5IG5A

Crystal structure of n. vectensis camkii-b hub at ph 4.2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
137
Chain Sequence
HTIIEEDTESTKTQREQEIIRLTQQLITSITAKDFDSYSKLVDPKITAFEPEALGNQVEGLEFHKFYFDNLPTTVNTTILAPHVQMLGEEGACISYVRLTQGIGPDGLPRTTQSEETRVWQKKKGVWLNVHFHRSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CaMKII-B hub
publication title Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II.
pubmed doi rcsb
source organism Nematostella vectensis
total genus 39
structure length 137
sequence length 141
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ig5A00
1W00A 3JUMA 4HM4B 5AIIA 2XSOB 5CF2A 3SOYA 3F8XA 3EN1B 3BLZA 3JUOA 1BUQA 3GZXB 2BMQB 3B4PA 2R4IA 2I9WA 1JN5B 5AI1A 2YFJB 1Q40B 2GBXB 5CXOA 3EC9A 3NM2A 3F9SA 1ZO2A 1OF5B 2W2CA 2QIYA 4L8OA 2YFLB 1Q42A 4LMIA 2OWPA 1STDA 4CDLA 3F7SA 2YFIB 3ER7A 3NXJA 3WMDA 5DREA 3T8NA 2HMLB 4HM8B 1O7PB 3KKGA 2F86B 2IMJA 4R9KA 2HMJB 5D82A 1NWWA 1JB4A 4Q53A 4HM3B 5KP1A 2K54A 3E99A 5IG3A 1O7MB 1QJGA 4HM7B 4XBTA 1ULIB 5AEWB 2HMOB 1GY7A 2B1XB 3RGAA 2XR8B 4HVNA 4ORLA 5CK6A 1SJWA 2GBWB 1S5AA 3F14A 3FF2A 2F98A 3I0YA 1GY6A 5JPUA 5AIHA 3MKIA 4R1KA 1WQLB 3GZBA 5G2GA 3IPTA 3OWUA 1ISKA 5TGNA 1O7HB 1JN5A 4KVHA 3NV0B 2UX0A 5D81A 5IEPA 1U5OA 1Q40A 3OWSA 4X2HA 1JB5A 3B4OA 2BNGA 1OF5A 2A15A 3DMCA 5AIGA 2HMKB 3ECFA 4WYKB 4FCJA 5IENA 4J9AA 2GEYA 1OGXA 3NBRA 4X2OA 4XB5A 3SEDA 1OHOA 1GY5A 1W01A 3KZTA 4L8PA 2RGQA 1GS3A 3A76A 4R9LA 3F40A 5BVBA 4XDVA 5HGRA 1K41A 4XBXA 3NUVA 4IIAA 2PZVA 3OX9A 2GXFA 1O7NB 2JQ5A 5JPPA 1OPYA 3EF8A 4HZ9B 2STDA 2F99A 1OHSA 2B24B 5IG4A 4STDA 3G8ZA 4HM0B 3CNMA 3VSYA 4LEHA 1VZZA 1DMMA 1QMAA 3K7CA 4K1VA 2CKFB 1A2KA 3UNLA 1DMNA 2Z76A 3EX9A 3MHEA 3VGNA 3FZWA 2Z77A 1OGZA 3JUPA 7STDA 5CF1A 1C7HA 4OVMA 1AR0A 2XRXB 1TUHA 1Z1SA 3OWYA 3Q90A 4XDWA 3NV0A 3JUQA 1GYBA 3G16A 5FW5A 3HK4A 3OXAA 6STDA 4HZBB 1HKXA 4WYKA 5KP4A 3CU3A 1O7WB 4PEJA 3MSOA 3FF0A 3MG2A 3K0ZA 1E97A 3FH1A 2RFRA 4HM6B 3EQQB 4HM5B 3CNXA 1ASKA 3LZAA 2GEXA 5STDA 4WP5A 2INXA 1W02A 5IG0A 3GZRA 3EJVA 2HMNB 3MG1A 3FLJA 3DM8A 3F7XA 4HM2B 5DRVA 3GZYB 1OHPA 3FKAA 5EVHA 5CLKA 3HX8A 4N3VA 5IEOA 4LGQA 3BB9A 1OCVA 5D83A 5KP3A 5BXQA 3S5CA 3EN8A 3GRDA 3CPOA 4HJLB 3SOAA 3LYGA 1JKGB 3B7CA 4XM4A 3DZLA 1OH0A 4H3UA 3EHCA 1NDOB 1NU3A 3B8LA 1E3VA 1UUWB 4WWUC 4U13A 1EG9B 3FGYA 3G0KA 1IDPA 3H51A 1TP6A 1CQSA 1ULJB 2RCDA 2BMOB 3DUKA 4RZMA 3JUNA 1UUVB 5IERA 5AEUB 4K1UA 4L7KA 4J8TA 3EBTA 2HMMB 3M8CA 3MG3A 2XSHB 3ROBA 4XBYA 4FCMA 1OUNA 3D9RA 4I4KA 3MYTA 4MJDA 1ZX2A 3NHXA 8CHOA 3UJMA 2BMRB 1W6YA 3FSDA 2QGUA 3RGRA 2CHCA 3GWRA 1EA2A 4HKVB 3OV4A 3HZPA 3T8UA 1JB2A 1O7GB 3EBYA 4OUQA 5IG5A 1DMQA 3KSPA 3F8HA 3KE7A 5IF6A 4HM1B 1E3RA 1JKGA 3DXOA 3H3HA 2Z7AA 3STDA 5AIFA 4GB5A
chains in the Genus database with same CATH superfamily
1U8CB 1W00A 3HIIA 3JUMA 1BRGA 4GL6A 4HM4B 5AIIA 3AGNA 3G713 2XSOB 3QRDA 2BIRA 5M18A 3CCE3 5CF2A 4N6V0 2P09A 2IA7A 2F5MA 4LYLB 3SOYA 3T0UA 3DY5A 3F8XA 3EN1B 4N6OB 1UCJA 3NX0A 1YGWA 3BLZA 3JUOA 4R4KA 1RGKA 4KFEA 1YNVX 1BUQA 3GZXB 2W04A 2BMQB 2CG1A 1A2VA 3UB1A 1PY3A 3B4PA 2R4IA 2I9WA 3WR2A 1JN5B 5AI1A 2YFJB 3LH4A 2CH9A 1Q40B 2GBXB 2Y73A 1NJI4 1F8NA 2F56A 3CCU3 5CXOA 2Z6BA 3EC9A 2KF3A 4AEQA 2K0MA 1Q824 1QVG2 1BRJA 3WHOA 1G02A 1K28A 3F9SA 3NM2A 6GSPA 1ZO2A 4BU4A 1FUTA 1GD4A 1OF5B 1T3BA 2E2UA 2W2CA 3D79A 3MWZA 5AYSC 2QIYA 1HZ1A 2H0GA 2YFLB 4L8OA 1Q42A 4LMIA 4HAAA 3ZFZA 1RCLA 1UCKA 2OWPA 1MWSA 1STDA 1MWRA 4CDLA 3CCV3 3F7SA 2IY2A 2YFIB 3ER7A 4BL2A 3D5IA 3NXJA 2W56A 3WMDA 5DREA 1BSBA 2IYJA 3HI7A 3T8NA 2HMLB 3D4AA 1BSAA 4KT3B 1RLSA 1W7CA 4HM8B 3IJEB 1O7PB 3A5EA 4GHOA 3KKGA 3CCJ3 2F86B 5HOHA 2IMJA 4R9KA 2HMJB 3VF1A 1SIHA 5D82A 3X3XA 1JZDA 1NWWA 1JB4A 1Q7Y4 1LNIA 1W6CA 2P05A 2L1SA 4Q53A 4HM3B 1X1XA 5KP1A 2WO0A 1JBRA 1RTUA 1BAOA 1RGGA 2K54A 3E99A 1X1YA 1SPUA 5IG3A 1EKMA 1O7MB 1CEWI 1QJGA 2IUKA 2IUJA 4HM7B 2F5WA 1VQM3 4XBTA 1TIJA 1B2MA 2CK3H 2KAAA 2BU4A 1M904 1ULIB 5AEWB 1FGTA 4NHFA 2HMOB 1C54A 1IU7A 1GY7A 3X41A 2GU1A 2B1XB 3RGAA 1YJN3 1M9GA 1YIT3 7RNTA 3BNCA 1N5HA 2XR8B 3SLUA 4HVNA 1IVUA 1RGAA 1BNSA 2SARA 4ZM8A 2BT3A 4ORLA 5CK6A 3I563 1SJWA 1A2PA 1I0XA 2GBWB 5AYRB 2KF4A 4J5KA 2CC3A 5M1AA 4BIRA 1S5AA 1DVDA 1BANA 4FMCA 4JF8A 1K8A4 3F14A 3FF2A 1IV9A 2F98A 3I0YA 5I97A 1GY6A 1RGHA 2FXTA 5JPUA 4K61A 1X1UA 1BGSA 5AIHA 3CC23 3HOHA 1BNIA 3MKIA 3DH2A 4R1KA 5GSPA 1JBSA 1VQQA 1UGIA 3D3LA 1IV7A 2CWVA 1QALA 1WQLB 3GZBA 5G2GA 1W6GA 3IPTA 4N6LA 3OWUA 3S28A 1YHQ3 2XGNA 4N6NB 3LXUX 1ISKA 3DGYA 5TGNA 4GSPA 2D1WA 1O7HB 1JN5A 1I3IA 1I70A 4KVHA 3NV0B 2UX0A 5D81A 5IEPA 4H61A 1U5OA 3LMLA 3QK9A 1FGQA 1Q40A 4EW5A 1GMQA 1S723 2BHMA 1FGRA 2ZA4A 3WODG 3BIRA 3I553 3ALAA 3FG3A 1LQMB 5JBSA 2J8XB 3OWSA 4G1MB 3J7Yd 4X2HA 3G4S3 1JB5A 3B4OA 1UGHI 2BNGA 3GSPA 3WA2X 1Q864 1DETA 1OF5A 2A15A 2ZHXB 5FGOA 5BIRA 1DE3A 3NM7A 3DMCA 3LTDA 2HMKB 3MPHA 5AIGA 3ECFA 4WYKB 1IT8A 1IQXA 4FCJA 4AKZA 3FG1A 5IENA 4J9AA 2GEYA 1OGXA 3NBRA 4X2OA 3Q2PA 4XB5A 3SEDA 2W6JH 3V99A 1OHOA 1GY5A 3Q3FA 2ML5A 2H0IA 1W01A 1BRIA 1JRQA 3KZTA 1IT7A 4L8PA 2AAEA 2CFLA 3K5TA 1L5GB 2D42A 1RN7A 4K90B 2RGQA 4FCZA 1GS3A 1RSNA 3A76A 1HYFA 1FYSA 4R9LA 1YVBI 1BNJA 3F40A 3S27A 4AKYA 5BVBA 4XDVA 2CFDA 5HGRA 4ILFA 1Y4KA 3PYJA 1GMPA 1UW1A 1K41A 1IVVA 2KCDA 2OCTA 2P38A 4XBXA 3NUVA 1VQ43 1I2EA 4IIAA 2PZVA 3OX9A 3CC73 2PNCA 1RN1A 2GXFA 2OQEA 4EYCA 3LOYA 3EE1A 1B3SA 3WOFB 1O7NB 1J2BA 3PCSA 3S67A 2JQ5A 5JPPA 3AHSA 3CC43 1VQK3 4RNTA 2GU3A 1OPYA 3EF8A 1FUSA 1RGFA 1RRLA 2QEX3 3WDGB 4HZ9B 2STDA 2F99A 4CCVA 1OHSA 1RGLA 3SX1A 1W2ZA 2B24B 5IG4A 2C10A 4STDA 3U97A 1EQKA 1FUWA 3G8ZA 3CCS3 1FA3A 1I2FA 3PXMA 4JRFA 4HM0B 3CNMA 3VSYA 4IT7A 1MWTA 4LEHA 1VZZA 1DMMA 1QMAA 3LT9A 1BUJA 3K7CA 1YVSA 3BNBA 1W2B2 1JV2B 3BNEA 2CKFB 4K1VA 3CXC2 2P0XA 1A2KA 3UNLA 1STFI 1BNFA 4EBGA 1DMNA 2Z76A 3EX9A 3MHEA 1PFPA 3CMA3 4HOHA 4EV5A 3VGNA 1LOXA 1VQ83 3IMAB 1R4CA 4I5QA 4KFDA 3FZWA 1FW7A 2Z77A 2FGTA 1VQ73 1LOVA 1OGZA 2F4YA 3JUPA 2CWUA 1I3FA 7STDA 2KF5A 5CF1A 1C7HA 2W9QA 2W03A 4EXRA 3X3YA 4OVMA 4FMBA 1AR0A 2XRXB 1TUHA 3PS8A 1Z1SA 3OWYA 3RNTA 1NNVA 3PCRA 4N6MA 3Q90A 1B2XA 3FCSB 1VQN3 1DVCA 1I2GA 3NV0A 4XDWA 4FMAA 3JUQA 3URPA 1LQGC 1GYBA 3G16A 4O3VA 1PU4A 1N8R4 1M1K4 1BRNL 4FR9A 2YX9A 5FW5A 1UCLA 2XEPA 1RKYA 3HK4A 1MGRA 3OXAA 4CPKA 2CFKA 3WA3A 6STDA 1Q814 1BRKA 1BSDA 2WOHA 1BVIA 1RGEA 4HZBB 4FMDA 1VQ63 1IQYA 1V57A 3NBJA 1FGMA 1KSIA 1HKXA 1X1WA 2ZL8A 4WYKA 5KP4A 2E2TA 3NBBA 3CU3A 1LOWA 1RDSA 1O7WB 2OOVC 1LVNA 3LTAA 3MSOA 1BSEA 4PEJA 1RHLA 1RMSA 3FF0A 3RDEA 3KFQC 2XGLA 3MG2A 4EV2A 2WGOA 2WOFA 1RGCA 1TFKA 1NB3I 2CIUA 1FGOA 3K0ZA 1E97A 3X40A 3CD63 1IQ8A 3KSED 3L0RA 3CPW2 2P0MA 3D5GA 3FH1A 1JNQA 1UCIA 2RFRA 1T5YA 4HM6B 1T2HA 2BO9B 3EQQB 1EUIC 1ROAA 1BOXA 4HM5B 3U1WA 3CNXA 3ZG0A 1Q9EA 1D6ZA 1WTHA 2ZDJA 1ASKA 1IVWA 1W4NA 3X3ZA 4RBNA 1AVKA 4J5GA 3G6E3 1UI8A 1GOYA 1ZGXA 2M7OA 3LZAA 2GEXA 5STDA 4WP5A 2INXA 1GOVA 3ZG5A 2E2VA 2CFWA 1W02A 5IG0A 6RNTA 2QA43 3GZRA 2RSXA 3EJVA 4LZIA 1IK3A 3UL5A 1MNLA 1ROVA 2HMNB 1YGEA 1Q7HA 1JJ22 3MG1A 3KN4A 1BNGA 2W9PA 3FLJA 4O8SA 4BTWA 1G96A 3BNDA 4R80A 1V58A 3DM8A 5EEOA 3F7XA 3FG4A 4HM2B 5DRVA 1RJOA 1KQS2 3GZYB 1OHPA 1LOYA 3DGNA 1B2SA 3FKAA 5EVHA 1RCKA 8RNTA 5CLKA 3HX8A 1G0TA 1BIRA 4LSOA 3UL6A 4N3VA 2Y74A 1QAKA 1N9EA 3LT8A 1PYLA 1AQZA 5IW9A 3CCR3 5IEOA 1SARA 4LGQA 4OK0A 1MOLA 2CG0A 3BB9A 1OCVA 2MF7A 2GSPA 2W0QA 5D83A 9RNTA 3K63A 5KP3A 1US1A 5G1KA 4KFFA 3V98A 1N8QA 5BXQA 5EQLA 3S5CA 2C11A 2UUGC 5LC7A 3EN8A 3SXXA 3GRDA 2KXGA 3CPOA 1CYUA 1BNEA 3AMOB 4HJLB 1T2IA 1TFOA 3SOAA 1WNHA 3LYGA 3NQYA 3N9HA 3CME3 3NQZA 2SBLA 3KCHA 3PGBA 2OOVA 2O9UX 4EC6A 3AGOA 3OW22 1JKGB 1V74A 1LRAA 3WOEB 1B2UA 3B7CA 1UUGB 4XM4A 4WFOA 2LYXA 4TX4A 1VQ93 2HOHA 1BNRA 3DZLA 1OH0A 1RNTA 4DKIA 3LTCA 4H3UA 2AADA 3DGMA 3EHCA 1A90A 2XFTA 1NDOB 3DGOA 1NU3A 5LC6A 3B8LA 1E3VA 5ELUA 1UUWB 4QWTA 4WWUC 4U13A 1EEJA 1A67A 1ZS7A 2WGQA 1EG9B 3FGYA 3G0KA 1OACA 1IDPA 2CX1A 3H51A 3KIIA 1IVXA 1TP6A 3SVAA 4WHAA 1KC84 4BTYA 2CFGA 1CQSA 1NO3A 1D6YA 3TDGA 1JZOA 1ULJB 4HBRA 1VQ53 2RCDA 2BMOB 3CCQ3 2RNTA 1K9M4 3N54B 1TJDA 1YJW3 2OTL3 3DUKA 1DYUA 5A0OB 1TRQA 4RZMA 1WMOA 4HYZA 4IPBA 1UI7A 4BTXA 3JUNA 2UGIA 1UUVB 1MWUA 2C4BA 4BL3A 5IERA 1B20A 5ELJA 5AEUB 1CH0A 4K1UA 2RBIA 4L7KA 1NB5I 3O8YA 4J8TA 1MGWA 2KRTA 3EBTA 2XH9A 3K9MC 3JVCA 2HMMB 2LQVA 3M8CA 3S29A 1BRSA 1RN4A 3MG3A 2XSHB 2L4VA 3ROBA 1R4YA 7GSPA 1TU5A 1LNHA 1I8VA 4XBYA 1AV4A 3X42A 1M1XB 1VQL3 2V1LA 2R41A 1I0VA 4NPBA 4FCMA 1HU9A 3SYUA 1OUNA 3D9RA 4I4KA 4N6UA 1BRHA 1IYYA 1LXEA 1B2ZA 1BU4A 3CCM3 3MYTA 4O2HA 1TTOA 3BU4A 4RNZA 1QVF2 3DGLA 3CCL3 3HIGA 1AVLA 1WMPA 2Q07A 2W56B 4MJDA 1YI23 1ZX2A 1GOUA 1GD3A 3NHXA 3Q1CA 8CHOA 3EB8A 3UJMA 2BMRB 2JDIH 1VQO3 1TRPA 1UDII 1B21A 4CJNA 1VQP3 1KD14 1W6YA 1JBTA 2OQEC 3FSDA 2CX0A 3N8BA 1W5ZA 4NREA 2QGUA 1K734 3RGRA 2ML6A 2CHCA 4MMYB 3GWRA 1EA2A 4HKVB 3OV4A 3HZPA 5BU4A 3T8UA 1JB2A 1GSPA 1O7GB 3EBYA 1RNBA 4OUQA 5IG5A 4KZ1A 1YJ93 1N5PA 1DMQA 2XFSA 3AMOA 1FZUA 3PZWA 3KSPA 1WMNA 2FNQA 4MMZB 3F8HA 4RNYA 5RNTA 1RRHA 2XF3A 3KE7A 1QAFA 4MMXB 4O02B 2H0HA 4N6TA 1D6UA 4HM1B 1B27A 2CWTA 5IF6A 1E3RA 1JKGA 1CYVA 3DXOA 3H3HA 2Z7AA 3STDA 3GAXA 2K3DA 2KF6A 5G1LA 1N9JA 2MC8A 2CW9A 2O3OA 5AIFA 4MEIA 2OTJ3 1YIJ3 4GB5A 3AHWA 1BSCA 1SQWA 3V92A 1SIIA 1GMRA 1KWIA 3LTBA 1AY7A 5M19A
chains in the Genus database with same CATH topology
1U8CB 1W00A 3HIIA 3JUMA 4GL6A 4HM4B 5AIIA 3G713 2XSOB 3QRDA 3CCE3 5CF2A 4N6V0 2P09A 2IA7A 3SOYA 3T0UA 3DY5A 3F8XA 3EN1B 4N6OB 3NX0A 3BLZA 3JUOA 4R4KA 4KFEA 1BUQA 3GZXB 2W04A 2BMQB 2CG1A 1A2VA 3UB1A 3B4PA 2R4IA 2I9WA 1JN5B 5AI1A 2YFJB 3LH4A 2CH9A 1Q40B 2GBXB 2Y73A 1NJI4 1F8NA 3CCU3 5CXOA 2Z6BA 3EC9A 4AEQA 2K0MA 1Q824 1QVG2 1K28A 3NM2A 3F9SA 1ZO2A 1OF5B 1GD4A 2E2UA 2W2CA 5AYSC 3MWZA 2QIYA 4L8OA 2YFLB 1Q42A 4LMIA 2OWPA 1STDA 4CDLA 3CCV3 3F7SA 2YFIB 3ER7A 3NXJA 2W56A 3WMDA 5DREA 3HI7A 3T8NA 2HMLB 1W7CA 4HM8B 3IJEB 1O7PB 3CCJ3 3KKGA 2F86B 2IMJA 4R9KA 2HMJB 3VF1A 1SIHA 5D82A 3X3XA 1NWWA 1JB4A 1Q7Y4 1W6CA 2P05A 4Q53A 4HM3B 5KP1A 2WO0A 2K54A 3E99A 1SPUA 5IG3A 1EKMA 1O7MB 1CEWI 1QJGA 2IUKA 2IUJA 4HM7B 1VQM3 4XBTA 1TIJA 2CK3H 1ULIB 5AEWB 1FGTA 4NHFA 2HMOB 1IU7A 1GY7A 3X41A 2GU1A 2B1XB 3RGAA 1YJN3 1M9GA 1YIT3 3BNCA 1N5HA 2XR8B 3SLUA 4HVNA 1IVUA 4ZM8A 2BT3A 4ORLA 5CK6A 3I563 1SJWA 2GBWB 5AYRB 2CC3A 1S5AA 1DVDA 4FMCA 4JF8A 1K8A4 3F14A 3FF2A 1IV9A 2F98A 3I0YA 5I97A 1GY6A 2FXTA 5JPUA 4K61A 5AIHA 3CC23 3MKIA 4R1KA 3D3LA 1IV7A 2CWVA 1QALA 1WQLB 3GZBA 5G2GA 1W6GA 3IPTA 4N6LA 3OWUA 3S28A 1YHQ3 2XGNA 4N6NB 3LXUX 1ISKA 5TGNA 2D1WA 1O7HB 1JN5A 4KVHA 3NV0B 2UX0A 5D81A 5IEPA 4H61A 1U5OA 3LMLA 3QK9A 1FGQA 1Q40A 1S723 2BHMA 1FGRA 3WODG 3I553 3ALAA 3FG3A 5JBSA 3G4S3 3OWSA 4G1MB 3J7Yd 4X2HA 1JB5A 3B4OA 2BNGA 1Q864 3WA2X 1OF5A 2A15A 5FGOA 3NM7A 3DMCA 3LTDA 2HMKB 3MPHA 5AIGA 3ECFA 4WYKB 1IT8A 1IQXA 4FCJA 4AKZA 3FG1A 5IENA 4J9AA 2GEYA 1OGXA 3NBRA 4X2OA 3Q2PA 4XB5A 3SEDA 2W6JH 3V99A 1OHOA 1GY5A 2ML5A 1W01A 1JRQA 3KZTA 1IT7A 4L8PA 2CFLA 3K5TA 1L5GB 2D42A 1RN7A 4K90B 2RGQA 4FCZA 1GS3A 3A76A 3S27A 4R9LA 1YVBI 3F40A 4AKYA 5BVBA 4XDVA 2CFDA 5HGRA 1Y4KA 3PYJA 1UW1A 1K41A 1IVVA 2KCDA 2OCTA 2P38A 4XBXA 3NUVA 1VQ43 4IIAA 2PZVA 3OX9A 3CC73 2PNCA 2GXFA 2OQEA 4EYCA 3LOYA 3EE1A 3WOFB 1O7NB 1J2BA 3PCSA 3S67A 2JQ5A 5JPPA 3CC43 1VQK3 2GU3A 1OPYA 3EF8A 1RRLA 2QEX3 3WDGB 4HZ9B 2STDA 2F99A 4CCVA 1OHSA 3SX1A 1M904 1W2ZA 2B24B 5IG4A 2C10A 4STDA 3U97A 1EQKA 1FUWA 3G8ZA 3CCS3 1FA3A 3PXMA 4JRFA 4HM0B 3CNMA 3VSYA 4IT7A 4LEHA 1VZZA 1DMMA 1QMAA 3LT9A 3K7CA 3BNBA 1W2B2 1JV2B 3BNEA 2CKFB 4K1VA 3CXC2 2P0XA 1A2KA 3UNLA 1STFI 4EBGA 1DMNA 2Z76A 3EX9A 3MHEA 1PFPA 3CMA3 4EV5A 3VGNA 1LOXA 1VQ83 3IMAB 1R4CA 4KFDA 3FZWA 2Z77A 2FGTA 1VQ73 1OGZA 3JUPA 2CWUA 7STDA 5CF1A 1C7HA 2W9QA 2W03A 4EXRA 3X3YA 4OVMA 4FMBA 1AR0A 2XRXB 1TUHA 3PS8A 1Z1SA 3OWYA 3PCRA 4N6MA 3Q90A 3FCSB 1VQN3 1DVCA 4XDWA 3NV0A 4FMAA 3JUQA 1GYBA 3G16A 4O3VA 1PU4A 1N8R4 1M1K4 4FR9A 2YX9A 5FW5A 2XEPA 1RKYA 3HK4A 3OXAA 2CFKA 3WA3A 6STDA 1Q814 2WOHA 4HZBB 4FMDA 1VQ63 1IQYA 3NBJA 1FGMA 1KSIA 1HKXA 2ZL8A 4WYKA 5KP4A 2E2TA 3NBBA 3CU3A 2OOVC 1O7WB 3LTAA 1LVNA 4PEJA 3MSOA 3RDEA 5A0OB 4EV2A 3FF0A 3KFQC 2XGLA 3MG2A 2WGOA 2WOFA 1TFKA 1NB3I 2CIUA 1FGOA 3K0ZA 1E97A 3X40A 3CD63 1IQ8A 3KSED 3L0RA 3CPW2 2P0MA 3FH1A 1JNQA 2RFRA 1T5YA 4HM6B 2BO9B 3EQQB 1ROAA 4HM5B 3U1WA 3CNXA 1D6ZA 1WTHA 2ZDJA 1ASKA 1IVWA 1W4NA 3X3ZA 4RBNA 1AVKA 3G6E3 1UI8A 2M7OA 3LZAA 2GEXA 5STDA 4WP5A 2INXA 2E2VA 2CFWA 1W02A 5IG0A 2QA43 3GZRA 2RSXA 3EJVA 4LZIA 1IK3A 3UL5A 1MNLA 1ROVA 2HMNB 1YGEA 1JJ22 3MG1A 3KN4A 2W9PA 3FLJA 4O8SA 4BTWA 1G96A 3BNDA 4R80A 3DM8A 5EEOA 3F7XA 3FG4A 4HM2B 5DRVA 1RJOA 1KQS2 3GZYB 1OHPA 3DGNA 3FKAA 5EVHA 5CLKA 3HX8A 4LSOA 3UL6A 4N3VA 2Y74A 1QAKA 1N9EA 3LT8A 5IW9A 3CCR3 5IEOA 4LGQA 4OK0A 1MOLA 2CG0A 3BB9A 1OCVA 2MF7A 5D83A 2W0QA 3K63A 5KP3A 1US1A 4KFFA 3V98A 1N8QA 5BXQA 5EQLA 3S5CA 2C11A 5LC7A 3EN8A 3SXXA 3GRDA 2KXGA 3CPOA 1CYUA 3AMOB 4HJLB 1TFOA 3SOAA 1WNHA 3LYGA 3NQYA 3N9HA 3CME3 3NQZA 2SBLA 3PGBA 2OOVA 2O9UX 4EC6A 3OW22 1JKGB 1V74A 3WOEB 3B7CA 4XM4A 4WFOA 2LYXA 4TX4A 1VQ93 3DZLA 1OH0A 3LTCA 4H3UA 3DGMA 3EHCA 1A90A 2XFTA 1NDOB 3DGOA 1NU3A 5LC6A 3B8LA 1E3VA 5ELUA 1UUWB 4QWTA 4WWUC 4U13A 1A67A 2WGQA 1EG9B 3FGYA 3G0KA 1OACA 1IDPA 3H51A 3KIIA 1IVXA 1TP6A 3SVAA 4WHAA 1KC84 4BTYA 2CFGA 1CQSA 1NO3A 1D6YA 3TDGA 1ULJB 4HBRA 1VQ53 2RCDA 2BMOB 3CCQ3 1K9M4 3N54B 1YJW3 2OTL3 3DUKA 1DYUA 4RZMA 1WMOA 4HYZA 4IPBA 1UI7A 4BTXA 3JUNA 1UUVB 5IERA 5ELJA 5AEUB 4K1UA 4L7KA 1NB5I 3O8YA 4J8TA 2KRTA 3EBTA 2XH9A 3K9MC 3JVCA 2HMMB 2LQVA 3M8CA 3S29A 3MG3A 2XSHB 2L4VA 3ROBA 1TU5A 1LNHA 4XBYA 3X42A 1AV4A 1M1XB 1VQL3 2V1LA 4FCMA 1HU9A 1OUNA 3D9RA 4I4KA 4N6UA 1LXEA 3CCM3 3MYTA 4O2HA 4RNZA 1QVF2 3DGLA 3CCL3 3HIGA 1AVLA 1WMPA 2Q07A 2W56B 4MJDA 1YI23 1ZX2A 3NHXA 1GD3A 3Q1CA 8CHOA 3EB8A 3UJMA 2BMRB 2JDIH 1VQO3 1VQP3 1KD14 1W6YA 2OQEC 3FSDA 3N8BA 1W5ZA 4NREA 2QGUA 1K734 3RGRA 2ML6A 2CHCA 4MMYB 3GWRA 1EA2A 4HKVB 3OV4A 3HZPA 3T8UA 1JB2A 1O7GB 3EBYA 4OUQA 5IG5A 4KZ1A 1YJ93 1N5PA 1DMQA 2XFSA 3AMOA 3PZWA 4MMZB 3KSPA 1WMNA 2FNQA 4RNYA 3F8HA 1RRHA 2XF3A 3KE7A 1QAFA 4MMXB 4O02B 5IF6A 4N6TA 1D6UA 4HM1B 2CWTA 1E3RA 1JKGA 1CYVA 3DXOA 3H3HA 2Z7AA 3STDA 3GAXA 1N9JA 2MC8A 2CW9A 2O3OA 5AIFA 4MEIA 1YIJ3 4GB5A 3V92A 1SQWA 1SIIA 1KWIA 3LTBA 2OTJ3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W00 A;  3JUM A;  4HM4 B;  5AII A;  2XSO B;  5CF2 A;  3SOY A;  3F8X A;  3EN1 B;  3BLZ A;  3JUO A;  1BUQ A;  3GZX B;  2BMQ B;  3B4P A;  2R4I A;  2I9W A;  1JN5 B;  5AI1 A;  2YFJ B;  1Q40 B;  2GBX B;  5CXO A;  3EC9 A;  3NM2 A;  3F9S A;  1ZO2 A;  1OF5 B;  2W2C A;  2QIY A;  4L8O A;  2YFL B;  1Q42 A;  4LMI A;  2OWP A;  1STD A;  4CDL A;  3F7S A;  2YFI B;  3ER7 A;  3NXJ A;  3WMD A;  5DRE A;  3T8N A;  2HML B;  4HM8 B;  1O7P B;  3KKG A;  2F86 B;  2IMJ A;  4R9K A;  2HMJ B;  5D82 A;  1NWW A;  1JB4 A;  4Q53 A;  4HM3 B;  5KP1 A;  2K54 A;  3E99 A;  5IG3 A;  1O7M B;  1QJG A;  4HM7 B;  4XBT A;  1ULI B;  5AEW B;  2HMO B;  1GY7 A;  2B1X B;  3RGA A;  2XR8 B;  4HVN A;  4ORL A;  5CK6 A;  1SJW A;  2GBW B;  1S5A A;  3F14 A;  3FF2 A;  2F98 A;  3I0Y A;  1GY6 A;  5JPU A;  5AIH A;  3MKI A;  4R1K A;  1WQL B;  3GZB A;  5G2G A;  3IPT A;  3OWU A;  1ISK A;  5TGN A;  1O7H B;  1JN5 A;  4KVH A;  3NV0 B;  2UX0 A;  5D81 A;  5IEP A;  1U5O A;  1Q40 A;  3OWS A;  4X2H A;  1JB5 A;  3B4O A;  2BNG A;  1OF5 A;  2A15 A;  3DMC A;  5AIG A;  2HMK B;  3ECF A;  4WYK B;  4FCJ A;  5IEN A;  4J9A A;  2GEY A;  1OGX A;  3NBR A;  4X2O A;  4XB5 A;  3SED A;  1OHO A;  1GY5 A;  1W01 A;  3KZT A;  4L8P A;  2RGQ A;  1GS3 A;  3A76 A;  4R9L A;  3F40 A;  5BVB A;  4XDV A;  5HGR A;  1K41 A;  4XBX A;  3NUV A;  4IIA A;  2PZV A;  3OX9 A;  2GXF A;  1O7N B;  2JQ5 A;  5JPP A;  1OPY A;  3EF8 A;  4HZ9 B;  2STD A;  2F99 A;  1OHS A;  2B24 B;  5IG4 A;  4STD A;  3G8Z A;  4HM0 B;  3CNM A;  3VSY A;  4LEH A;  1VZZ A;  1DMM A;  1QMA A;  3K7C A;  4K1V A;  2CKF B;  1A2K A;  3UNL A;  1DMN A;  2Z76 A;  3EX9 A;  3MHE A;  3VGN A;  3FZW A;  2Z77 A;  1OGZ A;  3JUP A;  7STD A;  5CF1 A;  1C7H A;  4OVM A;  1AR0 A;  2XRX B;  1TUH A;  1Z1S A;  3OWY A;  3Q90 A;  4XDW A;  3NV0 A;  3JUQ A;  1GYB A;  3G16 A;  5FW5 A;  3HK4 A;  3OXA A;  6STD A;  4HZB B;  1HKX A;  4WYK A;  5KP4 A;  3CU3 A;  1O7W B;  4PEJ A;  3MSO A;  3FF0 A;  3MG2 A;  3K0Z A;  1E97 A;  3FH1 A;  2RFR A;  4HM6 B;  3EQQ B;  4HM5 B;  3CNX A;  1ASK A;  3LZA A;  2GEX A;  5STD A;  4WP5 A;  2INX A;  1W02 A;  5IG0 A;  3GZR A;  3EJV A;  2HMN B;  3MG1 A;  3FLJ A;  3DM8 A;  3F7X A;  4HM2 B;  5DRV A;  3GZY B;  1OHP A;  3FKA A;  5EVH A;  5CLK A;  3HX8 A;  4N3V A;  5IEO A;  4LGQ A;  3BB9 A;  1OCV A;  5D83 A;  5KP3 A;  5BXQ A;  3S5C A;  3EN8 A;  3GRD A;  3CPO A;  4HJL B;  3SOA A;  3LYG A;  1JKG B;  3B7C A;  4XM4 A;  3DZL A;  1OH0 A;  4H3U A;  3EHC A;  1NDO B;  1NU3 A;  3B8L A;  1E3V A;  1UUW B;  4WWU C;  4U13 A;  1EG9 B;  3FGY A;  3G0K A;  1IDP A;  3H51 A;  1TP6 A;  1CQS A;  1ULJ B;  2RCD A;  2BMO B;  3DUK A;  4RZM A;  3JUN A;  1UUV B;  5IER A;  5AEU B;  4K1U A;  4L7K A;  4J8T A;  3EBT A;  2HMM B;  3M8C A;  3MG3 A;  2XSH B;  3ROB A;  4XBY A;  4FCM A;  1OUN A;  3D9R A;  4I4K A;  3MYT A;  4MJD A;  1ZX2 A;  3NHX A;  8CHO A;  3UJM A;  2BMR B;  1W6Y A;  3FSD A;  2QGU A;  3RGR A;  2CHC A;  3GWR A;  1EA2 A;  4HKV B;  3OV4 A;  3HZP A;  3T8U A;  1JB2 A;  1O7G B;  3EBY A;  4OUQ A;  5IG5 A;  1DMQ A;  3KSP A;  3F8H A;  3KE7 A;  5IF6 A;  4HM1 B;  1E3R A;  1JKG A;  3DXO A;  3H3H A;  2Z7A A;  3STD A;  5AIF A;  4GB5 A; 
#chains in the Genus database with same CATH topology
 1U8C B;  1W00 A;  3HII A;  3JUM A;  1BRG A;  4GL6 A;  4HM4 B;  5AII A;  3AGN A;  3G71 3;  2XSO B;  3QRD A;  2BIR A;  5M18 A;  3CCE 3;  5CF2 A;  4N6V 0;  2P09 A;  2IA7 A;  2F5M A;  4LYL B;  3SOY A;  3T0U A;  3DY5 A;  3F8X A;  3EN1 B;  4N6O B;  1UCJ A;  3NX0 A;  1YGW A;  3BLZ A;  3JUO A;  4R4K A;  1RGK A;  4KFE A;  1YNV X;  1BUQ A;  3GZX B;  2W04 A;  2BMQ B;  2CG1 A;  1A2V A;  3UB1 A;  1PY3 A;  3B4P A;  2R4I A;  2I9W A;  3WR2 A;  1JN5 B;  5AI1 A;  2YFJ B;  3LH4 A;  2CH9 A;  1Q40 B;  2GBX B;  2Y73 A;  1NJI 4;  1F8N A;  2F56 A;  3CCU 3;  5CXO A;  2Z6B A;  3EC9 A;  2KF3 A;  4AEQ A;  2K0M A;  1Q82 4;  1QVG 2;  1BRJ A;  3WHO A;  1G02 A;  1K28 A;  3F9S A;  3NM2 A;  6GSP A;  1ZO2 A;  4BU4 A;  1FUT A;  1GD4 A;  1OF5 B;  1T3B A;  2E2U A;  2W2C A;  3D79 A;  3MWZ A;  5AYS C;  2QIY A;  1HZ1 A;  2H0G A;  2YFL B;  4L8O A;  1Q42 A;  4LMI A;  4HAA A;  3ZFZ A;  1RCL A;  1UCK A;  2OWP A;  1MWS A;  1STD A;  1MWR A;  4CDL A;  3CCV 3;  3F7S A;  2IY2 A;  2YFI B;  3ER7 A;  4BL2 A;  3D5I A;  3NXJ A;  2W56 A;  3WMD A;  5DRE A;  1BSB A;  2IYJ A;  3HI7 A;  3T8N A;  2HML B;  3D4A A;  1BSA A;  4KT3 B;  1RLS A;  1W7C A;  4HM8 B;  3IJE B;  1O7P B;  3A5E A;  4GHO A;  3KKG A;  3CCJ 3;  2F86 B;  5HOH A;  2IMJ A;  4R9K A;  2HMJ B;  3VF1 A;  1SIH A;  5D82 A;  3X3X A;  1JZD A;  1NWW A;  1JB4 A;  1Q7Y 4;  1LNI A;  1W6C A;  2P05 A;  2L1S A;  4Q53 A;  4HM3 B;  1X1X A;  5KP1 A;  2WO0 A;  1JBR A;  1RTU A;  1BAO A;  1RGG A;  2K54 A;  3E99 A;  1X1Y A;  1SPU A;  5IG3 A;  1EKM A;  1O7M B;  1CEW I;  1QJG A;  2IUK A;  2IUJ A;  4HM7 B;  2F5W A;  1VQM 3;  4XBT A;  1TIJ A;  1B2M A;  2CK3 H;  2KAA A;  2BU4 A;  1M90 4;  1ULI B;  5AEW B;  1FGT A;  4NHF A;  2HMO B;  1C54 A;  1IU7 A;  1GY7 A;  3X41 A;  2GU1 A;  2B1X B;  3RGA A;  1YJN 3;  1M9G A;  1YIT 3;  7RNT A;  3BNC A;  1N5H A;  2XR8 B;  3SLU A;  4HVN A;  1IVU A;  1RGA A;  1BNS A;  2SAR A;  4ZM8 A;  2BT3 A;  4ORL A;  5CK6 A;  3I56 3;  1SJW A;  1A2P A;  1I0X A;  2GBW B;  5AYR B;  2KF4 A;  4J5K A;  2CC3 A;  5M1A A;  4BIR A;  1S5A A;  1DVD A;  1BAN A;  4FMC A;  4JF8 A;  1K8A 4;  3F14 A;  3FF2 A;  1IV9 A;  2F98 A;  3I0Y A;  5I97 A;  1GY6 A;  1RGH A;  2FXT A;  5JPU A;  4K61 A;  1X1U A;  1BGS A;  5AIH A;  3CC2 3;  3HOH A;  1BNI A;  3MKI A;  3DH2 A;  4R1K A;  5GSP A;  1JBS A;  1VQQ A;  1UGI A;  3D3L A;  1IV7 A;  2CWV A;  1QAL A;  1WQL B;  3GZB A;  5G2G A;  1W6G A;  3IPT A;  4N6L A;  3OWU A;  3S28 A;  1YHQ 3;  2XGN A;  4N6N B;  3LXU X;  1ISK A;  3DGY A;  5TGN A;  4GSP A;  2D1W A;  1O7H B;  1JN5 A;  1I3I A;  1I70 A;  4KVH A;  3NV0 B;  2UX0 A;  5D81 A;  5IEP A;  4H61 A;  1U5O A;  3LML A;  3QK9 A;  1FGQ A;  1Q40 A;  4EW5 A;  1GMQ A;  1S72 3;  2BHM A;  1FGR A;  2ZA4 A;  3WOD G;  3BIR A;  3I55 3;  3ALA A;  3FG3 A;  1LQM B;  5JBS A;  2J8X B;  3OWS A;  4G1M B;  3J7Y d;  4X2H A;  3G4S 3;  1JB5 A;  3B4O A;  1UGH I;  2BNG A;  3GSP A;  3WA2 X;  1Q86 4;  1DET A;  1OF5 A;  2A15 A;  2ZHX B;  5FGO A;  5BIR A;  1DE3 A;  3NM7 A;  3DMC A;  3LTD A;  2HMK B;  3MPH A;  5AIG A;  3ECF A;  4WYK B;  1IT8 A;  1IQX A;  4FCJ A;  4AKZ A;  3FG1 A;  5IEN A;  4J9A A;  2GEY A;  1OGX A;  3NBR A;  4X2O A;  3Q2P A;  4XB5 A;  3SED A;  2W6J H;  3V99 A;  1OHO A;  1GY5 A;  3Q3F A;  2ML5 A;  2H0I A;  1W01 A;  1BRI A;  1JRQ A;  3KZT A;  1IT7 A;  4L8P A;  2AAE A;  2CFL A;  3K5T A;  1L5G B;  2D42 A;  1RN7 A;  4K90 B;  2RGQ A;  4FCZ A;  1GS3 A;  1RSN A;  3A76 A;  1HYF A;  1FYS A;  4R9L A;  1YVB I;  1BNJ A;  3F40 A;  3S27 A;  4AKY A;  5BVB A;  4XDV A;  2CFD A;  5HGR A;  4ILF A;  1Y4K A;  3PYJ A;  1GMP A;  1UW1 A;  1K41 A;  1IVV A;  2KCD A;  2OCT A;  2P38 A;  4XBX A;  3NUV A;  1VQ4 3;  1I2E A;  4IIA A;  2PZV A;  3OX9 A;  3CC7 3;  2PNC A;  1RN1 A;  2GXF A;  2OQE A;  4EYC A;  3LOY A;  3EE1 A;  1B3S A;  3WOF B;  1O7N B;  1J2B A;  3PCS A;  3S67 A;  2JQ5 A;  5JPP A;  3AHS A;  3CC4 3;  1VQK 3;  4RNT A;  2GU3 A;  1OPY A;  3EF8 A;  1FUS A;  1RGF A;  1RRL A;  2QEX 3;  3WDG B;  4HZ9 B;  2STD A;  2F99 A;  4CCV A;  1OHS A;  1RGL A;  3SX1 A;  1W2Z A;  2B24 B;  5IG4 A;  2C10 A;  4STD A;  3U97 A;  1EQK A;  1FUW A;  3G8Z A;  3CCS 3;  1FA3 A;  1I2F A;  3PXM A;  4JRF A;  4HM0 B;  3CNM A;  3VSY A;  4IT7 A;  1MWT A;  4LEH A;  1VZZ A;  1DMM A;  1QMA A;  3LT9 A;  1BUJ A;  3K7C A;  1YVS A;  3BNB A;  1W2B 2;  1JV2 B;  3BNE A;  2CKF B;  4K1V A;  3CXC 2;  2P0X A;  1A2K A;  3UNL A;  1STF I;  1BNF A;  4EBG A;  1DMN A;  2Z76 A;  3EX9 A;  3MHE A;  1PFP A;  3CMA 3;  4HOH A;  4EV5 A;  3VGN A;  1LOX A;  1VQ8 3;  3IMA B;  1R4C A;  4I5Q A;  4KFD A;  3FZW A;  1FW7 A;  2Z77 A;  2FGT A;  1VQ7 3;  1LOV A;  1OGZ A;  2F4Y A;  3JUP A;  2CWU A;  1I3F A;  7STD A;  2KF5 A;  5CF1 A;  1C7H A;  2W9Q A;  2W03 A;  4EXR A;  3X3Y A;  4OVM A;  4FMB A;  1AR0 A;  2XRX B;  1TUH A;  3PS8 A;  1Z1S A;  3OWY A;  3RNT A;  1NNV A;  3PCR A;  4N6M A;  3Q90 A;  1B2X A;  3FCS B;  1VQN 3;  1DVC A;  1I2G A;  3NV0 A;  4XDW A;  4FMA A;  3JUQ A;  3URP A;  1LQG C;  1GYB A;  3G16 A;  4O3V A;  1PU4 A;  1N8R 4;  1M1K 4;  1BRN L;  4FR9 A;  2YX9 A;  5FW5 A;  1UCL A;  2XEP A;  1RKY A;  3HK4 A;  1MGR A;  3OXA A;  4CPK A;  2CFK A;  3WA3 A;  6STD A;  1Q81 4;  1BRK A;  1BSD A;  2WOH A;  1BVI A;  1RGE A;  4HZB B;  4FMD A;  1VQ6 3;  1IQY A;  1V57 A;  3NBJ A;  1FGM A;  1KSI A;  1HKX A;  1X1W A;  2ZL8 A;  4WYK A;  5KP4 A;  2E2T A;  3NBB A;  3CU3 A;  1LOW A;  1RDS A;  1O7W B;  2OOV C;  1LVN A;  3LTA A;  3MSO A;  1BSE A;  4PEJ A;  1RHL A;  1RMS A;  3FF0 A;  3RDE A;  3KFQ C;  2XGL A;  3MG2 A;  4EV2 A;  2WGO A;  2WOF A;  1RGC A;  1TFK A;  1NB3 I;  2CIU A;  1FGO A;  3K0Z A;  1E97 A;  3X40 A;  3CD6 3;  1IQ8 A;  3KSE D;  3L0R A;  3CPW 2;  2P0M A;  3D5G A;  3FH1 A;  1JNQ A;  1UCI A;  2RFR A;  1T5Y A;  4HM6 B;  1T2H A;  2BO9 B;  3EQQ B;  1EUI C;  1ROA A;  1BOX A;  4HM5 B;  3U1W A;  3CNX A;  3ZG0 A;  1Q9E A;  1D6Z A;  1WTH A;  2ZDJ A;  1ASK A;  1IVW A;  1W4N A;  3X3Z A;  4RBN A;  1AVK A;  4J5G A;  3G6E 3;  1UI8 A;  1GOY A;  1ZGX A;  2M7O A;  3LZA A;  2GEX A;  5STD A;  4WP5 A;  2INX A;  1GOV A;  3ZG5 A;  2E2V A;  2CFW A;  1W02 A;  5IG0 A;  6RNT A;  2QA4 3;  3GZR A;  2RSX A;  3EJV A;  4LZI A;  1IK3 A;  3UL5 A;  1MNL A;  1ROV A;  2HMN B;  1YGE A;  1Q7H A;  1JJ2 2;  3MG1 A;  3KN4 A;  1BNG A;  2W9P A;  3FLJ A;  4O8S A;  4BTW A;  1G96 A;  3BND A;  4R80 A;  1V58 A;  3DM8 A;  5EEO A;  3F7X A;  3FG4 A;  4HM2 B;  5DRV A;  1RJO A;  1KQS 2;  3GZY B;  1OHP A;  1LOY A;  3DGN A;  1B2S A;  3FKA A;  5EVH A;  1RCK A;  8RNT A;  5CLK A;  3HX8 A;  1G0T A;  1BIR A;  4LSO A;  3UL6 A;  4N3V A;  2Y74 A;  1QAK A;  1N9E A;  3LT8 A;  1PYL A;  1AQZ A;  5IW9 A;  3CCR 3;  5IEO A;  1SAR A;  4LGQ A;  4OK0 A;  1MOL A;  2CG0 A;  3BB9 A;  1OCV A;  2MF7 A;  2GSP A;  2W0Q A;  5D83 A;  9RNT A;  3K63 A;  5KP3 A;  1US1 A;  5G1K A;  4KFF A;  3V98 A;  1N8Q A;  5BXQ A;  5EQL A;  3S5C A;  2C11 A;  2UUG C;  5LC7 A;  3EN8 A;  3SXX A;  3GRD A;  2KXG A;  3CPO A;  1CYU A;  1BNE A;  3AMO B;  4HJL B;  1T2I A;  1TFO A;  3SOA A;  1WNH A;  3LYG A;  3NQY A;  3N9H A;  3CME 3;  3NQZ A;  2SBL A;  3KCH A;  3PGB A;  2OOV A;  2O9U X;  4EC6 A;  3AGO A;  3OW2 2;  1JKG B;  1V74 A;  1LRA A;  3WOE B;  1B2U A;  3B7C A;  1UUG B;  4XM4 A;  4WFO A;  2LYX A;  4TX4 A;  1VQ9 3;  2HOH A;  1BNR A;  3DZL A;  1OH0 A;  1RNT A;  4DKI A;  3LTC A;  4H3U A;  2AAD A;  3DGM A;  3EHC A;  1A90 A;  2XFT A;  1NDO B;  3DGO A;  1NU3 A;  5LC6 A;  3B8L A;  1E3V A;  5ELU A;  1UUW B;  4QWT A;  4WWU C;  4U13 A;  1EEJ A;  1A67 A;  1ZS7 A;  2WGQ A;  1EG9 B;  3FGY A;  3G0K A;  1OAC A;  1IDP A;  2CX1 A;  3H51 A;  3KII A;  1IVX A;  1TP6 A;  3SVA A;  4WHA A;  1KC8 4;  4BTY A;  2CFG A;  1CQS A;  1NO3 A;  1D6Y A;  3TDG A;  1JZO A;  1ULJ B;  4HBR A;  1VQ5 3;  2RCD A;  2BMO B;  3CCQ 3;  2RNT A;  1K9M 4;  3N54 B;  1TJD A;  1YJW 3;  2OTL 3;  3DUK A;  1DYU A;  5A0O B;  1TRQ A;  4RZM A;  1WMO A;  4HYZ A;  4IPB A;  1UI7 A;  4BTX A;  3JUN A;  2UGI A;  1UUV B;  1MWU A;  2C4B A;  4BL3 A;  5IER A;  1B20 A;  5ELJ A;  5AEU B;  1CH0 A;  4K1U A;  2RBI A;  4L7K A;  1NB5 I;  3O8Y A;  4J8T A;  1MGW A;  2KRT A;  3EBT A;  2XH9 A;  3K9M C;  3JVC A;  2HMM B;  2LQV A;  3M8C A;  3S29 A;  1BRS A;  1RN4 A;  3MG3 A;  2XSH B;  2L4V A;  3ROB A;  1R4Y A;  7GSP A;  1TU5 A;  1LNH A;  1I8V A;  4XBY A;  1AV4 A;  3X42 A;  1M1X B;  1VQL 3;  2V1L A;  2R41 A;  1I0V A;  4NPB A;  4FCM A;  1HU9 A;  3SYU A;  1OUN A;  3D9R A;  4I4K A;  4N6U A;  1BRH A;  1IYY A;  1LXE A;  1B2Z A;  1BU4 A;  3CCM 3;  3MYT A;  4O2H A;  1TTO A;  3BU4 A;  4RNZ A;  1QVF 2;  3DGL A;  3CCL 3;  3HIG A;  1AVL A;  1WMP A;  2Q07 A;  2W56 B;  4MJD A;  1YI2 3;  1ZX2 A;  1GOU A;  1GD3 A;  3NHX A;  3Q1C A;  8CHO A;  3EB8 A;  3UJM A;  2BMR B;  2JDI H;  1VQO 3;  1TRP A;  1UDI I;  1B21 A;  4CJN A;  1VQP 3;  1KD1 4;  1W6Y A;  1JBT A;  2OQE C;  3FSD A;  2CX0 A;  3N8B A;  1W5Z A;  4NRE A;  2QGU A;  1K73 4;  3RGR A;  2ML6 A;  2CHC A;  4MMY B;  3GWR A;  1EA2 A;  4HKV B;  3OV4 A;  3HZP A;  5BU4 A;  3T8U A;  1JB2 A;  1GSP A;  1O7G B;  3EBY A;  1RNB A;  4OUQ A;  5IG5 A;  4KZ1 A;  1YJ9 3;  1N5P A;  1DMQ A;  2XFS A;  3AMO A;  1FZU A;  3PZW A;  3KSP A;  1WMN A;  2FNQ A;  4MMZ B;  3F8H A;  4RNY A;  5RNT A;  1RRH A;  2XF3 A;  3KE7 A;  1QAF A;  4MMX B;  4O02 B;  2H0H A;  4N6T A;  1D6U A;  4HM1 B;  1B27 A;  2CWT A;  5IF6 A;  1E3R A;  1JKG A;  1CYV A;  3DXO A;  3H3H A;  2Z7A A;  3STD A;  3GAX A;  2K3D A;  2KF6 A;  5G1L A;  1N9J A;  2MC8 A;  2CW9 A;  2O3O A;  5AIF A;  4MEI A;  2OTJ 3;  1YIJ 3;  4GB5 A;  3AHW A;  1BSC A;  1SQW A;  3V92 A;  1SII A;  1GMR A;  1KWI A;  3LTB A;  1AY7 A;  5M19 A; 
#chains in the Genus database with same CATH homology
 1U8C B;  1W00 A;  3HII A;  3JUM A;  4GL6 A;  4HM4 B;  5AII A;  3G71 3;  2XSO B;  3QRD A;  3CCE 3;  5CF2 A;  4N6V 0;  2P09 A;  2IA7 A;  3SOY A;  3T0U A;  3DY5 A;  3F8X A;  3EN1 B;  4N6O B;  3NX0 A;  3BLZ A;  3JUO A;  4R4K A;  4KFE A;  1BUQ A;  3GZX B;  2W04 A;  2BMQ B;  2CG1 A;  1A2V A;  3UB1 A;  3B4P A;  2R4I A;  2I9W A;  1JN5 B;  5AI1 A;  2YFJ B;  3LH4 A;  2CH9 A;  1Q40 B;  2GBX B;  2Y73 A;  1NJI 4;  1F8N A;  3CCU 3;  5CXO A;  2Z6B A;  3EC9 A;  4AEQ A;  2K0M A;  1Q82 4;  1QVG 2;  1K28 A;  3NM2 A;  3F9S A;  1ZO2 A;  1OF5 B;  1GD4 A;  2E2U A;  2W2C A;  5AYS C;  3MWZ A;  2QIY A;  4L8O A;  2YFL B;  1Q42 A;  4LMI A;  2OWP A;  1STD A;  4CDL A;  3CCV 3;  3F7S A;  2YFI B;  3ER7 A;  3NXJ A;  2W56 A;  3WMD A;  5DRE A;  3HI7 A;  3T8N A;  2HML B;  1W7C A;  4HM8 B;  3IJE B;  1O7P B;  3CCJ 3;  3KKG A;  2F86 B;  2IMJ A;  4R9K A;  2HMJ B;  3VF1 A;  1SIH A;  5D82 A;  3X3X A;  1NWW A;  1JB4 A;  1Q7Y 4;  1W6C A;  2P05 A;  4Q53 A;  4HM3 B;  5KP1 A;  2WO0 A;  2K54 A;  3E99 A;  1SPU A;  5IG3 A;  1EKM A;  1O7M B;  1CEW I;  1QJG A;  2IUK A;  2IUJ A;  4HM7 B;  1VQM 3;  4XBT A;  1TIJ A;  2CK3 H;  1ULI B;  5AEW B;  1FGT A;  4NHF A;  2HMO B;  1IU7 A;  1GY7 A;  3X41 A;  2GU1 A;  2B1X B;  3RGA A;  1YJN 3;  1M9G A;  1YIT 3;  3BNC A;  1N5H A;  2XR8 B;  3SLU A;  4HVN A;  1IVU A;  4ZM8 A;  2BT3 A;  4ORL A;  5CK6 A;  3I56 3;  1SJW A;  2GBW B;  5AYR B;  2CC3 A;  1S5A A;  1DVD A;  4FMC A;  4JF8 A;  1K8A 4;  3F14 A;  3FF2 A;  1IV9 A;  2F98 A;  3I0Y A;  5I97 A;  1GY6 A;  2FXT A;  5JPU A;  4K61 A;  5AIH A;  3CC2 3;  3MKI A;  4R1K A;  3D3L A;  1IV7 A;  2CWV A;  1QAL A;  1WQL B;  3GZB A;  5G2G A;  1W6G A;  3IPT A;  4N6L A;  3OWU A;  3S28 A;  1YHQ 3;  2XGN A;  4N6N B;  3LXU X;  1ISK A;  5TGN A;  2D1W A;  1O7H B;  1JN5 A;  4KVH A;  3NV0 B;  2UX0 A;  5D81 A;  5IEP A;  4H61 A;  1U5O A;  3LML A;  3QK9 A;  1FGQ A;  1Q40 A;  1S72 3;  2BHM A;  1FGR A;  3WOD G;  3I55 3;  3ALA A;  3FG3 A;  5JBS A;  3G4S 3;  3OWS A;  4G1M B;  3J7Y d;  4X2H A;  1JB5 A;  3B4O A;  2BNG A;  1Q86 4;  3WA2 X;  1OF5 A;  2A15 A;  5FGO A;  3NM7 A;  3DMC A;  3LTD A;  2HMK B;  3MPH A;  5AIG A;  3ECF A;  4WYK B;  1IT8 A;  1IQX A;  4FCJ A;  4AKZ A;  3FG1 A;  5IEN A;  4J9A A;  2GEY A;  1OGX A;  3NBR A;  4X2O A;  3Q2P A;  4XB5 A;  3SED A;  2W6J H;  3V99 A;  1OHO A;  1GY5 A;  2ML5 A;  1W01 A;  1JRQ A;  3KZT A;  1IT7 A;  4L8P A;  2CFL A;  3K5T A;  1L5G B;  2D42 A;  1RN7 A;  4K90 B;  2RGQ A;  4FCZ A;  1GS3 A;  3A76 A;  3S27 A;  4R9L A;  1YVB I;  3F40 A;  4AKY A;  5BVB A;  4XDV A;  2CFD A;  5HGR A;  1Y4K A;  3PYJ A;  1UW1 A;  1K41 A;  1IVV A;  2KCD A;  2OCT A;  2P38 A;  4XBX A;  3NUV A;  1VQ4 3;  4IIA A;  2PZV A;  3OX9 A;  3CC7 3;  2PNC A;  2GXF A;  2OQE A;  4EYC A;  3LOY A;  3EE1 A;  3WOF B;  1O7N B;  1J2B A;  3PCS A;  3S67 A;  2JQ5 A;  5JPP A;  3CC4 3;  1VQK 3;  2GU3 A;  1OPY A;  3EF8 A;  1RRL A;  2QEX 3;  3WDG B;  4HZ9 B;  2STD A;  2F99 A;  4CCV A;  1OHS A;  3SX1 A;  1M90 4;  1W2Z A;  2B24 B;  5IG4 A;  2C10 A;  4STD A;  3U97 A;  1EQK A;  1FUW A;  3G8Z A;  3CCS 3;  1FA3 A;  3PXM A;  4JRF A;  4HM0 B;  3CNM A;  3VSY A;  4IT7 A;  4LEH A;  1VZZ A;  1DMM A;  1QMA A;  3LT9 A;  3K7C A;  3BNB A;  1W2B 2;  1JV2 B;  3BNE A;  2CKF B;  4K1V A;  3CXC 2;  2P0X A;  1A2K A;  3UNL A;  1STF I;  4EBG A;  1DMN A;  2Z76 A;  3EX9 A;  3MHE A;  1PFP A;  3CMA 3;  4EV5 A;  3VGN A;  1LOX A;  1VQ8 3;  3IMA B;  1R4C A;  4KFD A;  3FZW A;  2Z77 A;  2FGT A;  1VQ7 3;  1OGZ A;  3JUP A;  2CWU A;  7STD A;  5CF1 A;  1C7H A;  2W9Q A;  2W03 A;  4EXR A;  3X3Y A;  4OVM A;  4FMB A;  1AR0 A;  2XRX B;  1TUH A;  3PS8 A;  1Z1S A;  3OWY A;  3PCR A;  4N6M A;  3Q90 A;  3FCS B;  1VQN 3;  1DVC A;  4XDW A;  3NV0 A;  4FMA A;  3JUQ A;  1GYB A;  3G16 A;  4O3V A;  1PU4 A;  1N8R 4;  1M1K 4;  4FR9 A;  2YX9 A;  5FW5 A;  2XEP A;  1RKY A;  3HK4 A;  3OXA A;  2CFK A;  3WA3 A;  6STD A;  1Q81 4;  2WOH A;  4HZB B;  4FMD A;  1VQ6 3;  1IQY A;  3NBJ A;  1FGM A;  1KSI A;  1HKX A;  2ZL8 A;  4WYK A;  5KP4 A;  2E2T A;  3NBB A;  3CU3 A;  2OOV C;  1O7W B;  3LTA A;  1LVN A;  4PEJ A;  3MSO A;  3RDE A;  5A0O B;  4EV2 A;  3FF0 A;  3KFQ C;  2XGL A;  3MG2 A;  2WGO A;  2WOF A;  1TFK A;  1NB3 I;  2CIU A;  1FGO A;  3K0Z A;  1E97 A;  3X40 A;  3CD6 3;  1IQ8 A;  3KSE D;  3L0R A;  3CPW 2;  2P0M A;  3FH1 A;  1JNQ A;  2RFR A;  1T5Y A;  4HM6 B;  2BO9 B;  3EQQ B;  1ROA A;  4HM5 B;  3U1W A;  3CNX A;  1D6Z A;  1WTH A;  2ZDJ A;  1ASK A;  1IVW A;  1W4N A;  3X3Z A;  4RBN A;  1AVK A;  3G6E 3;  1UI8 A;  2M7O A;  3LZA A;  2GEX A;  5STD A;  4WP5 A;  2INX A;  2E2V A;  2CFW A;  1W02 A;  5IG0 A;  2QA4 3;  3GZR A;  2RSX A;  3EJV A;  4LZI A;  1IK3 A;  3UL5 A;  1MNL A;  1ROV A;  2HMN B;  1YGE A;  1JJ2 2;  3MG1 A;  3KN4 A;  2W9P A;  3FLJ A;  4O8S A;  4BTW A;  1G96 A;  3BND A;  4R80 A;  3DM8 A;  5EEO A;  3F7X A;  3FG4 A;  4HM2 B;  5DRV A;  1RJO A;  1KQS 2;  3GZY B;  1OHP A;  3DGN A;  3FKA A;  5EVH A;  5CLK A;  3HX8 A;  4LSO A;  3UL6 A;  4N3V A;  2Y74 A;  1QAK A;  1N9E A;  3LT8 A;  5IW9 A;  3CCR 3;  5IEO A;  4LGQ A;  4OK0 A;  1MOL A;  2CG0 A;  3BB9 A;  1OCV A;  2MF7 A;  5D83 A;  2W0Q A;  3K63 A;  5KP3 A;  1US1 A;  4KFF A;  3V98 A;  1N8Q A;  5BXQ A;  5EQL A;  3S5C A;  2C11 A;  5LC7 A;  3EN8 A;  3SXX A;  3GRD A;  2KXG A;  3CPO A;  1CYU A;  3AMO B;  4HJL B;  1TFO A;  3SOA A;  1WNH A;  3LYG A;  3NQY A;  3N9H A;  3CME 3;  3NQZ A;  2SBL A;  3PGB A;  2OOV A;  2O9U X;  4EC6 A;  3OW2 2;  1JKG B;  1V74 A;  3WOE B;  3B7C A;  4XM4 A;  4WFO A;  2LYX A;  4TX4 A;  1VQ9 3;  3DZL A;  1OH0 A;  3LTC A;  4H3U A;  3DGM A;  3EHC A;  1A90 A;  2XFT A;  1NDO B;  3DGO A;  1NU3 A;  5LC6 A;  3B8L A;  1E3V A;  5ELU A;  1UUW B;  4QWT A;  4WWU C;  4U13 A;  1A67 A;  2WGQ A;  1EG9 B;  3FGY A;  3G0K A;  1OAC A;  1IDP A;  3H51 A;  3KII A;  1IVX A;  1TP6 A;  3SVA A;  4WHA A;  1KC8 4;  4BTY A;  2CFG A;  1CQS A;  1NO3 A;  1D6Y A;  3TDG A;  1ULJ B;  4HBR A;  1VQ5 3;  2RCD A;  2BMO B;  3CCQ 3;  1K9M 4;  3N54 B;  1YJW 3;  2OTL 3;  3DUK A;  1DYU A;  4RZM A;  1WMO A;  4HYZ A;  4IPB A;  1UI7 A;  4BTX A;  3JUN A;  1UUV B;  5IER A;  5ELJ A;  5AEU B;  4K1U A;  4L7K A;  1NB5 I;  3O8Y A;  4J8T A;  2KRT A;  3EBT A;  2XH9 A;  3K9M C;  3JVC A;  2HMM B;  2LQV A;  3M8C A;  3S29 A;  3MG3 A;  2XSH B;  2L4V A;  3ROB A;  1TU5 A;  1LNH A;  4XBY A;  3X42 A;  1AV4 A;  1M1X B;  1VQL 3;  2V1L A;  4FCM A;  1HU9 A;  1OUN A;  3D9R A;  4I4K A;  4N6U A;  1LXE A;  3CCM 3;  3MYT A;  4O2H A;  4RNZ A;  1QVF 2;  3DGL A;  3CCL 3;  3HIG A;  1AVL A;  1WMP A;  2Q07 A;  2W56 B;  4MJD A;  1YI2 3;  1ZX2 A;  3NHX A;  1GD3 A;  3Q1C A;  8CHO A;  3EB8 A;  3UJM A;  2BMR B;  2JDI H;  1VQO 3;  1VQP 3;  1KD1 4;  1W6Y A;  2OQE C;  3FSD A;  3N8B A;  1W5Z A;  4NRE A;  2QGU A;  1K73 4;  3RGR A;  2ML6 A;  2CHC A;  4MMY B;  3GWR A;  1EA2 A;  4HKV B;  3OV4 A;  3HZP A;  3T8U A;  1JB2 A;  1O7G B;  3EBY A;  4OUQ A;  5IG5 A;  4KZ1 A;  1YJ9 3;  1N5P A;  1DMQ A;  2XFS A;  3AMO A;  3PZW A;  4MMZ B;  3KSP A;  1WMN A;  2FNQ A;  4RNY A;  3F8H A;  1RRH A;  2XF3 A;  3KE7 A;  1QAF A;  4MMX B;  4O02 B;  5IF6 A;  4N6T A;  1D6U A;  4HM1 B;  2CWT A;  1E3R A;  1JKG A;  1CYV A;  3DXO A;  3H3H A;  2Z7A A;  3STD A;  3GAX A;  1N9J A;  2MC8 A;  2CW9 A;  2O3O A;  5AIF A;  4MEI A;  1YIJ 3;  4GB5 A;  3V92 A;  1SQW A;  1SII A;  1KWI A;  3LTB A;  2OTJ 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...