4K1UA

Crystal structure of delta5-3-ketosteroid isomerase containing y16f and y32f mutations
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
122
Chain Sequence
NLPTAQEVQGLMARFIELVDVGDIEAIVQMFADDATVEDPFGQPPIHGREQIAAFYRQGLVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Rescue of deleterious mutations by the compensatory Y30F mutation in ketosteroid isomerase
pubmed doi rcsb
source organism Pseudomonas putida
total genus 31
structure length 122
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4k1uA00
1W00A 3EBTA 1OHSA 3NM2A 3DUKA 3MYTA 4HZ9B 3GZYB 3SEDA 1QJGA 1OUNA 2HMMB 3F40A 3F9SA 2RCDA 2GXFA 5AIHA 1TP6A 3LYGA 3FZWA 4H3UA 2OWPA 1OCVA 4XBTA 1U5OA 3JUQA 4HM0B 3OV4A 2A15A 5IEPA 3RGAA 3OX9A 3EN1B 3T8NA 3F7XA 4LMIA 3NV0B 4J8TA 4XB5A 4K1UA 1GY7A 3ECFA 3Q90A 2CHCA 1E97A 1E3RA 4WYKA 1CQSA 3FLJA 3OWSA 1O7PB 3CNMA 3F8XA 3EJVA 3GRDA 4HM4B 3DXOA 4FCMA 1W01A 4WP5A 5CLKA 3FKAA 2XSOB 5JPUA 1UUWB 3GWRA 1GY5A 1DMQA 3B7CA 4L8OA 3MG2A 1EA2A 2I9WA 4X2OA 2GBXB 2HMJB 2F86B 2R4IA 1OH0A 1O7HB 4KVHA 5TGNA 3G16A 2HMLB 5KP3A 3NV0A 4STDA 5BVBA 5IG0A 1OHPA 1ISKA 2INXA 2Z76A 1O7GB 3MSOA 4WWUC 1S5AA 3SOAA 2YFJB 3B8LA 3K0ZA 4LGQA 5CF1A 3MG1A 3JUPA 5CXOA 1OGZA 2XRXB 1O7MB 2Z7AA 3DZLA 3CU3A 4HM3B 3STDA 2BNGA 5AEUB 4XDWA 1VZZA 3B4PA 1ZO2A 1OPYA 1ULJB 4FCJA 4R9LA 4HVNA 1O7WB 5D82A 3OWYA 3HK4A 4XBXA 3F14A 1K41A 3LZAA 1O7NB 3JUMA 4IIAA 5AEWB 2F98A 5IG3A 1Q40A 3ER7A 4L7KA 3FSDA 1Q42A 4ORLA 1JKGA 5HGRA 4Q53A 2Z77A 1JN5B 7STDA 3JUOA 4I4KA 3G8ZA 4LEHA 5IG5A 3EBYA 3MKIA 2YFLB 3NBRA 4HM5B 3G0KA 4R9KA 1AR0A 4X2HA 3FF0A 3S5CA 3NHXA 5AIFA 5BXQA 3BLZA 3FF2A 3EQQB 5AI1A 2B1XB 1ASKA 1QMAA 3HZPA 1DMMA 1C7HA 3E99A 5FW5A 5CF2A 5JPPA 3SOYA 3I0YA 1OF5A 1JN5A 5IEOA 1Q40B 4HZBB 5KP4A 3K7CA 3NXJA 4OVMA 1JKGB 1UUVB 3UJMA 3WMDA 1IDPA 3IPTA 4HM7B 3MG3A 3DM8A 5CK6A 4R1KA 5DRVA 3KZTA 2YFIB 1BUQA 1E3VA 1GYBA 2BMRB 3F8HA 4N3VA 5AIGA 5D81A 5D83A 5IG4A 3MHEA 3BB9A 2B24B 4PEJA 1A2KA 3T8UA 5IERA 1GY6A 5KP1A 3D9RA 1WQLB 3EN8A 2RFRA 4HJLB 3EHCA 2RGQA 1SJWA 2UX0A 4HM1B 4GB5A 3OXAA 2XSHB 3F7SA 4U13A 2BMOB 2HMOB 2CKFB 1Z1SA 4K1VA 3KKGA 1OHOA 1OF5B 3CPOA 2HMNB 3CNXA 8CHOA 3HX8A 3EX9A 4MJDA 1EG9B 3VSYA 5EVHA 3A76A 4HM6B 4CDLA 3FH1A 3H51A 1DMNA 3EF8A 3OWUA 3GZRA 4J9AA 2QIYA 3ROBA 2BMQB 2IMJA 3M8CA 1JB4A 5AIIA 3GZXB 4XM4A 2XR8B 1JB5A 3UNLA 2GBWB 3FGYA 1ZX2A 5G2GA 2PZVA 2F99A 1NWWA 3H3HA 4OUQA 3KE7A 1ULIB 3GZBA 1GS3A 5DREA 4RZMA 3VGNA 4HKVB 1NU3A 3JUNA 3RGRA 3NUVA 1OGXA 1W6YA 3KSPA 2GEYA 4L8PA 4XDVA 6STDA 2HMKB 2STDA 3DMCA 4XBYA 2GEXA 4HM8B 2K54A 5STDA 5IF6A 2QGUA 5IENA 3EC9A 1STDA 1NDOB 3B4OA 1TUHA 4WYKB 2W2CA 2JQ5A 1JB2A 4HM2B 1HKXA 1W02A
chains in the Genus database with same CATH superfamily
1W00A 1BRHA 1RNTA 1MWSA 3UB1A 3EBTA 3S28A 1DYUA 1OHSA 2W03A 3NM2A 3X41A 3DUKA 1SPUA 3MYTA 4HZ9B 1V57A 1VQ73 3GZYB 1FGMA 1RCLA 1RGCA 1LRAA 1OACA 3CCV3 3CCM3 3SEDA 1QJGA 3CCR3 1K8A4 1OUNA 3CME3 2HMMB 3LTAA 3F40A 1BNGA 3F9SA 4N6UA 2RCDA 1A90A 2GXFA 2CWVA 2ML5A 4NREA 5AIHA 2W9QA 5ELUA 3WOFB 1TP6A 3LYGA 1F8NA 2RNTA 4N6NB 1G96A 3NX0A 1K9M4 3FZWA 3K5TA 1MGRA 1W6GA 4H3UA 5G1KA 1TU5A 3CXC2 2OWPA 1OCVA 1IQXA 1T2HA 4XBTA 1U5OA 1GMPA 1GD4A 3BNDA 3JUQA 3MPHA 4HM0B 3T0UA 1IU7A 1BNRA 5M18A 3KIIA 3OV4A 5AYSC 2XF3A 4J5KA 1B3SA 1G02A 2A15A 2M7OA 5IEPA 3CC73 2XGNA 1I0XA 3RGAA 1BRIA 1MOLA 3WDGB 1GOVA 2CFKA 3OX9A 1TRPA 4KFFA 2P0MA 2E2UA 3EN1B 1RTUA 3WA2X 1STFI 3T8NA 3JVCA 3NQYA 3F7XA 3SVAA 4LMIA 3NV0B 3D3LA 1FW7A 3G4S3 1BUJA 4J8TA 1MNLA 1SQWA 1RGAA 4XB5A 4K1UA 1BNSA 1GY7A 3ECFA 4N6LA 3Q90A 1X1UA 2CHCA 1E97A 1IT8A 1E3RA 1VQM3 4WYKA 1CQSA 5EEOA 2F4YA 3PGBA 1US1A 1RHLA 1I2GA 3FLJA 3J7Yd 4EW5A 3OWSA 1N8R4 1BRNL 4NPBA 1BNIA 2P0XA 1JBRA 3CCL3 2OQEC 1O7PB 4RNTA 1VQK3 3CNMA 3F8XA 3EJVA 4RBNA 4EYCA 1KD14 3LOYA 2ZL8A 3GRDA 1UCKA 1BSAA 1G0TA 2H0HA 2L4VA 2ZHXB 4AKZA 3PZWA 1YGEA 1Q9EA 4HM4B 3DXOA 1GMRA 3S27A 1LVNA 4FCMA 1I3IA 1W01A 4WP5A 3FCSB 5CLKA 3N54B 3FKAA 4AKYA 1RJOA 3S67A 1N5HA 2XSOB 5JPUA 1Q7HA 1UUWB 2RSXA 3N9HA 3D4AA 1B2UA 3GWRA 1IV7A 5LC7A 3SXXA 1MWUA 1YVBI 1A2PA 1KQS2 1GY5A 2OOVC 1DMQA 2OCTA 3B7CA 1BSCA 2KAAA 2MF7A 4L8OA 3MG2A 3WODG 7GSPA 1VQL3 3QRDA 1EA2A 2I9WA 2BO9B 4X2OA 2GBXB 2HMJB 1BRGA 2OQEA 3CC23 3LMLA 2F86B 1IVUA 3CPW2 1PYLA 3RDEA 2CWTA 1HU9A 2R4IA 3IMAB 1JNQA 1BRKA 1UGHI 1OH0A 2BT3A 1O7HB 4KVHA 1UCLA 2W56A 2FNQA 4G1MB 4HOHA 1SIIA 4BIRA 5TGNA 3X40A 3DH2A 2F5MA 2HMLB 3G16A 4RNYA 3U97A 3N8BA 3NV0A 5KP3A 3RNTA 4STDA 1YIT3 1N9JA 3DGMA 2WOHA 1BSEA 5BVBA 5IG0A 1OHPA 1ISKA 2INXA 2PNCA 1CEWI 1V58A 1AVLA 1M1XB 1X1YA 2Z76A 1O7GB 3MSOA 1VQP3 1VQ53 3LT8A 4FMCA 1X1XA 2O9UX 1FGQA 4WWUC 2K0MA 1S5AA 2D1WA 3SOAA 2YFJB 3B8LA 3NM7A 2MC8A 3K0ZA 4LGQA 5CF1A 3HIGA 1UUGB 3LTBA 3MG1A 3JUPA 1Q7Y4 1GSPA 5CXOA 4HYZA 1OGZA 1Q864 3BU4A 2XRXB 1O7MB 2H0GA 2W6JH 1UCJA 2Z7AA 2CX0A 5LC6A 3GAXA 1WMOA 1UI7A 1EKMA 2HOHA 3DZLA 1UW1A 5IW9A 3S29A 5M1AA 3DGOA 3CU3A 3LXUX 1Y4KA 3WOEB 1AY7A 3X3XA 4HM3B 3STDA 2BNGA 1JRQA 5AEUB 1B2SA 4XDWA 3AHSA 1TJDA 2W0QA 3HOHA 1BSBA 3ZFZA 1IQ8A 1VZZA 3B4PA 6RNTA 1RKYA 1IVWA 1ZO2A 1OPYA 1BNFA 1ULJB 1ZS7A 1W7CA 4FCJA 4MMZB 1N8QA 5RNTA 4R9LA 5BIRA 1FA3A 4HVNA 1O7WB 2FXTA 5D82A 3UL5A 3OWYA 1UGIA 3HK4A 4XBXA 4AEQA 2CC3A 1LNHA 3F14A 5BU4A 1TRQA 1K41A 4FMAA 3LZAA 1O7NB 3VF1A 4TX4A 3JUMA 2QA43 2H0IA 4IIAA 1L5GB 3Q2PA 5AEWB 4IPBA 1UCIA 4QWTA 1RCKA 2F98A 5IG3A 1Q40A 2W56B 3ER7A 4L7KA 2KCDA 1BAOA 2CG0A 3ZG0A 3FSDA 1Q42A 4ORLA 4EC6A 1JKGA 2P09A 1D6ZA 4Q53A 5HGRA 2XH9A 2XFTA 3HI7A 3D5IA 3TDGA 2ML6A 2Z77A 2CG1A 4KFDA 1RGFA 4HAAA 1JN5B 1RGGA 1YVSA 1YJN3 1BSDA 3AGNA 7STDA 3JUOA 5GSPA 1LQMB 1GOYA 3V98A 1YGWA 3G8ZA 4I4KA 1FUTA 2LQVA 4LEHA 1X1WA 4KFEA 1LQGC 4BTXA 3NQZA 3WA3A 1IVXA 1U8CB 5I97A 5IG5A 2CFLA 3EBYA 4EV2A 4FMDA 3MKIA 3MWZA 1M904 1FZUA 1T3BA 3DGNA 3G713 2V1LA 2IUKA 3LTCA 1BIRA 4R4KA 2YFLB 1AVKA 3NBRA 4EBGA 1ZGXA 3I563 4HM5B 4KZ1A 3G0KA 1M1K4 1PY3A 4R9KA 1VQ83 3AHWA 1AR0A 3WHOA 1K734 1Q824 3L0RA 4X2HA 2OTL3 3V99A 3FF0A 3S5CA 3V92A 2P38A 3KN4A 4O3VA 2FGTA 3LT9A 3QK9A 3NHXA 1IT7A 1VQ93 1NB5I 5AIFA 4O02B 5BXQA 1I2EA 3BLZA 2UGIA 2WGQA 2CK3H 2IUJA 2Q07A 4CPKA 3SLUA 3FF2A 1JJ22 4JF8A 4N6V0 3EQQB 5AI1A 2B1XB 1ASKA 4DKIA 4FMBA 3BIRA 5AYRB 1QMAA 3HZPA 2C4BA 1DMMA 1C7HA 1MWTA 4J5GA 1JBSA 3U1WA 4ZM8A 3E99A 3KCHA 3Q3FA 4ILFA 5FW5A 5CF2A 3D5GA 1B27A 5FGOA 5JPPA 3KFQC 3SOYA 1CYVA 2Y73A 3I0YA 5M19A 6GSPA 2CH9A 1OF5A 3PCSA 1DVDA 1JN5A 1R4CA 1PU4A 1IQYA 2CFGA 1WMNA 1FUSA 3BNEA 5IEOA 3CC43 1Q40B 4HZBB 5KP4A 1BANA 3K7CA 2C10A 3NXJA 4OVMA 3LH4A 1YNVX 4HBRA 1BNEA 3SYUA 4N6MA 1JKGB 1UUVB 2XFSA 4BL3A 4CCVA 3UJMA 3WMDA 3FG3A 1RGEA 3GSPA 9RNTA 1UDII 1A2VA 4GL6A 1YIJ3 1JBTA 3CCS3 1IDPA 1QVF2 3IPTA 4HM7B 1RGKA 1EEJA 3DM8A 3MG3A 1UI8A 5CK6A 2Y74A 3DGLA 3OW22 2LYXA 4R1KA 5DRVA 2ZA4A 4LYLB 5A0OB 3KZTA 1LOXA 3CCU3 2P05A 3PYJA 4GHOA 2YFIB 5HOHA 1E3VA 1B20A 1YJ93 2OTJ3 1GYBA 2BMRB 3F8HA 1HYFA 1BUQA 1I2FA 1TTOA 2BIRA 4N3VA 5AIGA 1R4YA 5D81A 5D83A 5IG4A 3MHEA 1IK3A 2W9PA 3BB9A 2WGOA 2B24B 1B2ZA 1I3FA 4PEJA 4WFOA 1J2BA 1A2KA 3T8UA 1JV2B 5IERA 1DVCA 1RSNA 3FG4A 4BTWA 1T5YA 1GY6A 1W6CA 3AMOA 4K61A 5KP1A 3D9RA 1WQLB 1ROAA 3EN8A 1WNHA 2RFRA 1FUWA 1GOUA 1CH0A 4HJLB 3LTDA 3EHCA 2RGQA 2CX1A 1RN1A 2IA7A 1SJWA 1LOWA 1Q814 1W2ZA 2UX0A 3BNBA 3K63A 4HM1B 4GB5A 3OXAA 1FGRA 1N5PA 1NO3A 4N6TA 4O2HA 2XSHB 4BTYA 3X3YA 3F7SA 1FYSA 1QAFA 1B2MA 5JBSA 1RDSA 2K3DA 4U13A 2BMOB 2SBLA 2W04A 2HMOB 1N9EA 1V74A 2CKFB 2E2VA 2GU1A 2XGLA 3CMA3 2BHMA 1Z1SA 1RN4A 4K1VA 1ROVA 4BU4A 3KKGA 1OHOA 4FCZA 1EUIC 1YI23 2KF4A 1AQZA 1BRSA 4N6OB 1OF5B 3CPOA 4MMXB 3D79A 2HMNB 2BU4A 1RNBA 3CNXA 2UUGC 2D42A 1I0VA 8CHOA 3HX8A 1FGTA 3EX9A 4MJDA 1EG9B 3VSYA 1EQKA 2YX9A 2AAEA 1W2B2 5EVHA 3A76A 2E2TA 4HM6B 4LSOA 2CIUA 3PS8A 1W4NA 1TFKA 2KRTA 4RNZA 4WHAA 4CDLA 1D6UA 3ZG5A 1BOXA 1S723 2CW9A 4FR9A 2KXGA 3FH1A 1RRHA 1D6YA 1RGLA 2F56A 2GU3A 1I8VA 3CCE3 1VQ63 2WO0A 2L1SA 3H51A 1DMNA 4O8SA 1A67A 1MWRA 1WMPA 1JZOA 1LOVA 3EF8A 1FGOA 3CCJ3 1NNVA 3IJEB 3OWUA 4EV5A 1M9GA 2KF3A 1K28A 1IVVA 3GZRA 1QAKA 1RRLA 4J9AA 1RMSA 2QIYA 3NBJA 3X42A 1DETA 1NJI4 2RBIA 5G1LA 3I553 1KSIA 1LXEA 3ROBA 1SIHA 2BMQB 1KC84 4KT3B 1MGWA 3AMOB 2IMJA 4GSPA 1JZDA 1IYYA 3M8CA 4MEIA 2CFWA 3EB8A 4CJNA 1JB4A 3SX1A 2IY2A 4OK0A 5AIIA 3GZXB 4XM4A 3WR2A 8RNTA 1GD3A 1W5ZA 2XR8B 3Q1CA 1JB5A 4K90B 3X3ZA 3UNLA 1DE3A 2GBWB 1BGSA 2IYJA 3FGYA 3URPA 4H61A 4MMYB 1ZX2A 2ZDJA 5G2GA 3A5EA 1BNJA 2PZVA 1GMQA 4BL2A 2O3OA 3DY5A 2WOFA 2F99A 3KSED 3NBBA 1YHQ3 2Z6BA 1HZ1A 1NWWA 1WTHA 3K9MC 1I70A 1VQN3 4I5QA 3H3HA 2F5WA 3CCQ3 1TFOA 1PFPA 2KF5A 2SARA 1TIJA 2R41A 5EQLA 1LNIA 7RNTA 4OUQA 2GSPA 3KE7A 1SARA 3EE1A 1ULIB 3GZBA 1GS3A 5DREA 2QEX3 3G6E3 4RZMA 3ALAA 3VGNA 1BVIA 4HKVB 1NU3A 3JUNA 3RGRA 3NUVA 4EXRA 1OGXA 1W6YA 3KSPA 2GEYA 4L8PA 4XDVA 6STDA 3UL6A 3FG1A 2HMKB 1QVG2 3HIIA 1RN7A 1AV4A 2XEPA 2STDA 1VQO3 4NHFA 3AGOA 1KWIA 4LZIA 1BRJA 2OOVA 1B2XA 3DMCA 4JRFA 1YJW3 4XBYA 2GEXA 4HM8B 2K54A 5STDA 1VQ43 5IF6A 1C54A 1NB3I 2QGUA 1LOYA 4IT7A 2C11A 2JDIH 5ELJA 5IENA 3EC9A 1STDA 2KF6A 1CYUA 1RLSA 3O8YA 3BNCA 3PCRA 4R80A 1IV9A 3DGYA 3CD63 1B21A 2J8XB 1NDOB 1VQQA 2CWUA 1TUHA 3B4OA 1QALA 2AADA 4WYKB 2W2CA 2JQ5A 1JB2A 2CFDA 3PXMA 4HM2B 1BU4A 1T2IA 1HKXA 1W02A 1RGHA
chains in the Genus database with same CATH topology
1W00A 3UB1A 3EBTA 3S28A 1DYUA 1OHSA 2W03A 3NM2A 3X41A 3DUKA 1SPUA 3MYTA 4HZ9B 1VQ73 3GZYB 1FGMA 1OACA 3CCV3 3CCM3 3SEDA 1QJGA 3CCR3 1K8A4 1OUNA 3CME3 2HMMB 3LTAA 3F40A 3F9SA 4N6UA 2RCDA 1A90A 2GXFA 2CWVA 2ML5A 4NREA 5AIHA 2W9QA 5ELUA 3WOFB 1TP6A 3LYGA 1F8NA 4N6NB 1G96A 3NX0A 1K9M4 3FZWA 3K5TA 1TU5A 1W6GA 4H3UA 3CXC2 2OWPA 1OCVA 1IQXA 4XBTA 1U5OA 1GD4A 3BNDA 3JUQA 3MPHA 4HM0B 3T0UA 1IU7A 3KIIA 3OV4A 5AYSC 2XF3A 2A15A 2M7OA 5IEPA 3CC73 2XGNA 3RGAA 1MOLA 3WDGB 2CFKA 3OX9A 4KFFA 2P0MA 2E2UA 3EN1B 3WA2X 1STFI 3T8NA 3JVCA 3NQYA 3F7XA 3SVAA 4LMIA 3NV0B 3D3LA 4J8TA 1MNLA 1SQWA 4XB5A 4K1UA 1GY7A 3ECFA 4N6LA 3Q90A 2CHCA 1E97A 1IT8A 1E3RA 1VQM3 4WYKA 1CQSA 5EEOA 3PGBA 1US1A 3J7Yd 3FLJA 1N8R4 3OWSA 2P0XA 3CCL3 2OQEC 1O7PB 1VQK3 3CNMA 3F8XA 3EJVA 4RBNA 4EYCA 1KD14 3LOYA 2ZL8A 3GRDA 2L4VA 4AKZA 3PZWA 1YGEA 4HM4B 3DXOA 3S27A 1LVNA 4FCMA 1W01A 4WP5A 3FCSB 5CLKA 3N54B 3FKAA 4AKYA 1RJOA 3S67A 1N5HA 2XSOB 5JPUA 1UUWB 2RSXA 3N9HA 3GWRA 5LC7A 1IV7A 3SXXA 1YVBI 1KQS2 1GY5A 2OOVC 1DMQA 2OCTA 3B7CA 1VQL3 2MF7A 4L8OA 3WODG 3MG2A 3QRDA 1EA2A 2I9WA 2BO9B 4X2OA 2GBXB 2HMJB 2OQEA 3CC23 3LMLA 2F86B 1IVUA 3CPW2 3RDEA 2CWTA 1HU9A 2R4IA 3IMAB 1JNQA 1OH0A 2BT3A 1O7HB 4KVHA 2W56A 2FNQA 4G1MB 1SIIA 5TGNA 3X40A 3G16A 2HMLB 4RNYA 3U97A 3N8BA 3NV0A 5KP3A 4STDA 1YIT3 1N9JA 3DGMA 2WOHA 5BVBA 5IG0A 1OHPA 1ISKA 2INXA 2PNCA 1CEWI 1AVLA 1M1XB 2Z76A 1O7GB 3MSOA 1VQP3 1VQ53 3LT8A 4FMCA 2O9UX 1FGQA 4WWUC 2K0MA 1S5AA 2D1WA 3SOAA 2YFJB 3B8LA 3NM7A 2MC8A 3K0ZA 4LGQA 5CF1A 3HIGA 3LTBA 3MG1A 3JUPA 1Q7Y4 5CXOA 4HYZA 1OGZA 1Q864 2XRXB 1O7MB 2W6JH 2Z7AA 5LC6A 3GAXA 1WMOA 1UI7A 1EKMA 3DZLA 1UW1A 5IW9A 3S29A 3DGOA 3CU3A 3LXUX 1Y4KA 3WOEB 3X3XA 4HM3B 3STDA 2BNGA 1JRQA 5AEUB 4XDWA 2W0QA 1IQ8A 1VZZA 3B4PA 1RKYA 1IVWA 1ZO2A 1OPYA 1ULJB 1W7CA 4MMZB 4FCJA 1N8QA 4R9LA 1FA3A 4HVNA 1O7WB 2FXTA 5D82A 3UL5A 3OWYA 3HK4A 4XBXA 4AEQA 2CC3A 1LNHA 3F14A 1K41A 4FMAA 3LZAA 1O7NB 3VF1A 4TX4A 3JUMA 2QA43 4IIAA 1L5GB 3Q2PA 5AEWB 4IPBA 4QWTA 2F98A 5IG3A 1Q40A 2W56B 3ER7A 4L7KA 2KCDA 2CG0A 3FSDA 1Q42A 4ORLA 4EC6A 1JKGA 2P09A 1D6ZA 4Q53A 5HGRA 2XH9A 2XFTA 3HI7A 3TDGA 2ML6A 2Z77A 2CG1A 4KFDA 1JN5B 1YJN3 7STDA 3JUOA 3V98A 4I4KA 3G8ZA 2LQVA 4LEHA 4KFEA 4BTXA 3NQZA 3WA3A 1IVXA 1U8CB 5I97A 5IG5A 2CFLA 3EBYA 4EV2A 4FMDA 3MKIA 3MWZA 1M904 3DGNA 3G713 2V1LA 2IUKA 3LTCA 4R4KA 4EBGA 2YFLB 1AVKA 3NBRA 3I563 4HM5B 4KZ1A 3G0KA 1M1K4 4R9KA 1VQ83 1AR0A 1K734 1Q824 3L0RA 4X2HA 2OTL3 3V99A 3FF0A 3S5CA 3V92A 2P38A 3KN4A 4O3VA 2FGTA 3LT9A 3QK9A 3NHXA 1IT7A 1VQ93 1NB5I 5AIFA 4O02B 5BXQA 3BLZA 2WGQA 2CK3H 2IUJA 2Q07A 3SLUA 3FF2A 1JJ22 4JF8A 4N6V0 3EQQB 5AI1A 2B1XB 1ASKA 4FMBA 5AYRB 1QMAA 3HZPA 1DMMA 1C7HA 3U1WA 4ZM8A 3E99A 5FW5A 5CF2A 5JPPA 5FGOA 3KFQC 3SOYA 1CYVA 2Y73A 3I0YA 1DVDA 2CH9A 1OF5A 3PCSA 1JN5A 1R4CA 1PU4A 1IQYA 2CFGA 1WMNA 3BNEA 5IEOA 3CC43 1Q40B 4HZBB 5KP4A 3K7CA 2C10A 3NXJA 4OVMA 3LH4A 3G4S3 4HBRA 4N6MA 1JKGB 1UUVB 2XFSA 4CCVA 3UJMA 3WMDA 3FG3A 1A2VA 4GL6A 1YIJ3 3CCS3 1IDPA 1QVF2 3IPTA 4HM7B 3MG3A 3DM8A 1UI8A 5CK6A 2Y74A 3DGLA 3OW22 2LYXA 4R1KA 5DRVA 5A0OB 3KZTA 1LOXA 3CCU3 2P05A 3PYJA 2YFIB 1BUQA 1E3VA 1YJ93 2OTJ3 1GYBA 2BMRB 3F8HA 4N3VA 5AIGA 5D81A 5D83A 5IG4A 3MHEA 1IK3A 2W9PA 3BB9A 2WGOA 2B24B 4PEJA 1J2BA 4WFOA 1A2KA 3T8UA 1JV2B 5IERA 1DVCA 3FG4A 4BTWA 1T5YA 1GY6A 1W6CA 3AMOA 4K61A 5KP1A 3D9RA 1WQLB 1ROAA 3EN8A 1WNHA 2RFRA 1FUWA 4HJLB 3LTDA 3EHCA 2RGQA 2IA7A 1SJWA 1Q814 1W2ZA 2UX0A 3BNBA 3K63A 4HM1B 4GB5A 3OXAA 1FGRA 1N5PA 1NO3A 4N6TA 4O2HA 2XSHB 4BTYA 3X3YA 3F7SA 1QAFA 5JBSA 4U13A 2BMOB 2SBLA 2W04A 2HMOB 1N9EA 1V74A 2CKFB 2E2VA 2GU1A 2XGLA 3CMA3 2BHMA 1Z1SA 4K1VA 1ROVA 3KKGA 1OHOA 4FCZA 1YI23 4N6OB 1OF5B 3CPOA 4MMXB 2HMNB 3CNXA 2D42A 8CHOA 3HX8A 1FGTA 3EX9A 4MJDA 1EG9B 3VSYA 1EQKA 2YX9A 1W2B2 5EVHA 3A76A 2E2TA 4HM6B 4LSOA 2CIUA 3PS8A 1W4NA 1TFKA 2KRTA 4RNZA 4WHAA 4CDLA 1D6UA 1S723 2CW9A 4FR9A 2KXGA 3FH1A 1RRHA 1D6YA 1VQ63 2GU3A 3CCE3 2WO0A 3H51A 4O8SA 1DMNA 1A67A 1WMPA 3EF8A 1FGOA 3CCJ3 3IJEB 3OWUA 4EV5A 1M9GA 1K28A 1IVVA 3GZRA 1QAKA 1RRLA 4J9AA 2QIYA 3NBJA 3X42A 1NJI4 3I553 1KSIA 1LXEA 3ROBA 1SIHA 2BMQB 1KC84 3AMOB 2IMJA 3M8CA 4MEIA 2CFWA 3EB8A 1JB4A 3SX1A 4OK0A 5AIIA 3GZXB 4XM4A 1GD3A 1W5ZA 2XR8B 3Q1CA 1JB5A 4K90B 3X3ZA 3UNLA 2GBWB 3FGYA 4H61A 4MMYB 1ZX2A 2ZDJA 5G2GA 2PZVA 2O3OA 3DY5A 2WOFA 2F99A 3KSED 3NBBA 1YHQ3 2Z6BA 1NWWA 1WTHA 3K9MC 1VQN3 3H3HA 3CCQ3 1TFOA 1PFPA 1TIJA 5EQLA 4OUQA 3KE7A 3EE1A 1ULIB 3GZBA 1GS3A 5DREA 2QEX3 3G6E3 4RZMA 3ALAA 3VGNA 4HKVB 1NU3A 3JUNA 3RGRA 3NUVA 4EXRA 1OGXA 1W6YA 3KSPA 2GEYA 4L8PA 4XDVA 6STDA 3UL6A 3FG1A 2HMKB 1QVG2 3HIIA 1RN7A 1AV4A 2XEPA 2STDA 1VQO3 4NHFA 1KWIA 4LZIA 1YJW3 2OOVA 3DMCA 4JRFA 4XBYA 2GEXA 4HM8B 2K54A 5STDA 1VQ43 5IF6A 1NB3I 2QGUA 4IT7A 2C11A 2JDIH 5ELJA 5IENA 3EC9A 1STDA 1CYUA 3O8YA 3BNCA 3PCRA 4R80A 1IV9A 3CD63 1NDOB 2CWUA 3B4OA 1TUHA 1QALA 4WYKB 2W2CA 2JQ5A 1JB2A 2CFDA 3PXMA 4HM2B 1HKXA 1W02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W00 A;  3EBT A;  1OHS A;  3NM2 A;  3DUK A;  3MYT A;  4HZ9 B;  3GZY B;  3SED A;  1QJG A;  1OUN A;  2HMM B;  3F40 A;  3F9S A;  2RCD A;  2GXF A;  5AIH A;  1TP6 A;  3LYG A;  3FZW A;  4H3U A;  2OWP A;  1OCV A;  4XBT A;  1U5O A;  3JUQ A;  4HM0 B;  3OV4 A;  2A15 A;  5IEP A;  3RGA A;  3OX9 A;  3EN1 B;  3T8N A;  3F7X A;  4LMI A;  3NV0 B;  4J8T A;  4XB5 A;  4K1U A;  1GY7 A;  3ECF A;  3Q90 A;  2CHC A;  1E97 A;  1E3R A;  4WYK A;  1CQS A;  3FLJ A;  3OWS A;  1O7P B;  3CNM A;  3F8X A;  3EJV A;  3GRD A;  4HM4 B;  3DXO A;  4FCM A;  1W01 A;  4WP5 A;  5CLK A;  3FKA A;  2XSO B;  5JPU A;  1UUW B;  3GWR A;  1GY5 A;  1DMQ A;  3B7C A;  4L8O A;  3MG2 A;  1EA2 A;  2I9W A;  4X2O A;  2GBX B;  2HMJ B;  2F86 B;  2R4I A;  1OH0 A;  1O7H B;  4KVH A;  5TGN A;  3G16 A;  2HML B;  5KP3 A;  3NV0 A;  4STD A;  5BVB A;  5IG0 A;  1OHP A;  1ISK A;  2INX A;  2Z76 A;  1O7G B;  3MSO A;  4WWU C;  1S5A A;  3SOA A;  2YFJ B;  3B8L A;  3K0Z A;  4LGQ A;  5CF1 A;  3MG1 A;  3JUP A;  5CXO A;  1OGZ A;  2XRX B;  1O7M B;  2Z7A A;  3DZL A;  3CU3 A;  4HM3 B;  3STD A;  2BNG A;  5AEU B;  4XDW A;  1VZZ A;  3B4P A;  1ZO2 A;  1OPY A;  1ULJ B;  4FCJ A;  4R9L A;  4HVN A;  1O7W B;  5D82 A;  3OWY A;  3HK4 A;  4XBX A;  3F14 A;  1K41 A;  3LZA A;  1O7N B;  3JUM A;  4IIA A;  5AEW B;  2F98 A;  5IG3 A;  1Q40 A;  3ER7 A;  4L7K A;  3FSD A;  1Q42 A;  4ORL A;  1JKG A;  5HGR A;  4Q53 A;  2Z77 A;  1JN5 B;  7STD A;  3JUO A;  4I4K A;  3G8Z A;  4LEH A;  5IG5 A;  3EBY A;  3MKI A;  2YFL B;  3NBR A;  4HM5 B;  3G0K A;  4R9K A;  1AR0 A;  4X2H A;  3FF0 A;  3S5C A;  3NHX A;  5AIF A;  5BXQ A;  3BLZ A;  3FF2 A;  3EQQ B;  5AI1 A;  2B1X B;  1ASK A;  1QMA A;  3HZP A;  1DMM A;  1C7H A;  3E99 A;  5FW5 A;  5CF2 A;  5JPP A;  3SOY A;  3I0Y A;  1OF5 A;  1JN5 A;  5IEO A;  1Q40 B;  4HZB B;  5KP4 A;  3K7C A;  3NXJ A;  4OVM A;  1JKG B;  1UUV B;  3UJM A;  3WMD A;  1IDP A;  3IPT A;  4HM7 B;  3MG3 A;  3DM8 A;  5CK6 A;  4R1K A;  5DRV A;  3KZT A;  2YFI B;  1BUQ A;  1E3V A;  1GYB A;  2BMR B;  3F8H A;  4N3V A;  5AIG A;  5D81 A;  5D83 A;  5IG4 A;  3MHE A;  3BB9 A;  2B24 B;  4PEJ A;  1A2K A;  3T8U A;  5IER A;  1GY6 A;  5KP1 A;  3D9R A;  1WQL B;  3EN8 A;  2RFR A;  4HJL B;  3EHC A;  2RGQ A;  1SJW A;  2UX0 A;  4HM1 B;  4GB5 A;  3OXA A;  2XSH B;  3F7S A;  4U13 A;  2BMO B;  2HMO B;  2CKF B;  1Z1S A;  4K1V A;  3KKG A;  1OHO A;  1OF5 B;  3CPO A;  2HMN B;  3CNX A;  8CHO A;  3HX8 A;  3EX9 A;  4MJD A;  1EG9 B;  3VSY A;  5EVH A;  3A76 A;  4HM6 B;  4CDL A;  3FH1 A;  3H51 A;  1DMN A;  3EF8 A;  3OWU A;  3GZR A;  4J9A A;  2QIY A;  3ROB A;  2BMQ B;  2IMJ A;  3M8C A;  1JB4 A;  5AII A;  3GZX B;  4XM4 A;  2XR8 B;  1JB5 A;  3UNL A;  2GBW B;  3FGY A;  1ZX2 A;  5G2G A;  2PZV A;  2F99 A;  1NWW A;  3H3H A;  4OUQ A;  3KE7 A;  1ULI B;  3GZB A;  1GS3 A;  5DRE A;  4RZM A;  3VGN A;  4HKV B;  1NU3 A;  3JUN A;  3RGR A;  3NUV A;  1OGX A;  1W6Y A;  3KSP A;  2GEY A;  4L8P A;  4XDV A;  6STD A;  2HMK B;  2STD A;  3DMC A;  4XBY A;  2GEX A;  4HM8 B;  2K54 A;  5STD A;  5IF6 A;  2QGU A;  5IEN A;  3EC9 A;  1STD A;  1NDO B;  3B4O A;  1TUH A;  4WYK B;  2W2C A;  2JQ5 A;  1JB2 A;  4HM2 B;  1HKX A;  1W02 A; 
#chains in the Genus database with same CATH topology
 1W00 A;  1BRH A;  1RNT A;  1MWS A;  3UB1 A;  3EBT A;  3S28 A;  1DYU A;  1OHS A;  2W03 A;  3NM2 A;  3X41 A;  3DUK A;  1SPU A;  3MYT A;  4HZ9 B;  1V57 A;  1VQ7 3;  3GZY B;  1FGM A;  1RCL A;  1RGC A;  1LRA A;  1OAC A;  3CCV 3;  3CCM 3;  3SED A;  1QJG A;  3CCR 3;  1K8A 4;  1OUN A;  3CME 3;  2HMM B;  3LTA A;  3F40 A;  1BNG A;  3F9S A;  4N6U A;  2RCD A;  1A90 A;  2GXF A;  2CWV A;  2ML5 A;  4NRE A;  5AIH A;  2W9Q A;  5ELU A;  3WOF B;  1TP6 A;  3LYG A;  1F8N A;  2RNT A;  4N6N B;  1G96 A;  3NX0 A;  1K9M 4;  3FZW A;  3K5T A;  1MGR A;  1W6G A;  4H3U A;  5G1K A;  1TU5 A;  3CXC 2;  2OWP A;  1OCV A;  1IQX A;  1T2H A;  4XBT A;  1U5O A;  1GMP A;  1GD4 A;  3BND A;  3JUQ A;  3MPH A;  4HM0 B;  3T0U A;  1IU7 A;  1BNR A;  5M18 A;  3KII A;  3OV4 A;  5AYS C;  2XF3 A;  4J5K A;  1B3S A;  1G02 A;  2A15 A;  2M7O A;  5IEP A;  3CC7 3;  2XGN A;  1I0X A;  3RGA A;  1BRI A;  1MOL A;  3WDG B;  1GOV A;  2CFK A;  3OX9 A;  1TRP A;  4KFF A;  2P0M A;  2E2U A;  3EN1 B;  1RTU A;  3WA2 X;  1STF I;  3T8N A;  3JVC A;  3NQY A;  3F7X A;  3SVA A;  4LMI A;  3NV0 B;  3D3L A;  1FW7 A;  3G4S 3;  1BUJ A;  4J8T A;  1MNL A;  1SQW A;  1RGA A;  4XB5 A;  4K1U A;  1BNS A;  1GY7 A;  3ECF A;  4N6L A;  3Q90 A;  1X1U A;  2CHC A;  1E97 A;  1IT8 A;  1E3R A;  1VQM 3;  4WYK A;  1CQS A;  5EEO A;  2F4Y A;  3PGB A;  1US1 A;  1RHL A;  1I2G A;  3FLJ A;  3J7Y d;  4EW5 A;  3OWS A;  1N8R 4;  1BRN L;  4NPB A;  1BNI A;  2P0X A;  1JBR A;  3CCL 3;  2OQE C;  1O7P B;  4RNT A;  1VQK 3;  3CNM A;  3F8X A;  3EJV A;  4RBN A;  4EYC A;  1KD1 4;  3LOY A;  2ZL8 A;  3GRD A;  1UCK A;  1BSA A;  1G0T A;  2H0H A;  2L4V A;  2ZHX B;  4AKZ A;  3PZW A;  1YGE A;  1Q9E A;  4HM4 B;  3DXO A;  1GMR A;  3S27 A;  1LVN A;  4FCM A;  1I3I A;  1W01 A;  4WP5 A;  3FCS B;  5CLK A;  3N54 B;  3FKA A;  4AKY A;  1RJO A;  3S67 A;  1N5H A;  2XSO B;  5JPU A;  1Q7H A;  1UUW B;  2RSX A;  3N9H A;  3D4A A;  1B2U A;  3GWR A;  1IV7 A;  5LC7 A;  3SXX A;  1MWU A;  1YVB I;  1A2P A;  1KQS 2;  1GY5 A;  2OOV C;  1DMQ A;  2OCT A;  3B7C A;  1BSC A;  2KAA A;  2MF7 A;  4L8O A;  3MG2 A;  3WOD G;  7GSP A;  1VQL 3;  3QRD A;  1EA2 A;  2I9W A;  2BO9 B;  4X2O A;  2GBX B;  2HMJ B;  1BRG A;  2OQE A;  3CC2 3;  3LML A;  2F86 B;  1IVU A;  3CPW 2;  1PYL A;  3RDE A;  2CWT A;  1HU9 A;  2R4I A;  3IMA B;  1JNQ A;  1BRK A;  1UGH I;  1OH0 A;  2BT3 A;  1O7H B;  4KVH A;  1UCL A;  2W56 A;  2FNQ A;  4G1M B;  4HOH A;  1SII A;  4BIR A;  5TGN A;  3X40 A;  3DH2 A;  2F5M A;  2HML B;  3G16 A;  4RNY A;  3U97 A;  3N8B A;  3NV0 A;  5KP3 A;  3RNT A;  4STD A;  1YIT 3;  1N9J A;  3DGM A;  2WOH A;  1BSE A;  5BVB A;  5IG0 A;  1OHP A;  1ISK A;  2INX A;  2PNC A;  1CEW I;  1V58 A;  1AVL A;  1M1X B;  1X1Y A;  2Z76 A;  1O7G B;  3MSO A;  1VQP 3;  1VQ5 3;  3LT8 A;  4FMC A;  1X1X A;  2O9U X;  1FGQ A;  4WWU C;  2K0M A;  1S5A A;  2D1W A;  3SOA A;  2YFJ B;  3B8L A;  3NM7 A;  2MC8 A;  3K0Z A;  4LGQ A;  5CF1 A;  3HIG A;  1UUG B;  3LTB A;  3MG1 A;  3JUP A;  1Q7Y 4;  1GSP A;  5CXO A;  4HYZ A;  1OGZ A;  1Q86 4;  3BU4 A;  2XRX B;  1O7M B;  2H0G A;  2W6J H;  1UCJ A;  2Z7A A;  2CX0 A;  5LC6 A;  3GAX A;  1WMO A;  1UI7 A;  1EKM A;  2HOH A;  3DZL A;  1UW1 A;  5IW9 A;  3S29 A;  5M1A A;  3DGO A;  3CU3 A;  3LXU X;  1Y4K A;  3WOE B;  1AY7 A;  3X3X A;  4HM3 B;  3STD A;  2BNG A;  1JRQ A;  5AEU B;  1B2S A;  4XDW A;  3AHS A;  1TJD A;  2W0Q A;  3HOH A;  1BSB A;  3ZFZ A;  1IQ8 A;  1VZZ A;  3B4P A;  6RNT A;  1RKY A;  1IVW A;  1ZO2 A;  1OPY A;  1BNF A;  1ULJ B;  1ZS7 A;  1W7C A;  4FCJ A;  4MMZ B;  1N8Q A;  5RNT A;  4R9L A;  5BIR A;  1FA3 A;  4HVN A;  1O7W B;  2FXT A;  5D82 A;  3UL5 A;  3OWY A;  1UGI A;  3HK4 A;  4XBX A;  4AEQ A;  2CC3 A;  1LNH A;  3F14 A;  5BU4 A;  1TRQ A;  1K41 A;  4FMA A;  3LZA A;  1O7N B;  3VF1 A;  4TX4 A;  3JUM A;  2QA4 3;  2H0I A;  4IIA A;  1L5G B;  3Q2P A;  5AEW B;  4IPB A;  1UCI A;  4QWT A;  1RCK A;  2F98 A;  5IG3 A;  1Q40 A;  2W56 B;  3ER7 A;  4L7K A;  2KCD A;  1BAO A;  2CG0 A;  3ZG0 A;  3FSD A;  1Q42 A;  4ORL A;  4EC6 A;  1JKG A;  2P09 A;  1D6Z A;  4Q53 A;  5HGR A;  2XH9 A;  2XFT A;  3HI7 A;  3D5I A;  3TDG A;  2ML6 A;  2Z77 A;  2CG1 A;  4KFD A;  1RGF A;  4HAA A;  1JN5 B;  1RGG A;  1YVS A;  1YJN 3;  1BSD A;  3AGN A;  7STD A;  3JUO A;  5GSP A;  1LQM B;  1GOY A;  3V98 A;  1YGW A;  3G8Z A;  4I4K A;  1FUT A;  2LQV A;  4LEH A;  1X1W A;  4KFE A;  1LQG C;  4BTX A;  3NQZ A;  3WA3 A;  1IVX A;  1U8C B;  5I97 A;  5IG5 A;  2CFL A;  3EBY A;  4EV2 A;  4FMD A;  3MKI A;  3MWZ A;  1M90 4;  1FZU A;  1T3B A;  3DGN A;  3G71 3;  2V1L A;  2IUK A;  3LTC A;  1BIR A;  4R4K A;  2YFL B;  1AVK A;  3NBR A;  4EBG A;  1ZGX A;  3I56 3;  4HM5 B;  4KZ1 A;  3G0K A;  1M1K 4;  1PY3 A;  4R9K A;  1VQ8 3;  3AHW A;  1AR0 A;  3WHO A;  1K73 4;  1Q82 4;  3L0R A;  4X2H A;  2OTL 3;  3V99 A;  3FF0 A;  3S5C A;  3V92 A;  2P38 A;  3KN4 A;  4O3V A;  2FGT A;  3LT9 A;  3QK9 A;  3NHX A;  1IT7 A;  1VQ9 3;  1NB5 I;  5AIF A;  4O02 B;  5BXQ A;  1I2E A;  3BLZ A;  2UGI A;  2WGQ A;  2CK3 H;  2IUJ A;  2Q07 A;  4CPK A;  3SLU A;  3FF2 A;  1JJ2 2;  4JF8 A;  4N6V 0;  3EQQ B;  5AI1 A;  2B1X B;  1ASK A;  4DKI A;  4FMB A;  3BIR A;  5AYR B;  1QMA A;  3HZP A;  2C4B A;  1DMM A;  1C7H A;  1MWT A;  4J5G A;  1JBS A;  3U1W A;  4ZM8 A;  3E99 A;  3KCH A;  3Q3F A;  4ILF A;  5FW5 A;  5CF2 A;  3D5G A;  1B27 A;  5FGO A;  5JPP A;  3KFQ C;  3SOY A;  1CYV A;  2Y73 A;  3I0Y A;  5M19 A;  6GSP A;  2CH9 A;  1OF5 A;  3PCS A;  1DVD A;  1JN5 A;  1R4C A;  1PU4 A;  1IQY A;  2CFG A;  1WMN A;  1FUS A;  3BNE A;  5IEO A;  3CC4 3;  1Q40 B;  4HZB B;  5KP4 A;  1BAN A;  3K7C A;  2C10 A;  3NXJ A;  4OVM A;  3LH4 A;  1YNV X;  4HBR A;  1BNE A;  3SYU A;  4N6M A;  1JKG B;  1UUV B;  2XFS A;  4BL3 A;  4CCV A;  3UJM A;  3WMD A;  3FG3 A;  1RGE A;  3GSP A;  9RNT A;  1UDI I;  1A2V A;  4GL6 A;  1YIJ 3;  1JBT A;  3CCS 3;  1IDP A;  1QVF 2;  3IPT A;  4HM7 B;  1RGK A;  1EEJ A;  3DM8 A;  3MG3 A;  1UI8 A;  5CK6 A;  2Y74 A;  3DGL A;  3OW2 2;  2LYX A;  4R1K A;  5DRV A;  2ZA4 A;  4LYL B;  5A0O B;  3KZT A;  1LOX A;  3CCU 3;  2P05 A;  3PYJ A;  4GHO A;  2YFI B;  5HOH A;  1E3V A;  1B20 A;  1YJ9 3;  2OTJ 3;  1GYB A;  2BMR B;  3F8H A;  1HYF A;  1BUQ A;  1I2F A;  1TTO A;  2BIR A;  4N3V A;  5AIG A;  1R4Y A;  5D81 A;  5D83 A;  5IG4 A;  3MHE A;  1IK3 A;  2W9P A;  3BB9 A;  2WGO A;  2B24 B;  1B2Z A;  1I3F A;  4PEJ A;  4WFO A;  1J2B A;  1A2K A;  3T8U A;  1JV2 B;  5IER A;  1DVC A;  1RSN A;  3FG4 A;  4BTW A;  1T5Y A;  1GY6 A;  1W6C A;  3AMO A;  4K61 A;  5KP1 A;  3D9R A;  1WQL B;  1ROA A;  3EN8 A;  1WNH A;  2RFR A;  1FUW A;  1GOU A;  1CH0 A;  4HJL B;  3LTD A;  3EHC A;  2RGQ A;  2CX1 A;  1RN1 A;  2IA7 A;  1SJW A;  1LOW A;  1Q81 4;  1W2Z A;  2UX0 A;  3BNB A;  3K63 A;  4HM1 B;  4GB5 A;  3OXA A;  1FGR A;  1N5P A;  1NO3 A;  4N6T A;  4O2H A;  2XSH B;  4BTY A;  3X3Y A;  3F7S A;  1FYS A;  1QAF A;  1B2M A;  5JBS A;  1RDS A;  2K3D A;  4U13 A;  2BMO B;  2SBL A;  2W04 A;  2HMO B;  1N9E A;  1V74 A;  2CKF B;  2E2V A;  2GU1 A;  2XGL A;  3CMA 3;  2BHM A;  1Z1S A;  1RN4 A;  4K1V A;  1ROV A;  4BU4 A;  3KKG A;  1OHO A;  4FCZ A;  1EUI C;  1YI2 3;  2KF4 A;  1AQZ A;  1BRS A;  4N6O B;  1OF5 B;  3CPO A;  4MMX B;  3D79 A;  2HMN B;  2BU4 A;  1RNB A;  3CNX A;  2UUG C;  2D42 A;  1I0V A;  8CHO A;  3HX8 A;  1FGT A;  3EX9 A;  4MJD A;  1EG9 B;  3VSY A;  1EQK A;  2YX9 A;  2AAE A;  1W2B 2;  5EVH A;  3A76 A;  2E2T A;  4HM6 B;  4LSO A;  2CIU A;  3PS8 A;  1W4N A;  1TFK A;  2KRT A;  4RNZ A;  4WHA A;  4CDL A;  1D6U A;  3ZG5 A;  1BOX A;  1S72 3;  2CW9 A;  4FR9 A;  2KXG A;  3FH1 A;  1RRH A;  1D6Y A;  1RGL A;  2F56 A;  2GU3 A;  1I8V A;  3CCE 3;  1VQ6 3;  2WO0 A;  2L1S A;  3H51 A;  1DMN A;  4O8S A;  1A67 A;  1MWR A;  1WMP A;  1JZO A;  1LOV A;  3EF8 A;  1FGO A;  3CCJ 3;  1NNV A;  3IJE B;  3OWU A;  4EV5 A;  1M9G A;  2KF3 A;  1K28 A;  1IVV A;  3GZR A;  1QAK A;  1RRL A;  4J9A A;  1RMS A;  2QIY A;  3NBJ A;  3X42 A;  1DET A;  1NJI 4;  2RBI A;  5G1L A;  3I55 3;  1KSI A;  1LXE A;  3ROB A;  1SIH A;  2BMQ B;  1KC8 4;  4KT3 B;  1MGW A;  3AMO B;  2IMJ A;  4GSP A;  1JZD A;  1IYY A;  3M8C A;  4MEI A;  2CFW A;  3EB8 A;  4CJN A;  1JB4 A;  3SX1 A;  2IY2 A;  4OK0 A;  5AII A;  3GZX B;  4XM4 A;  3WR2 A;  8RNT A;  1GD3 A;  1W5Z A;  2XR8 B;  3Q1C A;  1JB5 A;  4K90 B;  3X3Z A;  3UNL A;  1DE3 A;  2GBW B;  1BGS A;  2IYJ A;  3FGY A;  3URP A;  4H61 A;  4MMY B;  1ZX2 A;  2ZDJ A;  5G2G A;  3A5E A;  1BNJ A;  2PZV A;  1GMQ A;  4BL2 A;  2O3O A;  3DY5 A;  2WOF A;  2F99 A;  3KSE D;  3NBB A;  1YHQ 3;  2Z6B A;  1HZ1 A;  1NWW A;  1WTH A;  3K9M C;  1I70 A;  1VQN 3;  4I5Q A;  3H3H A;  2F5W A;  3CCQ 3;  1TFO A;  1PFP A;  2KF5 A;  2SAR A;  1TIJ A;  2R41 A;  5EQL A;  1LNI A;  7RNT A;  4OUQ A;  2GSP A;  3KE7 A;  1SAR A;  3EE1 A;  1ULI B;  3GZB A;  1GS3 A;  5DRE A;  2QEX 3;  3G6E 3;  4RZM A;  3ALA A;  3VGN A;  1BVI A;  4HKV B;  1NU3 A;  3JUN A;  3RGR A;  3NUV A;  4EXR A;  1OGX A;  1W6Y A;  3KSP A;  2GEY A;  4L8P A;  4XDV A;  6STD A;  3UL6 A;  3FG1 A;  2HMK B;  1QVG 2;  3HII A;  1RN7 A;  1AV4 A;  2XEP A;  2STD A;  1VQO 3;  4NHF A;  3AGO A;  1KWI A;  4LZI A;  1BRJ A;  2OOV A;  1B2X A;  3DMC A;  4JRF A;  1YJW 3;  4XBY A;  2GEX A;  4HM8 B;  2K54 A;  5STD A;  1VQ4 3;  5IF6 A;  1C54 A;  1NB3 I;  2QGU A;  1LOY A;  4IT7 A;  2C11 A;  2JDI H;  5ELJ A;  5IEN A;  3EC9 A;  1STD A;  2KF6 A;  1CYU A;  1RLS A;  3O8Y A;  3BNC A;  3PCR A;  4R80 A;  1IV9 A;  3DGY A;  3CD6 3;  1B21 A;  2J8X B;  1NDO B;  1VQQ A;  2CWU A;  1TUH A;  3B4O A;  1QAL A;  2AAD A;  4WYK B;  2W2C A;  2JQ5 A;  1JB2 A;  2CFD A;  3PXM A;  4HM2 B;  1BU4 A;  1T2I A;  1HKX A;  1W02 A;  1RGH A; 
#chains in the Genus database with same CATH homology
 1W00 A;  3UB1 A;  3EBT A;  3S28 A;  1DYU A;  1OHS A;  2W03 A;  3NM2 A;  3X41 A;  3DUK A;  1SPU A;  3MYT A;  4HZ9 B;  1VQ7 3;  3GZY B;  1FGM A;  1OAC A;  3CCV 3;  3CCM 3;  3SED A;  1QJG A;  3CCR 3;  1K8A 4;  1OUN A;  3CME 3;  2HMM B;  3LTA A;  3F40 A;  3F9S A;  4N6U A;  2RCD A;  1A90 A;  2GXF A;  2CWV A;  2ML5 A;  4NRE A;  5AIH A;  2W9Q A;  5ELU A;  3WOF B;  1TP6 A;  3LYG A;  1F8N A;  4N6N B;  1G96 A;  3NX0 A;  1K9M 4;  3FZW A;  3K5T A;  1TU5 A;  1W6G A;  4H3U A;  3CXC 2;  2OWP A;  1OCV A;  1IQX A;  4XBT A;  1U5O A;  1GD4 A;  3BND A;  3JUQ A;  3MPH A;  4HM0 B;  3T0U A;  1IU7 A;  3KII A;  3OV4 A;  5AYS C;  2XF3 A;  2A15 A;  2M7O A;  5IEP A;  3CC7 3;  2XGN A;  3RGA A;  1MOL A;  3WDG B;  2CFK A;  3OX9 A;  4KFF A;  2P0M A;  2E2U A;  3EN1 B;  3WA2 X;  1STF I;  3T8N A;  3JVC A;  3NQY A;  3F7X A;  3SVA A;  4LMI A;  3NV0 B;  3D3L A;  4J8T A;  1MNL A;  1SQW A;  4XB5 A;  4K1U A;  1GY7 A;  3ECF A;  4N6L A;  3Q90 A;  2CHC A;  1E97 A;  1IT8 A;  1E3R A;  1VQM 3;  4WYK A;  1CQS A;  5EEO A;  3PGB A;  1US1 A;  3J7Y d;  3FLJ A;  1N8R 4;  3OWS A;  2P0X A;  3CCL 3;  2OQE C;  1O7P B;  1VQK 3;  3CNM A;  3F8X A;  3EJV A;  4RBN A;  4EYC A;  1KD1 4;  3LOY A;  2ZL8 A;  3GRD A;  2L4V A;  4AKZ A;  3PZW A;  1YGE A;  4HM4 B;  3DXO A;  3S27 A;  1LVN A;  4FCM A;  1W01 A;  4WP5 A;  3FCS B;  5CLK A;  3N54 B;  3FKA A;  4AKY A;  1RJO A;  3S67 A;  1N5H A;  2XSO B;  5JPU A;  1UUW B;  2RSX A;  3N9H A;  3GWR A;  5LC7 A;  1IV7 A;  3SXX A;  1YVB I;  1KQS 2;  1GY5 A;  2OOV C;  1DMQ A;  2OCT A;  3B7C A;  1VQL 3;  2MF7 A;  4L8O A;  3WOD G;  3MG2 A;  3QRD A;  1EA2 A;  2I9W A;  2BO9 B;  4X2O A;  2GBX B;  2HMJ B;  2OQE A;  3CC2 3;  3LML A;  2F86 B;  1IVU A;  3CPW 2;  3RDE A;  2CWT A;  1HU9 A;  2R4I A;  3IMA B;  1JNQ A;  1OH0 A;  2BT3 A;  1O7H B;  4KVH A;  2W56 A;  2FNQ A;  4G1M B;  1SII A;  5TGN A;  3X40 A;  3G16 A;  2HML B;  4RNY A;  3U97 A;  3N8B A;  3NV0 A;  5KP3 A;  4STD A;  1YIT 3;  1N9J A;  3DGM A;  2WOH A;  5BVB A;  5IG0 A;  1OHP A;  1ISK A;  2INX A;  2PNC A;  1CEW I;  1AVL A;  1M1X B;  2Z76 A;  1O7G B;  3MSO A;  1VQP 3;  1VQ5 3;  3LT8 A;  4FMC A;  2O9U X;  1FGQ A;  4WWU C;  2K0M A;  1S5A A;  2D1W A;  3SOA A;  2YFJ B;  3B8L A;  3NM7 A;  2MC8 A;  3K0Z A;  4LGQ A;  5CF1 A;  3HIG A;  3LTB A;  3MG1 A;  3JUP A;  1Q7Y 4;  5CXO A;  4HYZ A;  1OGZ A;  1Q86 4;  2XRX B;  1O7M B;  2W6J H;  2Z7A A;  5LC6 A;  3GAX A;  1WMO A;  1UI7 A;  1EKM A;  3DZL A;  1UW1 A;  5IW9 A;  3S29 A;  3DGO A;  3CU3 A;  3LXU X;  1Y4K A;  3WOE B;  3X3X A;  4HM3 B;  3STD A;  2BNG A;  1JRQ A;  5AEU B;  4XDW A;  2W0Q A;  1IQ8 A;  1VZZ A;  3B4P A;  1RKY A;  1IVW A;  1ZO2 A;  1OPY A;  1ULJ B;  1W7C A;  4MMZ B;  4FCJ A;  1N8Q A;  4R9L A;  1FA3 A;  4HVN A;  1O7W B;  2FXT A;  5D82 A;  3UL5 A;  3OWY A;  3HK4 A;  4XBX A;  4AEQ A;  2CC3 A;  1LNH A;  3F14 A;  1K41 A;  4FMA A;  3LZA A;  1O7N B;  3VF1 A;  4TX4 A;  3JUM A;  2QA4 3;  4IIA A;  1L5G B;  3Q2P A;  5AEW B;  4IPB A;  4QWT A;  2F98 A;  5IG3 A;  1Q40 A;  2W56 B;  3ER7 A;  4L7K A;  2KCD A;  2CG0 A;  3FSD A;  1Q42 A;  4ORL A;  4EC6 A;  1JKG A;  2P09 A;  1D6Z A;  4Q53 A;  5HGR A;  2XH9 A;  2XFT A;  3HI7 A;  3TDG A;  2ML6 A;  2Z77 A;  2CG1 A;  4KFD A;  1JN5 B;  1YJN 3;  7STD A;  3JUO A;  3V98 A;  4I4K A;  3G8Z A;  2LQV A;  4LEH A;  4KFE A;  4BTX A;  3NQZ A;  3WA3 A;  1IVX A;  1U8C B;  5I97 A;  5IG5 A;  2CFL A;  3EBY A;  4EV2 A;  4FMD A;  3MKI A;  3MWZ A;  1M90 4;  3DGN A;  3G71 3;  2V1L A;  2IUK A;  3LTC A;  4R4K A;  4EBG A;  2YFL B;  1AVK A;  3NBR A;  3I56 3;  4HM5 B;  4KZ1 A;  3G0K A;  1M1K 4;  4R9K A;  1VQ8 3;  1AR0 A;  1K73 4;  1Q82 4;  3L0R A;  4X2H A;  2OTL 3;  3V99 A;  3FF0 A;  3S5C A;  3V92 A;  2P38 A;  3KN4 A;  4O3V A;  2FGT A;  3LT9 A;  3QK9 A;  3NHX A;  1IT7 A;  1VQ9 3;  1NB5 I;  5AIF A;  4O02 B;  5BXQ A;  3BLZ A;  2WGQ A;  2CK3 H;  2IUJ A;  2Q07 A;  3SLU A;  3FF2 A;  1JJ2 2;  4JF8 A;  4N6V 0;  3EQQ B;  5AI1 A;  2B1X B;  1ASK A;  4FMB A;  5AYR B;  1QMA A;  3HZP A;  1DMM A;  1C7H A;  3U1W A;  4ZM8 A;  3E99 A;  5FW5 A;  5CF2 A;  5JPP A;  5FGO A;  3KFQ C;  3SOY A;  1CYV A;  2Y73 A;  3I0Y A;  1DVD A;  2CH9 A;  1OF5 A;  3PCS A;  1JN5 A;  1R4C A;  1PU4 A;  1IQY A;  2CFG A;  1WMN A;  3BNE A;  5IEO A;  3CC4 3;  1Q40 B;  4HZB B;  5KP4 A;  3K7C A;  2C10 A;  3NXJ A;  4OVM A;  3LH4 A;  3G4S 3;  4HBR A;  4N6M A;  1JKG B;  1UUV B;  2XFS A;  4CCV A;  3UJM A;  3WMD A;  3FG3 A;  1A2V A;  4GL6 A;  1YIJ 3;  3CCS 3;  1IDP A;  1QVF 2;  3IPT A;  4HM7 B;  3MG3 A;  3DM8 A;  1UI8 A;  5CK6 A;  2Y74 A;  3DGL A;  3OW2 2;  2LYX A;  4R1K A;  5DRV A;  5A0O B;  3KZT A;  1LOX A;  3CCU 3;  2P05 A;  3PYJ A;  2YFI B;  1BUQ A;  1E3V A;  1YJ9 3;  2OTJ 3;  1GYB A;  2BMR B;  3F8H A;  4N3V A;  5AIG A;  5D81 A;  5D83 A;  5IG4 A;  3MHE A;  1IK3 A;  2W9P A;  3BB9 A;  2WGO A;  2B24 B;  4PEJ A;  1J2B A;  4WFO A;  1A2K A;  3T8U A;  1JV2 B;  5IER A;  1DVC A;  3FG4 A;  4BTW A;  1T5Y A;  1GY6 A;  1W6C A;  3AMO A;  4K61 A;  5KP1 A;  3D9R A;  1WQL B;  1ROA A;  3EN8 A;  1WNH A;  2RFR A;  1FUW A;  4HJL B;  3LTD A;  3EHC A;  2RGQ A;  2IA7 A;  1SJW A;  1Q81 4;  1W2Z A;  2UX0 A;  3BNB A;  3K63 A;  4HM1 B;  4GB5 A;  3OXA A;  1FGR A;  1N5P A;  1NO3 A;  4N6T A;  4O2H A;  2XSH B;  4BTY A;  3X3Y A;  3F7S A;  1QAF A;  5JBS A;  4U13 A;  2BMO B;  2SBL A;  2W04 A;  2HMO B;  1N9E A;  1V74 A;  2CKF B;  2E2V A;  2GU1 A;  2XGL A;  3CMA 3;  2BHM A;  1Z1S A;  4K1V A;  1ROV A;  3KKG A;  1OHO A;  4FCZ A;  1YI2 3;  4N6O B;  1OF5 B;  3CPO A;  4MMX B;  2HMN B;  3CNX A;  2D42 A;  8CHO A;  3HX8 A;  1FGT A;  3EX9 A;  4MJD A;  1EG9 B;  3VSY A;  1EQK A;  2YX9 A;  1W2B 2;  5EVH A;  3A76 A;  2E2T A;  4HM6 B;  4LSO A;  2CIU A;  3PS8 A;  1W4N A;  1TFK A;  2KRT A;  4RNZ A;  4WHA A;  4CDL A;  1D6U A;  1S72 3;  2CW9 A;  4FR9 A;  2KXG A;  3FH1 A;  1RRH A;  1D6Y A;  1VQ6 3;  2GU3 A;  3CCE 3;  2WO0 A;  3H51 A;  4O8S A;  1DMN A;  1A67 A;  1WMP A;  3EF8 A;  1FGO A;  3CCJ 3;  3IJE B;  3OWU A;  4EV5 A;  1M9G A;  1K28 A;  1IVV A;  3GZR A;  1QAK A;  1RRL A;  4J9A A;  2QIY A;  3NBJ A;  3X42 A;  1NJI 4;  3I55 3;  1KSI A;  1LXE A;  3ROB A;  1SIH A;  2BMQ B;  1KC8 4;  3AMO B;  2IMJ A;  3M8C A;  4MEI A;  2CFW A;  3EB8 A;  1JB4 A;  3SX1 A;  4OK0 A;  5AII A;  3GZX B;  4XM4 A;  1GD3 A;  1W5Z A;  2XR8 B;  3Q1C A;  1JB5 A;  4K90 B;  3X3Z A;  3UNL A;  2GBW B;  3FGY A;  4H61 A;  4MMY B;  1ZX2 A;  2ZDJ A;  5G2G A;  2PZV A;  2O3O A;  3DY5 A;  2WOF A;  2F99 A;  3KSE D;  3NBB A;  1YHQ 3;  2Z6B A;  1NWW A;  1WTH A;  3K9M C;  1VQN 3;  3H3H A;  3CCQ 3;  1TFO A;  1PFP A;  1TIJ A;  5EQL A;  4OUQ A;  3KE7 A;  3EE1 A;  1ULI B;  3GZB A;  1GS3 A;  5DRE A;  2QEX 3;  3G6E 3;  4RZM A;  3ALA A;  3VGN A;  4HKV B;  1NU3 A;  3JUN A;  3RGR A;  3NUV A;  4EXR A;  1OGX A;  1W6Y A;  3KSP A;  2GEY A;  4L8P A;  4XDV A;  6STD A;  3UL6 A;  3FG1 A;  2HMK B;  1QVG 2;  3HII A;  1RN7 A;  1AV4 A;  2XEP A;  2STD A;  1VQO 3;  4NHF A;  1KWI A;  4LZI A;  1YJW 3;  2OOV A;  3DMC A;  4JRF A;  4XBY A;  2GEX A;  4HM8 B;  2K54 A;  5STD A;  1VQ4 3;  5IF6 A;  1NB3 I;  2QGU A;  4IT7 A;  2C11 A;  2JDI H;  5ELJ A;  5IEN A;  3EC9 A;  1STD A;  1CYU A;  3O8Y A;  3BNC A;  3PCR A;  4R80 A;  1IV9 A;  3CD6 3;  1NDO B;  2CWU A;  3B4O A;  1TUH A;  1QAL A;  4WYK B;  2W2C A;  2JQ5 A;  1JB2 A;  2CFD A;  3PXM A;  4HM2 B;  1HKX A;  1W02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...