1E3RA 2W04A 1BVIA 1D6YA 3CD63 1G96A 1BRSA 3Q90A 5RNTA 3BLZA 1ISKA 1NB3I 2CK3H 3KFQC 1LNIA 1RGCA 2CC3A 3EC9A 3D5GA 1W6GA 3MG2A 5M19A 2IUJA 3WR2A 2Y73A 2CX0A 4WYKA 1O7NB 3FG4A 8CHOA 3CC73 1J2BA 4MMZB 4EBGA 3O8YA 5IEPA 4KFFA 1CYUA 5IG4A 1N5HA 1PFPA 2F4YA 3NBRA 5FGOA 2YFLB 3CCV3 1GY6A 1NWWA 1Z1SA 2F86B 2L1SA 4LZIA 1B20A 3SEDA 3K5TA 5G1LA 2AAEA 4L7KA 1DE3A 1IV7A 3JVCA 4XBXA 3TDGA 5CF1A 3VSYA 1O7WB 3F7SA 3MWZA 1FYSA 1BUQA 3N8BA 3PCRA 4GSPA 1N5PA 3I0YA 4CDLA 3GWRA 3FLJA 1LOXA 1NU3A 4K61A 7RNTA 3LXUX 3G4S3 1Q814 1AVKA 1M9GA 2C11A 1OGZA 3KIIA 4N3VA 3FZWA 2CX1A 3FH1A 2KCDA 3J7Yd 1OHPA 2L4VA 1G0TA 2W2CA 3SYUA 6GSPA 3CMA3 3MSOA 1YI23 1BSEA 1RTUA 5A0OB 1YJW3 2SBLA 1RRHA 1VZZA 1DETA 1X1YA 5I97A 2FGTA 1W4NA
chains in the Genus database with same CATH topology
1RLSA 8RNTA 1MGRA 2F56A 1JBSA 2AADA 3BIRA 2KF5A 1TRPA 1UCJA 3HOHA 3D4AA 3URPA 1BRJA 3A5EA 4J5KA 2RBIA 1T2IA 1RGKA 1YGWA 1SARA 3AGOA 5GSPA 9RNTA 1BRIA 1AY7A 1BSCA 3D5IA 1A2PA 1X1UA 3KCHA 1BU4A 3RNTA 1B3SA 1CH0A 1GSPA 4GHOA 1BUJA 5BU4A 4BU4A 1BNFA 1BNSA 1RGLA 1RN1A 1TTOA 1BSDA 1MGWA 1G02A 1I2GA 1RGEA 1FUSA 1GOYA 1B21A 2BIRA 1ZGXA 1BSAA 1LRAA 7GSPA 2F5WA 1RGFA 1T2HA 1LOVA 1BNIA 1X1WA 2KF6A 1IYYA 1BIRA 1TRQA 1RGAA 1RNTA 1AQZA 1BRKA 1HZ1A 2RNTA 1GMRA 1BANA 2ZA4A 1BNRA 3AHSA 5BIRA 4HAAA 1B2SA 1BNEA 2F5MA 3Q3FA 1GMPA 1RHLA 1BRGA 1BOXA 1LOYA 1FUTA 2BU4A 2KAAA 1I8VA 1BAOA 1BVIA 1BRSA 1JBRA 2HOHA 1GOVA 1UCKA 5RNTA 2GSPA 1LNIA 1RGCA 3AHWA 3D5GA 3WR2A 3DH2A 1X1XA 1C54A 1RMSA 3WHOA 1YNVX 3BU4A 1B2MA 4RNTA 2F4YA 1RDSA 1I2EA 1BRHA 1UCIA 1B20A 1UCLA 1I0VA 1Q9EA 1DE3A 2AAEA 1PY3A 1RGHA 1RCLA 1YVSA 2KF3A 1JBTA 1BNJA 1RSNA 1FYSA 1RN4A 3GSPA 4GSPA 4BIRA 1GMQA 1I70A 6RNTA 1B27A 1LOWA 1I2FA 2C4BA 1I0XA 7RNTA 1GOUA 1FZUA 3DGYA 1PYLA 1HYFA 1B2UA 1RNBA 1BNGA 1I3IA 5HOHA 3SYUA 6GSPA 1RCKA 2SARA 4HOHA 4J5GA 1B2ZA 1R4YA 1BGSA 1RGGA 1BSEA 1RTUA 2KF4A 1I3FA 1B2XA 1X1YA 1DETA 1BSBA 3AGNA 1FW7A 1BRNL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLS A;  8RNT A;  1MGR A;  2F56 A;  1JBS A;  2AAD A;  3BIR A;  2KF5 A;  1TRP A;  1UCJ A;  3HOH A;  3D4A A;  3URP A;  1BRJ A;  3A5E A;  4J5K A;  2RBI A;  1T2I A;  1RGK A;  1YGW A;  1SAR A;  3AGO A;  5GSP A;  9RNT A;  1BRI A;  1AY7 A;  1BSC A;  3D5I A;  1A2P A;  1X1U A;  3KCH A;  1BU4 A;  3RNT A;  1B3S A;  1CH0 A;  1GSP A;  4GHO A;  1BUJ A;  5BU4 A;  4BU4 A;  1BNF A;  1BNS A;  1RGL A;  1RN1 A;  1TTO A;  1BSD A;  1MGW A;  1G02 A;  1I2G A;  1RGE A;  1FUS A;  1GOY A;  1B21 A;  2BIR A;  1ZGX A;  1BSA A;  1LRA A;  7GSP A;  2F5W A;  1RGF A;  1T2H A;  1LOV A;  1BNI A;  1X1W A;  2KF6 A;  1IYY A;  1BIR A;  1TRQ A;  1RGA A;  1RNT A;  1AQZ A;  1BRK A;  1HZ1 A;  2RNT A;  1GMR A;  1BAN A;  2ZA4 A;  1BNR A;  3AHS A;  5BIR A;  4HAA A;  1B2S A;  1BNE A;  2F5M A;  3Q3F A;  1GMP A;  1RHL A;  1BRG A;  1BOX A;  1LOY A;  1FUT A;  2BU4 A;  2KAA A;  1I8V A;  1BAO A;  1BVI A;  1BRS A;  1JBR A;  2HOH A;  1GOV A;  1UCK A;  5RNT A;  2GSP A;  1LNI A;  1RGC A;  3AHW A;  3D5G A;  3WR2 A;  3DH2 A;  1X1X A;  1C54 A;  1RMS A;  3WHO A;  1YNV X;  3BU4 A;  1B2M A;  4RNT A;  2F4Y A;  1RDS A;  1I2E A;  1BRH A;  1UCI A;  1B20 A;  1UCL A;  1I0V A;  1Q9E A;  1DE3 A;  2AAE A;  1PY3 A;  1RGH A;  1RCL A;  1YVS A;  2KF3 A;  1JBT A;  1BNJ A;  1RSN A;  1FYS A;  1RN4 A;  3GSP A;  4GSP A;  4BIR A;  1GMQ A;  1I70 A;  6RNT A;  1B27 A;  1LOW A;  1I2F A;  2C4B A;  1I0X A;  7RNT A;  1GOU A;  1FZU A;  3DGY A;  1PYL A;  1HYF A;  1B2U A;  1RNB A;  1BNG A;  1I3I A;  5HOH A;  3SYU A;  6GSP A;  1RCK A;  2SAR A;  4HOH A;  4J5G A;  1B2Z A;  1R4Y A;  1BGS A;  1RGG A;  1BSE A;  1RTU A;  2KF4 A;  1I3F A;  1B2X A;  1X1Y A;  1DET A;  1BSB A;  3AGN A;  1FW7 A;  1BRN L; 
#chains in the Genus database with same CATH topology
 3LTA A;  3LOY A;  2BO9 B;  1VQ4 3;  1STD A;  3D3L A;  2UGI A;  2E2U A;  2F56 A;  3DGL A;  5G2G A;  5IF6 A;  4RNZ A;  3KSP A;  2H0I A;  2P38 A;  1FGR A;  2RBI A;  3F14 A;  4KVH A;  5KP1 A;  3AGO A;  1JRQ A;  2B1X B;  4HM7 B;  1AY7 A;  3Q2P A;  5IG3 A;  4QWT A;  3MHE A;  3F40 A;  1O7H B;  3AMO A;  2CWT A;  2CG0 A;  1Y4K A;  1GSP A;  3DXO A;  4AKY A;  1BUJ A;  3JUO A;  4N6N B;  4BU4 A;  4O8S A;  3LT8 A;  4EV2 A;  1SPU A;  3CC4 3;  1MWR A;  2HMJ B;  1EUI C;  3SOY A;  2RGQ A;  1MGW A;  1W2Z A;  4N6L A;  1I2G A;  2XF3 A;  1FUS A;  1MWS A;  3EJV A;  3MPH A;  2BIR A;  3V98 A;  3PZW A;  2C10 A;  1RKY A;  5ELU A;  3NBB A;  1WMO A;  3F7X A;  2IA7 A;  1RGF A;  4XBT A;  2CFW A;  3HIG A;  1IDP A;  1X1W A;  5IW9 A;  3FG1 A;  4FCM A;  4O02 B;  4ZM8 A;  4G1M B;  2GEY A;  3IJE B;  1O7M B;  1K8A 4;  2K3D A;  3X3Y A;  1BAN A;  1VQ6 3;  1QAK A;  3U1W A;  2D1W A;  5BIR A;  2XSO B;  1JNQ A;  4WP5 A;  1W01 A;  1BNE A;  2MF7 A;  1GMP A;  4XBY A;  2JDI H;  1VQ7 3;  4ILF A;  1JV2 B;  5AIG A;  2OQE A;  1IVX A;  5D82 A;  1W2B 2;  4KFD A;  1T5Y A;  1KQS 2;  5AEU B;  3RGA A;  1KWI A;  1NB5 I;  4BL2 A;  1RN7 A;  2YFI B;  1K9M 4;  4STD A;  3CCS 3;  2R4I A;  3B7C A;  3AHW A;  1FA3 A;  1IQ8 A;  3OWU A;  1WNH A;  2XFT A;  4FR9 A;  3X40 A;  3NUV A;  4FMC A;  2W03 A;  3ZFZ A;  4R9K A;  1W00 A;  2E2V A;  1KD1 4;  3F9S A;  3BU4 A;  4RBN A;  2UX0 A;  4HVN A;  2QEX 3;  3MG3 A;  1AR0 A;  1I2E A;  2KRT A;  3NBJ A;  4MJD A;  5AYS C;  1UCI A;  1I0V A;  1Q9E A;  3CCU 3;  1RCL A;  2XGN A;  3EN1 B;  4HJL B;  1JBT A;  3SX1 A;  1RSN A;  3EX9 A;  1GD3 A;  3DMC A;  3S5C A;  1LVN A;  2CFL A;  2BMQ B;  2FNQ A;  6RNT A;  1GMQ A;  1I70 A;  1JKG A;  1UGH I;  3D79 A;  1B27 A;  3BB9 A;  3BNB A;  3G71 3;  1JN5 B;  3QK9 A;  2C4B A;  3B8L A;  3NM7 A;  4EYC A;  3G16 A;  1YJN 3;  1TU5 A;  3CC2 3;  1E97 A;  2XFS A;  3NV0 A;  3PCS A;  1GY5 A;  3ECF A;  3ROB A;  3JUQ A;  3JUN A;  2HMO B;  1DMM A;  3MG1 A;  2UUG C;  3IPT A;  2SAR A;  1MNL A;  5CF2 A;  2W56 B;  2ZHX B;  1GYB A;  3OX9 A;  4BTX A;  1AVL A;  3UL6 A;  1UGI A;  1RJO A;  3HX8 A;  3M8C A;  3EQQ B;  2STD A;  3CNX A;  5EEO A;  1TJD A;  1SII A;  8RNT A;  3GRD A;  2BHM A;  1JB2 A;  3N9H A;  1FGT A;  1JBS A;  2AAD A;  2RFR A;  5HGR A;  3SXX A;  2Y74 A;  1UCJ A;  4U13 A;  1A2K A;  2BMR B;  4HM5 B;  1OF5 A;  1BRJ A;  1JJ2 2;  2ZL8 A;  1IVU A;  4CCV A;  3RDE A;  1YGW A;  2JQ5 A;  3ZG5 A;  1CYV A;  1QAL A;  3G6E 3;  2INX A;  5EVH A;  1K41 A;  1A2P A;  1C7H A;  1X1U A;  3WA3 A;  3CCL 3;  4XDW A;  1N9J A;  3DGO A;  1R4C A;  2PNC A;  2P0X A;  1B3S A;  4R80 A;  1VQL 3;  3SLU A;  1BNS A;  1RGL A;  3WOF B;  4OK0 A;  3WOD G;  4ORL A;  1RN1 A;  1S5A A;  1YJ9 3;  4LYL B;  1ZO2 A;  1S72 3;  1GOY A;  2OWP A;  3I55 3;  3WOE B;  3LTB A;  4IT7 A;  2CFG A;  1UI8 A;  1BSA A;  2YX9 A;  5AI1 A;  7GSP A;  1N8R 4;  3GZY B;  1JZO A;  2XSH B;  1EQK A;  3CPO A;  4X2O A;  4HM2 B;  1Q42 A;  3GZX B;  1LOV A;  4HM3 B;  4IPB A;  3FSD A;  3MKI A;  1M1K 4;  2XR8 B;  5AII A;  2GU3 A;  1IYY A;  2Z76 A;  1BIR A;  6STD A;  3X42 A;  4TX4 A;  2ZA4 A;  1BNR A;  3IMA B;  3T8N A;  2WGO A;  1LQM B;  4KT3 B;  4N6O B;  5STD A;  1M1X B;  2BNG A;  3ER7 A;  1QVG 2;  2D42 A;  3Q3F A;  5JPU A;  2B24 B;  4CJN A;  2WO0 A;  1V58 A;  1BOX A;  2F98 A;  2ZDJ A;  1LOY A;  4L8O A;  2GBX B;  1KC8 4;  3K9M C;  1O7P B;  1SQW A;  2BU4 A;  2KAA A;  4IIA A;  1I8V A;  3CCR 3;  3LH4 A;  3OXA A;  3CCM 3;  2HOH A;  1UCK A;  4X2H A;  4EC6 A;  2IUK A;  1TFO A;  3OWS A;  5BVB A;  4MMX B;  1Q40 A;  4N6T A;  1MWT A;  3GAX A;  3B4O A;  4I5Q A;  2HMN B;  3LTC A;  3STD A;  3EHC A;  4N6V 0;  1CEW I;  2J8X B;  4BL3 A;  4LSO A;  3H51 A;  4OUQ A;  3WHO A;  4I4K A;  3DGM A;  3GZR A;  5IER A;  1YHQ 3;  3G8Z A;  1ULJ B;  2FXT A;  4MMY B;  1ROA A;  2GEX A;  2CW9 A;  4NHF A;  4RNT A;  1RDS A;  1RRL A;  2Z7A A;  5KP3 A;  1GY7 A;  1UW1 A;  1BRH A;  1NDO B;  1UCL A;  1IT7 A;  5BXQ A;  1W5Z A;  1STF I;  2KF3 A;  3F8H A;  3SOA A;  4EV5 A;  3NM2 A;  2RSX A;  3FF0 A;  3KZT A;  3NV0 B;  1A90 A;  1RN4 A;  2BMO B;  1WTH A;  1MWU A;  3FGY A;  4WYK B;  4BIR A;  1K73 4;  3LZA A;  1VQP 3;  2GXF A;  1I2F A;  3PS8 A;  3K63 A;  3S67 A;  1I0X A;  4LMI A;  3OWY A;  3L0R A;  3I56 3;  3BNE A;  3DGY A;  3V99 A;  1VQ5 3;  1DVC A;  2OOV C;  5IEN A;  1OAC A;  1F8N A;  3CU3 A;  5AEW B;  1RNB A;  3WA2 X;  1BNG A;  1I3I A;  5HOH A;  1RCK A;  5JPP A;  2IMJ A;  2HML B;  1B2Z A;  1R4Y A;  1UUG B;  1BGS A;  1RGG A;  2KF4 A;  3H3H A;  4HOH A;  4J5G A;  5G1K A;  3OW2 2;  1T3B A;  2W9P A;  1OF5 B;  1BSB A;  2OTJ 3;  5JBS A;  1FW7 A;  1IV9 A;  1BRN L;  1N9E A;  4HM8 B;  5AIF A;  5AYR B;  5CXO A;  3S28 A;  3X3X A;  1JB4 A;  1W02 A;  3LML A;  1SIH A;  3BIR A;  4N6M A;  1U5O A;  1WMP A;  2CFD A;  1SJW A;  1DMN A;  1WQL B;  3D4A A;  3HOH A;  3DZL A;  1UUW B;  1W7C A;  3D9R A;  5KP4 A;  1HU9 A;  1Q7H A;  1W6C A;  3KN4 A;  2W6J H;  3NX0 A;  4XDV A;  2CFK A;  3A5E A;  4MEI A;  1T2I A;  1PU4 A;  3NHX A;  3UJM A;  1SAR A;  4FMA A;  5GSP A;  9RNT A;  1BRI A;  4DKI A;  5CK6 A;  3D5I A;  2K54 A;  3WMD A;  3CXC 2;  1W6Y A;  2QGU A;  1BU4 A;  3EF8 A;  2F99 A;  3HK4 A;  1ULI B;  3K7C A;  2KXG A;  4H3U A;  1VQK 3;  1VQ8 3;  1ASK A;  1OUN A;  4HM6 B;  2CHC A;  1CH0 A;  5FW5 A;  3T8U A;  5DRV A;  1EA2 A;  4CPK A;  1M90 4;  3MYT A;  2HMK B;  1IQX A;  2H0H A;  1U8C B;  3ALA A;  1TTO A;  1BSD A;  3HZP A;  3N54 B;  1EEJ A;  1G02 A;  2CH9 A;  4R9L A;  4FMD A;  1AV4 A;  2H0G A;  1ZGX A;  4FCZ A;  3V92 A;  2ML6 A;  1LRA A;  2O9U X;  3EN8 A;  4NPB A;  2F5W A;  4GB5 A;  1DVD A;  5M1A A;  1OHO A;  3AMO B;  1NNV A;  4BTW A;  1TIJ A;  3S27 A;  1LNH A;  1UUV B;  1TRQ A;  4HZB B;  1GD4 A;  1BRK A;  1HZ1 A;  3JUP A;  2I9W A;  1FGQ A;  3ZG0 A;  1HKX A;  3AHS A;  1LXE A;  2BT3 A;  2IY2 A;  1YIJ 3;  5ELJ A;  4WHA A;  1IU7 A;  5AIH A;  1RHL A;  4XB5 A;  1Q40 B;  3K0Z A;  1L5G B;  3CCQ 3;  3EB8 A;  1VQM 3;  3PYJ A;  1TFK A;  1YGE A;  4FCJ A;  1JBR A;  3E99 A;  2ML5 A;  1Q7Y 4;  1GOV A;  1ZS7 A;  5D83 A;  2XGL A;  1CQS A;  2GSP A;  1OH0 A;  7STD A;  2XH9 A;  4FMB A;  5CLK A;  3DH2 A;  2A15 A;  1D6Z A;  1OPY A;  1X1X A;  2YFJ B;  1C54 A;  1E3V A;  1RMS A;  4AKZ A;  1D6U A;  3JUM A;  1QMA A;  2XRX B;  4XM4 A;  1IK3 A;  1YNV X;  1A2V A;  1JN5 A;  3EE1 A;  4EW5 A;  2O3O A;  2K0M A;  2LYX A;  3DM8 A;  4PEJ A;  2W0Q A;  5LC6 A;  1B2M A;  1A67 A;  1IVW A;  4JRF A;  1VQN 3;  2OCT A;  4H61 A;  2HMM B;  1GS3 A;  3NQZ A;  1QJG A;  1PY3 A;  1RGH A;  2WGQ A;  3EBT A;  1YVS A;  3KSE D;  2QIY A;  1BNJ A;  3BND A;  5IG0 A;  3Q1C A;  1TP6 A;  3KE7 A;  3GSP A;  5IG5 A;  1IVV A;  4GL6 A;  4EXR A;  4R1K A;  2W56 A;  1LOW A;  3B4P A;  3FKA A;  4KFE A;  3PXM A;  3CCE 3;  4BTY A;  3UL5 A;  1GOU A;  4HZ9 B;  1FZU A;  1FGM A;  1UI7 A;  4NRE A;  1PYL A;  4OVM A;  1DMQ A;  4R4K A;  5LC7 A;  1HYF A;  1ZX2 A;  1B2U A;  3RGR A;  2XEP A;  3GZB A;  1OGX A;  2V1L A;  3KKG A;  4HM4 B;  3SVA A;  1JKG B;  3UB1 A;  2GBW B;  1I3F A;  1US1 A;  1B2X A;  1KSI A;  1MOL A;  1OCV A;  3QRD A;  4L8P A;  4LEH A;  3AGN A;  1NJI 4;  3X41 A;  1LQG C;  4WWU C;  2P0M A;  1JZD A;  1DYU A;  1RLS A;  4O2H A;  3EBY A;  1MGR A;  3CPW 2;  1EKM A;  3UNL A;  2KF5 A;  1TRP A;  2CWU A;  3BNC A;  3URP A;  3CCJ 3;  2Z77 A;  3LTD A;  1VQQ A;  1FUW A;  1UDI I;  4HKV B;  2MC8 A;  4J5K A;  2OTL 3;  1RGK A;  3DY5 A;  3DGN A;  4HM0 B;  1V74 A;  4WFO A;  1BSC A;  2OQE C;  4RNY A;  3KCH A;  4K1U A;  2LQV A;  5EQL A;  3VGN A;  1JB5 A;  3FCS B;  3LYG A;  4LGQ A;  3A76 A;  2QA4 3;  2WOH A;  3RNT A;  1VQ9 3;  3CNM A;  5DRE A;  2IYJ A;  1V57 A;  3G0K A;  4GHO A;  2OOV A;  3OV4 A;  5BU4 A;  4KZ1 A;  1BNF A;  3T0U A;  2P09 A;  4HBR A;  3U97 A;  1YVB I;  1IQY A;  1TUH A;  2Z6B A;  1QAF A;  2E2T A;  4N6U A;  4RZM A;  1QVF 2;  1RGE A;  1B21 A;  1ROV A;  1FGO A;  2Q07 A;  3X3Z A;  1O7G B;  2CG1 A;  3LT9 A;  3WDG B;  2P05 A;  2R41 A;  2W9Q A;  1VQO 3;  1Q86 4;  1T2H A;  4J9A A;  5IEO A;  4AEQ A;  2CKF B;  2GU1 A;  1BNI A;  3FG3 A;  1EG9 B;  1YIT 3;  2KF6 A;  2PZV A;  2M7O A;  3FF2 A;  4JF8 A;  4O3V A;  1RGA A;  1RNT A;  1AQZ A;  2RNT A;  4HYZ A;  3CME 3;  1GMR A;  2WOF A;  3HI7 A;  3S29 A;  1Q82 4;  3NQY A;  1IT8 A;  4HAA A;  1B2S A;  2RCD A;  1NO3 A;  3DUK A;  2F5M A;  4HM1 B;  4K1V A;  1WMN A;  2CIU A;  4J8T A;  4Q53 A;  1BRG A;  5D81 A;  3HII A;  1OHS A;  3NXJ A;  4K90 B;  3VF1 A;  5TGN A;  3PGB A;  1FUT A;  1K28 A;  3F8X A;  1N8Q A;  2CWV A;  5M18 A;  1BAO A;  1E3R A;  2W04 A;  1BVI A;  1D6Y A;  3CD6 3;  1G96 A;  1BRS A;  3Q90 A;  5RNT A;  3BLZ A;  1ISK A;  1NB3 I;  2CK3 H;  3KFQ C;  1LNI A;  1RGC A;  2CC3 A;  3EC9 A;  3D5G A;  1W6G A;  3MG2 A;  5M19 A;  2IUJ A;  3WR2 A;  2Y73 A;  2CX0 A;  4WYK A;  1O7N B;  3FG4 A;  8CHO A;  3CC7 3;  1J2B A;  4MMZ B;  4EBG A;  3O8Y A;  5IEP A;  4KFF A;  1CYU A;  5IG4 A;  1N5H A;  1PFP A;  2F4Y A;  3NBR A;  5FGO A;  2YFL B;  3CCV 3;  1GY6 A;  1NWW A;  1Z1S A;  2F86 B;  2L1S A;  4LZI A;  1B20 A;  3SED A;  3K5T A;  5G1L A;  2AAE A;  4L7K A;  1DE3 A;  1IV7 A;  3JVC A;  4XBX A;  3TDG A;  5CF1 A;  3VSY A;  1O7W B;  3F7S A;  3MWZ A;  1FYS A;  1BUQ A;  3N8B A;  3PCR A;  4GSP A;  1N5P A;  3I0Y A;  4CDL A;  3GWR A;  3FLJ A;  1LOX A;  1NU3 A;  4K61 A;  7RNT A;  3LXU X;  3G4S 3;  1Q81 4;  1AVK A;  1M9G A;  2C11 A;  1OGZ A;  3KII A;  4N3V A;  3FZW A;  2CX1 A;  3FH1 A;  2KCD A;  3J7Y d;  1OHP A;  2L4V A;  1G0T A;  2W2C A;  3SYU A;  6GSP A;  3CMA 3;  3MSO A;  1YI2 3;  1BSE A;  1RTU A;  5A0O B;  1YJW 3;  2SBL A;  1RRH A;  1VZZ A;  1DET A;  1X1Y A;  5I97 A;  2FGT A;  1W4N A; 
#chains in the Genus database with same CATH homology
 1RLS A;  8RNT A;  1MGR A;  2F56 A;  1JBS A;  2AAD A;  3BIR A;  2KF5 A;  1TRP A;  1UCJ A;  3HOH A;  3D4A A;  3URP A;  1BRJ A;  3A5E A;  4J5K A;  2RBI A;  1T2I A;  1RGK A;  1YGW A;  1SAR A;  3AGO A;  5GSP A;  9RNT A;  1BRI A;  1AY7 A;  1BSC A;  3D5I A;  1A2P A;  1X1U A;  3KCH A;  1BU4 A;  3RNT A;  1B3S A;  1CH0 A;  1GSP A;  4GHO A;  1BUJ A;  5BU4 A;  4BU4 A;  1BNF A;  1BNS A;  1RGL A;  1RN1 A;  1TTO A;  1BSD A;  1MGW A;  1G02 A;  1I2G A;  1RGE A;  1FUS A;  1GOY A;  1B21 A;  2BIR A;  1ZGX A;  1BSA A;  1LRA A;  7GSP A;  2F5W A;  1RGF A;  1T2H A;  1LOV A;  1BNI A;  1X1W A;  2KF6 A;  1IYY A;  1BIR A;  1TRQ A;  1RGA A;  1RNT A;  1AQZ A;  1BRK A;  1HZ1 A;  2RNT A;  1GMR A;  1BAN A;  2ZA4 A;  1BNR A;  3AHS A;  5BIR A;  4HAA A;  1B2S A;  1BNE A;  2F5M A;  3Q3F A;  1GMP A;  1RHL A;  1BRG A;  1BOX A;  1LOY A;  1FUT A;  2BU4 A;  2KAA A;  1I8V A;  1BAO A;  1BVI A;  1BRS A;  1JBR A;  2HOH A;  1GOV A;  1UCK A;  5RNT A;  2GSP A;  1LNI A;  1RGC A;  3AHW A;  3D5G A;  3WR2 A;  3DH2 A;  1X1X A;  1C54 A;  1RMS A;  3WHO A;  1YNV X;  3BU4 A;  1B2M A;  4RNT A;  2F4Y A;  1RDS A;  1I2E A;  1BRH A;  1UCI A;  1B20 A;  1UCL A;  1I0V A;  1Q9E A;  1DE3 A;  2AAE A;  1PY3 A;  1RGH A;  1RCL A;  1YVS A;  2KF3 A;  1JBT A;  1BNJ A;  1RSN A;  1FYS A;  1RN4 A;  3GSP A;  4GSP A;  4BIR A;  1GMQ A;  1I70 A;  6RNT A;  1B27 A;  1LOW A;  1I2F A;  2C4B A;  1I0X A;  7RNT A;  1GOU A;  1FZU A;  3DGY A;  1PYL A;  1HYF A;  1B2U A;  1RNB A;  1BNG A;  1I3I A;  5HOH A;  3SYU A;  6GSP A;  1RCK A;  2SAR A;  4HOH A;  4J5G A;  1B2Z A;  1R4Y A;  1BGS A;  1RGG A;  1BSE A;  1RTU A;  2KF4 A;  1I3F A;  1B2X A;  1X1Y A;  1DET A;  1BSB A;  3AGN A;  1FW7 A;  1BRN L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...