5IG5A

Crystal structure of n. vectensis camkii-b hub at ph 4.2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
137
Chain Sequence
HTIIEEDTESTKTQREQEIIRLTQQLITSITAKDFDSYSKLVDPKITAFEPEALGNQVEGLEFHKFYFDNLPTTVNTTILAPHVQMLGEEGACISYVRLTQGIGPDGLPRTTQSEETRVWQKKKGVWLNVHFHRSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Transferase
molecule keywords CaMKII-B hub
total genus 39
structure length 137
sequence length 141
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ig5A00
3FGYA 3M8CA 3F8XA 6STDA 1E97A 2Z76A 4HM4B 1OGZA 3NV0A 3OV4A 1Q40B 3HK4A 3EN1B 1DMNA 3KE7A 4R9LA 3F7SA 3RGRA 4HM7B 3OWSA 5BVBA 1OH0A 1OHOA 3UNLA 3GRDA 3FSDA 3VSYA 3STDA 1UUVB 3GZBA 3MHEA 4XDWA 5BXQA 5KP4A 5D83A 3K7CA 2RFRA 1NWWA 3GZXB 4PEJA 1CQSA 3OWYA 1Q40A 1OGXA 2QIYA 3IPTA 4X2OA 4HM8B 5HGRA 3EN8A 5AIHA 1OF5A 4N3VA 2JQ5A 4HM3B 3CPOA 2B1XB 5AEUB 3MKIA 3RGAA 3F8HA 1O7NB 3OXAA 1GS3A 4LEHA 4XBYA 1OHPA 4WP5A 1AR0A 1UUWB 4HKVB 3B8LA 4L8PA 4XBTA 4XM4A 1JN5B 2IMJA 5KP3A 3DZLA 2XSHB 2YFIB 3BLZA 3NHXA 4HM5B 1DMQA 3KZTA 3ROBA 3GZRA 1U5OA 2HMJB 1STDA 3FLJA 2Z77A 3S5CA 1OUNA 3VGNA 1S5AA 1TUHA 3LYGA 4XDVA 3NUVA 4K1VA 2R4IA 1Q42A 3EC9A 3K0ZA 4I4KA 4R9KA 5AEWB 8CHOA 1ASKA 5IG0A 5CXOA 1GY5A 4CDLA 1EG9B 1SJWA 3B7CA 3ECFA 3SOAA 3UJMA 1GY6A 1W02A 3MYTA 3FH1A 2BNGA 2CKFB 3HZPA 5CK6A 5FW5A 4L8OA 4STDA 1JN5A 4RZMA 2RGQA 3MG1A 3CU3A 3NBRA 4IIAA 5DRVA 3MSOA 5TGNA 3BB9A 1IDPA 2QGUA 3GZYB 2UX0A 1JKGA 4XB5A 1HKXA 5IEPA 5DREA 1W6YA 3EQQB 4FCJA 4LGQA 5IF6A 2HMLB 3FF0A 1JB2A 3EHCA 1JB4A 3HX8A 2CHCA 3NV0B 5STDA 1C7HA 3GWRA 3DM8A 5IG3A 3F14A 3E99A 3FKAA 3FF2A 2HMMB 3KSPA 1E3VA 1WQLB 2BMOB 3B4PA 3MG3A 4H3UA 2RCDA 5JPPA 5KP1A 2B24B 1GYBA 2F99A 3DUKA 4OVMA 4WWUC 4XBXA 3G0KA 1NU3A 4FCMA 7STDA 2STDA 4J8TA 2GEXA 5AIIA 2HMNB 2HMOB 1E3RA 4KVHA 3JUNA 3JUOA 4WYKB 3A76A 1GY7A 2YFLB 1O7MB 4HZ9B 4HJLB 5IENA 3H3HA 4R1KA 2HMKB 5D81A 1BUQA 3EF8A 2BMQB 2Z7AA 2A15A 4K1UA 1ULJB 5IG5A 1OHSA 1OPYA 5EVHA 5JPUA 2I9WA 3F40A 3CNMA 1A2KA 3OX9A 4MJDA 3G8ZA 2GBWB 3Q90A 1ZO2A 1QJGA 3FZWA 3I0YA 3F9SA 3T8UA 1QMAA 4HZBB 4U13A 1TP6A 3EX9A 3F7XA 3EBTA 4HM6B 4HVNA 4LMIA 4HM1B 3DXOA 4ORLA 4WYKA 3B4OA 5G2GA 1W01A 1JB5A 2GXFA 5D82A 1W00A 2F86B 3DMCA 3NXJA 1OCVA 1DMMA 1EA2A 4X2HA 5IEOA 2GBXB 1Z1SA 2K54A 3NM2A 3H51A 5IERA 2YFJB 5IG4A 1O7GB 2INXA 2OWPA 3CNXA 3EBYA 2XR8B 4HM2B 4L7KA 3T8NA 1O7PB 3ER7A 3D9RA 5AIGA 1O7WB 2XSOB 5AI1A 4HM0B 1VZZA 3JUPA 5CF2A 1K41A 4J9AA 5AIFA 2BMRB 3KKGA 2GEYA 1ULIB 3SOYA 3JUQA 1O7HB 1JKGB 2W2CA 3EJVA 2F98A 1ISKA 4GB5A 3OWUA 1OF5B 2PZVA 2XRXB 3G16A 4Q53A 1ZX2A 3SEDA 3WMDA 4OUQA 5CLKA 3JUMA 3MG2A 3LZAA 1NDOB 5CF1A
chains in the Genus database with same CATH superfamily
1I2GA 1E97A 1N5HA 5IG4A 1DVDA 3HK4A 4NPBA 1M1K4 1JV2B 3F7SA 5CF1A 3GRDA 3X3YA 3CCU3 3DY5A 1YHQ3 1RNTA 3GZBA 3LH4A 3NX0A 1W7CA 3K7CA 5D83A 3X42A 3WA3A 1UI7A 2D42A 1G96A 1UUGB 1RGEA 3IPTA 3D3LA 3IJEB 4X2OA 5HGRA 5RNTA 1Q824 1YIJ3 4N3VA 3CPOA 2B1XB 3ZFZA 1F8NA 3DGOA 3OXAA 5M1AA 1DYUA 1OHPA 4HKVB 3B8LA 4XBTA 4XM4A 1FUWA 2UGIA 2GU3A 2YFIB 1MNLA 1BRNL 4AEQA 1W5ZA 1STDA 1HZ1A 3D79A 1J2BA 1S5AA 4XDVA 2WO0A 3KN4A 6GSPA 1NNVA 3Q3FA 2KF5A 1M1XB 1B2MA 3EE1A 2KF6A 3S29A 2C4BA 4NHFA 1GY5A 5CXOA 5IG0A 3B7CA 3WHOA 3BIRA 2MF7A 1BRJA 2E2UA 2BNGA 1BNJA 1BRSA 1ROVA 3HZPA 4MMYB 4N6MA 1JN5A 3WA2X 2RGQA 5TGNA 1IV7A 3MSOA 2OTL3 2QGUA 3GZYB 3UB1A 1JKGA 1TTOA 3LTAA 1HKXA 4XB5A 2CX0A 1W6YA 1EQKA 4JF8A 4BU4A 4FCJA 4LGQA 1AY7A 1C54A 1JZOA 4DKIA 2W9QA 1RCKA 2SBLA 1B20A 2XGNA 2CHCA 3AGNA 4G1MB 1C7HA 2L4VA 2M7OA 1IQYA 2GU1A 3FF2A 1E3VA 2RCDA 1GYBA 2F99A 1B2ZA 4XBXA 1Q814 1IT7A 1RGKA 3G6E3 3A5EA 5ELUA 1FGRA 2GEXA 3DGLA 1EEJA 2HMOB 3RDEA 3LMLA 4O2HA 4KVHA 4WYKB 2QA43 1SIHA 1CYVA 4EYCA 3WDGB 5IENA 3CCQ3 4CCVA 2HMKB 3EB8A 1NB5I 3EF8A 1T2HA 1FW7A 1MGWA 3AMOA 1AV4A 2Y73A 4KFEA 4RBNA 3T0UA 5JPUA 2V1LA 3F40A 3DGYA 3CNMA 1A2KA 3KSED 5GSPA 4EW5A 3F9SA 2P05A 2P0XA 2W9PA 1UDII 4U13A 3NM7A 4HM6B 4N6UA 2K3DA 4WYKA 1GMRA 3MWZA 3KCHA 2H0HA 1W00A 2F86B 2WOHA 4J5GA 3NXJA 3ALAA 5AYRB 1FUTA 2W6JH 2F56A 2ML6A 2CFKA 4WFOA 1JNQA 1UCLA 1Q7Y4 2WGOA 3DGMA 3CNXA 3EBYA 2XR8B 1RGHA 5FGOA 5LC6A 3D9RA 5AIGA 1TIJA 1O7WB 3CMA3 1MWTA 4HM0B 3NQZA 1KWIA 3KKGA 4JRFA 1ULIB 1Q9EA 2KAAA 1KC84 1JKGB 5IW9A 4K90B 2OOVA 3SEDA 4KT3B 4HYZA 1UCKA 1UI8A 3MG2A 3LZAA 1PU4A 1VQN3 1EKMA 3F8XA 3LTDA 2F5MA 3EN1B 3KE7A 1SIIA 3OWSA 4HM7B 1BNGA 3K63A 1A2VA 3VF1A 3VSYA 5KP4A 1D6UA 3MHEA 4XDWA 1YVSA 1NWWA 2H0IA 2HOHA 3QRDA 1VQQA 2FNQA 1K8A4 4FMCA 1I2EA 1VQ53 1MOLA 1SPUA 2FXTA 3KIIA 3LT9A 2P38A 1N8QA 4WP5A 1AR0A 1UUWB 4L8PA 4GSPA 5KP3A 1JN5B 1WMNA 2IMJA 3DZLA 2OQEA 1B2UA 3CPW2 3BLZA 3ROBA 4BIRA 1DMQA 3KZTA 5A0OB 3GZRA 1QAFA 1U5OA 2GSPA 2HMJB 2IUKA 4FR9A 1CYUA 1TUHA 1JBTA 3NUVA 4NREA 4K1VA 1MGRA 2WOFA 3K0ZA 3LTBA 3CXC2 3LXUX 1D6YA 2BHMA 2ZHXB 1EG9B 1SJWA 2OOVC 3ECFA 3SOAA 4CDLA 1GY6A 1W02A 2RBIA 3MYTA 3DGNA 3D5IA 1GOUA 2XGLA 4L8OA 4RNZA 1YJN3 3D4AA 3BU4A 3I553 1NJI4 1S723 2BU4A 4WHAA 3JVCA 4GHOA 2C11A 4H61A 5IEPA 4EV2A 1BUJA 2BIRA 1AQZA 3URPA 2FGTA 4N6TA 2HMLB 2CG1A 3FF0A 3ZG0A 3U1WA 1JB4A 1FGTA 1MWSA 1Q7HA 2CWUA 4GL6A 3V92A 1D6ZA 2QEX3 3GWRA 2CWTA 4O3VA 3F14A 2W56A 2RNTA 3E99A 4H3UA 4EV5A 2BMOB 3MG3A 3B4PA 1RDSA 1LNHA 1VQ63 2B24B 2C10A 7GSPA 2IA7A 1RGFA 1ZGXA 2XH9A 1BANA 3K5TA 3NQYA 1BOXA 4FCMA 1RTUA 7STDA 1A67A 3PCSA 4HBRA 1RN7A 2HMNB 1VQ93 3JUNA 1QALA 2ZL8A 3FG4A 1BSAA 1RSNA 3PGBA 1BU4A 1Y4KA 2ZDJA 2XEPA 4N6OB 3WOFB 2A15A 1LOWA 4MEIA 1DE3A 1MWRA 1KSIA 1M9GA 2I9WA 1RNBA 1VQ83 2BO9B 1CEWI 2GBWB 1G02A 1ZO2A 1RN1A 5AYSC 3PZWA 4N6V0 3N54B 4TX4A 4ILFA 4BL3A 4HZBB 1TP6A 3EX9A 4KZ1A 3F7XA 3BNDA 1VQ43 4HM1B 3DXOA 1T3BA 1A90A 1IV9A 1W01A 5D82A 3SXXA 6RNTA 3CD63 3CCE3 4R80A 4X2HA 1EA2A 1FGQA 1WNHA 4RNTA 4EC6A 1VQP3 3NM2A 3H51A 1JBSA 3QK9A 2OQEC 3CCR3 1HU9A 3CC23 2K0MA 4HM2B 2OWPA 4HOHA 1WTHA 1AVKA 1O7PB 1GD4A 3CCS3 3JUPA 1K41A 2O3OA 1X1YA 3DH2A 2GEYA 3HOHA 1RGAA 1RLSA 2CWVA 3SOYA 1O7HB 1BRKA 3EJVA 3PS8A 5BIRA 1BSEA 1BRHA 3G16A 3WMDA 2CG0A 2Y74A 1RMSA 4OUQA 1BNEA 1RJOA 3FGYA 3M8CA 2Z76A 1KQS2 2F5WA 3NV0A 3OV4A 1Q40B 4FMBA 4R9LA 3WOEB 2W56B 1UCJA 1IU7A 2AADA 2ML5A 1K28A 3UNLA 3FSDA 5HOHA 3STDA 1UUVB 5BXQA 3CC73 1YJW3 3N8BA 2RFRA 2KF3A 1SARA 2CFDA 3LOYA 3OWYA 1Q40A 3AMOB 3J7Yd 1BNRA 1L5GB 1IQXA 2Q07A 2CX1A 2JQ5A 3S67A 4AKYA 5AEUB 1LOVA 3MKIA 1TRQA 2JDIH 1O7NB 4LEHA 2ZA4A 3V99A 1GOVA 2XSHB 1FUSA 3BNBA 4EBGA 3WR2A 1JJ22 2IYJA 3FLJA 3K9MC 4KFDA 4MMZB 4N6NB 1OUNA 3VGNA 1FGMA 1BVIA 3LYGA 1LNIA 1BNFA 1STFI 2R4IA 2CC3A 1TFOA 4I4KA 2XFSA 5AEWB 8CHOA 1BSCA 1T5YA 1ASKA 1IVXA 3CME3 1DVCA 3FG1A 1NO3A 2CKFB 5CK6A 1B2SA 2Z6BA 5FW5A 3BNEA 1IT8A 4RZMA 3MG1A 3CU3A 5DRVA 1UCIA 3SX1A 2W03A 3V98A 4ZM8A 5M19A 3SYUA 2CIUA 3CCM3 3EQQB 1N5PA 1YIT3 1GMQA 3EHCA 2OTJ3 3CC43 1YNVX 1JBRA 1I3IA 3NV0B 5STDA 2WGQA 3FKAA 3L0RA 4J9AA 2HMMB 2BT3A 5G1KA 5JPPA 1AVLA 3CCV3 1BNIA 1BAOA 2MC8A 4J8TA 4OK0A 3KFQC 3IMAB 2IUJA 1LQGC 1E3RA 3SVAA 3JUOA 4AKZA 1TRPA 1GY7A 3A76A 1O7MB 2P09A 4HZ9B 1VQM3 2IY2A 1RGLA 1I70A 3PXMA 1YGEA 4HJLB 1RCLA 1QAKA 5D81A 3X40A 4K1UA 3TDGA 3G4S3 1T2IA 3G713 2CFWA 1CH0A 4MJDA 1RKYA 1YI23 1RGCA 3G8ZA 3Q90A 1BRIA 1QMAA 3N9HA 1V57A 1B3SA 1QVG2 1ROAA 4HVNA 1TFKA 1DETA 5G2GA 3I563 2XF3A 1N9JA 3Q2PA 1OCVA 1VQL3 1GOYA 1LVNA 2GBXB 5IEOA 1ZS7A 1Z1SA 2H0GA 2PNCA 1PFPA 3GSPA 5IERA 2L1SA 4CJNA 1BSBA 3CCJ3 1RRLA 2INXA 1W4NA 5EEOA 4J5KA 5G1LA 3T8NA 4L7KA 4LYLB 5EQLA 1TU5A 1M904 4R4KA 1VZZA 3GAXA 4LZIA 2BMRB 4O02B 1U8CB 1I2FA 2W04A 1FZUA 1LXEA 2W2CA 2F98A 1LOXA 1OF5B 1B21A 1LRAA 2PZVA 5ELJA 3LT8A 2KXGA 3HIIA 1I3FA 4MMXB 5CLKA 4KFFA 6STDA 3RNTA 5I97A 1Q864 1I0XA 4HM4B 1OGZA 4RNYA 1DMNA 2RSXA 3RGRA 5BVBA 1OH0A 1OHOA 3ZG5A 4K61A 4O8SA 1VQ73 2CK3H 4PEJA 3GZXB 3NBBA 1CQSA 1OGXA 1JZDA 3BNCA 1WMPA 2QIYA 1A2PA 4HM8B 3EN8A 5AIHA 1FGOA 1N9EA 1OF5A 4HM3B 4EXRA 1OACA 1LQMB 2CW9A 3RGAA 3F8HA 1GS3A 1G0TA 4XBYA 2W0QA 2LQVA 1PYLA 3U97A 2F4YA 4FMAA 2CH9A 3NHXA 4HM5B 1RN4A 3FG3A 3S5CA 7RNTA 2Z77A 1UGIA 1W2B2 3WODG 4I5QA 1FA3A 3AGOA 1X1UA 1X1XA 1V58A 1Q42A 2KCDA 2E2TA 3EC9A 4R9KA 2CFLA 1YGWA 3X3ZA 3HIGA 1GD3A 3UJMA 1BGSA 1IVVA 1V74A 1TJDA 1FYSA 1IVWA 5LC7A 3FH1A 1QVF2 4STDA 2UUGC 3NBRA 3X3XA 4IIAA 2D1WA 1SQWA 1IDPA 3BB9A 2UX0A 4CPKA 5DREA 1I8VA 2E2VA 1RGGA 5IF6A 1EUIC 4HAAA 1BNSA 4FCZA 4N6LA 9RNTA 1JB2A 5M18A 1X1WA 3X41A 2KRTA 2OCTA 3HX8A 1KD14 1R4YA 2KF4A 2YX9A 1B27A 1R4CA 3DM8A 5IG3A 4BL2A 3KSPA 4IPBA 1RRHA 1W2ZA 1MWUA 1WQLB 5KP1A 3FCSB 1HYFA 1LOYA 3DUKA 4OVMA 4WWUC 3G0KA 1NU3A 4BTXA 2STDA 3SLUA 3LTCA 3PCRA 1YVBI 5AIIA 1IK3A 1K9M4 2YFLB 3H3HA 4R1KA 1BUQA 1PY3A 2BMQB 2Z7AA 1YJ93 1ULJB 8RNTA 1BIRA 1OHSA 1OPYA 1GSPA 5EVHA 5IG5A 1K734 3PYJA 1W6CA 3OX9A 5BU4A 3Q1CA 3FZWA 1QJGA 1US1A 1BSDA 3HI7A 3I0YA 3MPHA 3S27A 3UL6A 1GMPA 1B2XA 3T8UA 1VQK3 2P0MA 2SARA 3OW22 1IYYA 3EBTA 4LMIA 4ORLA 2XFTA 3B4OA 1JB5A 2GXFA 4BTYA 1VQO3 3DMCA 4FMDA 1DMMA 3NBJA 2K54A 2O9UX 3AHSA 3S28A 2J8XB 1UW1A 1I0VA 2YFJB 1O7GB 4QWTA 2CFGA 3O8YA 1BRGA 1IVUA 3ER7A 3AHWA 2LYXA 4BTWA 2XSOB 1IQ8A 5AI1A 1N8R4 1W6GA 5CF2A 2AAEA 5AIFA 3D5GA 5JBSA 3JUQA 3CCL3 1NB3I 1WMOA 3UL5A 4LSOA 1ISKA 4GB5A 3OWUA 2XRXB 4Q53A 1UGHI 1ZX2A 2R41A 1RHLA 3JUMA 1JRQA 1NDOB 4IT7A
chains in the Genus database with same CATH topology
1E97A 1N5HA 5IG4A 1DVDA 3HK4A 1M1K4 1JV2B 3F7SA 5CF1A 3GRDA 3X3YA 3CCU3 3DY5A 1YHQ3 3GZBA 3LH4A 3NX0A 1W7CA 3K7CA 5D83A 3X42A 3WA3A 1UI7A 2D42A 1G96A 3IPTA 3D3LA 3IJEB 4X2OA 5HGRA 1Q824 1YIJ3 4N3VA 3CPOA 2B1XB 1F8NA 3DGOA 3OXAA 1DYUA 1OHPA 4HKVB 3B8LA 4XBTA 4XM4A 1FUWA 2GU3A 2YFIB 1MNLA 4AEQA 1W5ZA 1STDA 1J2BA 1S5AA 4XDVA 2WO0A 3KN4A 1M1XB 3EE1A 3S29A 4NHFA 5CXOA 1GY5A 5IG0A 3B7CA 2MF7A 2E2UA 2BNGA 1ROVA 4MMYB 3HZPA 4N6MA 1JN5A 3WA2X 2RGQA 5TGNA 1IV7A 3MSOA 2OTL3 2QGUA 3GZYB 3UB1A 1JKGA 3LTAA 4XB5A 1HKXA 1W6YA 1EQKA 4JF8A 4FCJA 4LGQA 2W9QA 2SBLA 2XGNA 2CHCA 4G1MB 1C7HA 2L4VA 2M7OA 1IQYA 2GU1A 3FF2A 1E3VA 2RCDA 1GYBA 2F99A 4XBXA 1Q814 1IT7A 3G6E3 5ELUA 1FGRA 2GEXA 3DGLA 2HMOB 3RDEA 3LMLA 4O2HA 4KVHA 4WYKB 2QA43 1SIHA 1CYVA 4EYCA 3WDGB 5IENA 3CCQ3 4CCVA 2HMKB 3EB8A 1NB5I 3EF8A 3AMOA 1AV4A 2Y73A 4KFEA 4RBNA 3T0UA 5JPUA 2V1LA 3F40A 3KSED 3CNMA 1A2KA 3F9SA 2P0XA 2W9PA 4U13A 3NM7A 4HM6B 4N6UA 4WYKA 3MWZA 1W00A 2F86B 2WOHA 3NXJA 3ALAA 5AYRB 2W6JH 2ML6A 2CFKA 4WFOA 1JNQA 1Q7Y4 2WGOA 3DGMA 3CNXA 3EBYA 2XR8B 5FGOA 5LC6A 3D9RA 5AIGA 1TIJA 1O7WB 3CMA3 4HM0B 3NQZA 1KWIA 3KKGA 4JRFA 1ULIB 1KC84 1JKGB 5IW9A 4K90B 2OOVA 3SEDA 4HYZA 1UI8A 3MG2A 3LZAA 1PU4A 1VQN3 1EKMA 3F8XA 3LTDA 3EN1B 3KE7A 1SIIA 3OWSA 4HM7B 3K63A 1A2VA 3VF1A 3VSYA 5KP4A 1D6UA 3MHEA 4XDWA 1NWWA 3QRDA 2FNQA 1K8A4 4FMCA 1VQ53 1MOLA 1SPUA 2FXTA 3KIIA 3LT9A 2P38A 1N8QA 4WP5A 1AR0A 1UUWB 4L8PA 5KP3A 1JN5B 1WMNA 2IMJA 3DZLA 2OQEA 3CPW2 3BLZA 3ROBA 5A0OB 1DMQA 3KZTA 3GZRA 1QAFA 1U5OA 2HMJB 1CYUA 2IUKA 4FR9A 1TUHA 3NUVA 4NREA 4K1VA 3K0ZA 2WOFA 3CXC2 3LTBA 3LXUX 1D6YA 2BHMA 4CDLA 3ECFA 1EG9B 1SJWA 2OOVC 3SOAA 3CC43 1GY6A 1W02A 3MYTA 3DGNA 2XGLA 4L8OA 4RNZA 1YJN3 3I553 1NJI4 1S723 4WHAA 3JVCA 2C11A 4H61A 5IEPA 4EV2A 2FGTA 4N6TA 2HMLB 2CG1A 3FF0A 3U1WA 1JB4A 1FGTA 4GL6A 2CWUA 3V92A 2QEX3 1D6ZA 3GWRA 2CWTA 4O3VA 3F14A 2W56A 3E99A 4H3UA 4EV5A 2BMOB 3MG3A 3B4PA 1LNHA 1VQ63 2B24B 2C10A 2IA7A 3NQYA 2XH9A 3K5TA 4FCMA 7STDA 1A67A 3PCSA 4HBRA 1RN7A 2HMNB 1VQ93 3JUNA 1QALA 2ZL8A 3FG4A 3PGBA 1Y4KA 2ZDJA 2XEPA 4N6OB 3WOFB 2A15A 4MEIA 1KSIA 1M9GA 2I9WA 1VQ83 2BO9B 1CEWI 2GBWB 5AYSC 1ZO2A 3PZWA 4N6V0 3N54B 4TX4A 4HZBB 1TP6A 3EX9A 4KZ1A 3F7XA 3BNDA 1VQ43 4HM1B 3DXOA 1A90A 1IV9A 1W01A 5D82A 3SXXA 3CD63 3CCE3 4R80A 4X2HA 1EA2A 1FGQA 1WNHA 4EC6A 1VQP3 3NM2A 3H51A 3QK9A 2OQEC 3CCR3 1NDOB 1HU9A 3CC23 2K0MA 4HM2B 2OWPA 1WTHA 1AVKA 1O7PB 1GD4A 3CCS3 3JUPA 1K41A 2O3OA 2GEYA 3SOYA 2CWVA 1O7HB 3EJVA 3PS8A 3G16A 3WMDA 2CG0A 2Y74A 4OUQA 1RJOA 3FGYA 3M8CA 2Z76A 1KQS2 3NV0A 3OV4A 1Q40B 4FMBA 4R9LA 3WOEB 2W56B 1IU7A 2ML5A 1K28A 3UNLA 3FSDA 3CC73 3STDA 1UUVB 5BXQA 1YJW3 3N8BA 2RFRA 2CFDA 3LOYA 3OWYA 1Q40A 3AMOB 3J7Yd 1L5GB 1IQXA 2Q07A 2JQ5A 3S67A 4AKYA 5AEUB 3MKIA 2JDIH 1O7NB 4LEHA 3V99A 2XSHB 4EBGA 3BNBA 1JJ22 3FLJA 4MMZB 3K9MC 4KFDA 4N6NB 1OUNA 3VGNA 1FGMA 3LYGA 1STFI 2R4IA 2CC3A 1TFOA 4I4KA 2XFSA 5AEWB 8CHOA 1T5YA 1ASKA 1IVXA 3CME3 1DVCA 3FG1A 1NO3A 2CKFB 5CK6A 2Z6BA 5FW5A 3BNEA 1IT8A 4RZMA 3MG1A 3CU3A 5DRVA 3SX1A 2W03A 3V98A 4ZM8A 2CIUA 3CCM3 3EQQB 1N5PA 1YIT3 3EHCA 2OTJ3 3NV0B 5STDA 2WGQA 3FKAA 3L0RA 4J9AA 2HMMB 2BT3A 5JPPA 1AVLA 3CCV3 2MC8A 4J8TA 4OK0A 3KFQC 3IMAB 2IUJA 3SVAA 1E3RA 3JUOA 4AKZA 3A76A 1GY7A 1VQM3 1O7MB 2P09A 4HZ9B 3PXMA 4HJLB 1YGEA 5D81A 1QAKA 3X40A 4K1UA 3TDGA 3G4S3 3G713 2CFWA 1RKYA 4MJDA 1YI23 3G8ZA 3Q90A 1QMAA 3N9HA 1QVG2 1ROAA 4HVNA 1TFKA 5G2GA 3I563 2XF3A 1N9JA 3Q2PA 1OCVA 1VQL3 1LVNA 5IEOA 2GBXB 1Z1SA 2PNCA 1PFPA 5IERA 3CCJ3 1RRLA 2INXA 1W4NA 5EEOA 3T8NA 4L7KA 5EQLA 1TU5A 1M904 4R4KA 1VZZA 3GAXA 4LZIA 2BMRB 4O02B 1U8CB 2W04A 1LXEA 2W2CA 2F98A 1LOXA 1OF5B 2PZVA 5ELJA 3LT8A 2KXGA 3HIIA 5CLKA 4MMXB 4KFFA 6STDA 5I97A 1Q864 4HM4B 1OGZA 4RNYA 1DMNA 2RSXA 3RGRA 5BVBA 1OH0A 1OHOA 4K61A 4O8SA 1VQ73 2CK3H 4PEJA 3GZXB 3NBBA 1CQSA 1OGXA 3BNCA 1WMPA 2QIYA 4HM8B 3EN8A 5AIHA 1FGOA 1N9EA 1OF5A 4HM3B 4EXRA 1OACA 2CW9A 3RGAA 3F8HA 1GS3A 4XBYA 2W0QA 2LQVA 3U97A 4FMAA 2CH9A 3NHXA 4HM5B 3FG3A 3S5CA 2Z77A 1W2B2 3WODG 1FA3A 2KCDA 1Q42A 3EC9A 2E2TA 4R9KA 2CFLA 3X3ZA 3HIGA 1GD3A 3UJMA 1V74A 1IVVA 1IVWA 5LC7A 3FH1A 1QVF2 4STDA 3NBRA 3X3XA 4IIAA 2D1WA 1SQWA 1IDPA 3BB9A 2UX0A 5DREA 2E2VA 5IF6A 4N6LA 4FCZA 1JB2A 3X41A 2KRTA 2OCTA 3HX8A 1KD14 2YX9A 3DM8A 1R4CA 5IG3A 3KSPA 4IPBA 1RRHA 1W2ZA 1WQLB 5KP1A 3FCSB 3DUKA 4OVMA 4WWUC 3G0KA 1NU3A 4BTXA 2STDA 3SLUA 3LTCA 3PCRA 1YVBI 5AIIA 1IK3A 1K9M4 2YFLB 3H3HA 4R1KA 1BUQA 2BMQB 2Z7AA 1YJ93 1ULJB 5IG5A 1OHSA 1OPYA 5EVHA 1K734 3PYJA 1W6CA 3OX9A 3Q1CA 3FZWA 1QJGA 1US1A 3HI7A 3I0YA 3MPHA 3S27A 3UL6A 3T8UA 1VQK3 2P0MA 3OW22 3EBTA 4LMIA 4ORLA 2XFTA 3B4OA 1JB5A 2GXFA 4BTYA 1VQO3 3DMCA 4FMDA 1DMMA 3NBJA 2K54A 2O9UX 3S28A 1UW1A 2YFJB 1O7GB 4QWTA 2CFGA 3O8YA 1IVUA 3ER7A 4BTWA 2LYXA 2XSOB 1IQ8A 5AI1A 1N8R4 1W6GA 5CF2A 5AIFA 5JBSA 3JUQA 3CCL3 1NB3I 1WMOA 3UL5A 4LSOA 1ISKA 4GB5A 3OWUA 2XRXB 4Q53A 1ZX2A 3JUMA 1JRQA 2P05A 4IT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGY A;  3M8C A;  3F8X A;  6STD A;  1E97 A;  2Z76 A;  4HM4 B;  1OGZ A;  3NV0 A;  3OV4 A;  1Q40 B;  3HK4 A;  3EN1 B;  1DMN A;  3KE7 A;  4R9L A;  3F7S A;  3RGR A;  4HM7 B;  3OWS A;  5BVB A;  1OH0 A;  1OHO A;  3UNL A;  3GRD A;  3FSD A;  3VSY A;  3STD A;  1UUV B;  3GZB A;  3MHE A;  4XDW A;  5BXQ A;  5KP4 A;  5D83 A;  3K7C A;  2RFR A;  1NWW A;  3GZX B;  4PEJ A;  1CQS A;  3OWY A;  1Q40 A;  1OGX A;  2QIY A;  3IPT A;  4X2O A;  4HM8 B;  5HGR A;  3EN8 A;  5AIH A;  1OF5 A;  4N3V A;  2JQ5 A;  4HM3 B;  3CPO A;  2B1X B;  5AEU B;  3MKI A;  3RGA A;  3F8H A;  1O7N B;  3OXA A;  1GS3 A;  4LEH A;  4XBY A;  1OHP A;  4WP5 A;  1AR0 A;  1UUW B;  4HKV B;  3B8L A;  4L8P A;  4XBT A;  4XM4 A;  1JN5 B;  2IMJ A;  5KP3 A;  3DZL A;  2XSH B;  2YFI B;  3BLZ A;  3NHX A;  4HM5 B;  1DMQ A;  3KZT A;  3ROB A;  3GZR A;  1U5O A;  2HMJ B;  1STD A;  3FLJ A;  2Z77 A;  3S5C A;  1OUN A;  3VGN A;  1S5A A;  1TUH A;  3LYG A;  4XDV A;  3NUV A;  4K1V A;  2R4I A;  1Q42 A;  3EC9 A;  3K0Z A;  4I4K A;  4R9K A;  5AEW B;  8CHO A;  1ASK A;  5IG0 A;  5CXO A;  1GY5 A;  4CDL A;  1EG9 B;  1SJW A;  3B7C A;  3ECF A;  3SOA A;  3UJM A;  1GY6 A;  1W02 A;  3MYT A;  3FH1 A;  2BNG A;  2CKF B;  3HZP A;  5CK6 A;  5FW5 A;  4L8O A;  4STD A;  1JN5 A;  4RZM A;  2RGQ A;  3MG1 A;  3CU3 A;  3NBR A;  4IIA A;  5DRV A;  3MSO A;  5TGN A;  3BB9 A;  1IDP A;  2QGU A;  3GZY B;  2UX0 A;  1JKG A;  4XB5 A;  1HKX A;  5IEP A;  5DRE A;  1W6Y A;  3EQQ B;  4FCJ A;  4LGQ A;  5IF6 A;  2HML B;  3FF0 A;  1JB2 A;  3EHC A;  1JB4 A;  3HX8 A;  2CHC A;  3NV0 B;  5STD A;  1C7H A;  3GWR A;  3DM8 A;  5IG3 A;  3F14 A;  3E99 A;  3FKA A;  3FF2 A;  2HMM B;  3KSP A;  1E3V A;  1WQL B;  2BMO B;  3B4P A;  3MG3 A;  4H3U A;  2RCD A;  5JPP A;  5KP1 A;  2B24 B;  1GYB A;  2F99 A;  3DUK A;  4OVM A;  4WWU C;  4XBX A;  3G0K A;  1NU3 A;  4FCM A;  7STD A;  2STD A;  4J8T A;  2GEX A;  5AII A;  2HMN B;  2HMO B;  1E3R A;  4KVH A;  3JUN A;  3JUO A;  4WYK B;  3A76 A;  1GY7 A;  2YFL B;  1O7M B;  4HZ9 B;  4HJL B;  5IEN A;  3H3H A;  4R1K A;  2HMK B;  5D81 A;  1BUQ A;  3EF8 A;  2BMQ B;  2Z7A A;  2A15 A;  4K1U A;  1ULJ B;  5IG5 A;  1OHS A;  1OPY A;  5EVH A;  5JPU A;  2I9W A;  3F40 A;  3CNM A;  1A2K A;  3OX9 A;  4MJD A;  3G8Z A;  2GBW B;  3Q90 A;  1ZO2 A;  1QJG A;  3FZW A;  3I0Y A;  3F9S A;  3T8U A;  1QMA A;  4HZB B;  4U13 A;  1TP6 A;  3EX9 A;  3F7X A;  3EBT A;  4HM6 B;  4HVN A;  4LMI A;  4HM1 B;  3DXO A;  4ORL A;  4WYK A;  3B4O A;  5G2G A;  1W01 A;  1JB5 A;  2GXF A;  5D82 A;  1W00 A;  2F86 B;  3DMC A;  3NXJ A;  1OCV A;  1DMM A;  1EA2 A;  4X2H A;  5IEO A;  2GBX B;  1Z1S A;  2K54 A;  3NM2 A;  3H51 A;  5IER A;  2YFJ B;  5IG4 A;  1O7G B;  2INX A;  2OWP A;  3CNX A;  3EBY A;  2XR8 B;  4HM2 B;  4L7K A;  3T8N A;  1O7P B;  3ER7 A;  3D9R A;  5AIG A;  1O7W B;  2XSO B;  5AI1 A;  4HM0 B;  1VZZ A;  3JUP A;  5CF2 A;  1K41 A;  4J9A A;  5AIF A;  2BMR B;  3KKG A;  2GEY A;  1ULI B;  3SOY A;  3JUQ A;  1O7H B;  1JKG B;  2W2C A;  3EJV A;  2F98 A;  1ISK A;  4GB5 A;  3OWU A;  1OF5 B;  2PZV A;  2XRX B;  3G16 A;  4Q53 A;  1ZX2 A;  3SED A;  3WMD A;  4OUQ A;  5CLK A;  3JUM A;  3MG2 A;  3LZA A;  1NDO B;  5CF1 A; 
#chains in the Genus database with same CATH topology
 1I2G A;  1E97 A;  1N5H A;  5IG4 A;  1DVD A;  3HK4 A;  4NPB A;  1M1K 4;  1JV2 B;  3F7S A;  5CF1 A;  3GRD A;  3X3Y A;  3CCU 3;  3DY5 A;  1YHQ 3;  1RNT A;  3GZB A;  3LH4 A;  3NX0 A;  1W7C A;  3K7C A;  5D83 A;  3X42 A;  3WA3 A;  1UI7 A;  2D42 A;  1G96 A;  1UUG B;  1RGE A;  3IPT A;  3D3L A;  3IJE B;  4X2O A;  5HGR A;  5RNT A;  1Q82 4;  1YIJ 3;  4N3V A;  3CPO A;  2B1X B;  3ZFZ A;  1F8N A;  3DGO A;  3OXA A;  5M1A A;  1DYU A;  1OHP A;  4HKV B;  3B8L A;  4XBT A;  4XM4 A;  1FUW A;  2UGI A;  2GU3 A;  2YFI B;  1MNL A;  1BRN L;  4AEQ A;  1W5Z A;  1STD A;  1HZ1 A;  3D79 A;  1J2B A;  1S5A A;  4XDV A;  2WO0 A;  3KN4 A;  6GSP A;  1NNV A;  3Q3F A;  2KF5 A;  1M1X B;  1B2M A;  3EE1 A;  2KF6 A;  3S29 A;  2C4B A;  4NHF A;  1GY5 A;  5CXO A;  5IG0 A;  3B7C A;  3WHO A;  3BIR A;  2MF7 A;  1BRJ A;  2E2U A;  2BNG A;  1BNJ A;  1BRS A;  1ROV A;  3HZP A;  4MMY B;  4N6M A;  1JN5 A;  3WA2 X;  2RGQ A;  5TGN A;  1IV7 A;  3MSO A;  2OTL 3;  2QGU A;  3GZY B;  3UB1 A;  1JKG A;  1TTO A;  3LTA A;  1HKX A;  4XB5 A;  2CX0 A;  1W6Y A;  1EQK A;  4JF8 A;  4BU4 A;  4FCJ A;  4LGQ A;  1AY7 A;  1C54 A;  1JZO A;  4DKI A;  2W9Q A;  1RCK A;  2SBL A;  1B20 A;  2XGN A;  2CHC A;  3AGN A;  4G1M B;  1C7H A;  2L4V A;  2M7O A;  1IQY A;  2GU1 A;  3FF2 A;  1E3V A;  2RCD A;  1GYB A;  2F99 A;  1B2Z A;  4XBX A;  1Q81 4;  1IT7 A;  1RGK A;  3G6E 3;  3A5E A;  5ELU A;  1FGR A;  2GEX A;  3DGL A;  1EEJ A;  2HMO B;  3RDE A;  3LML A;  4O2H A;  4KVH A;  4WYK B;  2QA4 3;  1SIH A;  1CYV A;  4EYC A;  3WDG B;  5IEN A;  3CCQ 3;  4CCV A;  2HMK B;  3EB8 A;  1NB5 I;  3EF8 A;  1T2H A;  1FW7 A;  1MGW A;  3AMO A;  1AV4 A;  2Y73 A;  4KFE A;  4RBN A;  3T0U A;  5JPU A;  2V1L A;  3F40 A;  3DGY A;  3CNM A;  1A2K A;  3KSE D;  5GSP A;  4EW5 A;  3F9S A;  2P05 A;  2P0X A;  2W9P A;  1UDI I;  4U13 A;  3NM7 A;  4HM6 B;  4N6U A;  2K3D A;  4WYK A;  1GMR A;  3MWZ A;  3KCH A;  2H0H A;  1W00 A;  2F86 B;  2WOH A;  4J5G A;  3NXJ A;  3ALA A;  5AYR B;  1FUT A;  2W6J H;  2F56 A;  2ML6 A;  2CFK A;  4WFO A;  1JNQ A;  1UCL A;  1Q7Y 4;  2WGO A;  3DGM A;  3CNX A;  3EBY A;  2XR8 B;  1RGH A;  5FGO A;  5LC6 A;  3D9R A;  5AIG A;  1TIJ A;  1O7W B;  3CMA 3;  1MWT A;  4HM0 B;  3NQZ A;  1KWI A;  3KKG A;  4JRF A;  1ULI B;  1Q9E A;  2KAA A;  1KC8 4;  1JKG B;  5IW9 A;  4K90 B;  2OOV A;  3SED A;  4KT3 B;  4HYZ A;  1UCK A;  1UI8 A;  3MG2 A;  3LZA A;  1PU4 A;  1VQN 3;  1EKM A;  3F8X A;  3LTD A;  2F5M A;  3EN1 B;  3KE7 A;  1SII A;  3OWS A;  4HM7 B;  1BNG A;  3K63 A;  1A2V A;  3VF1 A;  3VSY A;  5KP4 A;  1D6U A;  3MHE A;  4XDW A;  1YVS A;  1NWW A;  2H0I A;  2HOH A;  3QRD A;  1VQQ A;  2FNQ A;  1K8A 4;  4FMC A;  1I2E A;  1VQ5 3;  1MOL A;  1SPU A;  2FXT A;  3KII A;  3LT9 A;  2P38 A;  1N8Q A;  4WP5 A;  1AR0 A;  1UUW B;  4L8P A;  4GSP A;  5KP3 A;  1JN5 B;  1WMN A;  2IMJ A;  3DZL A;  2OQE A;  1B2U A;  3CPW 2;  3BLZ A;  3ROB A;  4BIR A;  1DMQ A;  3KZT A;  5A0O B;  3GZR A;  1QAF A;  1U5O A;  2GSP A;  2HMJ B;  2IUK A;  4FR9 A;  1CYU A;  1TUH A;  1JBT A;  3NUV A;  4NRE A;  4K1V A;  1MGR A;  2WOF A;  3K0Z A;  3LTB A;  3CXC 2;  3LXU X;  1D6Y A;  2BHM A;  2ZHX B;  1EG9 B;  1SJW A;  2OOV C;  3ECF A;  3SOA A;  4CDL A;  1GY6 A;  1W02 A;  2RBI A;  3MYT A;  3DGN A;  3D5I A;  1GOU A;  2XGL A;  4L8O A;  4RNZ A;  1YJN 3;  3D4A A;  3BU4 A;  3I55 3;  1NJI 4;  1S72 3;  2BU4 A;  4WHA A;  3JVC A;  4GHO A;  2C11 A;  4H61 A;  5IEP A;  4EV2 A;  1BUJ A;  2BIR A;  1AQZ A;  3URP A;  2FGT A;  4N6T A;  2HML B;  2CG1 A;  3FF0 A;  3ZG0 A;  3U1W A;  1JB4 A;  1FGT A;  1MWS A;  1Q7H A;  2CWU A;  4GL6 A;  3V92 A;  1D6Z A;  2QEX 3;  3GWR A;  2CWT A;  4O3V A;  3F14 A;  2W56 A;  2RNT A;  3E99 A;  4H3U A;  4EV5 A;  2BMO B;  3MG3 A;  3B4P A;  1RDS A;  1LNH A;  1VQ6 3;  2B24 B;  2C10 A;  7GSP A;  2IA7 A;  1RGF A;  1ZGX A;  2XH9 A;  1BAN A;  3K5T A;  3NQY A;  1BOX A;  4FCM A;  1RTU A;  7STD A;  1A67 A;  3PCS A;  4HBR A;  1RN7 A;  2HMN B;  1VQ9 3;  3JUN A;  1QAL A;  2ZL8 A;  3FG4 A;  1BSA A;  1RSN A;  3PGB A;  1BU4 A;  1Y4K A;  2ZDJ A;  2XEP A;  4N6O B;  3WOF B;  2A15 A;  1LOW A;  4MEI A;  1DE3 A;  1MWR A;  1KSI A;  1M9G A;  2I9W A;  1RNB A;  1VQ8 3;  2BO9 B;  1CEW I;  2GBW B;  1G02 A;  1ZO2 A;  1RN1 A;  5AYS C;  3PZW A;  4N6V 0;  3N54 B;  4TX4 A;  4ILF A;  4BL3 A;  4HZB B;  1TP6 A;  3EX9 A;  4KZ1 A;  3F7X A;  3BND A;  1VQ4 3;  4HM1 B;  3DXO A;  1T3B A;  1A90 A;  1IV9 A;  1W01 A;  5D82 A;  3SXX A;  6RNT A;  3CD6 3;  3CCE 3;  4R80 A;  4X2H A;  1EA2 A;  1FGQ A;  1WNH A;  4RNT A;  4EC6 A;  1VQP 3;  3NM2 A;  3H51 A;  1JBS A;  3QK9 A;  2OQE C;  3CCR 3;  1HU9 A;  3CC2 3;  2K0M A;  4HM2 B;  2OWP A;  4HOH A;  1WTH A;  1AVK A;  1O7P B;  1GD4 A;  3CCS 3;  3JUP A;  1K41 A;  2O3O A;  1X1Y A;  3DH2 A;  2GEY A;  3HOH A;  1RGA A;  1RLS A;  2CWV A;  3SOY A;  1O7H B;  1BRK A;  3EJV A;  3PS8 A;  5BIR A;  1BSE A;  1BRH A;  3G16 A;  3WMD A;  2CG0 A;  2Y74 A;  1RMS A;  4OUQ A;  1BNE A;  1RJO A;  3FGY A;  3M8C A;  2Z76 A;  1KQS 2;  2F5W A;  3NV0 A;  3OV4 A;  1Q40 B;  4FMB A;  4R9L A;  3WOE B;  2W56 B;  1UCJ A;  1IU7 A;  2AAD A;  2ML5 A;  1K28 A;  3UNL A;  3FSD A;  5HOH A;  3STD A;  1UUV B;  5BXQ A;  3CC7 3;  1YJW 3;  3N8B A;  2RFR A;  2KF3 A;  1SAR A;  2CFD A;  3LOY A;  3OWY A;  1Q40 A;  3AMO B;  3J7Y d;  1BNR A;  1L5G B;  1IQX A;  2Q07 A;  2CX1 A;  2JQ5 A;  3S67 A;  4AKY A;  5AEU B;  1LOV A;  3MKI A;  1TRQ A;  2JDI H;  1O7N B;  4LEH A;  2ZA4 A;  3V99 A;  1GOV A;  2XSH B;  1FUS A;  3BNB A;  4EBG A;  3WR2 A;  1JJ2 2;  2IYJ A;  3FLJ A;  3K9M C;  4KFD A;  4MMZ B;  4N6N B;  1OUN A;  3VGN A;  1FGM A;  1BVI A;  3LYG A;  1LNI A;  1BNF A;  1STF I;  2R4I A;  2CC3 A;  1TFO A;  4I4K A;  2XFS A;  5AEW B;  8CHO A;  1BSC A;  1T5Y A;  1ASK A;  1IVX A;  3CME 3;  1DVC A;  3FG1 A;  1NO3 A;  2CKF B;  5CK6 A;  1B2S A;  2Z6B A;  5FW5 A;  3BNE A;  1IT8 A;  4RZM A;  3MG1 A;  3CU3 A;  5DRV A;  1UCI A;  3SX1 A;  2W03 A;  3V98 A;  4ZM8 A;  5M19 A;  3SYU A;  2CIU A;  3CCM 3;  3EQQ B;  1N5P A;  1YIT 3;  1GMQ A;  3EHC A;  2OTJ 3;  3CC4 3;  1YNV X;  1JBR A;  1I3I A;  3NV0 B;  5STD A;  2WGQ A;  3FKA A;  3L0R A;  4J9A A;  2HMM B;  2BT3 A;  5G1K A;  5JPP A;  1AVL A;  3CCV 3;  1BNI A;  1BAO A;  2MC8 A;  4J8T A;  4OK0 A;  3KFQ C;  3IMA B;  2IUJ A;  1LQG C;  1E3R A;  3SVA A;  3JUO A;  4AKZ A;  1TRP A;  1GY7 A;  3A76 A;  1O7M B;  2P09 A;  4HZ9 B;  1VQM 3;  2IY2 A;  1RGL A;  1I70 A;  3PXM A;  1YGE A;  4HJL B;  1RCL A;  1QAK A;  5D81 A;  3X40 A;  4K1U A;  3TDG A;  3G4S 3;  1T2I A;  3G71 3;  2CFW A;  1CH0 A;  4MJD A;  1RKY A;  1YI2 3;  1RGC A;  3G8Z A;  3Q90 A;  1BRI A;  1QMA A;  3N9H A;  1V57 A;  1B3S A;  1QVG 2;  1ROA A;  4HVN A;  1TFK A;  1DET A;  5G2G A;  3I56 3;  2XF3 A;  1N9J A;  3Q2P A;  1OCV A;  1VQL 3;  1GOY A;  1LVN A;  2GBX B;  5IEO A;  1ZS7 A;  1Z1S A;  2H0G A;  2PNC A;  1PFP A;  3GSP A;  5IER A;  2L1S A;  4CJN A;  1BSB A;  3CCJ 3;  1RRL A;  2INX A;  1W4N A;  5EEO A;  4J5K A;  5G1L A;  3T8N A;  4L7K A;  4LYL B;  5EQL A;  1TU5 A;  1M90 4;  4R4K A;  1VZZ A;  3GAX A;  4LZI A;  2BMR B;  4O02 B;  1U8C B;  1I2F A;  2W04 A;  1FZU A;  1LXE A;  2W2C A;  2F98 A;  1LOX A;  1OF5 B;  1B21 A;  1LRA A;  2PZV A;  5ELJ A;  3LT8 A;  2KXG A;  3HII A;  1I3F A;  4MMX B;  5CLK A;  4KFF A;  6STD A;  3RNT A;  5I97 A;  1Q86 4;  1I0X A;  4HM4 B;  1OGZ A;  4RNY A;  1DMN A;  2RSX A;  3RGR A;  5BVB A;  1OH0 A;  1OHO A;  3ZG5 A;  4K61 A;  4O8S A;  1VQ7 3;  2CK3 H;  4PEJ A;  3GZX B;  3NBB A;  1CQS A;  1OGX A;  1JZD A;  3BNC A;  1WMP A;  2QIY A;  1A2P A;  4HM8 B;  3EN8 A;  5AIH A;  1FGO A;  1N9E A;  1OF5 A;  4HM3 B;  4EXR A;  1OAC A;  1LQM B;  2CW9 A;  3RGA A;  3F8H A;  1GS3 A;  1G0T A;  4XBY A;  2W0Q A;  2LQV A;  1PYL A;  3U97 A;  2F4Y A;  4FMA A;  2CH9 A;  3NHX A;  4HM5 B;  1RN4 A;  3FG3 A;  3S5C A;  7RNT A;  2Z77 A;  1UGI A;  1W2B 2;  3WOD G;  4I5Q A;  1FA3 A;  3AGO A;  1X1U A;  1X1X A;  1V58 A;  1Q42 A;  2KCD A;  2E2T A;  3EC9 A;  4R9K A;  2CFL A;  1YGW A;  3X3Z A;  3HIG A;  1GD3 A;  3UJM A;  1BGS A;  1IVV A;  1V74 A;  1TJD A;  1FYS A;  1IVW A;  5LC7 A;  3FH1 A;  1QVF 2;  4STD A;  2UUG C;  3NBR A;  3X3X A;  4IIA A;  2D1W A;  1SQW A;  1IDP A;  3BB9 A;  2UX0 A;  4CPK A;  5DRE A;  1I8V A;  2E2V A;  1RGG A;  5IF6 A;  1EUI C;  4HAA A;  1BNS A;  4FCZ A;  4N6L A;  9RNT A;  1JB2 A;  5M18 A;  1X1W A;  3X41 A;  2KRT A;  2OCT A;  3HX8 A;  1KD1 4;  1R4Y A;  2KF4 A;  2YX9 A;  1B27 A;  1R4C A;  3DM8 A;  5IG3 A;  4BL2 A;  3KSP A;  4IPB A;  1RRH A;  1W2Z A;  1MWU A;  1WQL B;  5KP1 A;  3FCS B;  1HYF A;  1LOY A;  3DUK A;  4OVM A;  4WWU C;  3G0K A;  1NU3 A;  4BTX A;  2STD A;  3SLU A;  3LTC A;  3PCR A;  1YVB I;  5AII A;  1IK3 A;  1K9M 4;  2YFL B;  3H3H A;  4R1K A;  1BUQ A;  1PY3 A;  2BMQ B;  2Z7A A;  1YJ9 3;  1ULJ B;  8RNT A;  1BIR A;  1OHS A;  1OPY A;  1GSP A;  5EVH A;  5IG5 A;  1K73 4;  3PYJ A;  1W6C A;  3OX9 A;  5BU4 A;  3Q1C A;  3FZW A;  1QJG A;  1US1 A;  1BSD A;  3HI7 A;  3I0Y A;  3MPH A;  3S27 A;  3UL6 A;  1GMP A;  1B2X A;  3T8U A;  1VQK 3;  2P0M A;  2SAR A;  3OW2 2;  1IYY A;  3EBT A;  4LMI A;  4ORL A;  2XFT A;  3B4O A;  1JB5 A;  2GXF A;  4BTY A;  1VQO 3;  3DMC A;  4FMD A;  1DMM A;  3NBJ A;  2K54 A;  2O9U X;  3AHS A;  3S28 A;  2J8X B;  1UW1 A;  1I0V A;  2YFJ B;  1O7G B;  4QWT A;  2CFG A;  3O8Y A;  1BRG A;  1IVU A;  3ER7 A;  3AHW A;  2LYX A;  4BTW A;  2XSO B;  1IQ8 A;  5AI1 A;  1N8R 4;  1W6G A;  5CF2 A;  2AAE A;  5AIF A;  3D5G A;  5JBS A;  3JUQ A;  3CCL 3;  1NB3 I;  1WMO A;  3UL5 A;  4LSO A;  1ISK A;  4GB5 A;  3OWU A;  2XRX B;  4Q53 A;  1UGH I;  1ZX2 A;  2R41 A;  1RHL A;  3JUM A;  1JRQ A;  1NDO B;  4IT7 A; 
#chains in the Genus database with same CATH homology
 1E97 A;  1N5H A;  5IG4 A;  1DVD A;  3HK4 A;  1M1K 4;  1JV2 B;  3F7S A;  5CF1 A;  3GRD A;  3X3Y A;  3CCU 3;  3DY5 A;  1YHQ 3;  3GZB A;  3LH4 A;  3NX0 A;  1W7C A;  3K7C A;  5D83 A;  3X42 A;  3WA3 A;  1UI7 A;  2D42 A;  1G96 A;  3IPT A;  3D3L A;  3IJE B;  4X2O A;  5HGR A;  1Q82 4;  1YIJ 3;  4N3V A;  3CPO A;  2B1X B;  1F8N A;  3DGO A;  3OXA A;  1DYU A;  1OHP A;  4HKV B;  3B8L A;  4XBT A;  4XM4 A;  1FUW A;  2GU3 A;  2YFI B;  1MNL A;  4AEQ A;  1W5Z A;  1STD A;  1J2B A;  1S5A A;  4XDV A;  2WO0 A;  3KN4 A;  1M1X B;  3EE1 A;  3S29 A;  4NHF A;  5CXO A;  1GY5 A;  5IG0 A;  3B7C A;  2MF7 A;  2E2U A;  2BNG A;  1ROV A;  4MMY B;  3HZP A;  4N6M A;  1JN5 A;  3WA2 X;  2RGQ A;  5TGN A;  1IV7 A;  3MSO A;  2OTL 3;  2QGU A;  3GZY B;  3UB1 A;  1JKG A;  3LTA A;  4XB5 A;  1HKX A;  1W6Y A;  1EQK A;  4JF8 A;  4FCJ A;  4LGQ A;  2W9Q A;  2SBL A;  2XGN A;  2CHC A;  4G1M B;  1C7H A;  2L4V A;  2M7O A;  1IQY A;  2GU1 A;  3FF2 A;  1E3V A;  2RCD A;  1GYB A;  2F99 A;  4XBX A;  1Q81 4;  1IT7 A;  3G6E 3;  5ELU A;  1FGR A;  2GEX A;  3DGL A;  2HMO B;  3RDE A;  3LML A;  4O2H A;  4KVH A;  4WYK B;  2QA4 3;  1SIH A;  1CYV A;  4EYC A;  3WDG B;  5IEN A;  3CCQ 3;  4CCV A;  2HMK B;  3EB8 A;  1NB5 I;  3EF8 A;  3AMO A;  1AV4 A;  2Y73 A;  4KFE A;  4RBN A;  3T0U A;  5JPU A;  2V1L A;  3F40 A;  3KSE D;  3CNM A;  1A2K A;  3F9S A;  2P0X A;  2W9P A;  4U13 A;  3NM7 A;  4HM6 B;  4N6U A;  4WYK A;  3MWZ A;  1W00 A;  2F86 B;  2WOH A;  3NXJ A;  3ALA A;  5AYR B;  2W6J H;  2ML6 A;  2CFK A;  4WFO A;  1JNQ A;  1Q7Y 4;  2WGO A;  3DGM A;  3CNX A;  3EBY A;  2XR8 B;  5FGO A;  5LC6 A;  3D9R A;  5AIG A;  1TIJ A;  1O7W B;  3CMA 3;  4HM0 B;  3NQZ A;  1KWI A;  3KKG A;  4JRF A;  1ULI B;  1KC8 4;  1JKG B;  5IW9 A;  4K90 B;  2OOV A;  3SED A;  4HYZ A;  1UI8 A;  3MG2 A;  3LZA A;  1PU4 A;  1VQN 3;  1EKM A;  3F8X A;  3LTD A;  3EN1 B;  3KE7 A;  1SII A;  3OWS A;  4HM7 B;  3K63 A;  1A2V A;  3VF1 A;  3VSY A;  5KP4 A;  1D6U A;  3MHE A;  4XDW A;  1NWW A;  3QRD A;  2FNQ A;  1K8A 4;  4FMC A;  1VQ5 3;  1MOL A;  1SPU A;  2FXT A;  3KII A;  3LT9 A;  2P38 A;  1N8Q A;  4WP5 A;  1AR0 A;  1UUW B;  4L8P A;  5KP3 A;  1JN5 B;  1WMN A;  2IMJ A;  3DZL A;  2OQE A;  3CPW 2;  3BLZ A;  3ROB A;  5A0O B;  1DMQ A;  3KZT A;  3GZR A;  1QAF A;  1U5O A;  2HMJ B;  1CYU A;  2IUK A;  4FR9 A;  1TUH A;  3NUV A;  4NRE A;  4K1V A;  3K0Z A;  2WOF A;  3CXC 2;  3LTB A;  3LXU X;  1D6Y A;  2BHM A;  4CDL A;  3ECF A;  1EG9 B;  1SJW A;  2OOV C;  3SOA A;  3CC4 3;  1GY6 A;  1W02 A;  3MYT A;  3DGN A;  2XGL A;  4L8O A;  4RNZ A;  1YJN 3;  3I55 3;  1NJI 4;  1S72 3;  4WHA A;  3JVC A;  2C11 A;  4H61 A;  5IEP A;  4EV2 A;  2FGT A;  4N6T A;  2HML B;  2CG1 A;  3FF0 A;  3U1W A;  1JB4 A;  1FGT A;  4GL6 A;  2CWU A;  3V92 A;  2QEX 3;  1D6Z A;  3GWR A;  2CWT A;  4O3V A;  3F14 A;  2W56 A;  3E99 A;  4H3U A;  4EV5 A;  2BMO B;  3MG3 A;  3B4P A;  1LNH A;  1VQ6 3;  2B24 B;  2C10 A;  2IA7 A;  3NQY A;  2XH9 A;  3K5T A;  4FCM A;  7STD A;  1A67 A;  3PCS A;  4HBR A;  1RN7 A;  2HMN B;  1VQ9 3;  3JUN A;  1QAL A;  2ZL8 A;  3FG4 A;  3PGB A;  1Y4K A;  2ZDJ A;  2XEP A;  4N6O B;  3WOF B;  2A15 A;  4MEI A;  1KSI A;  1M9G A;  2I9W A;  1VQ8 3;  2BO9 B;  1CEW I;  2GBW B;  5AYS C;  1ZO2 A;  3PZW A;  4N6V 0;  3N54 B;  4TX4 A;  4HZB B;  1TP6 A;  3EX9 A;  4KZ1 A;  3F7X A;  3BND A;  1VQ4 3;  4HM1 B;  3DXO A;  1A90 A;  1IV9 A;  1W01 A;  5D82 A;  3SXX A;  3CD6 3;  3CCE 3;  4R80 A;  4X2H A;  1EA2 A;  1FGQ A;  1WNH A;  4EC6 A;  1VQP 3;  3NM2 A;  3H51 A;  3QK9 A;  2OQE C;  3CCR 3;  1NDO B;  1HU9 A;  3CC2 3;  2K0M A;  4HM2 B;  2OWP A;  1WTH A;  1AVK A;  1O7P B;  1GD4 A;  3CCS 3;  3JUP A;  1K41 A;  2O3O A;  2GEY A;  3SOY A;  2CWV A;  1O7H B;  3EJV A;  3PS8 A;  3G16 A;  3WMD A;  2CG0 A;  2Y74 A;  4OUQ A;  1RJO A;  3FGY A;  3M8C A;  2Z76 A;  1KQS 2;  3NV0 A;  3OV4 A;  1Q40 B;  4FMB A;  4R9L A;  3WOE B;  2W56 B;  1IU7 A;  2ML5 A;  1K28 A;  3UNL A;  3FSD A;  3CC7 3;  3STD A;  1UUV B;  5BXQ A;  1YJW 3;  3N8B A;  2RFR A;  2CFD A;  3LOY A;  3OWY A;  1Q40 A;  3AMO B;  3J7Y d;  1L5G B;  1IQX A;  2Q07 A;  2JQ5 A;  3S67 A;  4AKY A;  5AEU B;  3MKI A;  2JDI H;  1O7N B;  4LEH A;  3V99 A;  2XSH B;  4EBG A;  3BNB A;  1JJ2 2;  3FLJ A;  4MMZ B;  3K9M C;  4KFD A;  4N6N B;  1OUN A;  3VGN A;  1FGM A;  3LYG A;  1STF I;  2R4I A;  2CC3 A;  1TFO A;  4I4K A;  2XFS A;  5AEW B;  8CHO A;  1T5Y A;  1ASK A;  1IVX A;  3CME 3;  1DVC A;  3FG1 A;  1NO3 A;  2CKF B;  5CK6 A;  2Z6B A;  5FW5 A;  3BNE A;  1IT8 A;  4RZM A;  3MG1 A;  3CU3 A;  5DRV A;  3SX1 A;  2W03 A;  3V98 A;  4ZM8 A;  2CIU A;  3CCM 3;  3EQQ B;  1N5P A;  1YIT 3;  3EHC A;  2OTJ 3;  3NV0 B;  5STD A;  2WGQ A;  3FKA A;  3L0R A;  4J9A A;  2HMM B;  2BT3 A;  5JPP A;  1AVL A;  3CCV 3;  2MC8 A;  4J8T A;  4OK0 A;  3KFQ C;  3IMA B;  2IUJ A;  3SVA A;  1E3R A;  3JUO A;  4AKZ A;  3A76 A;  1GY7 A;  1VQM 3;  1O7M B;  2P09 A;  4HZ9 B;  3PXM A;  4HJL B;  1YGE A;  5D81 A;  1QAK A;  3X40 A;  4K1U A;  3TDG A;  3G4S 3;  3G71 3;  2CFW A;  1RKY A;  4MJD A;  1YI2 3;  3G8Z A;  3Q90 A;  1QMA A;  3N9H A;  1QVG 2;  1ROA A;  4HVN A;  1TFK A;  5G2G A;  3I56 3;  2XF3 A;  1N9J A;  3Q2P A;  1OCV A;  1VQL 3;  1LVN A;  5IEO A;  2GBX B;  1Z1S A;  2PNC A;  1PFP A;  5IER A;  3CCJ 3;  1RRL A;  2INX A;  1W4N A;  5EEO A;  3T8N A;  4L7K A;  5EQL A;  1TU5 A;  1M90 4;  4R4K A;  1VZZ A;  3GAX A;  4LZI A;  2BMR B;  4O02 B;  1U8C B;  2W04 A;  1LXE A;  2W2C A;  2F98 A;  1LOX A;  1OF5 B;  2PZV A;  5ELJ A;  3LT8 A;  2KXG A;  3HII A;  5CLK A;  4MMX B;  4KFF A;  6STD A;  5I97 A;  1Q86 4;  4HM4 B;  1OGZ A;  4RNY A;  1DMN A;  2RSX A;  3RGR A;  5BVB A;  1OH0 A;  1OHO A;  4K61 A;  4O8S A;  1VQ7 3;  2CK3 H;  4PEJ A;  3GZX B;  3NBB A;  1CQS A;  1OGX A;  3BNC A;  1WMP A;  2QIY A;  4HM8 B;  3EN8 A;  5AIH A;  1FGO A;  1N9E A;  1OF5 A;  4HM3 B;  4EXR A;  1OAC A;  2CW9 A;  3RGA A;  3F8H A;  1GS3 A;  4XBY A;  2W0Q A;  2LQV A;  3U97 A;  4FMA A;  2CH9 A;  3NHX A;  4HM5 B;  3FG3 A;  3S5C A;  2Z77 A;  1W2B 2;  3WOD G;  1FA3 A;  2KCD A;  1Q42 A;  3EC9 A;  2E2T A;  4R9K A;  2CFL A;  3X3Z A;  3HIG A;  1GD3 A;  3UJM A;  1V74 A;  1IVV A;  1IVW A;  5LC7 A;  3FH1 A;  1QVF 2;  4STD A;  3NBR A;  3X3X A;  4IIA A;  2D1W A;  1SQW A;  1IDP A;  3BB9 A;  2UX0 A;  5DRE A;  2E2V A;  5IF6 A;  4N6L A;  4FCZ A;  1JB2 A;  3X41 A;  2KRT A;  2OCT A;  3HX8 A;  1KD1 4;  2YX9 A;  3DM8 A;  1R4C A;  5IG3 A;  3KSP A;  4IPB A;  1RRH A;  1W2Z A;  1WQL B;  5KP1 A;  3FCS B;  3DUK A;  4OVM A;  4WWU C;  3G0K A;  1NU3 A;  4BTX A;  2STD A;  3SLU A;  3LTC A;  3PCR A;  1YVB I;  5AII A;  1IK3 A;  1K9M 4;  2YFL B;  3H3H A;  4R1K A;  1BUQ A;  2BMQ B;  2Z7A A;  1YJ9 3;  1ULJ B;  5IG5 A;  1OHS A;  1OPY A;  5EVH A;  1K73 4;  3PYJ A;  1W6C A;  3OX9 A;  3Q1C A;  3FZW A;  1QJG A;  1US1 A;  3HI7 A;  3I0Y A;  3MPH A;  3S27 A;  3UL6 A;  3T8U A;  1VQK 3;  2P0M A;  3OW2 2;  3EBT A;  4LMI A;  4ORL A;  2XFT A;  3B4O A;  1JB5 A;  2GXF A;  4BTY A;  1VQO 3;  3DMC A;  4FMD A;  1DMM A;  3NBJ A;  2K54 A;  2O9U X;  3S28 A;  1UW1 A;  2YFJ B;  1O7G B;  4QWT A;  2CFG A;  3O8Y A;  1IVU A;  3ER7 A;  4BTW A;  2LYX A;  2XSO B;  1IQ8 A;  5AI1 A;  1N8R 4;  1W6G A;  5CF2 A;  5AIF A;  5JBS A;  3JUQ A;  3CCL 3;  1NB3 I;  1WMO A;  3UL5 A;  4LSO A;  1ISK A;  4GB5 A;  3OWU A;  2XRX B;  4Q53 A;  1ZX2 A;  3JUM A;  1JRQ A;  2P05 A;  4IT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...