2SARA

Determination and restrained least-squares refinement of the crystal structures of ribonuclease sa and its complex with 3'-guanylic acid at 1.8 angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE SA
publication title Determination and restrained least-squares refinement of the structures of ribonuclease Sa and its complex with 3'-guanylic acid at 1.8 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase (endoribonuclease)
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1990-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2sarA00
1B21A 4GSPA 3BIRA 2KF5A 1BOXA 1I2GA 1X1XA 1SARA 1B2UA 1LOWA 1BRNL 1DETA 1I2FA 1UCKA 1FZUA 3BU4A 3SYUA 1GSPA 2BU4A 2GSPA 1MGRA 4J5KA 2F5WA 1AQZA 1FYSA 2F5MA 1BAOA 1HZ1A 3A5EA 3D4AA 5BIRA 5RNTA 1FUSA 1IYYA 1TRQA 1BSCA 1I70A 1MGWA 3RNTA 1BUJA 1GOYA 8RNTA 1BNEA 2SARA 1TTOA 3DGYA 2F4YA 2RBIA 4J5GA 1RCLA 1GMQA 1GOUA 3D5GA 3D5IA 1T2HA 1YGWA 1YVSA 5GSPA 2KF3A 1BRKA 3URPA 3AGOA 1PYLA 1TRPA 1X1WA 1I3IA 1RGGA 1RGLA 1FW7A 1BRJA 1BSEA 1I2EA 2KF4A 3AHWA 1RGKA 1T2IA 1LRAA 5BU4A 1RTUA 3DH2A 1BU4A 1R4YA 2AAEA 2ZA4A 1RSNA 1I0VA 1B2XA 1LOVA 1RLSA 3GSPA 1G02A 1FUTA 4BU4A 1CH0A 1RN4A 3WR2A 1ZGXA 2F56A 1BSAA 1RMSA 2KAAA 3Q3FA 1BRHA 3HOHA 1RGFA 1BNIA 1I8VA 2C4BA 1JBSA 1DE3A 1UCIA 1RCKA 5HOHA 1HYFA 1BGSA 4HOHA 4HAAA 4GHOA 1RHLA 1BNJA 1RGAA 1X1UA 1BNFA 2AADA 6GSPA 1RNBA 9RNTA 1YNVX 1RNTA 1BVIA 1BRGA 2HOHA 4BIRA 1I0XA 1B2MA 1BANA 1B3SA 1BIRA 1GMPA 1RGEA 7RNTA 1Q9EA 1BSBA 1C54A 1B2SA 1RDSA 1GOVA 1B2ZA 3AHSA 1AY7A 1A2PA 1BNSA 1JBRA 1UCLA 2KF6A 1RGCA 1LOYA 1RN1A 1BNGA 2BIRA 1JBTA 3KCHA 4RNTA 1GMRA 2RNTA 1LNIA 1PY3A 1BRIA 1BNRA 1I3FA 1RGHA 3AGNA 1B27A 1B20A 7GSPA 1BRSA 1UCJA 6RNTA 1BSDA 1X1YA 3WHOA
chains in the Genus database with same CATH superfamily
1B21A 1HKXA 1U8CB 3G8ZA 1QJGA 4MJDA 1HU9A 5JPUA 3FSDA 1STFI 1JZOA 4IIAA 2ZL8A 3MG1A 2FXTA 1SARA 3N9HA 3LZAA 1LOWA 1DETA 1I2FA 1UCKA 1FZUA 3BU4A 3F40A 3NM7A 1GSPA 4XDVA 3V98A 4H61A 3CCE3 1IQ8A 3EBYA 5AYRB 3IMAB 5ELUA 3SX1A 3UL5A 5IF6A 1S723 3D4AA 5BIRA 2F5MA 1BAOA 1IVWA 1AR0A 1IVUA 3CCR3 1O7GB 2CG0A 1UDII 1IQXA 4FMDA 3A76A 1C7HA 3SVAA 1YIT3 1GOYA 1KD14 1US1A 3NBJA 4OVMA 1VQ83 1BNEA 5DRVA 2SARA 1TTOA 2Q07A 5ELJA 1JKGA 3VGNA 5KP1A 1Y4KA 2F4YA 1JKGB 3LT9A 1BUQA 2HMOB 4J5GA 1YHQ3 1OGXA 1R4CA 1NJI4 2CG1A 4OK0A 1KQS2 1VQ53 3ECFA 3EE1A 1LNHA 2B24B 2F98A 1BRKA 2KF3A 2J8XB 3URPA 3LTAA 4N6UA 2BO9B 3BNCA 4ZM8A 4MMXB 2LYXA 1E3VA 3DY5A 2OOVA 1I3IA 1RGGA 2XFTA 2XR8B 3PYJA 3CCV3 1RGKA 4IPBA 1PU4A 1LRAA 3UNLA 1BU4A 4KFFA 2XH9A 4LSOA 5AIIA 1FA3A 3LTDA 3O8YA 1M904 1JB4A 2AAEA 3SLUA 3MSOA 1OH0A 3GSPA 4H3UA 3I0YA 4AKZA 1RKYA 1AV4A 4BU4A 1CH0A 1RN4A 5IG0A 1IVXA 3B4PA 1FGRA 3LOYA 5AIGA 2YFJB 5IW9A 2YFIB 3B7CA 3MPHA 3CCS3 4HYZA 1ROVA 4HZBB 1KSIA 3GZXB 1I8VA 1O7HB 2C4BA 1JZDA 1E97A 1YGEA 3PGBA 4FMCA 1JBSA 3WDGB 1SPUA 1G0TA 1UCIA 1ROAA 1M9GA 1BGSA 3NQZA 4HOHA 5FGOA 3FCSB 1JNQA 1TJDA 3U1WA 2L4VA 1RGAA 2GBXB 2RSXA 2WOFA 1BNFA 5EQLA 3SOAA 1UGIA 2K3DA 3V99A 1RNTA 4XBXA 1WQLB 1BRGA 3UL6A 1KC84 4WHAA 4BIRA 2ZHXB 1F8NA 1I0XA 1IT7A 1K28A 2INXA 1O7WB 4LGQA 1B3SA 1TIJA 7RNTA 3DM8A 3LH4A 1Q9EA 1BSBA 3DXOA 4CPKA 2OOVC 1B2SA 1GOVA 2QIYA 1YVBI 1V57A 3F7XA 1Q7HA 3CCU3 1D6YA 1VQ43 1AY7A 5BVBA 1W2ZA 1A2PA 3T8NA 4O3VA 1BNSA 3WA2X 2W56A 2CX0A 1UCLA 3V92A 1RGCA 2W56B 1Q814 1AVLA 3CME3 2CH9A 1CYUA 2BIRA 3S27A 1JBTA 3EJVA 3NHXA 4R9KA 2IUKA 3Q1CA 3KCHA 1GS3A 2IMJA 1CEWI 1LNIA 1PY3A 1CYVA 1JN5A 1VZZA 3WOEB 1BNRA 2OTL3 1JN5B 1I3FA 1RGHA 2FNQA 1BRSA 3EB8A 1KWIA 2WGQA 1UCJA 2GU1A 2JQ5A 2MF7A 3N8BA 3PCRA 3OWUA 4FCMA 1MNLA 3U97A 3WHOA 6RNTA 5I97A 1TFKA 3PXMA 5LC6A 3BIRA 2W9PA 3RGAA 1BOXA 1I2GA 3NUVA 4KFDA 3T8UA 2H0HA 2IY2A 1VQO3 7STDA 1OGZA 1N8R4 2W04A 1JV2B 2Z6BA 3M8CA 4R4KA 3LTBA 1NO3A 1OPYA 1QMAA 4HM0B 1RJOA 1NB3I 4J5KA 3HIIA 2B1XB 2F5WA 3HK4A 3HIGA 5KP3A 2Y73A 1Q864 2IA7A 1TRQA 1UGHI 4AKYA 1MGWA 3ROBA 3LMLA 4XB5A 5G1LA 3IJEB 1DYUA 3EF8A 5AI1A 5AIFA 2OQEA 4EW5A 8RNTA 5IG4A 1DVCA 3X3ZA 2E2UA 1Q40A 2BMQB 3JUMA 4N3VA 2BHMA 3GZBA 4STDA 3D9RA 2CFGA 3G4S3 2D1WA 3DGYA 1ZX2A 1W6YA 5DREA 3S29A 2RBIA 5LC7A 2F99A 4Q53A 4WYKA 2Y74A 1GOUA 1W5ZA 3D5IA 1OF5A 3NM2A 2BT3A 4WYKB 2P05A 1OHOA 5IERA 3KSPA 5GSPA 1OF5B 1EKMA 3BNEA 1L5GB 4GL6A 3CC43 2HMLB 2RGQA 2HMMB 1K9M4 1ISKA 1DMNA 3AGOA 1PYLA 1TRPA 1O7NB 1UUGB 1N5PA 3D79A 1BRJA 1SQWA 1TU5A 2KF4A 3AHWA 4I5QA 4KVHA 5BU4A 1RTUA 2PNCA 3E99A 1N5HA 2Z7AA 4R80A 3FF2A 1SIHA 1WMPA 1YI23 5A0OB 3CCQ3 1RSNA 1B2XA 1LOVA 3AMOA 1FUTA 3PS8A 4O8SA 1N9JA 3AMOB 3WR2A 1ZGXA 3SEDA 3ER7A 5FW5A 1RMSA 4CDLA 1YIJ3 2QA43 2QGUA 1DE3A 1RCKA 3BNDA 3JUOA 3B4OA 2W9QA 2YX9A 3FKAA 3KN4A 3CU3A 2CFWA 1BNJA 3F8XA 2W2CA 3MYTA 2WGOA 1RNBA 3CPOA 4LZIA 2OCTA 1FGTA 1MOLA 4MMZB 4L8OA 2HOHA 1IK3A 4J9AA 1EG9B 5AYSC 4MEIA 1GY7A 3DGLA 2W03A 3ALAA 4K1UA 2C10A 1C54A 3Q90A 1MWRA 1RDSA 3X3YA 1W02A 1W7CA 3NV0A 4JRFA 1IV9A 1UI8A 1SJWA 3NV0B 3OWYA 3PZWA 2ML5A 4HM2B 3BLZA 5HGRA 8CHOA 2C11A 1GY5A 2KF6A 2I9WA 3FLJA 1TFOA 2P0XA 1N8QA 3EQQB 5AEWB 1OUNA 3JVCA 3N54B 4EV2A 2P09A 2CFLA 3JUQA 3DGNA 2CX1A 1IVVA 2CWTA 2QEX3 1YJ93 3X3XA 7GSPA 4QWTA 2GU3A 2RFRA 4BL2A 1UW1A 1BSDA 1EA2A 3G16A 3GRDA 4KT3B 1VQL3 4BTWA 1A2VA 3MG3A 4GSPA 1VQ93 1O7MB 2YFLB 1UUVB 3K9MC 1O7PB 1X1XA 5M1AA 4LMIA 4MMYB 5M18A 4RBNA 1B2UA 1W4NA 4N6MA 1BRNL 4X2HA 1QAKA 6STDA 3CCL3 1IT8A 3IPTA 4EV5A 2BMOB 4N6NB 3A5EA 2K54A 1HZ1A 5RNTA 2GEYA 1FUSA 1AVKA 1I70A 2KXGA 2CKFB 2CWUA 2A15A 3S5CA 3X41A 1MWTA 3L0RA 4R1KA 1K734 2XFSA 3CC23 1D6ZA 4FCZA 3KSED 1IV7A 3CCJ3 1PFPA 1GD3A 1W6GA 3D5GA 2HMJB 4DKIA 1YGWA 1YVSA 4BL3A 3CNXA 1TP6A 2RCDA 5STDA 3UJMA 1QAFA 1G96A 3T0UA 5IEPA 4WP5A 3ZG0A 3DUKA 1RGLA 5CF1A 2D42A 2ZDJA 3FG3A 1QVF2 1IU7A 1T2IA 4LYLB 4EBGA 3DZLA 1EUIC 1R4YA 4XBTA 1T5YA 3H51A 4N6TA 1Q824 4N6OB 2ZA4A 3OXAA 4K1VA 1I0VA 1G02A 1QALA 1RN7A 1T3BA 4HZ9B 1E3RA 4HM3B 2XGLA 3ZFZA 2E2VA 1VQQA 2F56A 1Q40B 2E2TA 1BSAA 4HM4B 4FMAA 3LT8A 1RGFA 4HBRA 5AEUB 1BNIA 1DMMA 3CMA3 2CK3H 4CCVA 1STDA 2Z77A 1SIIA 2ML6A 4OUQA 3WMDA 2UUGC 1HYFA 3FH1A 2LQVA 4HAAA 3MKIA 1NB5I 2XSHB 4EYCA 3F14A 2W0QA 3PCSA 5EEOA 2WO0A 1W6CA 2AADA 1JRQA 1S5AA 2H0GA 4TX4A 5EVHA 9RNTA 3G713 1BVIA 4HKVB 2XRXB 1RRHA 3EN1B 3OW22 4O02B 1ASKA 1WMNA 4U13A 5CK6A 1OHPA 3G6E3 1VQ73 4WWUC 1GMPA 3CD63 2BNGA 2CWVA 4CJNA 2M7OA 3GAXA 4N6V0 4GB5A 2SBLA 2CFKA 3VF1A 1LOXA 3DGMA 1DVDA 4G1MB 1B2ZA 3AHSA 4NREA 5G2GA 1GY6A 1WMOA 3D3LA 4HM1B 4O2HA 1N9EA 5D82A 5KP4A 1W01A 3EX9A 2F86B 3HZPA 1RRLA 3JUNA 2HMNB 1LOYA 2OQEC 1RN1A 2R4IA 3F8HA 3HX8A 4FCJA 1Q7Y4 1EQKA 1BNGA 4ORLA 1ZO2A 4N6LA 1EEJA 3K5TA 4JF8A 1IDPA 5BXQA 3GWRA 2OTJ3 4AEQA 2K0MA 4IT7A 3AGNA 1B27A 3DMCA 2H0IA 3CPW2 4WFOA 3K0ZA 4BTXA 4HJLB 1J2BA 4HM5B 3I563 4RNYA 2KF5A 2XF3A 1V58A 2W6JH 3GZRA 1LVNA 2FGTA 3KE7A 3S67A 1A90A 3SYUA 1CQSA 2BU4A 2GSPA 2UGIA 2XGNA 4FR9A 5JBSA 3NXJA 3CC73 1MGRA 3F9SA 1WNHA 3NBBA 3RGRA 1ZS7A 3F7SA 1AQZA 1FYSA 1UI7A 3WOFB 1K8A4 3FZWA 1IYYA 1BSCA 1OACA 2XSOB 3RDEA 2CIUA 3H3HA 4J8TA 2CHCA 3RNTA 4K90B 4XBYA 1BUJA 5IG3A 1VQK3 4EXRA 4HM8B 1LXEA 1A2KA 3GZYB 3I553 3K7CA 4I4KA 3MWZA 1FGMA 3VSYA 3SOYA 4X2OA 1GYBA 1RCLA 1GMQA 3K63A 4HM6B 4KZ1A 3CCM3 1FUWA 1W2B2 1T2HA 2KRTA 3OX9A 4RZMA 1Q42A 5IEOA 2O3OA 3MG2A 2IYJA 3KZTA 3HI7A 3LTCA 2IUJA 2BMRB 3ZG5A 1MWSA 2V1LA 1X1WA 2MC8A 1FW7A 1BSEA 1I2EA 4NHFA 3B8LA 3S28A 1W00A 4ILFA 1NWWA 3DH2A 3BNBA 3FGYA 5G1KA 1UUWB 3EHCA 1V74A 3KIIA 3SXXA 3OWSA 5CF2A 1VQP3 3FG1A 1RLSA 3WODG 1M1K4 4KFEA 1IQYA 1VQN3 1OHSA 2WOHA 3OV4A 1FGOA 3LYGA 3G0KA 1WTHA 3Q3FA 2KAAA 1LQGC 4HM7B 1BRHA 3HOHA 5IENA 1YJN3 5M19A 2PZVA 4PEJA 1GD4A 2KCDA 3LXUX 1TUHA 1K41A 5CLKA 4FMBA 3KFQC 1NU3A 5D83A 5HOHA 5IG5A 2P0MA 1D6UA 3MHEA 1VQM3 2GXFA 2P38A 1RHLA 4GHOA 3Q2PA 4HVNA 3UB1A 1X1UA 6GSPA 1MWUA 2STDA 1LQMB 1YNVX 2HMKB 3BB9A 2JDIH 3JUPA 4XDWA 1DMQA 3KKGA 1QVG2 4K61A 4EC6A 1B2MA 1BANA 5JPPA 1BIRA 1RGEA 1U5OA 2R41A 3EBTA 3QRDA 2O9UX 1ULIB 2CW9A 5D81A 5TGNA 2GEXA 2Z76A 3FF0A 3FG4A 3NX0A 3WA3A 3X40A 3CNMA 2GBWB 2CC3A 1M1XB 2CFDA 3J7Yd 1JBRA 2L1SA 3STDA 3NBRA 4NPBA 3EN8A 3TDGA 4BTYA 3QK9A 1OCVA 4RNTA 5AIHA 1ULJB 1GMRA 3NQYA 2RNTA 3EC9A 3DGOA 5CXOA 1JB5A 1JB2A 1Z1SA 2OWPA 2UX0A 1A67A 4RNZA 4L7KA 1BRIA 4XM4A 3X42A 2XEPA 3CXC2 1VQ63 1B20A 4R9LA 1NNVA 4LEHA 4L8PA 1NDOB 1JJ22 1FGQA 1X1YA 1YJW3
chains in the Genus database with same CATH topology
1B21A 4GSPA 3BIRA 2KF5A 1BOXA 1I2GA 1X1XA 1SARA 1B2UA 1LOWA 1BRNL 1DETA 1I2FA 1UCKA 1FZUA 3BU4A 3SYUA 1GSPA 2BU4A 2GSPA 1MGRA 4J5KA 2F5WA 1AQZA 1FYSA 2F5MA 1BAOA 1HZ1A 3A5EA 3D4AA 5BIRA 5RNTA 1FUSA 1IYYA 1TRQA 1BSCA 1I70A 1MGWA 3RNTA 1BUJA 1GOYA 8RNTA 1BNEA 2SARA 1TTOA 3DGYA 2F4YA 2RBIA 4J5GA 1RCLA 1GMQA 1GOUA 3D5GA 3D5IA 1T2HA 1YGWA 1YVSA 5GSPA 2KF3A 1BRKA 3URPA 3AGOA 1PYLA 1TRPA 1X1WA 1I3IA 1RGGA 1RGLA 1FW7A 1BRJA 1BSEA 1I2EA 2KF4A 3AHWA 1RGKA 1T2IA 1LRAA 5BU4A 1RTUA 3DH2A 1BU4A 1R4YA 2AAEA 2ZA4A 1RSNA 1I0VA 1B2XA 1LOVA 1RLSA 3GSPA 1G02A 1FUTA 4BU4A 1CH0A 1RN4A 3WR2A 1ZGXA 2F56A 1BSAA 1RMSA 2KAAA 3Q3FA 1BRHA 3HOHA 1RGFA 1BNIA 1I8VA 2C4BA 1JBSA 1DE3A 1UCIA 1RCKA 5HOHA 1HYFA 1BGSA 4HOHA 4HAAA 4GHOA 1RHLA 1BNJA 1RGAA 1X1UA 1BNFA 2AADA 6GSPA 1RNBA 9RNTA 1YNVX 1RNTA 1BVIA 1BRGA 2HOHA 4BIRA 1I0XA 1B2MA 1BANA 1B3SA 1BIRA 1GMPA 1RGEA 7RNTA 1Q9EA 1BSBA 1C54A 1B2SA 1RDSA 1GOVA 1B2ZA 3AHSA 1AY7A 1A2PA 1BNSA 1JBRA 1UCLA 2KF6A 1RGCA 1LOYA 1RN1A 1BNGA 2BIRA 1JBTA 3KCHA 4RNTA 1GMRA 2RNTA 1LNIA 1PY3A 1BRIA 1BNRA 1I3FA 1RGHA 3AGNA 1B27A 1B20A 7GSPA 1BRSA 1UCJA 6RNTA 1BSDA 1X1YA 3WHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B21 A;  4GSP A;  3BIR A;  2KF5 A;  1BOX A;  1I2G A;  1X1X A;  1SAR A;  1B2U A;  1LOW A;  1BRN L;  1DET A;  1I2F A;  1UCK A;  1FZU A;  3BU4 A;  3SYU A;  1GSP A;  2BU4 A;  2GSP A;  1MGR A;  4J5K A;  2F5W A;  1AQZ A;  1FYS A;  2F5M A;  1BAO A;  1HZ1 A;  3A5E A;  3D4A A;  5BIR A;  5RNT A;  1FUS A;  1IYY A;  1TRQ A;  1BSC A;  1I70 A;  1MGW A;  3RNT A;  1BUJ A;  1GOY A;  8RNT A;  1BNE A;  2SAR A;  1TTO A;  3DGY A;  2F4Y A;  2RBI A;  4J5G A;  1RCL A;  1GMQ A;  1GOU A;  3D5G A;  3D5I A;  1T2H A;  1YGW A;  1YVS A;  5GSP A;  2KF3 A;  1BRK A;  3URP A;  3AGO A;  1PYL A;  1TRP A;  1X1W A;  1I3I A;  1RGG A;  1RGL A;  1FW7 A;  1BRJ A;  1BSE A;  1I2E A;  2KF4 A;  3AHW A;  1RGK A;  1T2I A;  1LRA A;  5BU4 A;  1RTU A;  3DH2 A;  1BU4 A;  1R4Y A;  2AAE A;  2ZA4 A;  1RSN A;  1I0V A;  1B2X A;  1LOV A;  1RLS A;  3GSP A;  1G02 A;  1FUT A;  4BU4 A;  1CH0 A;  1RN4 A;  3WR2 A;  1ZGX A;  2F56 A;  1BSA A;  1RMS A;  2KAA A;  3Q3F A;  1BRH A;  3HOH A;  1RGF A;  1BNI A;  1I8V A;  2C4B A;  1JBS A;  1DE3 A;  1UCI A;  1RCK A;  5HOH A;  1HYF A;  1BGS A;  4HOH A;  4HAA A;  4GHO A;  1RHL A;  1BNJ A;  1RGA A;  1X1U A;  1BNF A;  2AAD A;  6GSP A;  1RNB A;  9RNT A;  1YNV X;  1RNT A;  1BVI A;  1BRG A;  2HOH A;  4BIR A;  1I0X A;  1B2M A;  1BAN A;  1B3S A;  1BIR A;  1GMP A;  1RGE A;  7RNT A;  1Q9E A;  1BSB A;  1C54 A;  1B2S A;  1RDS A;  1GOV A;  1B2Z A;  3AHS A;  1AY7 A;  1A2P A;  1BNS A;  1JBR A;  1UCL A;  2KF6 A;  1RGC A;  1LOY A;  1RN1 A;  1BNG A;  2BIR A;  1JBT A;  3KCH A;  4RNT A;  1GMR A;  2RNT A;  1LNI A;  1PY3 A;  1BRI A;  1BNR A;  1I3F A;  1RGH A;  3AGN A;  1B27 A;  1B20 A;  7GSP A;  1BRS A;  1UCJ A;  6RNT A;  1BSD A;  1X1Y A;  3WHO A; 
#chains in the Genus database with same CATH topology
 1B21 A;  1HKX A;  1U8C B;  3G8Z A;  1QJG A;  4MJD A;  1HU9 A;  5JPU A;  3FSD A;  1STF I;  1JZO A;  4IIA A;  2ZL8 A;  3MG1 A;  2FXT A;  1SAR A;  3N9H A;  3LZA A;  1LOW A;  1DET A;  1I2F A;  1UCK A;  1FZU A;  3BU4 A;  3F40 A;  3NM7 A;  1GSP A;  4XDV A;  3V98 A;  4H61 A;  3CCE 3;  1IQ8 A;  3EBY A;  5AYR B;  3IMA B;  5ELU A;  3SX1 A;  3UL5 A;  5IF6 A;  1S72 3;  3D4A A;  5BIR A;  2F5M A;  1BAO A;  1IVW A;  1AR0 A;  1IVU A;  3CCR 3;  1O7G B;  2CG0 A;  1UDI I;  1IQX A;  4FMD A;  3A76 A;  1C7H A;  3SVA A;  1YIT 3;  1GOY A;  1KD1 4;  1US1 A;  3NBJ A;  4OVM A;  1VQ8 3;  1BNE A;  5DRV A;  2SAR A;  1TTO A;  2Q07 A;  5ELJ A;  1JKG A;  3VGN A;  5KP1 A;  1Y4K A;  2F4Y A;  1JKG B;  3LT9 A;  1BUQ A;  2HMO B;  4J5G A;  1YHQ 3;  1OGX A;  1R4C A;  1NJI 4;  2CG1 A;  4OK0 A;  1KQS 2;  1VQ5 3;  3ECF A;  3EE1 A;  1LNH A;  2B24 B;  2F98 A;  1BRK A;  2KF3 A;  2J8X B;  3URP A;  3LTA A;  4N6U A;  2BO9 B;  3BNC A;  4ZM8 A;  4MMX B;  2LYX A;  1E3V A;  3DY5 A;  2OOV A;  1I3I A;  1RGG A;  2XFT A;  2XR8 B;  3PYJ A;  3CCV 3;  1RGK A;  4IPB A;  1PU4 A;  1LRA A;  3UNL A;  1BU4 A;  4KFF A;  2XH9 A;  4LSO A;  5AII A;  1FA3 A;  3LTD A;  3O8Y A;  1M90 4;  1JB4 A;  2AAE A;  3SLU A;  3MSO A;  1OH0 A;  3GSP A;  4H3U A;  3I0Y A;  4AKZ A;  1RKY A;  1AV4 A;  4BU4 A;  1CH0 A;  1RN4 A;  5IG0 A;  1IVX A;  3B4P A;  1FGR A;  3LOY A;  5AIG A;  2YFJ B;  5IW9 A;  2YFI B;  3B7C A;  3MPH A;  3CCS 3;  4HYZ A;  1ROV A;  4HZB B;  1KSI A;  3GZX B;  1I8V A;  1O7H B;  2C4B A;  1JZD A;  1E97 A;  1YGE A;  3PGB A;  4FMC A;  1JBS A;  3WDG B;  1SPU A;  1G0T A;  1UCI A;  1ROA A;  1M9G A;  1BGS A;  3NQZ A;  4HOH A;  5FGO A;  3FCS B;  1JNQ A;  1TJD A;  3U1W A;  2L4V A;  1RGA A;  2GBX B;  2RSX A;  2WOF A;  1BNF A;  5EQL A;  3SOA A;  1UGI A;  2K3D A;  3V99 A;  1RNT A;  4XBX A;  1WQL B;  1BRG A;  3UL6 A;  1KC8 4;  4WHA A;  4BIR A;  2ZHX B;  1F8N A;  1I0X A;  1IT7 A;  1K28 A;  2INX A;  1O7W B;  4LGQ A;  1B3S A;  1TIJ A;  7RNT A;  3DM8 A;  3LH4 A;  1Q9E A;  1BSB A;  3DXO A;  4CPK A;  2OOV C;  1B2S A;  1GOV A;  2QIY A;  1YVB I;  1V57 A;  3F7X A;  1Q7H A;  3CCU 3;  1D6Y A;  1VQ4 3;  1AY7 A;  5BVB A;  1W2Z A;  1A2P A;  3T8N A;  4O3V A;  1BNS A;  3WA2 X;  2W56 A;  2CX0 A;  1UCL A;  3V92 A;  1RGC A;  2W56 B;  1Q81 4;  1AVL A;  3CME 3;  2CH9 A;  1CYU A;  2BIR A;  3S27 A;  1JBT A;  3EJV A;  3NHX A;  4R9K A;  2IUK A;  3Q1C A;  3KCH A;  1GS3 A;  2IMJ A;  1CEW I;  1LNI A;  1PY3 A;  1CYV A;  1JN5 A;  1VZZ A;  3WOE B;  1BNR A;  2OTL 3;  1JN5 B;  1I3F A;  1RGH A;  2FNQ A;  1BRS A;  3EB8 A;  1KWI A;  2WGQ A;  1UCJ A;  2GU1 A;  2JQ5 A;  2MF7 A;  3N8B A;  3PCR A;  3OWU A;  4FCM A;  1MNL A;  3U97 A;  3WHO A;  6RNT A;  5I97 A;  1TFK A;  3PXM A;  5LC6 A;  3BIR A;  2W9P A;  3RGA A;  1BOX A;  1I2G A;  3NUV A;  4KFD A;  3T8U A;  2H0H A;  2IY2 A;  1VQO 3;  7STD A;  1OGZ A;  1N8R 4;  2W04 A;  1JV2 B;  2Z6B A;  3M8C A;  4R4K A;  3LTB A;  1NO3 A;  1OPY A;  1QMA A;  4HM0 B;  1RJO A;  1NB3 I;  4J5K A;  3HII A;  2B1X B;  2F5W A;  3HK4 A;  3HIG A;  5KP3 A;  2Y73 A;  1Q86 4;  2IA7 A;  1TRQ A;  1UGH I;  4AKY A;  1MGW A;  3ROB A;  3LML A;  4XB5 A;  5G1L A;  3IJE B;  1DYU A;  3EF8 A;  5AI1 A;  5AIF A;  2OQE A;  4EW5 A;  8RNT A;  5IG4 A;  1DVC A;  3X3Z A;  2E2U A;  1Q40 A;  2BMQ B;  3JUM A;  4N3V A;  2BHM A;  3GZB A;  4STD A;  3D9R A;  2CFG A;  3G4S 3;  2D1W A;  3DGY A;  1ZX2 A;  1W6Y A;  5DRE A;  3S29 A;  2RBI A;  5LC7 A;  2F99 A;  4Q53 A;  4WYK A;  2Y74 A;  1GOU A;  1W5Z A;  3D5I A;  1OF5 A;  3NM2 A;  2BT3 A;  4WYK B;  2P05 A;  1OHO A;  5IER A;  3KSP A;  5GSP A;  1OF5 B;  1EKM A;  3BNE A;  1L5G B;  4GL6 A;  3CC4 3;  2HML B;  2RGQ A;  2HMM B;  1K9M 4;  1ISK A;  1DMN A;  3AGO A;  1PYL A;  1TRP A;  1O7N B;  1UUG B;  1N5P A;  3D79 A;  1BRJ A;  1SQW A;  1TU5 A;  2KF4 A;  3AHW A;  4I5Q A;  4KVH A;  5BU4 A;  1RTU A;  2PNC A;  3E99 A;  1N5H A;  2Z7A A;  4R80 A;  3FF2 A;  1SIH A;  1WMP A;  1YI2 3;  5A0O B;  3CCQ 3;  1RSN A;  1B2X A;  1LOV A;  3AMO A;  1FUT A;  3PS8 A;  4O8S A;  1N9J A;  3AMO B;  3WR2 A;  1ZGX A;  3SED A;  3ER7 A;  5FW5 A;  1RMS A;  4CDL A;  1YIJ 3;  2QA4 3;  2QGU A;  1DE3 A;  1RCK A;  3BND A;  3JUO A;  3B4O A;  2W9Q A;  2YX9 A;  3FKA A;  3KN4 A;  3CU3 A;  2CFW A;  1BNJ A;  3F8X A;  2W2C A;  3MYT A;  2WGO A;  1RNB A;  3CPO A;  4LZI A;  2OCT A;  1FGT A;  1MOL A;  4MMZ B;  4L8O A;  2HOH A;  1IK3 A;  4J9A A;  1EG9 B;  5AYS C;  4MEI A;  1GY7 A;  3DGL A;  2W03 A;  3ALA A;  4K1U A;  2C10 A;  1C54 A;  3Q90 A;  1MWR A;  1RDS A;  3X3Y A;  1W02 A;  1W7C A;  3NV0 A;  4JRF A;  1IV9 A;  1UI8 A;  1SJW A;  3NV0 B;  3OWY A;  3PZW A;  2ML5 A;  4HM2 B;  3BLZ A;  5HGR A;  8CHO A;  2C11 A;  1GY5 A;  2KF6 A;  2I9W A;  3FLJ A;  1TFO A;  2P0X A;  1N8Q A;  3EQQ B;  5AEW B;  1OUN A;  3JVC A;  3N54 B;  4EV2 A;  2P09 A;  2CFL A;  3JUQ A;  3DGN A;  2CX1 A;  1IVV A;  2CWT A;  2QEX 3;  1YJ9 3;  3X3X A;  7GSP A;  4QWT A;  2GU3 A;  2RFR A;  4BL2 A;  1UW1 A;  1BSD A;  1EA2 A;  3G16 A;  3GRD A;  4KT3 B;  1VQL 3;  4BTW A;  1A2V A;  3MG3 A;  4GSP A;  1VQ9 3;  1O7M B;  2YFL B;  1UUV B;  3K9M C;  1O7P B;  1X1X A;  5M1A A;  4LMI A;  4MMY B;  5M18 A;  4RBN A;  1B2U A;  1W4N A;  4N6M A;  1BRN L;  4X2H A;  1QAK A;  6STD A;  3CCL 3;  1IT8 A;  3IPT A;  4EV5 A;  2BMO B;  4N6N B;  3A5E A;  2K54 A;  1HZ1 A;  5RNT A;  2GEY A;  1FUS A;  1AVK A;  1I70 A;  2KXG A;  2CKF B;  2CWU A;  2A15 A;  3S5C A;  3X41 A;  1MWT A;  3L0R A;  4R1K A;  1K73 4;  2XFS A;  3CC2 3;  1D6Z A;  4FCZ A;  3KSE D;  1IV7 A;  3CCJ 3;  1PFP A;  1GD3 A;  1W6G A;  3D5G A;  2HMJ B;  4DKI A;  1YGW A;  1YVS A;  4BL3 A;  3CNX A;  1TP6 A;  2RCD A;  5STD A;  3UJM A;  1QAF A;  1G96 A;  3T0U A;  5IEP A;  4WP5 A;  3ZG0 A;  3DUK A;  1RGL A;  5CF1 A;  2D42 A;  2ZDJ A;  3FG3 A;  1QVF 2;  1IU7 A;  1T2I A;  4LYL B;  4EBG A;  3DZL A;  1EUI C;  1R4Y A;  4XBT A;  1T5Y A;  3H51 A;  4N6T A;  1Q82 4;  4N6O B;  2ZA4 A;  3OXA A;  4K1V A;  1I0V A;  1G02 A;  1QAL A;  1RN7 A;  1T3B A;  4HZ9 B;  1E3R A;  4HM3 B;  2XGL A;  3ZFZ A;  2E2V A;  1VQQ A;  2F56 A;  1Q40 B;  2E2T A;  1BSA A;  4HM4 B;  4FMA A;  3LT8 A;  1RGF A;  4HBR A;  5AEU B;  1BNI A;  1DMM A;  3CMA 3;  2CK3 H;  4CCV A;  1STD A;  2Z77 A;  1SII A;  2ML6 A;  4OUQ A;  3WMD A;  2UUG C;  1HYF A;  3FH1 A;  2LQV A;  4HAA A;  3MKI A;  1NB5 I;  2XSH B;  4EYC A;  3F14 A;  2W0Q A;  3PCS A;  5EEO A;  2WO0 A;  1W6C A;  2AAD A;  1JRQ A;  1S5A A;  2H0G A;  4TX4 A;  5EVH A;  9RNT A;  3G71 3;  1BVI A;  4HKV B;  2XRX B;  1RRH A;  3EN1 B;  3OW2 2;  4O02 B;  1ASK A;  1WMN A;  4U13 A;  5CK6 A;  1OHP A;  3G6E 3;  1VQ7 3;  4WWU C;  1GMP A;  3CD6 3;  2BNG A;  2CWV A;  4CJN A;  2M7O A;  3GAX A;  4N6V 0;  4GB5 A;  2SBL A;  2CFK A;  3VF1 A;  1LOX A;  3DGM A;  1DVD A;  4G1M B;  1B2Z A;  3AHS A;  4NRE A;  5G2G A;  1GY6 A;  1WMO A;  3D3L A;  4HM1 B;  4O2H A;  1N9E A;  5D82 A;  5KP4 A;  1W01 A;  3EX9 A;  2F86 B;  3HZP A;  1RRL A;  3JUN A;  2HMN B;  1LOY A;  2OQE C;  1RN1 A;  2R4I A;  3F8H A;  3HX8 A;  4FCJ A;  1Q7Y 4;  1EQK A;  1BNG A;  4ORL A;  1ZO2 A;  4N6L A;  1EEJ A;  3K5T A;  4JF8 A;  1IDP A;  5BXQ A;  3GWR A;  2OTJ 3;  4AEQ A;  2K0M A;  4IT7 A;  3AGN A;  1B27 A;  3DMC A;  2H0I A;  3CPW 2;  4WFO A;  3K0Z A;  4BTX A;  4HJL B;  1J2B A;  4HM5 B;  3I56 3;  4RNY A;  2KF5 A;  2XF3 A;  1V58 A;  2W6J H;  3GZR A;  1LVN A;  2FGT A;  3KE7 A;  3S67 A;  1A90 A;  3SYU A;  1CQS A;  2BU4 A;  2GSP A;  2UGI A;  2XGN A;  4FR9 A;  5JBS A;  3NXJ A;  3CC7 3;  1MGR A;  3F9S A;  1WNH A;  3NBB A;  3RGR A;  1ZS7 A;  3F7S A;  1AQZ A;  1FYS A;  1UI7 A;  3WOF B;  1K8A 4;  3FZW A;  1IYY A;  1BSC A;  1OAC A;  2XSO B;  3RDE A;  2CIU A;  3H3H A;  4J8T A;  2CHC A;  3RNT A;  4K90 B;  4XBY A;  1BUJ A;  5IG3 A;  1VQK 3;  4EXR A;  4HM8 B;  1LXE A;  1A2K A;  3GZY B;  3I55 3;  3K7C A;  4I4K A;  3MWZ A;  1FGM A;  3VSY A;  3SOY A;  4X2O A;  1GYB A;  1RCL A;  1GMQ A;  3K63 A;  4HM6 B;  4KZ1 A;  3CCM 3;  1FUW A;  1W2B 2;  1T2H A;  2KRT A;  3OX9 A;  4RZM A;  1Q42 A;  5IEO A;  2O3O A;  3MG2 A;  2IYJ A;  3KZT A;  3HI7 A;  3LTC A;  2IUJ A;  2BMR B;  3ZG5 A;  1MWS A;  2V1L A;  1X1W A;  2MC8 A;  1FW7 A;  1BSE A;  1I2E A;  4NHF A;  3B8L A;  3S28 A;  1W00 A;  4ILF A;  1NWW A;  3DH2 A;  3BNB A;  3FGY A;  5G1K A;  1UUW B;  3EHC A;  1V74 A;  3KII A;  3SXX A;  3OWS A;  5CF2 A;  1VQP 3;  3FG1 A;  1RLS A;  3WOD G;  1M1K 4;  4KFE A;  1IQY A;  1VQN 3;  1OHS A;  2WOH A;  3OV4 A;  1FGO A;  3LYG A;  3G0K A;  1WTH A;  3Q3F A;  2KAA A;  1LQG C;  4HM7 B;  1BRH A;  3HOH A;  5IEN A;  1YJN 3;  5M19 A;  2PZV A;  4PEJ A;  1GD4 A;  2KCD A;  3LXU X;  1TUH A;  1K41 A;  5CLK A;  4FMB A;  3KFQ C;  1NU3 A;  5D83 A;  5HOH A;  5IG5 A;  2P0M A;  1D6U A;  3MHE A;  1VQM 3;  2GXF A;  2P38 A;  1RHL A;  4GHO A;  3Q2P A;  4HVN A;  3UB1 A;  1X1U A;  6GSP A;  1MWU A;  2STD A;  1LQM B;  1YNV X;  2HMK B;  3BB9 A;  2JDI H;  3JUP A;  4XDW A;  1DMQ A;  3KKG A;  1QVG 2;  4K61 A;  4EC6 A;  1B2M A;  1BAN A;  5JPP A;  1BIR A;  1RGE A;  1U5O A;  2R41 A;  3EBT A;  3QRD A;  2O9U X;  1ULI B;  2CW9 A;  5D81 A;  5TGN A;  2GEX A;  2Z76 A;  3FF0 A;  3FG4 A;  3NX0 A;  3WA3 A;  3X40 A;  3CNM A;  2GBW B;  2CC3 A;  1M1X B;  2CFD A;  3J7Y d;  1JBR A;  2L1S A;  3STD A;  3NBR A;  4NPB A;  3EN8 A;  3TDG A;  4BTY A;  3QK9 A;  1OCV A;  4RNT A;  5AIH A;  1ULJ B;  1GMR A;  3NQY A;  2RNT A;  3EC9 A;  3DGO A;  5CXO A;  1JB5 A;  1JB2 A;  1Z1S A;  2OWP A;  2UX0 A;  1A67 A;  4RNZ A;  4L7K A;  1BRI A;  4XM4 A;  3X42 A;  2XEP A;  3CXC 2;  1VQ6 3;  1B20 A;  4R9L A;  1NNV A;  4LEH A;  4L8P A;  1NDO B;  1JJ2 2;  1FGQ A;  1X1Y A;  1YJW 3; 
#chains in the Genus database with same CATH homology
 1B21 A;  4GSP A;  3BIR A;  2KF5 A;  1BOX A;  1I2G A;  1X1X A;  1SAR A;  1B2U A;  1LOW A;  1BRN L;  1DET A;  1I2F A;  1UCK A;  1FZU A;  3BU4 A;  3SYU A;  1GSP A;  2BU4 A;  2GSP A;  1MGR A;  4J5K A;  2F5W A;  1AQZ A;  1FYS A;  2F5M A;  1BAO A;  1HZ1 A;  3A5E A;  3D4A A;  5BIR A;  5RNT A;  1FUS A;  1IYY A;  1TRQ A;  1BSC A;  1I70 A;  1MGW A;  3RNT A;  1BUJ A;  1GOY A;  8RNT A;  1BNE A;  2SAR A;  1TTO A;  3DGY A;  2F4Y A;  2RBI A;  4J5G A;  1RCL A;  1GMQ A;  1GOU A;  3D5G A;  3D5I A;  1T2H A;  1YGW A;  1YVS A;  5GSP A;  2KF3 A;  1BRK A;  3URP A;  3AGO A;  1PYL A;  1TRP A;  1X1W A;  1I3I A;  1RGG A;  1RGL A;  1FW7 A;  1BRJ A;  1BSE A;  1I2E A;  2KF4 A;  3AHW A;  1RGK A;  1T2I A;  1LRA A;  5BU4 A;  1RTU A;  3DH2 A;  1BU4 A;  1R4Y A;  2AAE A;  2ZA4 A;  1RSN A;  1I0V A;  1B2X A;  1LOV A;  1RLS A;  3GSP A;  1G02 A;  1FUT A;  4BU4 A;  1CH0 A;  1RN4 A;  3WR2 A;  1ZGX A;  2F56 A;  1BSA A;  1RMS A;  2KAA A;  3Q3F A;  1BRH A;  3HOH A;  1RGF A;  1BNI A;  1I8V A;  2C4B A;  1JBS A;  1DE3 A;  1UCI A;  1RCK A;  5HOH A;  1HYF A;  1BGS A;  4HOH A;  4HAA A;  4GHO A;  1RHL A;  1BNJ A;  1RGA A;  1X1U A;  1BNF A;  2AAD A;  6GSP A;  1RNB A;  9RNT A;  1YNV X;  1RNT A;  1BVI A;  1BRG A;  2HOH A;  4BIR A;  1I0X A;  1B2M A;  1BAN A;  1B3S A;  1BIR A;  1GMP A;  1RGE A;  7RNT A;  1Q9E A;  1BSB A;  1C54 A;  1B2S A;  1RDS A;  1GOV A;  1B2Z A;  3AHS A;  1AY7 A;  1A2P A;  1BNS A;  1JBR A;  1UCL A;  2KF6 A;  1RGC A;  1LOY A;  1RN1 A;  1BNG A;  2BIR A;  1JBT A;  3KCH A;  4RNT A;  1GMR A;  2RNT A;  1LNI A;  1PY3 A;  1BRI A;  1BNR A;  1I3F A;  1RGH A;  3AGN A;  1B27 A;  1B20 A;  7GSP A;  1BRS A;  1UCJ A;  6RNT A;  1BSD A;  1X1Y A;  3WHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...