4K1UA

Crystal structure of delta5-3-ketosteroid isomerase containing y16f and y32f mutations
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
122
Chain Sequence
b'NLPTAQEVQGLMARFIELVDVGDIEAIVQMFADDATVEDPFGQPPIHGREQIAAFYRQGLVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Rescue of deleterious mutations by the compensatory Y30F mutation in ketosteroid isomerase
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 31
structure length 122
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4k1uA00
2K54A 3CPOA 2GEXA 1AR0A 1OPYA 2YFIB 3T8NA 4RZMA 3K7CA 5EVHA 2HMLB 5CXOA 1NU3A 3MG3A 3B7CA 2STDA 3NV0A 3BLZA 2PZVA 3GZYB 5AEWB 2HMJB 5AI1A 3OXAA 5IG5A 4KVHA 5IG4A 3NXJA 3MKIA 3F8XA 5KP3A 4XM4A 4LEHA 1VZZA 3EQQB 5IERA 3GZBA 1S5AA 3S5CA 1C7HA 1SJWA 3NUVA 1OGZA 4HM3B 1TP6A 2RFRA 4OUQA 3B8LA 3DXOA 2W2CA 3NHXA 1DMMA 2GBXB 1E97A 3OWSA 5AIHA 3EHCA 3KSPA 4J9AA 2F99A 5D81A 3LYGA 3E99A 2R4IA 2CKFB 2UX0A 1UUVB 3FF2A 1OGXA 4J8TA 4STDA 3DMCA 2QGUA 5KP1A 4HZBB 4PEJA 3OV4A 1ZO2A 4U13A 3FLJA 5CF2A 3SEDA 3JUQA 1O7GB 1O7WB 3H3HA 3OX9A 1IDPA 5D82A 1NWWA 3CU3A 5IF6A 2OWPA 5TGNA 1GYBA 3WMDA 2F98A 2BNGA 4HM5B 1W6YA 3F7XA 2XRXB 3DZLA 3BB9A 5CLKA 3UNLA 1Q40A 3LZAA 3UJMA 3NM2A 4XBYA 5BXQA 2IMJA 4H3UA 3MSOA 2RGQA 3F40A 3EF8A 4FCMA 3ROBA 3EX9A 3G0KA 1K41A 5STDA 1OF5A 2HMKB 3KZTA 5FW5A 3HZPA 5IENA 4GB5A 3HK4A 3FZWA 4CDLA 4XBTA 4WWUC 4HKVB 2GBWB 2F86B 4HJLB 1U5OA 1HKXA 2BMRB 4HM0B 1O7NB 1EA2A 1W00A 1JN5A 3B4PA 3A76A 4MJDA 3MHEA 3FGYA 4WYKA 4X2HA 3MYTA 4ORLA 3DM8A 1QMAA 4HM8B 4R1KA 1ULIB 1W01A 1OH0A 1TUHA 4L8PA 3JUNA 5IEOA 3CNMA 4L8OA 5AIIA 5D83A 1OCVA 2B1XB 1WQLB 3D9RA 1Z1SA 1EG9B 3ER7A 3EN8A 1JKGA 3STDA 3EBYA 3GRDA 3FSDA 1UUWB 1OHPA 2BMQB 2YFLB 3RGRA 2HMNB 1GY5A 1JB4A 4OVMA 2XR8B 3EBTA 3B4OA 3SOAA 1Q40B 4FCJA 1O7MB 1O7HB 3JUPA 2QIYA 3NV0B 2HMMB 5IG0A 3Q90A 3G8ZA 1OHSA 4HZ9B 2RCDA 4R9KA 5G2GA 3OWUA 2INXA 5JPUA 2GXFA 3FF0A 8CHOA 3M8CA 3GZRA 2JQ5A 5BVBA 3VSYA 1E3RA 4HM7B 3F7SA 1O7PB 2BMOB 3NBRA 4K1UA 5AIGA 4XDVA 4LGQA 3OWYA 4XB5A 1BUQA 2I9WA 1STDA 5DREA 5JPPA 2HMOB 4I4KA 1A2KA 1NDOB 5AIFA 2GEYA 2CHCA 2YFJB 2XSOB 2B24B 4N3VA 4IIAA 1CQSA 1JKGB 4HM6B 5IG3A 2A15A 3FH1A 1W02A 3IPTA 3EN1B 6STDA 2Z77A 4HM1B 3F8HA 3I0YA 3H51A 3K0ZA 4R9LA 3MG1A 3MG2A 7STDA 3ECFA 3F9SA 5CF1A 5AEUB 3KE7A 3G16A 3GZXB 3JUOA 4LMIA 1Q42A 2Z76A 5CK6A 1QJGA 4X2OA 1ULJB 3EC9A 2XSHB 4K1VA 1ISKA 3HX8A 3VGNA 4L7KA 5HGRA 1ASKA 3SOYA 3GWRA 1DMQA 3EJVA 3KKGA 4XBXA 2Z7AA 3T8UA 3FKAA 1DMNA 1OF5B 1E3VA 4XDWA 1JB5A 1JB2A 1OHOA 3CNXA 3RGAA 4WP5A 1ZX2A 1GY7A 1GS3A 4HM4B 4HVNA 3DUKA 5DRVA 1GY6A 4HM2B 1JN5B 4Q53A 5IEPA 1OUNA 4WYKB 3JUMA 5KP4A 3F14A
chains in the Genus database with same CATH superfamily
1FUTA 1YGEA 2K54A 2Q07A 3CPOA 4BTXA 2KF4A 1RKYA 1N9JA 2GEXA 3CCJ3 1AR0A 1OPYA 2YFIB 3T8NA 2E2VA 4RZMA 3K7CA 4NREA 5EVHA 1BRSA 2HMLB 2M7OA 1VQ73 5CXOA 1NU3A 3MG3A 3B7CA 2STDA 1B27A 1X1YA 3Q1CA 1ROVA 2KF3A 3NV0A 1BVIA 3RNTA 3BLZA 4CJNA 1TIJA 2PZVA 3GZYB 4RNTA 2OOVA 1VQ53 5AEWB 2BT3A 3IJEB 2HMJB 3AGOA 4K61A 1YIT3 5AI1A 7GSPA 4EW5A 1Q9EA 2MC8A 3DH2A 4KFFA 3OXAA 5AYSC 1RDSA 4FMAA 3CXC2 1VQN3 4AEQA 1VQL3 4K90B 5IG5A 1SIHA 1RGCA 1FZUA 1PU4A 4KVHA 5AYRB 1I3FA 2CFLA 1FGMA 1UGHI 1MWUA 3JVCA 5IG4A 1LOWA 1BNRA 3NXJA 3MKIA 3N54B 3F8XA 4WHAA 2CFKA 3NM7A 3GAXA 2YX9A 3QRDA 4RNYA 5KP3A 4XM4A 4LEHA 4FCZA 4O2HA 1CEWI 1Q814 1VZZA 2MF7A 1IVVA 1SQWA 3KN4A 3EQQB 5IERA 1NB5I 3GZBA 1S5AA 1RCLA 2P0XA 3S5CA 1C7HA 2CWVA 3S27A 4J5KA 1IT8A 4EXRA 3AHWA 2IY2A 1MWSA 5LC6A 1SJWA 1RN4A 3NUVA 1OGZA 1US1A 3CCS3 4HM3B 1TP6A 3WHOA 1VQ93 2RFRA 3EB8A 1BANA 4BTWA 1IQYA 3LMLA 1QALA 4OUQA 1GOYA 4RNZA 1BRNL 3AMOB 3DGOA 3PGBA 3PCRA 1RCKA 1LOXA 3B8LA 1J2BA 1VQO3 3DXOA 2CFDA 3BNEA 1AY7A 2W2CA 3N9HA 3NHXA 3WOFB 4LZIA 1YJW3 1DE3A 1IVUA 2K3DA 1JBTA 1DMMA 3WODG 2GBXB 1E97A 3OWSA 4EV5A 3LTAA 1TTOA 3N8BA 4N6UA 1M1XB 5AIHA 1U8CB 2CW9A 3EHCA 3KSPA 1OACA 1EQKA 1W6GA 4J9AA 2CWTA 1DVDA 1I0XA 2F99A 1GD4A 5D81A 5EQLA 2CIUA 3E99A 3LYGA 2SARA 2QA43 1JZDA 5FGOA 2R4IA 4O8SA 3S28A 1FUWA 1M9GA 1AV4A 4KFEA 1SIIA 1L5GB 3URPA 1WNHA 5RNTA 2CKFB 4GHOA 5LC7A 5JBSA 2W04A 1A2PA 1TJDA 2UX0A 3UL5A 3X3ZA 1UUVB 1SPUA 3FF2A 1OGXA 3G6E3 1G96A 1R4CA 3ZG5A 4J8TA 1YIJ3 1BRIA 1T5YA 2QEX3 4STDA 3DMCA 3K9MC 4KT3B 2P38A 3RDEA 2QGUA 4ILFA 1VQ43 1BNFA 2ZDJA 1PFPA 4N6V0 3KSED 2WGOA 5KP1A 2ML6A 3K5TA 2CX1A 2XGLA 2WOFA 3DGYA 1X1UA 1MWRA 4HZBB 2UGIA 2WOHA 1UCLA 1TFOA 1I2GA 1MNLA 4PEJA 2O3OA 1FGQA 3OV4A 1WMOA 1ZO2A 4U13A 5GSPA 3ZFZA 3CC73 2P05A 5G1KA 3FLJA 1NO3A 3LT8A 3S29A 3SEDA 5CF2A 1TRPA 2K0MA 1YVSA 3JUQA 1O7GB 1O7WB 1D6UA 3H3HA 3LXUX 3OX9A 3CC43 1IDPA 2BIRA 5D82A 1GMRA 1NWWA 2D1WA 2F4YA 2KAAA 3CU3A 5IF6A 1NNVA 2OWPA 5TGNA 3D3LA 1GYBA 3NQZA 3WMDA 3NX0A 1IQXA 2F98A 4AKZA 2BNGA 1I3IA 4HM5B 2W03A 4N6LA 4MMYB 1QVF2 1RN1A 5BU4A 1W6YA 5I97A 2BU4A 3F7XA 3CCU3 1UCIA 1UDII 2XRXB 3DZLA 1RGKA 3BB9A 5CLKA 3UNLA 1FGTA 2CG0A 2RBIA 4H61A 4WFOA 1Q7HA 1Q40A 5ELUA 1RGAA 1T2HA 3LZAA 3UJMA 4BU4A 3NM2A 4XBYA 8RNTA 5BXQA 2IMJA 3DY5A 4H3UA 1STFI 4NHFA 6GSPA 4MMXB 1MGRA 2GU3A 2LQVA 1GOUA 2IUKA 2C4BA 3MSOA 2D42A 5EEOA 2XEPA 1G02A 1BRHA 1X1XA 1UW1A 3CPW2 2E2UA 3CCM3 1DYUA 2RGQA 1VQP3 3F40A 1LRAA 3TDGA 2ZA4A 3SX1A 1BSBA 3EF8A 4FCMA 2RSXA 3ROBA 1WMNA 1YVBI 3EX9A 3G0KA 1K41A 5STDA 1FYSA 1OF5A 3CCR3 1YI23 2HMKB 1QAFA 2IA7A 2ML5A 4N6NB 1W2B2 1D6YA 3SXXA 3KZTA 5FW5A 1F8NA 3HZPA 1YGWA 5IENA 4GB5A 4IT7A 1LOVA 3HK4A 2H0GA 2J8XB 3DGLA 3FZWA 3PS8A 4CDLA 4DKIA 4XBTA 3AHSA 3SLUA 1RHLA 1JRQA 1B3SA 3BNDA 4WWUC 4HKVB 2GBWB 2F86B 4HJLB 1GSPA 1U5OA 1W7CA 1HKXA 2W0QA 2CWUA 2W6JH 2OQEC 4GL6A 2BMRB 4HM0B 9RNTA 1NJI4 1O7NB 3FG3A 1EA2A 1W00A 1JN5A 1WTHA 1EKMA 3B4PA 3A76A 3A5EA 1TU5A 4MJDA 3S67A 3MHEA 1X1WA 3FGYA 4WYKA 1AQZA 2C10A 3X40A 3ZG0A 4X2HA 1C54A 3MYTA 2W9PA 4ORLA 2CFWA 3DM8A 2CFGA 1UGIA 2KRTA 1BRJA 1PYLA 1QMAA 2FGTA 4HM8B 4R1KA 4JRFA 2IUJA 1N9EA 1ULIB 1W01A 3FCSB 1A2VA 1OH0A 3FG4A 1RSNA 1BSEA 1TUHA 4L8PA 1IQ8A 3JUNA 5IEOA 3G713 3CNMA 3CCV3 4L8OA 5AIIA 4CCVA 5D83A 1OCVA 2B1XB 3PZWA 1YJN3 1B2MA 1WQLB 3D9RA 1BOXA 1UI8A 1Z1SA 3HIGA 1GOVA 1EG9B 1LNHA 1T3BA 1RGLA 3ER7A 2R41A 1I0VA 3NBJA 3EN8A 1JKGA 1CYUA 2ZHXB 3WDGB 3STDA 3I553 1ROAA 1B20A 2CX0A 3D79A 3EBYA 1RNBA 3GRDA 5G1LA 1BU4A 2JDIH 3ALAA 1UUWB 3FSDA 1OHPA 3UB1A 3DGNA 2BMQB 2YFLB 3RGRA 2HMNB 4EV2A 1GY5A 1JB4A 4OVMA 2XR8B 1N5HA 3V92A 3MPHA 3EBTA 2P09A 2KF5A 3B4OA 4RBNA 3Q2PA 3SOAA 1UUGB 1Q40B 4FCJA 1O7MB 1O7HB 3JUPA 4LYLB 3HOHA 3WA3A 3PYJA 1LQGC 2QIYA 2CG1A 1Y4KA 1RGGA 4EC6A 1AVLA 3NV0B 3WA2X 1BNJA 1BNIA 1B2ZA 2HMMB 3LOYA 5IG0A 2Y73A 3CC23 1FW7A 3Q90A 1I2FA 5HOHA 3G8ZA 2BHMA 1OHSA 1W4NA 4HZ9B 4HOHA 2RCDA 4R9KA 5G2GA 1YNVX 3OWUA 3EE1A 5M18A 2AADA 3LTDA 1MGWA 4R4KA 1LQMB 2IYJA 2INXA 1D6ZA 1IV9A 3SYUA 2GXFA 5JPUA 1S723 3FF0A 1V74A 1VQ63 8CHOA 1GMPA 1I70A 1BRGA 3DGMA 1B2XA 3AMOA 3GZRA 2AAEA 2JQ5A 3M8CA 5M1AA 5BVBA 3VSYA 2H0IA 1E3RA 2CK3H 3LTBA 4LSOA 4CPKA 4HM7B 3KFQC 3D5GA 3F7SA 4FR9A 1O7PB 4FMBA 1RLSA 1DVCA 4IPBA 2LYXA 4KZ1A 1A67A 2BMOB 3NBRA 1EEJA 1IK3A 1UCJA 3IMAB 4K1UA 1LXEA 5AIGA 3X3YA 4XDVA 2FNQA 3WOEB 1IYYA 1WMPA 1W6CA 1HYFA 4LGQA 3OWYA 1BIRA 2KCDA 1DETA 1Q824 4XB5A 4JF8A 3SVAA 1B2SA 1BUQA 2I9WA 1LOYA 4TX4A 2GSPA 1BSDA 1T2IA 2OTL3 1NB3I 1STDA 3NBBA 5DREA 3J7Yd 1AVKA 4I5QA 4BL3A 1JBRA 2OOVC 2CH9A 3QK9A 2HMOB 5JPPA 2XGNA 1IU7A 2UUGC 3D4AA 4NPBA 3CCE3 1VQQA 2ZL8A 4I4KA 3CD63 2XFSA 2E2TA 1A2KA 1V57A 1KSIA 1NDOB 3OW22 3CCL3 1N5PA 4R80A 5AIFA 2GEYA 4O3VA 2CHCA 1FUSA 2WO0A 2YFJB 2XSOB 3LT9A 1QAKA 2B24B 4N3VA 6RNTA 4IIAA 1CQSA 4O02B 1JNQA 1RNTA 1FGOA 3HI7A 1K9M4 1JKGB 4HM6B 3O8YA 2OTJ3 3MWZA 1KWIA 2F5WA 1ZGXA 1JV2B 3AGNA 3UL6A 5IG3A 1R4YA 2A15A 3WR2A 2W56A 1W02A 3FH1A 3PCSA 4OK0A 1G0TA 1FGRA 3IPTA 3EN1B 1CYVA 3D5IA 6STDA 1M1K4 1IVWA 1GD3A 2Z77A 4HM1B 1W5ZA 3F8HA 3I0YA 3BNCA 3H51A 5M19A 1SARA 1IV7A 3X41A 1Q7Y4 1BGSA 2O9UX 4N6OB 3K0ZA 1LNIA 3X3XA 3GSPA 5BIRA 4R9LA 3MG1A 2XFTA 3MG2A 4EBGA 2KF6A 7STDA 3V98A 3ECFA 1VQK3 3HIIA 2OQEA 3F9SA 1TFKA 1M904 5CF1A 3K63A 5AEUB 1KD14 3FG1A 3KE7A 1RGFA 3LTCA 1YJ93 4J5GA 4FMCA 1LVNA 3G16A 1N8R4 3GZXB 1N8QA 3LH4A 1BAOA 1UCKA 4HYZA 3JUOA 4LMIA 1HU9A 1Q42A 2Z76A 5CK6A 2L4VA 3VF1A 1QJGA 4X2OA 2XF3A 1ULJB 1HZ1A 3EC9A 2XSHB 4K1VA 3V99A 1BNSA 1RRLA 3X42A 1ISKA 3HX8A 2RNTA 1I8VA 4EYCA 1IT7A 2F5MA 3VGNA 4GSPA 4L7KA 3I563 2Y74A 3U97A 2FXTA 5HGRA 4ZM8A 1FA3A 1VQ83 2PNCA 4MEIA 1RTUA 1CH0A 1ASKA 2OCTA 4G1MB 4QWTA 1Q864 4N6MA 1ZS7A 2BO9B 4HAAA 4MMZB 7RNTA 1W2ZA 3GWRA 3SOYA 1MOLA 1DMQA 3EJVA 1B2UA 1V58A 1RGHA 3Q3FA 1EUIC 3KKGA 1KC84 1YHQ3 4BIRA 4XBXA 1BSAA 2Z7AA 1PY3A 1K8A4 2Z6BA 5IW9A 1UI7A 2L1SA 3T8UA 3T0UA 1BUJA 1BRKA 1I2EA 2KXGA 3NQYA 3FKAA 1DMNA 1OF5B 4N6TA 2C11A 1E3VA 1RGEA 4XDWA 1JB5A 2P0MA 4AKYA 1JB2A 1B21A 3BU4A 4HBRA 4BTYA 3U1WA 1BNGA 3KCHA 1OHOA 3CNXA 4KFDA 5ELJA 3BIRA 4FMDA 3RGAA 4WP5A 1K734 1ZX2A 3L0RA 1GY7A 1GS3A 4BL2A 2H0HA 2WGQA 4HM4B 2SBLA 5A0OB 4HVNA 3DUKA 5DRVA 1VQM3 1QVG2 1K28A 1TRQA 1IVXA 2GU1A 1GY6A 1JZOA 2F56A 2V1LA 2W56B 2XH9A 1GMQA 3CME3 3CCQ3 3KIIA 3G4S3 4HM2B 3PXMA 1JN5B 4Q53A 1A90A 3CMA3 1BSCA 2CC3A 1RRHA 5IEPA 1JBSA 1JJ22 1OUNA 1MWTA 2HOHA 4WYKB 2W9QA 1BNEA 1RMSA 3JUMA 1RJOA 5KP4A 1KQS2 1RN7A 3F14A 3BNBA
chains in the Genus database with same CATH topology
1YGEA 2K54A 2Q07A 3CPOA 4BTXA 1RKYA 1N9JA 2GEXA 3CCJ3 1AR0A 1OPYA 2YFIB 3T8NA 2E2VA 4RZMA 3K7CA 4NREA 5EVHA 1VQ73 2HMLB 2M7OA 5CXOA 1NU3A 3MG3A 3B7CA 2STDA 3Q1CA 1ROVA 3NV0A 3BLZA 1TIJA 2PZVA 3GZYB 2OOVA 1VQ53 5AEWB 2BT3A 3IJEB 2HMJB 1YIT3 4K61A 5AI1A 2MC8A 4KFFA 3OXAA 5AYSC 4FMAA 3CXC2 1VQN3 4AEQA 1VQL3 4K90B 5IG5A 1SIHA 1PU4A 4KVHA 5AYRB 2CFLA 1FGMA 3JVCA 5IG4A 3NXJA 3MKIA 3N54B 3F8XA 4WHAA 2CFKA 3NM7A 3GAXA 2YX9A 3QRDA 4RNYA 5KP3A 4XM4A 4LEHA 4FCZA 4O2HA 1CEWI 1Q814 1VZZA 2MF7A 1IVVA 1SQWA 3KN4A 3EQQB 5IERA 1NB5I 3GZBA 1S5AA 2P0XA 3S5CA 3S27A 1C7HA 2CWVA 4EXRA 1YI23 1IT8A 5LC6A 1SJWA 3NUVA 1OGZA 1US1A 3CCS3 4HM3B 1TP6A 1VQ93 2RFRA 3EB8A 4BTWA 1IQYA 3LMLA 1QALA 4OUQA 4RNZA 3AMOB 3DGOA 3PGBA 3PCRA 1LOXA 3B8LA 1J2BA 1VQO3 3DXOA 2CFDA 3BNEA 2W2CA 3N9HA 3NHXA 3WOFB 1YJW3 4LZIA 1IVUA 1DMMA 3WODG 2GBXB 1E97A 3OWSA 4EV5A 3LTAA 4N6UA 3N8BA 5AIHA 1M1XB 1U8CB 2CW9A 3EHCA 3KSPA 1OACA 1EQKA 1W6GA 4J9AA 2CWTA 1DVDA 2F99A 5D81A 1GD4A 5EQLA 2CIUA 3E99A 3LYGA 2QA43 5FGOA 2R4IA 4O8SA 3S28A 1FUWA 1M9GA 1AV4A 4KFEA 1SIIA 1L5GB 1WNHA 2CKFB 5LC7A 5JBSA 2W04A 2UX0A 3UL5A 3X3ZA 1UUVB 1SPUA 3FF2A 1OGXA 3G6E3 1G96A 1R4CA 4J8TA 1YIJ3 2QEX3 1T5YA 4STDA 3DMCA 3K9MC 2P38A 3RDEA 2QGUA 1VQ43 2ZDJA 1PFPA 4N6V0 3KSED 2WGOA 5KP1A 2ML6A 3K5TA 2XGLA 2WOFA 4HZBB 2WOHA 1TFOA 1MNLA 4PEJA 2O3OA 1FGQA 3OV4A 1WMOA 1ZO2A 4U13A 3CC73 2P05A 3FLJA 1NO3A 3LT8A 3S29A 3SEDA 5CF2A 2K0MA 3JUQA 1O7GB 1O7WB 1D6UA 3H3HA 3LXUX 3OX9A 3CC43 1IDPA 5D82A 1NWWA 2D1WA 3CU3A 5IF6A 2OWPA 5TGNA 3D3LA 1GYBA 3NQZA 3WMDA 3NX0A 1IQXA 2F98A 4AKZA 2BNGA 4HM5B 2W03A 4N6LA 4MMYB 1QVF2 1W6YA 5I97A 3F7XA 3CCU3 2XRXB 3DZLA 3BB9A 5CLKA 3UNLA 1FGTA 2CG0A 4H61A 4WFOA 1Q40A 5ELUA 3LZAA 3UJMA 3NM2A 4XBYA 5BXQA 2IMJA 3DY5A 4H3UA 1STFI 4NHFA 4MMXB 2GU3A 2LQVA 2IUKA 5EEOA 3MSOA 2D42A 2XEPA 1UW1A 3CPW2 2E2UA 3CCM3 1DYUA 2RGQA 1VQP3 3F40A 3TDGA 3SX1A 3EF8A 4FCMA 2RSXA 3ROBA 1WMNA 1YVBI 3EX9A 3G0KA 1K41A 5STDA 1OF5A 3CCR3 2HMKB 1QAFA 2IA7A 2ML5A 4N6NB 1W2B2 1D6YA 3SXXA 3KZTA 5FW5A 1F8NA 3HZPA 5IENA 4GB5A 4IT7A 3HK4A 3DGLA 3FZWA 4CDLA 3PS8A 4XBTA 3SLUA 1JRQA 3BNDA 4WWUC 4HKVB 2GBWB 2F86B 4HJLB 1U5OA 1W7CA 1HKXA 2W0QA 2CWUA 2W6JH 2OQEC 4GL6A 2BMRB 4HM0B 1NJI4 1O7NB 3FG3A 1EA2A 1W00A 1JN5A 1WTHA 1EKMA 3B4PA 3A76A 1TU5A 4MJDA 3S67A 3MHEA 3FGYA 4WYKA 2C10A 3X40A 4X2HA 3MYTA 2W9PA 4ORLA 2CFWA 3DM8A 2CFGA 2KRTA 2FGTA 1QMAA 4HM8B 4R1KA 4JRFA 2IUJA 1N9EA 1ULIB 1W01A 3FCSB 1A2VA 1OH0A 3FG4A 1TUHA 3G713 4L8PA 1IQ8A 3JUNA 5IEOA 3CNMA 3CCV3 4L8OA 5AIIA 4CCVA 5D83A 1OCVA 2B1XB 3PZWA 1YJN3 1WQLB 3D9RA 1UI8A 1Z1SA 3HIGA 1EG9B 1LNHA 3ER7A 1CYUA 3NBJA 3EN8A 1JKGA 3WDGB 3STDA 3I553 1ROAA 3EBYA 3GRDA 2JDIH 3ALAA 1UUWB 3FSDA 1OHPA 3UB1A 3DGNA 2BMQB 2YFLB 3RGRA 2HMNB 4EV2A 1GY5A 1JB4A 4OVMA 2XR8B 1N5HA 3V92A 3MPHA 3EBTA 2P09A 3B4OA 4RBNA 3Q2PA 3SOAA 1Q40B 4FCJA 1O7MB 1O7HB 3JUPA 3WA3A 3PYJA 2QIYA 2CG1A 4EC6A 1Y4KA 1AVLA 3NV0B 3WA2X 3LOYA 2HMMB 5IG0A 2Y73A 3CC23 3Q90A 3G8ZA 2BHMA 1OHSA 1W4NA 4HZ9B 2RCDA 4R9KA 5G2GA 3OWUA 3EE1A 3LTDA 4R4KA 2INXA 1D6ZA 1IV9A 5JPUA 2GXFA 1S723 3FF0A 1V74A 1VQ63 8CHOA 3DGMA 3M8CA 3AMOA 3GZRA 2JQ5A 5BVBA 3VSYA 1E3RA 2CK3H 3LTBA 4LSOA 4HM7B 3KFQC 3F7SA 4FR9A 1O7PB 4FMBA 1DVCA 4IPBA 2LYXA 4KZ1A 1A67A 2BMOB 3NBRA 1IK3A 3IMAB 4K1UA 1LXEA 5AIGA 3X3YA 4XDVA 2FNQA 3WOEB 1WMPA 1W6CA 4LGQA 3OWYA 2KCDA 1Q824 4XB5A 4JF8A 3SVAA 1BUQA 2I9WA 4TX4A 2OTL3 1NB3I 1STDA 3NBBA 5DREA 3J7Yd 1AVKA 2OOVC 2CH9A 3QK9A 2HMOB 5JPPA 2XGNA 1IU7A 3CCE3 2ZL8A 4I4KA 3CD63 2XFSA 2E2TA 1A2KA 1KSIA 1NDOB 3OW22 3CCL3 1N5PA 4R80A 5AIFA 2GEYA 4O3VA 2CHCA 2WO0A 2YFJB 2XSOB 3LT9A 1QAKA 2B24B 4N3VA 4IIAA 1CQSA 4O02B 1JNQA 3HI7A 1FGOA 1K9M4 1JKGB 4HM6B 3O8YA 2OTJ3 3MWZA 1KWIA 1JV2B 3UL6A 5IG3A 2A15A 2W56A 1W02A 3FH1A 3PCSA 4OK0A 1FGRA 3IPTA 3EN1B 1CYVA 6STDA 1M1K4 1IVWA 1GD3A 2Z77A 4HM1B 1W5ZA 3F8HA 3I0YA 3BNCA 3H51A 1IV7A 3X41A 1Q7Y4 4N6OB 2O9UX 3K0ZA 3X3XA 4R9LA 3MG1A 2XFTA 3MG2A 4EBGA 7STDA 1VQK3 3V98A 3ECFA 3HIIA 2OQEA 3F9SA 1TFKA 1M904 5CF1A 3K63A 5AEUB 1KD14 3FG1A 3KE7A 3LTCA 1YJ93 4FMCA 1LVNA 3G16A 1N8R4 3GZXB 1N8QA 3LH4A 4HYZA 3JUOA 4LMIA 1HU9A 1Q42A 2Z76A 5CK6A 2L4VA 3VF1A 1QJGA 4X2OA 2XF3A 1ULJB 3EC9A 2XSHB 4K1VA 3V99A 1RRLA 3X42A 1ISKA 3HX8A 4EYCA 1IT7A 3VGNA 4L7KA 3I563 2Y74A 3U97A 2FXTA 5HGRA 4ZM8A 1FA3A 1VQ83 2PNCA 4MEIA 1ASKA 2OCTA 4G1MB 4QWTA 1Q864 4N6MA 2BO9B 4MMZB 1W2ZA 3GWRA 3SOYA 1MOLA 1DMQA 3EJVA 3KKGA 1KC84 1YHQ3 4XBXA 2Z7AA 1K8A4 2Z6BA 5IW9A 1UI7A 3T8UA 3T0UA 2KXGA 3NQYA 3FKAA 1DMNA 1OF5B 4N6TA 2C11A 1E3VA 4XDWA 1JB5A 2P0MA 4AKYA 1JB2A 4HBRA 4BTYA 3U1WA 1OHOA 3CNXA 4KFDA 5ELJA 4FMDA 3RGAA 4WP5A 1K734 1ZX2A 3L0RA 1GY7A 1GS3A 2WGQA 4HM4B 2SBLA 5A0OB 4HVNA 3DUKA 5DRVA 1VQM3 1QVG2 1K28A 2V1LA 2XH9A 1IVXA 2GU1A 1GY6A 2W56B 3CME3 3CCQ3 3KIIA 3G4S3 4HM2B 3PXMA 1JN5B 4Q53A 1A90A 3CMA3 2CC3A 1RRHA 5IEPA 1JJ22 1OUNA 4WYKB 2W9QA 3JUMA 1RJOA 5KP4A 1KQS2 1RN7A 3F14A 3BNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K54 A;  3CPO A;  2GEX A;  1AR0 A;  1OPY A;  2YFI B;  3T8N A;  4RZM A;  3K7C A;  5EVH A;  2HML B;  5CXO A;  1NU3 A;  3MG3 A;  3B7C A;  2STD A;  3NV0 A;  3BLZ A;  2PZV A;  3GZY B;  5AEW B;  2HMJ B;  5AI1 A;  3OXA A;  5IG5 A;  4KVH A;  5IG4 A;  3NXJ A;  3MKI A;  3F8X A;  5KP3 A;  4XM4 A;  4LEH A;  1VZZ A;  3EQQ B;  5IER A;  3GZB A;  1S5A A;  3S5C A;  1C7H A;  1SJW A;  3NUV A;  1OGZ A;  4HM3 B;  1TP6 A;  2RFR A;  4OUQ A;  3B8L A;  3DXO A;  2W2C A;  3NHX A;  1DMM A;  2GBX B;  1E97 A;  3OWS A;  5AIH A;  3EHC A;  3KSP A;  4J9A A;  2F99 A;  5D81 A;  3LYG A;  3E99 A;  2R4I A;  2CKF B;  2UX0 A;  1UUV B;  3FF2 A;  1OGX A;  4J8T A;  4STD A;  3DMC A;  2QGU A;  5KP1 A;  4HZB B;  4PEJ A;  3OV4 A;  1ZO2 A;  4U13 A;  3FLJ A;  5CF2 A;  3SED A;  3JUQ A;  1O7G B;  1O7W B;  3H3H A;  3OX9 A;  1IDP A;  5D82 A;  1NWW A;  3CU3 A;  5IF6 A;  2OWP A;  5TGN A;  1GYB A;  3WMD A;  2F98 A;  2BNG A;  4HM5 B;  1W6Y A;  3F7X A;  2XRX B;  3DZL A;  3BB9 A;  5CLK A;  3UNL A;  1Q40 A;  3LZA A;  3UJM A;  3NM2 A;  4XBY A;  5BXQ A;  2IMJ A;  4H3U A;  3MSO A;  2RGQ A;  3F40 A;  3EF8 A;  4FCM A;  3ROB A;  3EX9 A;  3G0K A;  1K41 A;  5STD A;  1OF5 A;  2HMK B;  3KZT A;  5FW5 A;  3HZP A;  5IEN A;  4GB5 A;  3HK4 A;  3FZW A;  4CDL A;  4XBT A;  4WWU C;  4HKV B;  2GBW B;  2F86 B;  4HJL B;  1U5O A;  1HKX A;  2BMR B;  4HM0 B;  1O7N B;  1EA2 A;  1W00 A;  1JN5 A;  3B4P A;  3A76 A;  4MJD A;  3MHE A;  3FGY A;  4WYK A;  4X2H A;  3MYT A;  4ORL A;  3DM8 A;  1QMA A;  4HM8 B;  4R1K A;  1ULI B;  1W01 A;  1OH0 A;  1TUH A;  4L8P A;  3JUN A;  5IEO A;  3CNM A;  4L8O A;  5AII A;  5D83 A;  1OCV A;  2B1X B;  1WQL B;  3D9R A;  1Z1S A;  1EG9 B;  3ER7 A;  3EN8 A;  1JKG A;  3STD A;  3EBY A;  3GRD A;  3FSD A;  1UUW B;  1OHP A;  2BMQ B;  2YFL B;  3RGR A;  2HMN B;  1GY5 A;  1JB4 A;  4OVM A;  2XR8 B;  3EBT A;  3B4O A;  3SOA A;  1Q40 B;  4FCJ A;  1O7M B;  1O7H B;  3JUP A;  2QIY A;  3NV0 B;  2HMM B;  5IG0 A;  3Q90 A;  3G8Z A;  1OHS A;  4HZ9 B;  2RCD A;  4R9K A;  5G2G A;  3OWU A;  2INX A;  5JPU A;  2GXF A;  3FF0 A;  8CHO A;  3M8C A;  3GZR A;  2JQ5 A;  5BVB A;  3VSY A;  1E3R A;  4HM7 B;  3F7S A;  1O7P B;  2BMO B;  3NBR A;  4K1U A;  5AIG A;  4XDV A;  4LGQ A;  3OWY A;  4XB5 A;  1BUQ A;  2I9W A;  1STD A;  5DRE A;  5JPP A;  2HMO B;  4I4K A;  1A2K A;  1NDO B;  5AIF A;  2GEY A;  2CHC A;  2YFJ B;  2XSO B;  2B24 B;  4N3V A;  4IIA A;  1CQS A;  1JKG B;  4HM6 B;  5IG3 A;  2A15 A;  3FH1 A;  1W02 A;  3IPT A;  3EN1 B;  6STD A;  2Z77 A;  4HM1 B;  3F8H A;  3I0Y A;  3H51 A;  3K0Z A;  4R9L A;  3MG1 A;  3MG2 A;  7STD A;  3ECF A;  3F9S A;  5CF1 A;  5AEU B;  3KE7 A;  3G16 A;  3GZX B;  3JUO A;  4LMI A;  1Q42 A;  2Z76 A;  5CK6 A;  1QJG A;  4X2O A;  1ULJ B;  3EC9 A;  2XSH B;  4K1V A;  1ISK A;  3HX8 A;  3VGN A;  4L7K A;  5HGR A;  1ASK A;  3SOY A;  3GWR A;  1DMQ A;  3EJV A;  3KKG A;  4XBX A;  2Z7A A;  3T8U A;  3FKA A;  1DMN A;  1OF5 B;  1E3V A;  4XDW A;  1JB5 A;  1JB2 A;  1OHO A;  3CNX A;  3RGA A;  4WP5 A;  1ZX2 A;  1GY7 A;  1GS3 A;  4HM4 B;  4HVN A;  3DUK A;  5DRV A;  1GY6 A;  4HM2 B;  1JN5 B;  4Q53 A;  5IEP A;  1OUN A;  4WYK B;  3JUM A;  5KP4 A;  3F14 A; 
#chains in the Genus database with same CATH topology
 1FUT A;  1YGE A;  2K54 A;  2Q07 A;  3CPO A;  4BTX A;  2KF4 A;  1RKY A;  1N9J A;  2GEX A;  3CCJ 3;  1AR0 A;  1OPY A;  2YFI B;  3T8N A;  2E2V A;  4RZM A;  3K7C A;  4NRE A;  5EVH A;  1BRS A;  2HML B;  2M7O A;  1VQ7 3;  5CXO A;  1NU3 A;  3MG3 A;  3B7C A;  2STD A;  1B27 A;  1X1Y A;  3Q1C A;  1ROV A;  2KF3 A;  3NV0 A;  1BVI A;  3RNT A;  3BLZ A;  4CJN A;  1TIJ A;  2PZV A;  3GZY B;  4RNT A;  2OOV A;  1VQ5 3;  5AEW B;  2BT3 A;  3IJE B;  2HMJ B;  3AGO A;  4K61 A;  1YIT 3;  5AI1 A;  7GSP A;  4EW5 A;  1Q9E A;  2MC8 A;  3DH2 A;  4KFF A;  3OXA A;  5AYS C;  1RDS A;  4FMA A;  3CXC 2;  1VQN 3;  4AEQ A;  1VQL 3;  4K90 B;  5IG5 A;  1SIH A;  1RGC A;  1FZU A;  1PU4 A;  4KVH A;  5AYR B;  1I3F A;  2CFL A;  1FGM A;  1UGH I;  1MWU A;  3JVC A;  5IG4 A;  1LOW A;  1BNR A;  3NXJ A;  3MKI A;  3N54 B;  3F8X A;  4WHA A;  2CFK A;  3NM7 A;  3GAX A;  2YX9 A;  3QRD A;  4RNY A;  5KP3 A;  4XM4 A;  4LEH A;  4FCZ A;  4O2H A;  1CEW I;  1Q81 4;  1VZZ A;  2MF7 A;  1IVV A;  1SQW A;  3KN4 A;  3EQQ B;  5IER A;  1NB5 I;  3GZB A;  1S5A A;  1RCL A;  2P0X A;  3S5C A;  1C7H A;  2CWV A;  3S27 A;  4J5K A;  1IT8 A;  4EXR A;  3AHW A;  2IY2 A;  1MWS A;  5LC6 A;  1SJW A;  1RN4 A;  3NUV A;  1OGZ A;  1US1 A;  3CCS 3;  4HM3 B;  1TP6 A;  3WHO A;  1VQ9 3;  2RFR A;  3EB8 A;  1BAN A;  4BTW A;  1IQY A;  3LML A;  1QAL A;  4OUQ A;  1GOY A;  4RNZ A;  1BRN L;  3AMO B;  3DGO A;  3PGB A;  3PCR A;  1RCK A;  1LOX A;  3B8L A;  1J2B A;  1VQO 3;  3DXO A;  2CFD A;  3BNE A;  1AY7 A;  2W2C A;  3N9H A;  3NHX A;  3WOF B;  4LZI A;  1YJW 3;  1DE3 A;  1IVU A;  2K3D A;  1JBT A;  1DMM A;  3WOD G;  2GBX B;  1E97 A;  3OWS A;  4EV5 A;  3LTA A;  1TTO A;  3N8B A;  4N6U A;  1M1X B;  5AIH A;  1U8C B;  2CW9 A;  3EHC A;  3KSP A;  1OAC A;  1EQK A;  1W6G A;  4J9A A;  2CWT A;  1DVD A;  1I0X A;  2F99 A;  1GD4 A;  5D81 A;  5EQL A;  2CIU A;  3E99 A;  3LYG A;  2SAR A;  2QA4 3;  1JZD A;  5FGO A;  2R4I A;  4O8S A;  3S28 A;  1FUW A;  1M9G A;  1AV4 A;  4KFE A;  1SII A;  1L5G B;  3URP A;  1WNH A;  5RNT A;  2CKF B;  4GHO A;  5LC7 A;  5JBS A;  2W04 A;  1A2P A;  1TJD A;  2UX0 A;  3UL5 A;  3X3Z A;  1UUV B;  1SPU A;  3FF2 A;  1OGX A;  3G6E 3;  1G96 A;  1R4C A;  3ZG5 A;  4J8T A;  1YIJ 3;  1BRI A;  1T5Y A;  2QEX 3;  4STD A;  3DMC A;  3K9M C;  4KT3 B;  2P38 A;  3RDE A;  2QGU A;  4ILF A;  1VQ4 3;  1BNF A;  2ZDJ A;  1PFP A;  4N6V 0;  3KSE D;  2WGO A;  5KP1 A;  2ML6 A;  3K5T A;  2CX1 A;  2XGL A;  2WOF A;  3DGY A;  1X1U A;  1MWR A;  4HZB B;  2UGI A;  2WOH A;  1UCL A;  1TFO A;  1I2G A;  1MNL A;  4PEJ A;  2O3O A;  1FGQ A;  3OV4 A;  1WMO A;  1ZO2 A;  4U13 A;  5GSP A;  3ZFZ A;  3CC7 3;  2P05 A;  5G1K A;  3FLJ A;  1NO3 A;  3LT8 A;  3S29 A;  3SED A;  5CF2 A;  1TRP A;  2K0M A;  1YVS A;  3JUQ A;  1O7G B;  1O7W B;  1D6U A;  3H3H A;  3LXU X;  3OX9 A;  3CC4 3;  1IDP A;  2BIR A;  5D82 A;  1GMR A;  1NWW A;  2D1W A;  2F4Y A;  2KAA A;  3CU3 A;  5IF6 A;  1NNV A;  2OWP A;  5TGN A;  3D3L A;  1GYB A;  3NQZ A;  3WMD A;  3NX0 A;  1IQX A;  2F98 A;  4AKZ A;  2BNG A;  1I3I A;  4HM5 B;  2W03 A;  4N6L A;  4MMY B;  1QVF 2;  1RN1 A;  5BU4 A;  1W6Y A;  5I97 A;  2BU4 A;  3F7X A;  3CCU 3;  1UCI A;  1UDI I;  2XRX B;  3DZL A;  1RGK A;  3BB9 A;  5CLK A;  3UNL A;  1FGT A;  2CG0 A;  2RBI A;  4H61 A;  4WFO A;  1Q7H A;  1Q40 A;  5ELU A;  1RGA A;  1T2H A;  3LZA A;  3UJM A;  4BU4 A;  3NM2 A;  4XBY A;  8RNT A;  5BXQ A;  2IMJ A;  3DY5 A;  4H3U A;  1STF I;  4NHF A;  6GSP A;  4MMX B;  1MGR A;  2GU3 A;  2LQV A;  1GOU A;  2IUK A;  2C4B A;  3MSO A;  2D42 A;  5EEO A;  2XEP A;  1G02 A;  1BRH A;  1X1X A;  1UW1 A;  3CPW 2;  2E2U A;  3CCM 3;  1DYU A;  2RGQ A;  1VQP 3;  3F40 A;  1LRA A;  3TDG A;  2ZA4 A;  3SX1 A;  1BSB A;  3EF8 A;  4FCM A;  2RSX A;  3ROB A;  1WMN A;  1YVB I;  3EX9 A;  3G0K A;  1K41 A;  5STD A;  1FYS A;  1OF5 A;  3CCR 3;  1YI2 3;  2HMK B;  1QAF A;  2IA7 A;  2ML5 A;  4N6N B;  1W2B 2;  1D6Y A;  3SXX A;  3KZT A;  5FW5 A;  1F8N A;  3HZP A;  1YGW A;  5IEN A;  4GB5 A;  4IT7 A;  1LOV A;  3HK4 A;  2H0G A;  2J8X B;  3DGL A;  3FZW A;  3PS8 A;  4CDL A;  4DKI A;  4XBT A;  3AHS A;  3SLU A;  1RHL A;  1JRQ A;  1B3S A;  3BND A;  4WWU C;  4HKV B;  2GBW B;  2F86 B;  4HJL B;  1GSP A;  1U5O A;  1W7C A;  1HKX A;  2W0Q A;  2CWU A;  2W6J H;  2OQE C;  4GL6 A;  2BMR B;  4HM0 B;  9RNT A;  1NJI 4;  1O7N B;  3FG3 A;  1EA2 A;  1W00 A;  1JN5 A;  1WTH A;  1EKM A;  3B4P A;  3A76 A;  3A5E A;  1TU5 A;  4MJD A;  3S67 A;  3MHE A;  1X1W A;  3FGY A;  4WYK A;  1AQZ A;  2C10 A;  3X40 A;  3ZG0 A;  4X2H A;  1C54 A;  3MYT A;  2W9P A;  4ORL A;  2CFW A;  3DM8 A;  2CFG A;  1UGI A;  2KRT A;  1BRJ A;  1PYL A;  1QMA A;  2FGT A;  4HM8 B;  4R1K A;  4JRF A;  2IUJ A;  1N9E A;  1ULI B;  1W01 A;  3FCS B;  1A2V A;  1OH0 A;  3FG4 A;  1RSN A;  1BSE A;  1TUH A;  4L8P A;  1IQ8 A;  3JUN A;  5IEO A;  3G71 3;  3CNM A;  3CCV 3;  4L8O A;  5AII A;  4CCV A;  5D83 A;  1OCV A;  2B1X B;  3PZW A;  1YJN 3;  1B2M A;  1WQL B;  3D9R A;  1BOX A;  1UI8 A;  1Z1S A;  3HIG A;  1GOV A;  1EG9 B;  1LNH A;  1T3B A;  1RGL A;  3ER7 A;  2R41 A;  1I0V A;  3NBJ A;  3EN8 A;  1JKG A;  1CYU A;  2ZHX B;  3WDG B;  3STD A;  3I55 3;  1ROA A;  1B20 A;  2CX0 A;  3D79 A;  3EBY A;  1RNB A;  3GRD A;  5G1L A;  1BU4 A;  2JDI H;  3ALA A;  1UUW B;  3FSD A;  1OHP A;  3UB1 A;  3DGN A;  2BMQ B;  2YFL B;  3RGR A;  2HMN B;  4EV2 A;  1GY5 A;  1JB4 A;  4OVM A;  2XR8 B;  1N5H A;  3V92 A;  3MPH A;  3EBT A;  2P09 A;  2KF5 A;  3B4O A;  4RBN A;  3Q2P A;  3SOA A;  1UUG B;  1Q40 B;  4FCJ A;  1O7M B;  1O7H B;  3JUP A;  4LYL B;  3HOH A;  3WA3 A;  3PYJ A;  1LQG C;  2QIY A;  2CG1 A;  1Y4K A;  1RGG A;  4EC6 A;  1AVL A;  3NV0 B;  3WA2 X;  1BNJ A;  1BNI A;  1B2Z A;  2HMM B;  3LOY A;  5IG0 A;  2Y73 A;  3CC2 3;  1FW7 A;  3Q90 A;  1I2F A;  5HOH A;  3G8Z A;  2BHM A;  1OHS A;  1W4N A;  4HZ9 B;  4HOH A;  2RCD A;  4R9K A;  5G2G A;  1YNV X;  3OWU A;  3EE1 A;  5M18 A;  2AAD A;  3LTD A;  1MGW A;  4R4K A;  1LQM B;  2IYJ A;  2INX A;  1D6Z A;  1IV9 A;  3SYU A;  2GXF A;  5JPU A;  1S72 3;  3FF0 A;  1V74 A;  1VQ6 3;  8CHO A;  1GMP A;  1I70 A;  1BRG A;  3DGM A;  1B2X A;  3AMO A;  3GZR A;  2AAE A;  2JQ5 A;  3M8C A;  5M1A A;  5BVB A;  3VSY A;  2H0I A;  1E3R A;  2CK3 H;  3LTB A;  4LSO A;  4CPK A;  4HM7 B;  3KFQ C;  3D5G A;  3F7S A;  4FR9 A;  1O7P B;  4FMB A;  1RLS A;  1DVC A;  4IPB A;  2LYX A;  4KZ1 A;  1A67 A;  2BMO B;  3NBR A;  1EEJ A;  1IK3 A;  1UCJ A;  3IMA B;  4K1U A;  1LXE A;  5AIG A;  3X3Y A;  4XDV A;  2FNQ A;  3WOE B;  1IYY A;  1WMP A;  1W6C A;  1HYF A;  4LGQ A;  3OWY A;  1BIR A;  2KCD A;  1DET A;  1Q82 4;  4XB5 A;  4JF8 A;  3SVA A;  1B2S A;  1BUQ A;  2I9W A;  1LOY A;  4TX4 A;  2GSP A;  1BSD A;  1T2I A;  2OTL 3;  1NB3 I;  1STD A;  3NBB A;  5DRE A;  3J7Y d;  1AVK A;  4I5Q A;  4BL3 A;  1JBR A;  2OOV C;  2CH9 A;  3QK9 A;  2HMO B;  5JPP A;  2XGN A;  1IU7 A;  2UUG C;  3D4A A;  4NPB A;  3CCE 3;  1VQQ A;  2ZL8 A;  4I4K A;  3CD6 3;  2XFS A;  2E2T A;  1A2K A;  1V57 A;  1KSI A;  1NDO B;  3OW2 2;  3CCL 3;  1N5P A;  4R80 A;  5AIF A;  2GEY A;  4O3V A;  2CHC A;  1FUS A;  2WO0 A;  2YFJ B;  2XSO B;  3LT9 A;  1QAK A;  2B24 B;  4N3V A;  6RNT A;  4IIA A;  1CQS A;  4O02 B;  1JNQ A;  1RNT A;  1FGO A;  3HI7 A;  1K9M 4;  1JKG B;  4HM6 B;  3O8Y A;  2OTJ 3;  3MWZ A;  1KWI A;  2F5W A;  1ZGX A;  1JV2 B;  3AGN A;  3UL6 A;  5IG3 A;  1R4Y A;  2A15 A;  3WR2 A;  2W56 A;  1W02 A;  3FH1 A;  3PCS A;  4OK0 A;  1G0T A;  1FGR A;  3IPT A;  3EN1 B;  1CYV A;  3D5I A;  6STD A;  1M1K 4;  1IVW A;  1GD3 A;  2Z77 A;  4HM1 B;  1W5Z A;  3F8H A;  3I0Y A;  3BNC A;  3H51 A;  5M19 A;  1SAR A;  1IV7 A;  3X41 A;  1Q7Y 4;  1BGS A;  2O9U X;  4N6O B;  3K0Z A;  1LNI A;  3X3X A;  3GSP A;  5BIR A;  4R9L A;  3MG1 A;  2XFT A;  3MG2 A;  4EBG A;  2KF6 A;  7STD A;  3V98 A;  3ECF A;  1VQK 3;  3HII A;  2OQE A;  3F9S A;  1TFK A;  1M90 4;  5CF1 A;  3K63 A;  5AEU B;  1KD1 4;  3FG1 A;  3KE7 A;  1RGF A;  3LTC A;  1YJ9 3;  4J5G A;  4FMC A;  1LVN A;  3G16 A;  1N8R 4;  3GZX B;  1N8Q A;  3LH4 A;  1BAO A;  1UCK A;  4HYZ A;  3JUO A;  4LMI A;  1HU9 A;  1Q42 A;  2Z76 A;  5CK6 A;  2L4V A;  3VF1 A;  1QJG A;  4X2O A;  2XF3 A;  1ULJ B;  1HZ1 A;  3EC9 A;  2XSH B;  4K1V A;  3V99 A;  1BNS A;  1RRL A;  3X42 A;  1ISK A;  3HX8 A;  2RNT A;  1I8V A;  4EYC A;  1IT7 A;  2F5M A;  3VGN A;  4GSP A;  4L7K A;  3I56 3;  2Y74 A;  3U97 A;  2FXT A;  5HGR A;  4ZM8 A;  1FA3 A;  1VQ8 3;  2PNC A;  4MEI A;  1RTU A;  1CH0 A;  1ASK A;  2OCT A;  4G1M B;  4QWT A;  1Q86 4;  4N6M A;  1ZS7 A;  2BO9 B;  4HAA A;  4MMZ B;  7RNT A;  1W2Z A;  3GWR A;  3SOY A;  1MOL A;  1DMQ A;  3EJV A;  1B2U A;  1V58 A;  1RGH A;  3Q3F A;  1EUI C;  3KKG A;  1KC8 4;  1YHQ 3;  4BIR A;  4XBX A;  1BSA A;  2Z7A A;  1PY3 A;  1K8A 4;  2Z6B A;  5IW9 A;  1UI7 A;  2L1S A;  3T8U A;  3T0U A;  1BUJ A;  1BRK A;  1I2E A;  2KXG A;  3NQY A;  3FKA A;  1DMN A;  1OF5 B;  4N6T A;  2C11 A;  1E3V A;  1RGE A;  4XDW A;  1JB5 A;  2P0M A;  4AKY A;  1JB2 A;  1B21 A;  3BU4 A;  4HBR A;  4BTY A;  3U1W A;  1BNG A;  3KCH A;  1OHO A;  3CNX A;  4KFD A;  5ELJ A;  3BIR A;  4FMD A;  3RGA A;  4WP5 A;  1K73 4;  1ZX2 A;  3L0R A;  1GY7 A;  1GS3 A;  4BL2 A;  2H0H A;  2WGQ A;  4HM4 B;  2SBL A;  5A0O B;  4HVN A;  3DUK A;  5DRV A;  1VQM 3;  1QVG 2;  1K28 A;  1TRQ A;  1IVX A;  2GU1 A;  1GY6 A;  1JZO A;  2F56 A;  2V1L A;  2W56 B;  2XH9 A;  1GMQ A;  3CME 3;  3CCQ 3;  3KII A;  3G4S 3;  4HM2 B;  3PXM A;  1JN5 B;  4Q53 A;  1A90 A;  3CMA 3;  1BSC A;  2CC3 A;  1RRH A;  5IEP A;  1JBS A;  1JJ2 2;  1OUN A;  1MWT A;  2HOH A;  4WYK B;  2W9Q A;  1BNE A;  1RMS A;  3JUM A;  1RJO A;  5KP4 A;  1KQS 2;  1RN7 A;  3F14 A;  3BNB A; 
#chains in the Genus database with same CATH homology
 1YGE A;  2K54 A;  2Q07 A;  3CPO A;  4BTX A;  1RKY A;  1N9J A;  2GEX A;  3CCJ 3;  1AR0 A;  1OPY A;  2YFI B;  3T8N A;  2E2V A;  4RZM A;  3K7C A;  4NRE A;  5EVH A;  1VQ7 3;  2HML B;  2M7O A;  5CXO A;  1NU3 A;  3MG3 A;  3B7C A;  2STD A;  3Q1C A;  1ROV A;  3NV0 A;  3BLZ A;  1TIJ A;  2PZV A;  3GZY B;  2OOV A;  1VQ5 3;  5AEW B;  2BT3 A;  3IJE B;  2HMJ B;  1YIT 3;  4K61 A;  5AI1 A;  2MC8 A;  4KFF A;  3OXA A;  5AYS C;  4FMA A;  3CXC 2;  1VQN 3;  4AEQ A;  1VQL 3;  4K90 B;  5IG5 A;  1SIH A;  1PU4 A;  4KVH A;  5AYR B;  2CFL A;  1FGM A;  3JVC A;  5IG4 A;  3NXJ A;  3MKI A;  3N54 B;  3F8X A;  4WHA A;  2CFK A;  3NM7 A;  3GAX A;  2YX9 A;  3QRD A;  4RNY A;  5KP3 A;  4XM4 A;  4LEH A;  4FCZ A;  4O2H A;  1CEW I;  1Q81 4;  1VZZ A;  2MF7 A;  1IVV A;  1SQW A;  3KN4 A;  3EQQ B;  5IER A;  1NB5 I;  3GZB A;  1S5A A;  2P0X A;  3S5C A;  3S27 A;  1C7H A;  2CWV A;  4EXR A;  1YI2 3;  1IT8 A;  5LC6 A;  1SJW A;  3NUV A;  1OGZ A;  1US1 A;  3CCS 3;  4HM3 B;  1TP6 A;  1VQ9 3;  2RFR A;  3EB8 A;  4BTW A;  1IQY A;  3LML A;  1QAL A;  4OUQ A;  4RNZ A;  3AMO B;  3DGO A;  3PGB A;  3PCR A;  1LOX A;  3B8L A;  1J2B A;  1VQO 3;  3DXO A;  2CFD A;  3BNE A;  2W2C A;  3N9H A;  3NHX A;  3WOF B;  1YJW 3;  4LZI A;  1IVU A;  1DMM A;  3WOD G;  2GBX B;  1E97 A;  3OWS A;  4EV5 A;  3LTA A;  4N6U A;  3N8B A;  5AIH A;  1M1X B;  1U8C B;  2CW9 A;  3EHC A;  3KSP A;  1OAC A;  1EQK A;  1W6G A;  4J9A A;  2CWT A;  1DVD A;  2F99 A;  5D81 A;  1GD4 A;  5EQL A;  2CIU A;  3E99 A;  3LYG A;  2QA4 3;  5FGO A;  2R4I A;  4O8S A;  3S28 A;  1FUW A;  1M9G A;  1AV4 A;  4KFE A;  1SII A;  1L5G B;  1WNH A;  2CKF B;  5LC7 A;  5JBS A;  2W04 A;  2UX0 A;  3UL5 A;  3X3Z A;  1UUV B;  1SPU A;  3FF2 A;  1OGX A;  3G6E 3;  1G96 A;  1R4C A;  4J8T A;  1YIJ 3;  2QEX 3;  1T5Y A;  4STD A;  3DMC A;  3K9M C;  2P38 A;  3RDE A;  2QGU A;  1VQ4 3;  2ZDJ A;  1PFP A;  4N6V 0;  3KSE D;  2WGO A;  5KP1 A;  2ML6 A;  3K5T A;  2XGL A;  2WOF A;  4HZB B;  2WOH A;  1TFO A;  1MNL A;  4PEJ A;  2O3O A;  1FGQ A;  3OV4 A;  1WMO A;  1ZO2 A;  4U13 A;  3CC7 3;  2P05 A;  3FLJ A;  1NO3 A;  3LT8 A;  3S29 A;  3SED A;  5CF2 A;  2K0M A;  3JUQ A;  1O7G B;  1O7W B;  1D6U A;  3H3H A;  3LXU X;  3OX9 A;  3CC4 3;  1IDP A;  5D82 A;  1NWW A;  2D1W A;  3CU3 A;  5IF6 A;  2OWP A;  5TGN A;  3D3L A;  1GYB A;  3NQZ A;  3WMD A;  3NX0 A;  1IQX A;  2F98 A;  4AKZ A;  2BNG A;  4HM5 B;  2W03 A;  4N6L A;  4MMY B;  1QVF 2;  1W6Y A;  5I97 A;  3F7X A;  3CCU 3;  2XRX B;  3DZL A;  3BB9 A;  5CLK A;  3UNL A;  1FGT A;  2CG0 A;  4H61 A;  4WFO A;  1Q40 A;  5ELU A;  3LZA A;  3UJM A;  3NM2 A;  4XBY A;  5BXQ A;  2IMJ A;  3DY5 A;  4H3U A;  1STF I;  4NHF A;  4MMX B;  2GU3 A;  2LQV A;  2IUK A;  5EEO A;  3MSO A;  2D42 A;  2XEP A;  1UW1 A;  3CPW 2;  2E2U A;  3CCM 3;  1DYU A;  2RGQ A;  1VQP 3;  3F40 A;  3TDG A;  3SX1 A;  3EF8 A;  4FCM A;  2RSX A;  3ROB A;  1WMN A;  1YVB I;  3EX9 A;  3G0K A;  1K41 A;  5STD A;  1OF5 A;  3CCR 3;  2HMK B;  1QAF A;  2IA7 A;  2ML5 A;  4N6N B;  1W2B 2;  1D6Y A;  3SXX A;  3KZT A;  5FW5 A;  1F8N A;  3HZP A;  5IEN A;  4GB5 A;  4IT7 A;  3HK4 A;  3DGL A;  3FZW A;  4CDL A;  3PS8 A;  4XBT A;  3SLU A;  1JRQ A;  3BND A;  4WWU C;  4HKV B;  2GBW B;  2F86 B;  4HJL B;  1U5O A;  1W7C A;  1HKX A;  2W0Q A;  2CWU A;  2W6J H;  2OQE C;  4GL6 A;  2BMR B;  4HM0 B;  1NJI 4;  1O7N B;  3FG3 A;  1EA2 A;  1W00 A;  1JN5 A;  1WTH A;  1EKM A;  3B4P A;  3A76 A;  1TU5 A;  4MJD A;  3S67 A;  3MHE A;  3FGY A;  4WYK A;  2C10 A;  3X40 A;  4X2H A;  3MYT A;  2W9P A;  4ORL A;  2CFW A;  3DM8 A;  2CFG A;  2KRT A;  2FGT A;  1QMA A;  4HM8 B;  4R1K A;  4JRF A;  2IUJ A;  1N9E A;  1ULI B;  1W01 A;  3FCS B;  1A2V A;  1OH0 A;  3FG4 A;  1TUH A;  3G71 3;  4L8P A;  1IQ8 A;  3JUN A;  5IEO A;  3CNM A;  3CCV 3;  4L8O A;  5AII A;  4CCV A;  5D83 A;  1OCV A;  2B1X B;  3PZW A;  1YJN 3;  1WQL B;  3D9R A;  1UI8 A;  1Z1S A;  3HIG A;  1EG9 B;  1LNH A;  3ER7 A;  1CYU A;  3NBJ A;  3EN8 A;  1JKG A;  3WDG B;  3STD A;  3I55 3;  1ROA A;  3EBY A;  3GRD A;  2JDI H;  3ALA A;  1UUW B;  3FSD A;  1OHP A;  3UB1 A;  3DGN A;  2BMQ B;  2YFL B;  3RGR A;  2HMN B;  4EV2 A;  1GY5 A;  1JB4 A;  4OVM A;  2XR8 B;  1N5H A;  3V92 A;  3MPH A;  3EBT A;  2P09 A;  3B4O A;  4RBN A;  3Q2P A;  3SOA A;  1Q40 B;  4FCJ A;  1O7M B;  1O7H B;  3JUP A;  3WA3 A;  3PYJ A;  2QIY A;  2CG1 A;  4EC6 A;  1Y4K A;  1AVL A;  3NV0 B;  3WA2 X;  3LOY A;  2HMM B;  5IG0 A;  2Y73 A;  3CC2 3;  3Q90 A;  3G8Z A;  2BHM A;  1OHS A;  1W4N A;  4HZ9 B;  2RCD A;  4R9K A;  5G2G A;  3OWU A;  3EE1 A;  3LTD A;  4R4K A;  2INX A;  1D6Z A;  1IV9 A;  5JPU A;  2GXF A;  1S72 3;  3FF0 A;  1V74 A;  1VQ6 3;  8CHO A;  3DGM A;  3M8C A;  3AMO A;  3GZR A;  2JQ5 A;  5BVB A;  3VSY A;  1E3R A;  2CK3 H;  3LTB A;  4LSO A;  4HM7 B;  3KFQ C;  3F7S A;  4FR9 A;  1O7P B;  4FMB A;  1DVC A;  4IPB A;  2LYX A;  4KZ1 A;  1A67 A;  2BMO B;  3NBR A;  1IK3 A;  3IMA B;  4K1U A;  1LXE A;  5AIG A;  3X3Y A;  4XDV A;  2FNQ A;  3WOE B;  1WMP A;  1W6C A;  4LGQ A;  3OWY A;  2KCD A;  1Q82 4;  4XB5 A;  4JF8 A;  3SVA A;  1BUQ A;  2I9W A;  4TX4 A;  2OTL 3;  1NB3 I;  1STD A;  3NBB A;  5DRE A;  3J7Y d;  1AVK A;  2OOV C;  2CH9 A;  3QK9 A;  2HMO B;  5JPP A;  2XGN A;  1IU7 A;  3CCE 3;  2ZL8 A;  4I4K A;  3CD6 3;  2XFS A;  2E2T A;  1A2K A;  1KSI A;  1NDO B;  3OW2 2;  3CCL 3;  1N5P A;  4R80 A;  5AIF A;  2GEY A;  4O3V A;  2CHC A;  2WO0 A;  2YFJ B;  2XSO B;  3LT9 A;  1QAK A;  2B24 B;  4N3V A;  4IIA A;  1CQS A;  4O02 B;  1JNQ A;  3HI7 A;  1FGO A;  1K9M 4;  1JKG B;  4HM6 B;  3O8Y A;  2OTJ 3;  3MWZ A;  1KWI A;  1JV2 B;  3UL6 A;  5IG3 A;  2A15 A;  2W56 A;  1W02 A;  3FH1 A;  3PCS A;  4OK0 A;  1FGR A;  3IPT A;  3EN1 B;  1CYV A;  6STD A;  1M1K 4;  1IVW A;  1GD3 A;  2Z77 A;  4HM1 B;  1W5Z A;  3F8H A;  3I0Y A;  3BNC A;  3H51 A;  1IV7 A;  3X41 A;  1Q7Y 4;  4N6O B;  2O9U X;  3K0Z A;  3X3X A;  4R9L A;  3MG1 A;  2XFT A;  3MG2 A;  4EBG A;  7STD A;  1VQK 3;  3V98 A;  3ECF A;  3HII A;  2OQE A;  3F9S A;  1TFK A;  1M90 4;  5CF1 A;  3K63 A;  5AEU B;  1KD1 4;  3FG1 A;  3KE7 A;  3LTC A;  1YJ9 3;  4FMC A;  1LVN A;  3G16 A;  1N8R 4;  3GZX B;  1N8Q A;  3LH4 A;  4HYZ A;  3JUO A;  4LMI A;  1HU9 A;  1Q42 A;  2Z76 A;  5CK6 A;  2L4V A;  3VF1 A;  1QJG A;  4X2O A;  2XF3 A;  1ULJ B;  3EC9 A;  2XSH B;  4K1V A;  3V99 A;  1RRL A;  3X42 A;  1ISK A;  3HX8 A;  4EYC A;  1IT7 A;  3VGN A;  4L7K A;  3I56 3;  2Y74 A;  3U97 A;  2FXT A;  5HGR A;  4ZM8 A;  1FA3 A;  1VQ8 3;  2PNC A;  4MEI A;  1ASK A;  2OCT A;  4G1M B;  4QWT A;  1Q86 4;  4N6M A;  2BO9 B;  4MMZ B;  1W2Z A;  3GWR A;  3SOY A;  1MOL A;  1DMQ A;  3EJV A;  3KKG A;  1KC8 4;  1YHQ 3;  4XBX A;  2Z7A A;  1K8A 4;  2Z6B A;  5IW9 A;  1UI7 A;  3T8U A;  3T0U A;  2KXG A;  3NQY A;  3FKA A;  1DMN A;  1OF5 B;  4N6T A;  2C11 A;  1E3V A;  4XDW A;  1JB5 A;  2P0M A;  4AKY A;  1JB2 A;  4HBR A;  4BTY A;  3U1W A;  1OHO A;  3CNX A;  4KFD A;  5ELJ A;  4FMD A;  3RGA A;  4WP5 A;  1K73 4;  1ZX2 A;  3L0R A;  1GY7 A;  1GS3 A;  2WGQ A;  4HM4 B;  2SBL A;  5A0O B;  4HVN A;  3DUK A;  5DRV A;  1VQM 3;  1QVG 2;  1K28 A;  2V1L A;  2XH9 A;  1IVX A;  2GU1 A;  1GY6 A;  2W56 B;  3CME 3;  3CCQ 3;  3KII A;  3G4S 3;  4HM2 B;  3PXM A;  1JN5 B;  4Q53 A;  1A90 A;  3CMA 3;  2CC3 A;  1RRH A;  5IEP A;  1JJ2 2;  1OUN A;  4WYK B;  2W9Q A;  3JUM A;  1RJO A;  5KP4 A;  1KQS 2;  1RN7 A;  3F14 A;  3BNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...