4J5KA

Crystal structure analysis of streptomyces aureofaciens ribonuclease sa y51f mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGFYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Contribution of hydrogen bonds to protein stability.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4j5kA00
5HOHA 1BIRA 2KF4A 1LOVA 1I2GA 1FZUA 1LOYA 3A5EA 1X1YA 1BNJA 1B2ZA 1GOUA 8RNTA 1IYYA 2F5MA 1UCKA 2F5WA 5BIRA 3RNTA 1PY3A 1X1UA 4J5KA 1BRHA 1YGWA 1RGEA 3HOHA 5BU4A 1RGCA 1DETA 4BIRA 1B2UA 1PYLA 1RCLA 2KAAA 3AHWA 1RHLA 1RDSA 2BU4A 1MGRA 3Q3FA 3WHOA 1JBSA 1BANA 1BNGA 2RNTA 1UCIA 1BOXA 1I3IA 5GSPA 3D5IA 3URPA 1MGWA 1GSPA 1RGFA 5RNTA 1UCJA 3KCHA 1T2IA 2C4BA 4HAAA 2KF6A 2ZA4A 1R4YA 1C54A 3BU4A 1BRSA 9RNTA 1RN1A 1I3FA 1Q9EA 1BUJA 1BGSA 1B2SA 1TTOA 1LNIA 1ZGXA 4HOHA 1HYFA 2AAEA 1GMRA 1RSNA 3D4AA 1GMQA 1LOWA 7GSPA 1BNRA 1BNSA 1BNFA 1RGKA 4GHOA 1BU4A 1I2EA 1TRPA 4J5GA 1RGAA 1A2PA 1B2MA 1I0VA 1AY7A 1BRJA 4RNTA 1FUSA 1BSAA 1X1XA 1I8VA 3GSPA 1UCLA 1RTUA 2KF3A 1RCKA 3BIRA 1BNIA 1FUTA 1BRGA 3AGOA 1RNBA 1SARA 1RNTA 1B27A 1BRIA 1B21A 2KF5A 1BSCA 1FW7A 1GOVA 2RBIA 1YNVX 2AADA 1B2XA 3DGYA 1BSEA 1TRQA 1RGGA 7RNTA 1RN4A 1YVSA 1GOYA 3SYUA 4BU4A 1X1WA 1FYSA 1RGHA 2HOHA 1RLSA 1I0XA 1BSBA 1GMPA 1BSDA 6RNTA 3AGNA 1JBTA 2SARA 1DE3A 1CH0A 3D5GA 2F4YA 2F56A 3AHSA 1B3SA 1B20A 1LRAA 1G02A 2BIRA 1AQZA 6GSPA 1BRNL 1RMSA 3WR2A 1I2FA 1BNEA 1T2HA 1I70A 1BRKA 1HZ1A 2GSPA 1JBRA 1BVIA 3DH2A 4GSPA 1BAOA 1RGLA
chains in the Genus database with same CATH superfamily
4R9KA 3BLZA 4KFEA 5BXQA 1LOVA 4H61A 1Q42A 1ZX2A 3A5EA 5KP3A 3FGYA 1BNJA 1GOUA 1N5PA 2IY2A 5M1AA 5G1LA 1K8A4 3ALAA 2B24B 2FGTA 3UNLA 1UGHI 1F8NA 3EN8A 3LYGA 1UI7A 3BB9A 4LYLB 5CLKA 4QWTA 3NM7A 2CKFB 5CK6A 5BU4A 1TFOA 3FCSB 3T0UA 2CFGA 3GZRA 1Q40A 3WA3A 2C11A 1PYLA 3JUMA 2BHMA 2F86B 1IVWA 3IMAB 2BU4A 1MGRA 1BNGA 3A76A 2HMMB 5JBSA 1UCIA 4HKVB 3UL6A 2ZDJA 3HIIA 3O8YA 5GSPA 4CCVA 1W6YA 2HMLB 4R9LA 1NB5I 5AYRB 1U8CB 2XR8B 1Q824 1CYVA 2C4BA 2MF7A 3ZFZA 3CPW2 2QIYA 2WGOA 2XH9A 4K90B 1VQ83 2XGNA 5G2GA 1JJ22 4J9AA 2JQ5A 2PZVA 1M1K4 1IVVA 2GU1A 2OOVA 1R4CA 4CDLA 4O3VA 4H3UA 4EC6A 1TTOA 3JUNA 3ER7A 3B4OA 4K1VA 4HOHA 1HYFA 3N54B 2AAEA 1BUQA 1IV9A 1GMRA 1JZOA 1RSNA 2BT3A 5ELUA 3G713 1Q864 1VQL3 1LOWA 1W7CA 1BNFA 1JKGA 3FF2A 8CHOA 1BU4A 1D6YA 1TRPA 1W00A 4HM5B 2IUJA 1I0VA 1UUVB 1FGTA 1JRQA 1BRJA 3BNDA 4RNTA 1IDPA 1X1XA 3N8BA 1OHPA 4WYKB 4TX4A 1JB5A 2ML5A 1FUWA 3FG3A 2K54A 2KF5A 3EJVA 5KP4A 1WNHA 3MSOA 1BSCA 3CME3 2XFTA 4EBGA 1GOVA 2IMJA 1YNVX 3S28A 1N5HA 4HJLB 2AADA 3HK4A 3CU3A 3VF1A 4LGQA 2BMOB 1K9M4 2CFWA 3Q2PA 3SXXA 4HM8B 1YVSA 2GEYA 3LT8A 1FA3A 1NO3A 2XFSA 3F7XA 2BO9B 1YJW3 1RGHA 2XSOB 2WGQA 3GWRA 2HOHA 1T5YA 1AVLA 2YFIB 4N6OB 4R4KA 6RNTA 1VQO3 3CCU3 5IG5A 2WO0A 1JBTA 1N8QA 1STFI 1QALA 2F56A 5D82A 3ECFA 1RN7A 1V58A 1GY6A 1YGEA 4MMXB 4IIAA 2BIRA 3KSPA 1PU4A 1BRNL 1GYBA 1WQLB 2IA7A 5AIGA 3KZTA 2WOFA 2GU3A 1WMPA 2CWVA 1BRKA 3TDGA 1VQ73 5M18A 2UX0A 3DMCA 3EBYA 1BAOA 3V99A 1OF5B 3LT9A 5HOHA 4ILFA 1C7HA 3EN1B 2Y73A 2Y74A 2KF4A 1OPYA 2HMOB 3KE7A 3Q90A 5STDA 1LOXA 1KC84 1JB4A 4RNYA 1X1YA 1QJGA 3F8HA 3K5TA 3T8NA 2OQEC 5IEPA 1IYYA 5IG4A 5IG3A 4RBNA 4WHAA 1RJOA 3N9HA 2BMQB 4J5KA 2RSXA 2L1SA 1BRHA 1YGWA 1Y4KA 1QAKA 3JUOA 1L5GB 2CWTA 3WMDA 1CEWI 3CCS3 2OTJ3 3WOFB 3U1WA 4KFFA 2KAAA 4KZ1A 5EQLA 3G0KA 1LQGC 2XGLA 5IEOA 1VQM3 1JBSA 2F98A 3WHOA 3CMA3 2JDIH 2LQVA 1YIJ3 3H51A 1O7MB 1BOXA 1W6GA 3FH1A 4FCJA 3NQYA 5IG0A 2STDA 3URPA 1W2B2 2H0HA 1HKXA 4XBYA 2UUGC 3OXAA 1UCJA 4KT3B 1JKGB 3RGRA 1ROAA 1NWWA 5AEWB 3EHCA 4J8TA 4MJDA 1OHSA 3DGNA 1C54A 3MG1A 3BNEA 3GZXB 1VQQA 3CCM3 1N9JA 1Q9EA 3B8LA 1BUJA 4XDWA 1ZGXA 2GBWB 2HMNB 5DREA 5BVBA 3D4AA 1GMQA 1NNVA 3AMOA 2ZHXB 3HX8A 5IENA 3CXC2 3DUKA 1BNSA 2FXTA 2CC3A 1RGKA 3MG3A 3T8UA 3DXOA 1N8R4 4EXRA 4J5GA 5LC6A 3SEDA 2MC8A 1FGQA 1NJI4 2OCTA 1AY7A 3EF8A 4G1MB 1BSAA 4LMIA 1I8VA 2R41A 3FKAA 2Z77A 1IU7A 4EV2A 4HYZA 2INXA 3NV0A 1A2VA 1EEJA 1RCKA 2KF3A 3BIRA 3WODG 2L4VA 1K41A 3CCR3 3AGOA 1SARA 2BNGA 1OUNA 2RGQA 1B21A 1VQP3 2XRXB 3G8ZA 1FW7A 3F14A 3JUQA 2D42A 1VQ53 1QVG2 2E2TA 3X3XA 3KKGA 4BL3A 4LSOA 1IT8A 2GXFA 5D83A 1RGGA 4XDVA 3FZWA 4RZMA 3I563 1GOYA 2QGUA 1FYSA 2YFJB 3VSYA 3F7SA 1TU5A 3G4S3 1GMPA 1OGXA 3D9RA 2FNQA 1J2BA 4U13A 1FGRA 1ROVA 3AGNA 3K7CA 1K28A 3EC9A 1DE3A 3DGMA 1CH0A 1SQWA 2A15A 2E2VA 3D5GA 3HZPA 3CD63 4OUQA 1B3SA 4KVHA 4RNZA 1JB2A 5AEUB 2HMJB 3DZLA 3L0RA 1G02A 3OWSA 4HVNA 2O3OA 5JPUA 3NBBA 1YHQ3 3DM8A 3QRDA 2CFDA 4HM7B 4BTYA 1M9GA 3GZBA 4FMCA 5AI1A 3BNBA 4BTWA 1JZDA 4MMYB 1LVNA 1TJDA 1SIHA 4AKYA 3OX9A 3X41A 2CH9A 1ASKA 3S5CA 1KSIA 1YVBI 4MMZB 5AIFA 3LMLA 1DYUA 4LEHA 1I2GA 1EQKA 1LOYA 1JN5B 1B2ZA 5HGRA 1O7NB 3FG4A 1OACA 3LZAA 1ZS7A 4XBXA 5AYSC 3I553 3NBRA 4N6UA 2C10A 3QK9A 2W9PA 1UGIA 3RNTA 1PY3A 2OOVC 3CCJ3 2OQEA 4DKIA 1TIJA 2GBXB 2W6JH 1RGEA 2O9UX 3GRDA 4ZM8A 2UGIA 2RFRA 4WFOA 1UDII 3CPOA 3OWUA 1RGCA 3F9SA 4BIRA 1TP6A 2CFLA 2P0XA 2P38A 3AHWA 2K0MA 1GS3A 6STDA 1RHLA 1RDSA 3G16A 3Q3FA 4L8OA 4HM1B 2RCDA 2P05A 2M7OA 3X40A 1W2ZA 1OHOA 1O7HB 3LOYA 4HM2B 4K1UA 1Q40B 2KXGA 2ML6A 5EVHA 2W2CA 1W01A 3DY5A 1GSPA 1U5OA 2WOHA 3NQZA 5RNTA 3AMOB 3RDEA 1KWIA 1UUWB 3HIGA 4HAAA 3MG2A 4STDA 1G96A 1AR0A 1OCVA 1Q7HA 1GD4A 1NDOB 1OH0A 2Z7AA 2ZA4A 3NX0A 4FR9A 5CF2A 5M19A 4R1KA 2QEX3 2W0QA 5ELJA 3BU4A 1E3RA 1S5AA 1LNHA 3LTDA 1I3FA 2CW9A 5CF1A 1Q7Y4 1BGSA 3PCSA 5TGNA 3IJEB 3EBTA 1IVXA 2CK3H 3SOAA 4JRFA 3DGLA 3CCQ3 3H3HA 5I97A 7GSPA 1YIT3 4IT7A 1BNRA 4GHOA 3KIIA 2K3DA 1KQS2 7STDA 1RGAA 1A2PA 4EYCA 1B2MA 1A90A 2XEPA 3KFQC 3RGAA 1FUSA 1UW1A 3EQQB 1ZO2A 1VQ93 3GSPA 1UCLA 1WMNA 3PS8A 5KP1A 4FCZA 3X3ZA 3CCL3 3V98A 3S27A 4O2HA 3MYTA 1BNIA 1FUTA 2H0GA 1VQK3 1RNBA 3LTAA 4KFDA 1O7PB 1CYUA 1OGZA 4FMBA 3UB1A 2W9QA 1QMAA 1DVDA 1DVCA 3ZG0A 4Q53A 3CCV3 2RBIA 2W04A 3FG1A 4BTXA 3J7Yd 1B2XA 3NHXA 1AV4A 1TRQA 4XM4A 4AEQA 2HMKB 1MWSA 1RN4A 3Q1CA 5AIHA 3ROBA 3SLUA 7RNTA 1MWTA 1ULIB 1SJWA 2IUKA 3UL5A 4IPBA 1RLSA 1I0XA 2CIUA 3LXUX 3GZYB 4N6LA 1BSDA 1TFKA 5CXOA 3BNCA 2QA43 1IT7A 3CNMA 3WDGB 2BMRB 4EV5A 3CC73 1QVF2 1VZZA 3FSDA 1GY7A 2YX9A 3NXJA 5EEOA 3AHSA 3SX1A 1LRAA 3S67A 1OF5A 3KN4A 1AQZA 6GSPA 3D3LA 2W56A 3EE1A 1I2FA 3WR2A 1WMOA 4EW5A 5D81A 4FMAA 3KSED 1I70A 2XSHB 1MNLA 1PFPA 4N6V0 4WWUC 3HI7A 2LYXA 2SBLA 3M8CA 1O7WB 4PEJA 2W03A 1VQ63 1JBRA 3EX9A 4ORLA 1RGLA 4O02B 1BIRA 4N6TA 1IQ8A 1JNQA 3STDA 2KRTA 1FZUA 3ZG5A 1G0TA 4I5QA 4HM4B 3UJMA 4OK0A 3DGOA 8RNTA 1CQSA 1DMQA 2F5MA 1UCKA 3K9MC 1E3VA 3PGBA 2F5WA 4HM3B 4N3VA 5BIRA 1X1UA 2CWUA 2CFKA 3SVAA 5LC7A 1GD3A 3MHEA 1W6CA 3E99A 3HOHA 3U97A 3VGNA 1JV2B 1DETA 2P0MA 1B2UA 2GEXA 2IYJA 1RCLA 4L8PA 5G1KA 1W5ZA 1V74A 4AKZA 1IK3A 1Z1SA 1DMNA 4XBTA 1FGMA 1WTHA 3MWZA 5FGOA 3SOYA 3NUVA 1BANA 1DMMA 2OWPA 3PXMA 4X2HA 2KCDA 2RNTA 3WA2X 4R80A 1YJ93 1IVUA 1I3IA 2D1WA 3D5IA 1NU3A 1EUIC 1M1XB 1MGWA 3K63A 3MKIA 1RGFA 3CC23 3KCHA 1T2IA 1V57A 4FCMA 3S29A 2P09A 1STDA 3OWYA 4HZBB 2KF6A 3LH4A 5JPPA 1R4YA 3X42A 4HBRA 1W4NA 3LTCA 1BRSA 3F8XA 2CHCA 3GAXA 1O7GB 3PYJA 5AIIA 1A2KA 1RN1A 9RNTA 1UI8A 1VQ43 1MWUA 3G6E3 1RKYA 1B2SA 2ZL8A 1LNIA 1VQN3 2YFLB 2B1XB 3I0YA 2J8XB 3MPHA 1D6ZA 3OW22 1YJN3 1I2EA 5DRVA 2E2UA 2F99A 2OTL3 3FF0A 4JF8A 2CG1A 3PZWA 4CJNA 4NREA 1RTUA 4XB5A 3FLJA 3IPTA 4HM0B 1IQXA 3CCE3 4HZ9B 4N6MA 1T3BA 4GL6A 3V92A 1BRGA 1GY5A 3PCRA 1M904 1RNTA 3JVCA 1B27A 1BRIA 1AVKA 1D6UA 1HU9A 4HM6B 4BL2A 1RRLA 3NBJA 1MOLA 2V1LA 2CX1A 4K61A 4NHFA 1ULJB 2H0IA 5A0OB 5FW5A 1EG9B 1A67A 1LQMB 3DGYA 1BSEA 4OVMA 3NV0B 1K734 1EA2A 3JUPA 1S723 1TUHA 3K0ZA 4WYKA 3NM2A 2Z76A 2W56B 3SYUA 4FMDA 2I9WA 3B7CA 3EB8A 1X1WA 3F40A 4BU4A 4NPBA 1FGOA 1E97A 4LZIA 1MWRA 3CC43 1RRHA 2PNCA 1BSBA 4WP5A 5IW9A 1YI23 1NB3I 1IQYA 2R4IA 4GB5A 4O8SA 3OV4A 2SARA 1Q814 4I4KA 3LTBA 1N9EA 3CNXA 3D79A 3B4PA 1US1A 2Z6BA 2F4YA 4X2OA 5IERA 1B20A 1KD14 1IV7A 3X3YA 1QAFA 1RMSA 1BNEA 1T2HA 2CX0A 2Q07A 4MEIA 1SIIA 3WOEB 1JN5A 1LXEA 1SPUA 4L7KA 1HZ1A 1EKMA 2XF3A 5IF6A 2GSPA 4N6NB 1BVIA 3DH2A 4GSPA 4CPKA 1ISKA 1UUGB 1W02A 2CG0A
chains in the Genus database with same CATH topology
5HOHA 1BIRA 2KF4A 1LOVA 1I2GA 1FZUA 1LOYA 3A5EA 1X1YA 1BNJA 1B2ZA 1GOUA 8RNTA 1IYYA 2F5MA 1UCKA 2F5WA 5BIRA 3RNTA 1PY3A 1X1UA 4J5KA 1BRHA 1YGWA 1RGEA 3HOHA 5BU4A 1RGCA 1DETA 4BIRA 1B2UA 1PYLA 1RCLA 2KAAA 3AHWA 1RHLA 1RDSA 2BU4A 1MGRA 3Q3FA 3WHOA 1JBSA 1BANA 1BNGA 2RNTA 1UCIA 1BOXA 1I3IA 5GSPA 3D5IA 3URPA 1MGWA 1GSPA 1RGFA 5RNTA 1UCJA 3KCHA 1T2IA 2C4BA 4HAAA 2KF6A 2ZA4A 1R4YA 1C54A 3BU4A 1BRSA 9RNTA 1RN1A 1I3FA 1Q9EA 1BUJA 1BGSA 1B2SA 1TTOA 1LNIA 1ZGXA 4HOHA 1HYFA 2AAEA 1GMRA 1RSNA 3D4AA 1GMQA 1LOWA 7GSPA 1BNRA 1BNSA 1BNFA 1RGKA 4GHOA 1BU4A 1I2EA 1TRPA 4J5GA 1RGAA 1A2PA 1B2MA 1I0VA 1AY7A 1BRJA 4RNTA 1FUSA 1BSAA 1X1XA 1I8VA 3GSPA 1UCLA 1RTUA 2KF3A 1RCKA 3BIRA 1BNIA 1FUTA 1BRGA 3AGOA 1RNBA 1SARA 1RNTA 1B27A 1BRIA 1B21A 2KF5A 1BSCA 1FW7A 1GOVA 2RBIA 1YNVX 2AADA 1B2XA 3DGYA 1BSEA 1TRQA 1RGGA 7RNTA 1RN4A 1YVSA 1GOYA 3SYUA 4BU4A 1X1WA 1FYSA 1RGHA 2HOHA 1RLSA 1I0XA 1BSBA 1GMPA 1BSDA 6RNTA 3AGNA 1JBTA 2SARA 1DE3A 1CH0A 3D5GA 2F4YA 2F56A 3AHSA 1B3SA 1B20A 1LRAA 1G02A 2BIRA 1AQZA 6GSPA 1BRNL 1RMSA 3WR2A 1I2FA 1BNEA 1T2HA 1I70A 1BRKA 1HZ1A 2GSPA 1JBRA 1BVIA 3DH2A 4GSPA 1BAOA 1RGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HOH A;  1BIR A;  2KF4 A;  1LOV A;  1I2G A;  1FZU A;  1LOY A;  3A5E A;  1X1Y A;  1BNJ A;  1B2Z A;  1GOU A;  8RNT A;  1IYY A;  2F5M A;  1UCK A;  2F5W A;  5BIR A;  3RNT A;  1PY3 A;  1X1U A;  4J5K A;  1BRH A;  1YGW A;  1RGE A;  3HOH A;  5BU4 A;  1RGC A;  1DET A;  4BIR A;  1B2U A;  1PYL A;  1RCL A;  2KAA A;  3AHW A;  1RHL A;  1RDS A;  2BU4 A;  1MGR A;  3Q3F A;  3WHO A;  1JBS A;  1BAN A;  1BNG A;  2RNT A;  1UCI A;  1BOX A;  1I3I A;  5GSP A;  3D5I A;  3URP A;  1MGW A;  1GSP A;  1RGF A;  5RNT A;  1UCJ A;  3KCH A;  1T2I A;  2C4B A;  4HAA A;  2KF6 A;  2ZA4 A;  1R4Y A;  1C54 A;  3BU4 A;  1BRS A;  9RNT A;  1RN1 A;  1I3F A;  1Q9E A;  1BUJ A;  1BGS A;  1B2S A;  1TTO A;  1LNI A;  1ZGX A;  4HOH A;  1HYF A;  2AAE A;  1GMR A;  1RSN A;  3D4A A;  1GMQ A;  1LOW A;  7GSP A;  1BNR A;  1BNS A;  1BNF A;  1RGK A;  4GHO A;  1BU4 A;  1I2E A;  1TRP A;  4J5G A;  1RGA A;  1A2P A;  1B2M A;  1I0V A;  1AY7 A;  1BRJ A;  4RNT A;  1FUS A;  1BSA A;  1X1X A;  1I8V A;  3GSP A;  1UCL A;  1RTU A;  2KF3 A;  1RCK A;  3BIR A;  1BNI A;  1FUT A;  1BRG A;  3AGO A;  1RNB A;  1SAR A;  1RNT A;  1B27 A;  1BRI A;  1B21 A;  2KF5 A;  1BSC A;  1FW7 A;  1GOV A;  2RBI A;  1YNV X;  2AAD A;  1B2X A;  3DGY A;  1BSE A;  1TRQ A;  1RGG A;  7RNT A;  1RN4 A;  1YVS A;  1GOY A;  3SYU A;  4BU4 A;  1X1W A;  1FYS A;  1RGH A;  2HOH A;  1RLS A;  1I0X A;  1BSB A;  1GMP A;  1BSD A;  6RNT A;  3AGN A;  1JBT A;  2SAR A;  1DE3 A;  1CH0 A;  3D5G A;  2F4Y A;  2F56 A;  3AHS A;  1B3S A;  1B20 A;  1LRA A;  1G02 A;  2BIR A;  1AQZ A;  6GSP A;  1BRN L;  1RMS A;  3WR2 A;  1I2F A;  1BNE A;  1T2H A;  1I70 A;  1BRK A;  1HZ1 A;  2GSP A;  1JBR A;  1BVI A;  3DH2 A;  4GSP A;  1BAO A;  1RGL A; 
#chains in the Genus database with same CATH topology
 4R9K A;  3BLZ A;  4KFE A;  5BXQ A;  1LOV A;  4H61 A;  1Q42 A;  1ZX2 A;  3A5E A;  5KP3 A;  3FGY A;  1BNJ A;  1GOU A;  1N5P A;  2IY2 A;  5M1A A;  5G1L A;  1K8A 4;  3ALA A;  2B24 B;  2FGT A;  3UNL A;  1UGH I;  1F8N A;  3EN8 A;  3LYG A;  1UI7 A;  3BB9 A;  4LYL B;  5CLK A;  4QWT A;  3NM7 A;  2CKF B;  5CK6 A;  5BU4 A;  1TFO A;  3FCS B;  3T0U A;  2CFG A;  3GZR A;  1Q40 A;  3WA3 A;  2C11 A;  1PYL A;  3JUM A;  2BHM A;  2F86 B;  1IVW A;  3IMA B;  2BU4 A;  1MGR A;  1BNG A;  3A76 A;  2HMM B;  5JBS A;  1UCI A;  4HKV B;  3UL6 A;  2ZDJ A;  3HII A;  3O8Y A;  5GSP A;  4CCV A;  1W6Y A;  2HML B;  4R9L A;  1NB5 I;  5AYR B;  1U8C B;  2XR8 B;  1Q82 4;  1CYV A;  2C4B A;  2MF7 A;  3ZFZ A;  3CPW 2;  2QIY A;  2WGO A;  2XH9 A;  4K90 B;  1VQ8 3;  2XGN A;  5G2G A;  1JJ2 2;  4J9A A;  2JQ5 A;  2PZV A;  1M1K 4;  1IVV A;  2GU1 A;  2OOV A;  1R4C A;  4CDL A;  4O3V A;  4H3U A;  4EC6 A;  1TTO A;  3JUN A;  3ER7 A;  3B4O A;  4K1V A;  4HOH A;  1HYF A;  3N54 B;  2AAE A;  1BUQ A;  1IV9 A;  1GMR A;  1JZO A;  1RSN A;  2BT3 A;  5ELU A;  3G71 3;  1Q86 4;  1VQL 3;  1LOW A;  1W7C A;  1BNF A;  1JKG A;  3FF2 A;  8CHO A;  1BU4 A;  1D6Y A;  1TRP A;  1W00 A;  4HM5 B;  2IUJ A;  1I0V A;  1UUV B;  1FGT A;  1JRQ A;  1BRJ A;  3BND A;  4RNT A;  1IDP A;  1X1X A;  3N8B A;  1OHP A;  4WYK B;  4TX4 A;  1JB5 A;  2ML5 A;  1FUW A;  3FG3 A;  2K54 A;  2KF5 A;  3EJV A;  5KP4 A;  1WNH A;  3MSO A;  1BSC A;  3CME 3;  2XFT A;  4EBG A;  1GOV A;  2IMJ A;  1YNV X;  3S28 A;  1N5H A;  4HJL B;  2AAD A;  3HK4 A;  3CU3 A;  3VF1 A;  4LGQ A;  2BMO B;  1K9M 4;  2CFW A;  3Q2P A;  3SXX A;  4HM8 B;  1YVS A;  2GEY A;  3LT8 A;  1FA3 A;  1NO3 A;  2XFS A;  3F7X A;  2BO9 B;  1YJW 3;  1RGH A;  2XSO B;  2WGQ A;  3GWR A;  2HOH A;  1T5Y A;  1AVL A;  2YFI B;  4N6O B;  4R4K A;  6RNT A;  1VQO 3;  3CCU 3;  5IG5 A;  2WO0 A;  1JBT A;  1N8Q A;  1STF I;  1QAL A;  2F56 A;  5D82 A;  3ECF A;  1RN7 A;  1V58 A;  1GY6 A;  1YGE A;  4MMX B;  4IIA A;  2BIR A;  3KSP A;  1PU4 A;  1BRN L;  1GYB A;  1WQL B;  2IA7 A;  5AIG A;  3KZT A;  2WOF A;  2GU3 A;  1WMP A;  2CWV A;  1BRK A;  3TDG A;  1VQ7 3;  5M18 A;  2UX0 A;  3DMC A;  3EBY A;  1BAO A;  3V99 A;  1OF5 B;  3LT9 A;  5HOH A;  4ILF A;  1C7H A;  3EN1 B;  2Y73 A;  2Y74 A;  2KF4 A;  1OPY A;  2HMO B;  3KE7 A;  3Q90 A;  5STD A;  1LOX A;  1KC8 4;  1JB4 A;  4RNY A;  1X1Y A;  1QJG A;  3F8H A;  3K5T A;  3T8N A;  2OQE C;  5IEP A;  1IYY A;  5IG4 A;  5IG3 A;  4RBN A;  4WHA A;  1RJO A;  3N9H A;  2BMQ B;  4J5K A;  2RSX A;  2L1S A;  1BRH A;  1YGW A;  1Y4K A;  1QAK A;  3JUO A;  1L5G B;  2CWT A;  3WMD A;  1CEW I;  3CCS 3;  2OTJ 3;  3WOF B;  3U1W A;  4KFF A;  2KAA A;  4KZ1 A;  5EQL A;  3G0K A;  1LQG C;  2XGL A;  5IEO A;  1VQM 3;  1JBS A;  2F98 A;  3WHO A;  3CMA 3;  2JDI H;  2LQV A;  1YIJ 3;  3H51 A;  1O7M B;  1BOX A;  1W6G A;  3FH1 A;  4FCJ A;  3NQY A;  5IG0 A;  2STD A;  3URP A;  1W2B 2;  2H0H A;  1HKX A;  4XBY A;  2UUG C;  3OXA A;  1UCJ A;  4KT3 B;  1JKG B;  3RGR A;  1ROA A;  1NWW A;  5AEW B;  3EHC A;  4J8T A;  4MJD A;  1OHS A;  3DGN A;  1C54 A;  3MG1 A;  3BNE A;  3GZX B;  1VQQ A;  3CCM 3;  1N9J A;  1Q9E A;  3B8L A;  1BUJ A;  4XDW A;  1ZGX A;  2GBW B;  2HMN B;  5DRE A;  5BVB A;  3D4A A;  1GMQ A;  1NNV A;  3AMO A;  2ZHX B;  3HX8 A;  5IEN A;  3CXC 2;  3DUK A;  1BNS A;  2FXT A;  2CC3 A;  1RGK A;  3MG3 A;  3T8U A;  3DXO A;  1N8R 4;  4EXR A;  4J5G A;  5LC6 A;  3SED A;  2MC8 A;  1FGQ A;  1NJI 4;  2OCT A;  1AY7 A;  3EF8 A;  4G1M B;  1BSA A;  4LMI A;  1I8V A;  2R41 A;  3FKA A;  2Z77 A;  1IU7 A;  4EV2 A;  4HYZ A;  2INX A;  3NV0 A;  1A2V A;  1EEJ A;  1RCK A;  2KF3 A;  3BIR A;  3WOD G;  2L4V A;  1K41 A;  3CCR 3;  3AGO A;  1SAR A;  2BNG A;  1OUN A;  2RGQ A;  1B21 A;  1VQP 3;  2XRX B;  3G8Z A;  1FW7 A;  3F14 A;  3JUQ A;  2D42 A;  1VQ5 3;  1QVG 2;  2E2T A;  3X3X A;  3KKG A;  4BL3 A;  4LSO A;  1IT8 A;  2GXF A;  5D83 A;  1RGG A;  4XDV A;  3FZW A;  4RZM A;  3I56 3;  1GOY A;  2QGU A;  1FYS A;  2YFJ B;  3VSY A;  3F7S A;  1TU5 A;  3G4S 3;  1GMP A;  1OGX A;  3D9R A;  2FNQ A;  1J2B A;  4U13 A;  1FGR A;  1ROV A;  3AGN A;  3K7C A;  1K28 A;  3EC9 A;  1DE3 A;  3DGM A;  1CH0 A;  1SQW A;  2A15 A;  2E2V A;  3D5G A;  3HZP A;  3CD6 3;  4OUQ A;  1B3S A;  4KVH A;  4RNZ A;  1JB2 A;  5AEU B;  2HMJ B;  3DZL A;  3L0R A;  1G02 A;  3OWS A;  4HVN A;  2O3O A;  5JPU A;  3NBB A;  1YHQ 3;  3DM8 A;  3QRD A;  2CFD A;  4HM7 B;  4BTY A;  1M9G A;  3GZB A;  4FMC A;  5AI1 A;  3BNB A;  4BTW A;  1JZD A;  4MMY B;  1LVN A;  1TJD A;  1SIH A;  4AKY A;  3OX9 A;  3X41 A;  2CH9 A;  1ASK A;  3S5C A;  1KSI A;  1YVB I;  4MMZ B;  5AIF A;  3LML A;  1DYU A;  4LEH A;  1I2G A;  1EQK A;  1LOY A;  1JN5 B;  1B2Z A;  5HGR A;  1O7N B;  3FG4 A;  1OAC A;  3LZA A;  1ZS7 A;  4XBX A;  5AYS C;  3I55 3;  3NBR A;  4N6U A;  2C10 A;  3QK9 A;  2W9P A;  1UGI A;  3RNT A;  1PY3 A;  2OOV C;  3CCJ 3;  2OQE A;  4DKI A;  1TIJ A;  2GBX B;  2W6J H;  1RGE A;  2O9U X;  3GRD A;  4ZM8 A;  2UGI A;  2RFR A;  4WFO A;  1UDI I;  3CPO A;  3OWU A;  1RGC A;  3F9S A;  4BIR A;  1TP6 A;  2CFL A;  2P0X A;  2P38 A;  3AHW A;  2K0M A;  1GS3 A;  6STD A;  1RHL A;  1RDS A;  3G16 A;  3Q3F A;  4L8O A;  4HM1 B;  2RCD A;  2P05 A;  2M7O A;  3X40 A;  1W2Z A;  1OHO A;  1O7H B;  3LOY A;  4HM2 B;  4K1U A;  1Q40 B;  2KXG A;  2ML6 A;  5EVH A;  2W2C A;  1W01 A;  3DY5 A;  1GSP A;  1U5O A;  2WOH A;  3NQZ A;  5RNT A;  3AMO B;  3RDE A;  1KWI A;  1UUW B;  3HIG A;  4HAA A;  3MG2 A;  4STD A;  1G96 A;  1AR0 A;  1OCV A;  1Q7H A;  1GD4 A;  1NDO B;  1OH0 A;  2Z7A A;  2ZA4 A;  3NX0 A;  4FR9 A;  5CF2 A;  5M19 A;  4R1K A;  2QEX 3;  2W0Q A;  5ELJ A;  3BU4 A;  1E3R A;  1S5A A;  1LNH A;  3LTD A;  1I3F A;  2CW9 A;  5CF1 A;  1Q7Y 4;  1BGS A;  3PCS A;  5TGN A;  3IJE B;  3EBT A;  1IVX A;  2CK3 H;  3SOA A;  4JRF A;  3DGL A;  3CCQ 3;  3H3H A;  5I97 A;  7GSP A;  1YIT 3;  4IT7 A;  1BNR A;  4GHO A;  3KII A;  2K3D A;  1KQS 2;  7STD A;  1RGA A;  1A2P A;  4EYC A;  1B2M A;  1A90 A;  2XEP A;  3KFQ C;  3RGA A;  1FUS A;  1UW1 A;  3EQQ B;  1ZO2 A;  1VQ9 3;  3GSP A;  1UCL A;  1WMN A;  3PS8 A;  5KP1 A;  4FCZ A;  3X3Z A;  3CCL 3;  3V98 A;  3S27 A;  4O2H A;  3MYT A;  1BNI A;  1FUT A;  2H0G A;  1VQK 3;  1RNB A;  3LTA A;  4KFD A;  1O7P B;  1CYU A;  1OGZ A;  4FMB A;  3UB1 A;  2W9Q A;  1QMA A;  1DVD A;  1DVC A;  3ZG0 A;  4Q53 A;  3CCV 3;  2RBI A;  2W04 A;  3FG1 A;  4BTX A;  3J7Y d;  1B2X A;  3NHX A;  1AV4 A;  1TRQ A;  4XM4 A;  4AEQ A;  2HMK B;  1MWS A;  1RN4 A;  3Q1C A;  5AIH A;  3ROB A;  3SLU A;  7RNT A;  1MWT A;  1ULI B;  1SJW A;  2IUK A;  3UL5 A;  4IPB A;  1RLS A;  1I0X A;  2CIU A;  3LXU X;  3GZY B;  4N6L A;  1BSD A;  1TFK A;  5CXO A;  3BNC A;  2QA4 3;  1IT7 A;  3CNM A;  3WDG B;  2BMR B;  4EV5 A;  3CC7 3;  1QVF 2;  1VZZ A;  3FSD A;  1GY7 A;  2YX9 A;  3NXJ A;  5EEO A;  3AHS A;  3SX1 A;  1LRA A;  3S67 A;  1OF5 A;  3KN4 A;  1AQZ A;  6GSP A;  3D3L A;  2W56 A;  3EE1 A;  1I2F A;  3WR2 A;  1WMO A;  4EW5 A;  5D81 A;  4FMA A;  3KSE D;  1I70 A;  2XSH B;  1MNL A;  1PFP A;  4N6V 0;  4WWU C;  3HI7 A;  2LYX A;  2SBL A;  3M8C A;  1O7W B;  4PEJ A;  2W03 A;  1VQ6 3;  1JBR A;  3EX9 A;  4ORL A;  1RGL A;  4O02 B;  1BIR A;  4N6T A;  1IQ8 A;  1JNQ A;  3STD A;  2KRT A;  1FZU A;  3ZG5 A;  1G0T A;  4I5Q A;  4HM4 B;  3UJM A;  4OK0 A;  3DGO A;  8RNT A;  1CQS A;  1DMQ A;  2F5M A;  1UCK A;  3K9M C;  1E3V A;  3PGB A;  2F5W A;  4HM3 B;  4N3V A;  5BIR A;  1X1U A;  2CWU A;  2CFK A;  3SVA A;  5LC7 A;  1GD3 A;  3MHE A;  1W6C A;  3E99 A;  3HOH A;  3U97 A;  3VGN A;  1JV2 B;  1DET A;  2P0M A;  1B2U A;  2GEX A;  2IYJ A;  1RCL A;  4L8P A;  5G1K A;  1W5Z A;  1V74 A;  4AKZ A;  1IK3 A;  1Z1S A;  1DMN A;  4XBT A;  1FGM A;  1WTH A;  3MWZ A;  5FGO A;  3SOY A;  3NUV A;  1BAN A;  1DMM A;  2OWP A;  3PXM A;  4X2H A;  2KCD A;  2RNT A;  3WA2 X;  4R80 A;  1YJ9 3;  1IVU A;  1I3I A;  2D1W A;  3D5I A;  1NU3 A;  1EUI C;  1M1X B;  1MGW A;  3K63 A;  3MKI A;  1RGF A;  3CC2 3;  3KCH A;  1T2I A;  1V57 A;  4FCM A;  3S29 A;  2P09 A;  1STD A;  3OWY A;  4HZB B;  2KF6 A;  3LH4 A;  5JPP A;  1R4Y A;  3X42 A;  4HBR A;  1W4N A;  3LTC A;  1BRS A;  3F8X A;  2CHC A;  3GAX A;  1O7G B;  3PYJ A;  5AII A;  1A2K A;  1RN1 A;  9RNT A;  1UI8 A;  1VQ4 3;  1MWU A;  3G6E 3;  1RKY A;  1B2S A;  2ZL8 A;  1LNI A;  1VQN 3;  2YFL B;  2B1X B;  3I0Y A;  2J8X B;  3MPH A;  1D6Z A;  3OW2 2;  1YJN 3;  1I2E A;  5DRV A;  2E2U A;  2F99 A;  2OTL 3;  3FF0 A;  4JF8 A;  2CG1 A;  3PZW A;  4CJN A;  4NRE A;  1RTU A;  4XB5 A;  3FLJ A;  3IPT A;  4HM0 B;  1IQX A;  3CCE 3;  4HZ9 B;  4N6M A;  1T3B A;  4GL6 A;  3V92 A;  1BRG A;  1GY5 A;  3PCR A;  1M90 4;  1RNT A;  3JVC A;  1B27 A;  1BRI A;  1AVK A;  1D6U A;  1HU9 A;  4HM6 B;  4BL2 A;  1RRL A;  3NBJ A;  1MOL A;  2V1L A;  2CX1 A;  4K61 A;  4NHF A;  1ULJ B;  2H0I A;  5A0O B;  5FW5 A;  1EG9 B;  1A67 A;  1LQM B;  3DGY A;  1BSE A;  4OVM A;  3NV0 B;  1K73 4;  1EA2 A;  3JUP A;  1S72 3;  1TUH A;  3K0Z A;  4WYK A;  3NM2 A;  2Z76 A;  2W56 B;  3SYU A;  4FMD A;  2I9W A;  3B7C A;  3EB8 A;  1X1W A;  3F40 A;  4BU4 A;  4NPB A;  1FGO A;  1E97 A;  4LZI A;  1MWR A;  3CC4 3;  1RRH A;  2PNC A;  1BSB A;  4WP5 A;  5IW9 A;  1YI2 3;  1NB3 I;  1IQY A;  2R4I A;  4GB5 A;  4O8S A;  3OV4 A;  2SAR A;  1Q81 4;  4I4K A;  3LTB A;  1N9E A;  3CNX A;  3D79 A;  3B4P A;  1US1 A;  2Z6B A;  2F4Y A;  4X2O A;  5IER A;  1B20 A;  1KD1 4;  1IV7 A;  3X3Y A;  1QAF A;  1RMS A;  1BNE A;  1T2H A;  2CX0 A;  2Q07 A;  4MEI A;  1SII A;  3WOE B;  1JN5 A;  1LXE A;  1SPU A;  4L7K A;  1HZ1 A;  1EKM A;  2XF3 A;  5IF6 A;  2GSP A;  4N6N B;  1BVI A;  3DH2 A;  4GSP A;  4CPK A;  1ISK A;  1UUG B;  1W02 A;  2CG0 A; 
#chains in the Genus database with same CATH homology
 5HOH A;  1BIR A;  2KF4 A;  1LOV A;  1I2G A;  1FZU A;  1LOY A;  3A5E A;  1X1Y A;  1BNJ A;  1B2Z A;  1GOU A;  8RNT A;  1IYY A;  2F5M A;  1UCK A;  2F5W A;  5BIR A;  3RNT A;  1PY3 A;  1X1U A;  4J5K A;  1BRH A;  1YGW A;  1RGE A;  3HOH A;  5BU4 A;  1RGC A;  1DET A;  4BIR A;  1B2U A;  1PYL A;  1RCL A;  2KAA A;  3AHW A;  1RHL A;  1RDS A;  2BU4 A;  1MGR A;  3Q3F A;  3WHO A;  1JBS A;  1BAN A;  1BNG A;  2RNT A;  1UCI A;  1BOX A;  1I3I A;  5GSP A;  3D5I A;  3URP A;  1MGW A;  1GSP A;  1RGF A;  5RNT A;  1UCJ A;  3KCH A;  1T2I A;  2C4B A;  4HAA A;  2KF6 A;  2ZA4 A;  1R4Y A;  1C54 A;  3BU4 A;  1BRS A;  9RNT A;  1RN1 A;  1I3F A;  1Q9E A;  1BUJ A;  1BGS A;  1B2S A;  1TTO A;  1LNI A;  1ZGX A;  4HOH A;  1HYF A;  2AAE A;  1GMR A;  1RSN A;  3D4A A;  1GMQ A;  1LOW A;  7GSP A;  1BNR A;  1BNS A;  1BNF A;  1RGK A;  4GHO A;  1BU4 A;  1I2E A;  1TRP A;  4J5G A;  1RGA A;  1A2P A;  1B2M A;  1I0V A;  1AY7 A;  1BRJ A;  4RNT A;  1FUS A;  1BSA A;  1X1X A;  1I8V A;  3GSP A;  1UCL A;  1RTU A;  2KF3 A;  1RCK A;  3BIR A;  1BNI A;  1FUT A;  1BRG A;  3AGO A;  1RNB A;  1SAR A;  1RNT A;  1B27 A;  1BRI A;  1B21 A;  2KF5 A;  1BSC A;  1FW7 A;  1GOV A;  2RBI A;  1YNV X;  2AAD A;  1B2X A;  3DGY A;  1BSE A;  1TRQ A;  1RGG A;  7RNT A;  1RN4 A;  1YVS A;  1GOY A;  3SYU A;  4BU4 A;  1X1W A;  1FYS A;  1RGH A;  2HOH A;  1RLS A;  1I0X A;  1BSB A;  1GMP A;  1BSD A;  6RNT A;  3AGN A;  1JBT A;  2SAR A;  1DE3 A;  1CH0 A;  3D5G A;  2F4Y A;  2F56 A;  3AHS A;  1B3S A;  1B20 A;  1LRA A;  1G02 A;  2BIR A;  1AQZ A;  6GSP A;  1BRN L;  1RMS A;  3WR2 A;  1I2F A;  1BNE A;  1T2H A;  1I70 A;  1BRK A;  1HZ1 A;  2GSP A;  1JBR A;  1BVI A;  3DH2 A;  4GSP A;  1BAO A;  1RGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...