2SARA

Determination and restrained least-squares refinement of the crystal structures of ribonuclease sa and its complex with 3'-guanylic acid at 1.8 angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination and restrained least-squares refinement of the structures of ribonuclease Sa and its complex with 3'-guanylic acid at 1.8 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase (endoribonuclease)
molecule keywords RIBONUCLEASE SA
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1990-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2sarA00
1RN1A 1T2HA 2BU4A 1BNSA 1GMPA 1RGKA 1DETA 1BNFA 1BNIA 1YNVX 1JBRA 1RNTA 1BSEA 9RNTA 3BU4A 1T2IA 1BRHA 1BSBA 1RDSA 4J5GA 3SYUA 1LOYA 2HOHA 1TRPA 1BAOA 1FYSA 1I2EA 6RNTA 1BSDA 2ZA4A 5BIRA 1UCJA 1X1YA 1RGLA 3AGOA 1LOVA 1GMQA 4HAAA 4RNTA 1BU4A 3BIRA 2F56A 1JBTA 1B2UA 3HOHA 1RMSA 1X1UA 1BNGA 3A5EA 1BUJA 2AADA 3AGNA 2KF3A 1UCIA 1I2FA 1A2PA 1MGRA 1BVIA 1BRSA 1BANA 1B21A 1I0XA 3DGYA 1RGAA 3DH2A 1B20A 1RGFA 1I2GA 1Q9EA 3RNTA 1RNBA 1BNRA 4HOHA 1YGWA 1ZGXA 1BRKA 1BSCA 3D5IA 1I3IA 4GHOA 1RGGA 2GSPA 1RGHA 5BU4A 2RNTA 1GOYA 1RTUA 1DE3A 1GSPA 1RLSA 1RN4A 7GSPA 1TTOA 1UCKA 5GSPA 1YVSA 1B2XA 4BIRA 1JBSA 3Q3FA 1B3SA 1GMRA 1CH0A 2C4BA 1BRJA 1BSAA 1I70A 1C54A 8RNTA 1RGEA 1G02A 1GOVA 1LOWA 1B2SA 1I8VA 2RBIA 1FW7A 1HYFA 2F5WA 1RGCA 1TRQA 1UCLA 1RHLA 1SARA 1X1WA 1BGSA 1X1XA 5HOHA 4BU4A 2KAAA 3D4AA 1IYYA 1LNIA 1FZUA 1FUTA 7RNTA 1HZ1A 1B2ZA 2F5MA 3KCHA 1PYLA 2KF6A 2AAEA 3URPA 1RCKA 2KF4A 2F4YA 3AHWA 1BRGA 6GSPA 2KF5A 4GSPA 1BRIA 1BNEA 2BIRA 2SARA 3WR2A 1PY3A 1RSNA 1AY7A 1AQZA 4J5KA 1GOUA 1I3FA 1LRAA 1R4YA 1I0VA 1B27A 1RCLA 1B2MA 1BRNL 3WHOA 1BOXA 1MGWA 3GSPA 1BIRA 1BNJA 5RNTA 3AHSA 1FUSA 3D5GA
chains in the Genus database with same CATH superfamily
1RN1A 4X2OA 1T2HA 5IEOA 1ROVA 1FGOA 3LH4A 3S29A 3VF1A 4HM1B 3NV0A 3NHXA 3CCJ3 2J8XB 1IV9A 5M1AA 1BNIA 3KN4A 2BMOB 2WO0A 4CCVA 1VQL3 4FMAA 2UGIA 1BSEA 3WODG 4CPKA 9RNTA 3FZWA 1TP6A 3G713 3CME3 1N5PA 4LMIA 4BL2A 2BMRB 1O7HB 2XGNA 1JRQA 3ER7A 1AR0A 1R4CA 3JUMA 2STDA 4HKVB 1KQS2 2HOHA 4OVMA 1BAOA 2OWPA 3SOAA 3F9SA 3ZG0A 1V58A 4NREA 1VQM3 1TIJA 2RCDA 1LOVA 2CFKA 3BIRA 3HX8A 2F56A 4NPBA 5CF1A 2OOVA 1QJGA 3FKAA 3RGRA 4LZIA 3HOHA 1RMSA 4BTYA 2K0MA 1X1UA 4KZ1A 1JB4A 3RGAA 3F14A 1IVXA 1OGZA 1QVG2 3F8XA 3LT9A 3AGNA 2KF3A 2CWTA 1N9JA 3NUVA 5EEOA 2WOHA 1UCIA 3HI7A 5KP3A 1SQWA 1W2B2 1TFKA 4XM4A 2OCTA 3CNXA 4RZMA 1BANA 1DMQA 4Q53A 2YX9A 3FLJA 3NQYA 3VGNA 1RGAA 1OHPA 1GY7A 4KVHA 3H51A 4TX4A 1OACA 2FNQA 5AYRB 1W4NA 3A76A 3AMOB 4MMZB 3EC9A 3F40A 3GZXB 2WGQA 5CLKA 2GSPA 1A2VA 4XBTA 1US1A 3K5TA 1STFI 1RLSA 4MMYB 4R4KA 2GBWB 4FCMA 2XSHB 3DZLA 4HZBB 2F99A 3KSED 3NXJA 3EX9A 1T3BA 4GB5A 4K90B 2H0GA 4RBNA 3WA3A 1FA3A 1I70A 8RNTA 5IEPA 1RGEA 4BL3A 4CJNA 2OTL3 1G02A 1GOVA 1LOWA 1VQO3 5JBSA 1OF5B 1B2SA 1O7NB 3O8YA 4HVNA 4WWUC 1IT7A 5D81A 1QVF2 1ROAA 3OXAA 1E97A 1EUIC 2F86B 1HYFA 4FMBA 4HJLB 3I563 3H3HA 3WMDA 5IF6A 2D42A 3K63A 1RHLA 2B24B 2CFDA 5M18A 1BGSA 1Z1SA 1X1XA 1N5HA 2PNCA 3FF2A 3CNMA 2A15A 1FZUA 1WNHA 3DMCA 4LGQA 2Y73A 1VQ43 1JN5B 2K54A 4WYKA 3CC73 2IUJA 2F5MA 1LVNA 3KCHA 2MF7A 2GEYA 2XF3A 3FGYA 3UL6A 3URPA 2BT3A 1NB3I 2F4YA 1WMNA 5G2GA 1VQ53 3G16A 4EW5A 3ECFA 4GSPA 6GSPA 2W03A 2HMKB 2XEPA 1TUHA 1JNQA 3DGOA 3QRDA 4FCZA 1UGIA 3OX9A 1FGMA 1E3RA 2SBLA 1VQ83 1PY3A 3CXC2 3EBYA 2CWVA 1V74A 1ZS7A 4BTWA 1A67A 1I3FA 1I0VA 3EN1B 2YFJB 1Y4KA 3HK4A 5AEWB 3CCS3 4J8TA 2BMQB 1T5YA 3WHOA 3K0ZA 1D6UA 3GSPA 1BIRA 1L5GB 1NJI4 1C7HA 6STDA 3AHSA 3D5GA 2OQEC 2I9WA 2BU4A 3DGLA 2RGQA 5ELJA 3NQZA 1SJWA 1K9M4 3LXUX 1JBRA 2CHCA 4DKIA 3CMA3 1T2IA 3D3LA 3EHCA 3D9RA 1CYVA 1RDSA 5D82A 3VSYA 2W6JH 4J5GA 4NHFA 3SYUA 1LOYA 3X41A 3KE7A 1FGRA 3WDGB 5JPUA 1JJ22 1BSDA 3EJVA 1Q7Y4 3AGOA 2R4IA 2C11A 3JUPA 5EQLA 4HAAA 3SLUA 2CWUA 1BU4A 4K1VA 1NO3A 4EXRA 3ALAA 4N6NB 2GXFA 3NX0A 4H3UA 3CCU3 1JBTA 3PGBA 4XDWA 5AIIA 3FG4A 1OH0A 2W2CA 4R9KA 3DY5A 1LQGC 2AADA 1SIHA 1YIJ3 1UUVB 2HMNB 1W6CA 4LYLB 1MWRA 1MWTA 1M1K4 2UX0A 3GRDA 5STDA 5IW9A 1BVIA 1LXEA 1GD3A 3KIIA 5FW5A 3ROBA 1IK3A 1BRSA 4EBGA 1D6ZA 1YGEA 5JPPA 5AEUB 3B4OA 1A2KA 1CEWI 3MG2A 3DH2A 1B20A 2CX1A 3GWRA 4RNZA 3J7Yd 1HKXA 1O7WB 3CCM3 1I2GA 3MHEA 4N6V0 4XDVA 1IVUA 1MWUA 1BNRA 3S5CA 4HM3B 3SX1A 4IIAA 1RNBA 1YGWA 1BUQA 3D5IA 4HBRA 1DMMA 4HM6B 3U97A 3CC23 5A0OB 1KWIA 1UI8A 1O7PB 3MG1A 1DVDA 1VQK3 4U13A 1N9EA 7GSPA 5GSPA 1JBSA 3SOYA 5TGNA 3Q3FA 1B3SA 3OW22 1MOLA 1AVKA 1KD14 1W5ZA 2E2TA 3TDGA 1QAFA 1CH0A 1C54A 3LT8A 3NV0B 3HZPA 1W01A 1YVBI 3GAXA 5LC6A 1PFPA 3HIGA 1EKMA 2INXA 2P38A 2C10A 3WOEB 4O2HA 3N54B 1TU5A 4LEHA 5AIGA 5D83A 1EQKA 1UCLA 1Q824 1V57A 1QALA 1QMAA 2CX0A 2KAAA 4G1MB 1IYYA 4MJDA 1IU7A 2W56B 2FGTA 3EBTA 1RJOA 1MNLA 3PCSA 4KT3B 4KFEA 4L7KA 2LYXA 7RNTA 1B2ZA 3MPHA 1PYLA 2FXTA 3IPTA 2AAEA 5AI1A 2P0XA 4N6UA 2KF4A 3AHWA 1IQXA 1N8QA 2IY2A 2KF5A 3Q2PA 1Q40A 1UGHI 3S28A 2SARA 2BO9B 2M7OA 2V1LA 3BNBA 3EQQB 3NM7A 3OWUA 3PYJA 2XFTA 2HMJB 2Z77A 2E2VA 2JQ5A 3GZRA 4J5KA 5LC7A 1UUGB 1LRAA 3V98A 4HZ9B 2H0HA 1RCLA 3D79A 3SEDA 4RNYA 1STDA 4WHAA 1B2MA 2YFLB 1IQ8A 3V92A 5RNTA 2HMMB 2Z7AA 4IT7A 1BNSA 3F7XA 1GMPA 3B7CA 1MWSA 1RGKA 3I553 4AKYA 2H0IA 1DETA 4ZM8A 2CC3A 4HM5B 3NBJA 3N8BA 3U1WA 1RNTA 1SIIA 2BNGA 4EV5A 3STDA 1HU9A 2PZVA 4L8PA 1EEJA 2CIUA 1WTHA 2IUKA 1YJN3 4WP5A 1TRPA 1D6YA 1FYSA 2P0MA 3CU3A 4EC6A 1K28A 1ISKA 6RNTA 2ZA4A 4N3VA 5BIRA 1UCJA 1X1YA 1RGLA 3FG3A 4HM2B 3DGMA 1GMQA 2W9PA 5CXOA 4RNTA 5IERA 3KZTA 4XBXA 5KP1A 1N8R4 1CYUA 5AIHA 1GYBA 5AIFA 5I97A 3F7SA 2QA43 1EG9B 1S723 1DMNA 1DVCA 1OGXA 2R41A 3N9HA 1GY6A 2E2UA 2ML5A 4OK0A 3A5EA 4AEQA 1EA2A 3KFQC 4R1KA 3BNCA 2W04A 3DXOA 3UJMA 1VQ63 4WYKB 3M8CA 1F8NA 1I2FA 1Q7HA 1O7MB 4LSOA 3CPOA 2ML6A 3X3YA 3LOYA 1GY5A 2BHMA 2P05A 2KCDA 3BNEA 3CCQ3 2ZL8A 1B21A 2CW9A 1GD4A 1VQP3 2Z76A 3NM2A 3S27A 1OPYA 3UNLA 3DGNA 3CCE3 1UDII 1RN7A 1U5OA 1JB5A 1Q9EA 3RNTA 1Q864 1ZO2A 4GL6A 4HOHA 1ZGXA 5CK6A 1BRKA 1BSCA 8CHOA 3DUKA 2D1WA 4WFOA 1RGGA 5EVHA 4BTXA 5BU4A 2O3OA 2RNTA 1GOYA 3EF8A 4N6LA 1DE3A 3T8UA 3Q90A 4HM7B 1TTOA 3UL5A 2XR8B 1J2BA 1B2XA 1VQN3 4FR9A 2CKFB 3X40A 3EB8A 3BLZA 1JKGB 3FG1A 3E99A 2C4BA 1BSAA 5FGOA 5ELUA 1IT8A 2QEX3 1RRHA 2XRXB 4X2HA 3V99A 1YJW3 3G4S3 3L0RA 1I8VA 1FGTA 3LTCA 1M9GA 1FW7A 4O3VA 1RGCA 1LOXA 3IMAB 3ZG5A 1IVWA 2KXGA 2XFSA 3LYGA 4HM4B 3Q1CA 3PS8A 3K7CA 3OV4A 5HOHA 1FUWA 1OHSA 2K3DA 1FGQA 2GEXA 3PCRA 3HIIA 1HZ1A 5M19A 3UB1A 4ORLA 4MEIA 4EV2A 1RCKA 2OQEA 5DREA 1K41A 3MWZA 1BRIA 1BNEA 2BIRA 3KKGA 1UI7A 3WR2A 3ZFZA 1YJ93 1IV7A 2GU3A 4EYCA 2CK3H 4CDLA 3OWSA 4OUQA 5KP4A 1Q40B 3FSDA 1RSNA 2HMLB 1JB2A 3LMLA 1YI23 1R4YA 2CH9A 3PXMA 1B27A 4H61A 1VQQA 3SVAA 1Q814 1M904 2OTJ3 2GU1A 2IYJA 1MGWA 1NB5I 1YHQ3 2CFWA 1BNJA 1A90A 4MMXB 2B1XB 2XH9A 3AMOA 4I5QA 4AKZA 4N6OB 2O9UX 3OWYA 3JUQA 3GZBA 1ULIB 1BNFA 1YNVX 1YIT3 1W00A 4FCJA 4K1UA 3B8LA 3BU4A 1K8A4 1PU4A 2GBXB 3WA2X 1BRHA 1TFOA 1BSBA 5BXQA 2L4VA 5G1LA 1ULJB 2IMJA 3MKIA 2JDIH 2WGOA 2F98A 5IENA 1NWWA 3G8ZA 1IVVA 1I2EA 1RRLA 2ZDJA 5DRVA 3MSOA 4XBYA 2ZHXB 3MYTA 2HMOB 4HYZA 3RDEA 3G0KA 1OCVA 2KRTA 4J9AA 1JN5A 1OF5A 3QK9A 4L8OA 3CCR3 1K734 1O7GB 2YFIB 3JUOA 1B2UA 1TJDA 3EN8A 1BNGA 1OHOA 1BUJA 5IG4A 4FMDA 3CC43 2UUGC 3T8NA 1VZZA 1W6YA 1A2PA 1S5AA 4QWTA 4O8SA 1MGRA 1W7CA 1M1XB 4PEJA 1KC84 4ILFA 3CCV3 3JUNA 1I0XA 3DGYA 2CFLA 3GZYB 1DYUA 2P09A 1JKGA 3NBBA 3G6E3 1RGFA 7STDA 3MG3A 1LNHA 4XB5A 3T0UA 2CG1A 2MC8A 1I3IA 3CD63 4GHOA 4O02B 1RGHA 3S67A 1JZOA 3LZAA 1RTUA 2L1SA 1GSPA 1WMOA 2W9QA 2CG0A 3I0YA 3JVCA 4JRFA 1RN4A 5IG3A 1UCKA 1NDOB 4KFDA 1YVSA 2XSOB 4BIRA 3WOFB 1JV2B 3FCSB 3FH1A 5G1KA 3LTAA 1RKYA 1GMRA 1GS3A 2IA7A 3IJEB 1W2ZA 1BRJA 4R80A 2OOVC 5BVBA 1VQ73 2WOFA 1WMPA 1AV4A 3LTDA 1VQ93 3B4PA 2QGUA 1Q42A 3K9MC 1CQSA 1E3VA 2RBIA 3X3ZA 3BNDA 4K61A 4FMCA 2F5WA 4R9LA 5CF2A 1TRQA 2RFRA 1SARA 1X1WA 1G0TA 2Y74A 4BU4A 1ZX2A 3DM8A 3D4AA 1NNVA 1AVLA 2LQVA 3F8HA 1LNIA 3KSPA 4IPBA 1ASKA 1FUTA 4STDA 1SPUA 2KF6A 1UUWB 1W6GA 2CFGA 4HM8B 5HGRA 1BRGA 1G96A 3FF0A 3CPW2 5AYSC 1UW1A 5IG5A 1NU3A 2Q07A 4KFFA 1LQMB 1OUNA 4HM0B 2Z6BA 4I4KA 3SXXA 1AY7A 1AQZA 1U8CB 2XGLA 4N6MA 1QAKA 1GOUA 3EE1A 1W02A 3NBRA 1IQYA 3CCL3 2W56A 1BRNL 1JZDA 5IG0A 3LTBA 1BOXA 1WQLB 3X42A 1KSIA 4JF8A 3PZWA 1IDPA 2RSXA 2W0QA 3X3XA 4N6TA 3BB9A 2QIYA 1FUSA
chains in the Genus database with same CATH topology
1RN1A 1T2HA 2BU4A 1BNSA 1GMPA 1RGKA 1DETA 1BNFA 1BNIA 1YNVX 1JBRA 1RNTA 1BSEA 9RNTA 3BU4A 1T2IA 1BRHA 1BSBA 1RDSA 4J5GA 3SYUA 1LOYA 2HOHA 1TRPA 1BAOA 1FYSA 1I2EA 6RNTA 1BSDA 2ZA4A 5BIRA 1UCJA 1X1YA 1RGLA 3AGOA 1LOVA 1GMQA 4HAAA 4RNTA 1BU4A 3BIRA 2F56A 1JBTA 1B2UA 3HOHA 1RMSA 1X1UA 1BNGA 3A5EA 1BUJA 2AADA 3AGNA 2KF3A 1UCIA 1I2FA 1A2PA 1MGRA 1BVIA 1BRSA 1BANA 1B21A 1I0XA 3DGYA 1RGAA 3DH2A 1B20A 1RGFA 1I2GA 1Q9EA 3RNTA 1RNBA 1BNRA 4HOHA 1YGWA 1ZGXA 1BRKA 1BSCA 3D5IA 1I3IA 4GHOA 1RGGA 2GSPA 1RGHA 5BU4A 2RNTA 1GOYA 1RTUA 1DE3A 1GSPA 1RLSA 1RN4A 7GSPA 1TTOA 1UCKA 5GSPA 1YVSA 1B2XA 4BIRA 1JBSA 3Q3FA 1B3SA 1GMRA 1CH0A 2C4BA 1BRJA 1BSAA 1I70A 1C54A 8RNTA 1RGEA 1G02A 1GOVA 1LOWA 1B2SA 1I8VA 2RBIA 1FW7A 1HYFA 2F5WA 1RGCA 1TRQA 1UCLA 1RHLA 1SARA 1X1WA 1BGSA 1X1XA 5HOHA 4BU4A 2KAAA 3D4AA 1IYYA 1LNIA 1FZUA 1FUTA 7RNTA 1HZ1A 1B2ZA 2F5MA 3KCHA 1PYLA 2KF6A 2AAEA 3URPA 1RCKA 2KF4A 2F4YA 3AHWA 1BRGA 6GSPA 2KF5A 4GSPA 1BRIA 1BNEA 2BIRA 2SARA 3WR2A 1PY3A 1RSNA 1AY7A 1AQZA 4J5KA 1GOUA 1I3FA 1LRAA 1R4YA 1I0VA 1B27A 1RCLA 1B2MA 1BRNL 3WHOA 1BOXA 1MGWA 3GSPA 1BIRA 1BNJA 5RNTA 3AHSA 1FUSA 3D5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RN1 A;  1T2H A;  2BU4 A;  1BNS A;  1GMP A;  1RGK A;  1DET A;  1BNF A;  1BNI A;  1YNV X;  1JBR A;  1RNT A;  1BSE A;  9RNT A;  3BU4 A;  1T2I A;  1BRH A;  1BSB A;  1RDS A;  4J5G A;  3SYU A;  1LOY A;  2HOH A;  1TRP A;  1BAO A;  1FYS A;  1I2E A;  6RNT A;  1BSD A;  2ZA4 A;  5BIR A;  1UCJ A;  1X1Y A;  1RGL A;  3AGO A;  1LOV A;  1GMQ A;  4HAA A;  4RNT A;  1BU4 A;  3BIR A;  2F56 A;  1JBT A;  1B2U A;  3HOH A;  1RMS A;  1X1U A;  1BNG A;  3A5E A;  1BUJ A;  2AAD A;  3AGN A;  2KF3 A;  1UCI A;  1I2F A;  1A2P A;  1MGR A;  1BVI A;  1BRS A;  1BAN A;  1B21 A;  1I0X A;  3DGY A;  1RGA A;  3DH2 A;  1B20 A;  1RGF A;  1I2G A;  1Q9E A;  3RNT A;  1RNB A;  1BNR A;  4HOH A;  1YGW A;  1ZGX A;  1BRK A;  1BSC A;  3D5I A;  1I3I A;  4GHO A;  1RGG A;  2GSP A;  1RGH A;  5BU4 A;  2RNT A;  1GOY A;  1RTU A;  1DE3 A;  1GSP A;  1RLS A;  1RN4 A;  7GSP A;  1TTO A;  1UCK A;  5GSP A;  1YVS A;  1B2X A;  4BIR A;  1JBS A;  3Q3F A;  1B3S A;  1GMR A;  1CH0 A;  2C4B A;  1BRJ A;  1BSA A;  1I70 A;  1C54 A;  8RNT A;  1RGE A;  1G02 A;  1GOV A;  1LOW A;  1B2S A;  1I8V A;  2RBI A;  1FW7 A;  1HYF A;  2F5W A;  1RGC A;  1TRQ A;  1UCL A;  1RHL A;  1SAR A;  1X1W A;  1BGS A;  1X1X A;  5HOH A;  4BU4 A;  2KAA A;  3D4A A;  1IYY A;  1LNI A;  1FZU A;  1FUT A;  7RNT A;  1HZ1 A;  1B2Z A;  2F5M A;  3KCH A;  1PYL A;  2KF6 A;  2AAE A;  3URP A;  1RCK A;  2KF4 A;  2F4Y A;  3AHW A;  1BRG A;  6GSP A;  2KF5 A;  4GSP A;  1BRI A;  1BNE A;  2BIR A;  2SAR A;  3WR2 A;  1PY3 A;  1RSN A;  1AY7 A;  1AQZ A;  4J5K A;  1GOU A;  1I3F A;  1LRA A;  1R4Y A;  1I0V A;  1B27 A;  1RCL A;  1B2M A;  1BRN L;  3WHO A;  1BOX A;  1MGW A;  3GSP A;  1BIR A;  1BNJ A;  5RNT A;  3AHS A;  1FUS A;  3D5G A; 
#chains in the Genus database with same CATH topology
 1RN1 A;  4X2O A;  1T2H A;  5IEO A;  1ROV A;  1FGO A;  3LH4 A;  3S29 A;  3VF1 A;  4HM1 B;  3NV0 A;  3NHX A;  3CCJ 3;  2J8X B;  1IV9 A;  5M1A A;  1BNI A;  3KN4 A;  2BMO B;  2WO0 A;  4CCV A;  1VQL 3;  4FMA A;  2UGI A;  1BSE A;  3WOD G;  4CPK A;  9RNT A;  3FZW A;  1TP6 A;  3G71 3;  3CME 3;  1N5P A;  4LMI A;  4BL2 A;  2BMR B;  1O7H B;  2XGN A;  1JRQ A;  3ER7 A;  1AR0 A;  1R4C A;  3JUM A;  2STD A;  4HKV B;  1KQS 2;  2HOH A;  4OVM A;  1BAO A;  2OWP A;  3SOA A;  3F9S A;  3ZG0 A;  1V58 A;  4NRE A;  1VQM 3;  1TIJ A;  2RCD A;  1LOV A;  2CFK A;  3BIR A;  3HX8 A;  2F56 A;  4NPB A;  5CF1 A;  2OOV A;  1QJG A;  3FKA A;  3RGR A;  4LZI A;  3HOH A;  1RMS A;  4BTY A;  2K0M A;  1X1U A;  4KZ1 A;  1JB4 A;  3RGA A;  3F14 A;  1IVX A;  1OGZ A;  1QVG 2;  3F8X A;  3LT9 A;  3AGN A;  2KF3 A;  2CWT A;  1N9J A;  3NUV A;  5EEO A;  2WOH A;  1UCI A;  3HI7 A;  5KP3 A;  1SQW A;  1W2B 2;  1TFK A;  4XM4 A;  2OCT A;  3CNX A;  4RZM A;  1BAN A;  1DMQ A;  4Q53 A;  2YX9 A;  3FLJ A;  3NQY A;  3VGN A;  1RGA A;  1OHP A;  1GY7 A;  4KVH A;  3H51 A;  4TX4 A;  1OAC A;  2FNQ A;  5AYR B;  1W4N A;  3A76 A;  3AMO B;  4MMZ B;  3EC9 A;  3F40 A;  3GZX B;  2WGQ A;  5CLK A;  2GSP A;  1A2V A;  4XBT A;  1US1 A;  3K5T A;  1STF I;  1RLS A;  4MMY B;  4R4K A;  2GBW B;  4FCM A;  2XSH B;  3DZL A;  4HZB B;  2F99 A;  3KSE D;  3NXJ A;  3EX9 A;  1T3B A;  4GB5 A;  4K90 B;  2H0G A;  4RBN A;  3WA3 A;  1FA3 A;  1I70 A;  8RNT A;  5IEP A;  1RGE A;  4BL3 A;  4CJN A;  2OTL 3;  1G02 A;  1GOV A;  1LOW A;  1VQO 3;  5JBS A;  1OF5 B;  1B2S A;  1O7N B;  3O8Y A;  4HVN A;  4WWU C;  1IT7 A;  5D81 A;  1QVF 2;  1ROA A;  3OXA A;  1E97 A;  1EUI C;  2F86 B;  1HYF A;  4FMB A;  4HJL B;  3I56 3;  3H3H A;  3WMD A;  5IF6 A;  2D42 A;  3K63 A;  1RHL A;  2B24 B;  2CFD A;  5M18 A;  1BGS A;  1Z1S A;  1X1X A;  1N5H A;  2PNC A;  3FF2 A;  3CNM A;  2A15 A;  1FZU A;  1WNH A;  3DMC A;  4LGQ A;  2Y73 A;  1VQ4 3;  1JN5 B;  2K54 A;  4WYK A;  3CC7 3;  2IUJ A;  2F5M A;  1LVN A;  3KCH A;  2MF7 A;  2GEY A;  2XF3 A;  3FGY A;  3UL6 A;  3URP A;  2BT3 A;  1NB3 I;  2F4Y A;  1WMN A;  5G2G A;  1VQ5 3;  3G16 A;  4EW5 A;  3ECF A;  4GSP A;  6GSP A;  2W03 A;  2HMK B;  2XEP A;  1TUH A;  1JNQ A;  3DGO A;  3QRD A;  4FCZ A;  1UGI A;  3OX9 A;  1FGM A;  1E3R A;  2SBL A;  1VQ8 3;  1PY3 A;  3CXC 2;  3EBY A;  2CWV A;  1V74 A;  1ZS7 A;  4BTW A;  1A67 A;  1I3F A;  1I0V A;  3EN1 B;  2YFJ B;  1Y4K A;  3HK4 A;  5AEW B;  3CCS 3;  4J8T A;  2BMQ B;  1T5Y A;  3WHO A;  3K0Z A;  1D6U A;  3GSP A;  1BIR A;  1L5G B;  1NJI 4;  1C7H A;  6STD A;  3AHS A;  3D5G A;  2OQE C;  2I9W A;  2BU4 A;  3DGL A;  2RGQ A;  5ELJ A;  3NQZ A;  1SJW A;  1K9M 4;  3LXU X;  1JBR A;  2CHC A;  4DKI A;  3CMA 3;  1T2I A;  3D3L A;  3EHC A;  3D9R A;  1CYV A;  1RDS A;  5D82 A;  3VSY A;  2W6J H;  4J5G A;  4NHF A;  3SYU A;  1LOY A;  3X41 A;  3KE7 A;  1FGR A;  3WDG B;  5JPU A;  1JJ2 2;  1BSD A;  3EJV A;  1Q7Y 4;  3AGO A;  2R4I A;  2C11 A;  3JUP A;  5EQL A;  4HAA A;  3SLU A;  2CWU A;  1BU4 A;  4K1V A;  1NO3 A;  4EXR A;  3ALA A;  4N6N B;  2GXF A;  3NX0 A;  4H3U A;  3CCU 3;  1JBT A;  3PGB A;  4XDW A;  5AII A;  3FG4 A;  1OH0 A;  2W2C A;  4R9K A;  3DY5 A;  1LQG C;  2AAD A;  1SIH A;  1YIJ 3;  1UUV B;  2HMN B;  1W6C A;  4LYL B;  1MWR A;  1MWT A;  1M1K 4;  2UX0 A;  3GRD A;  5STD A;  5IW9 A;  1BVI A;  1LXE A;  1GD3 A;  3KII A;  5FW5 A;  3ROB A;  1IK3 A;  1BRS A;  4EBG A;  1D6Z A;  1YGE A;  5JPP A;  5AEU B;  3B4O A;  1A2K A;  1CEW I;  3MG2 A;  3DH2 A;  1B20 A;  2CX1 A;  3GWR A;  4RNZ A;  3J7Y d;  1HKX A;  1O7W B;  3CCM 3;  1I2G A;  3MHE A;  4N6V 0;  4XDV A;  1IVU A;  1MWU A;  1BNR A;  3S5C A;  4HM3 B;  3SX1 A;  4IIA A;  1RNB A;  1YGW A;  1BUQ A;  3D5I A;  4HBR A;  1DMM A;  4HM6 B;  3U97 A;  3CC2 3;  5A0O B;  1KWI A;  1UI8 A;  1O7P B;  3MG1 A;  1DVD A;  1VQK 3;  4U13 A;  1N9E A;  7GSP A;  5GSP A;  1JBS A;  3SOY A;  5TGN A;  3Q3F A;  1B3S A;  3OW2 2;  1MOL A;  1AVK A;  1KD1 4;  1W5Z A;  2E2T A;  3TDG A;  1QAF A;  1CH0 A;  1C54 A;  3LT8 A;  3NV0 B;  3HZP A;  1W01 A;  1YVB I;  3GAX A;  5LC6 A;  1PFP A;  3HIG A;  1EKM A;  2INX A;  2P38 A;  2C10 A;  3WOE B;  4O2H A;  3N54 B;  1TU5 A;  4LEH A;  5AIG A;  5D83 A;  1EQK A;  1UCL A;  1Q82 4;  1V57 A;  1QAL A;  1QMA A;  2CX0 A;  2KAA A;  4G1M B;  1IYY A;  4MJD A;  1IU7 A;  2W56 B;  2FGT A;  3EBT A;  1RJO A;  1MNL A;  3PCS A;  4KT3 B;  4KFE A;  4L7K A;  2LYX A;  7RNT A;  1B2Z A;  3MPH A;  1PYL A;  2FXT A;  3IPT A;  2AAE A;  5AI1 A;  2P0X A;  4N6U A;  2KF4 A;  3AHW A;  1IQX A;  1N8Q A;  2IY2 A;  2KF5 A;  3Q2P A;  1Q40 A;  1UGH I;  3S28 A;  2SAR A;  2BO9 B;  2M7O A;  2V1L A;  3BNB A;  3EQQ B;  3NM7 A;  3OWU A;  3PYJ A;  2XFT A;  2HMJ B;  2Z77 A;  2E2V A;  2JQ5 A;  3GZR A;  4J5K A;  5LC7 A;  1UUG B;  1LRA A;  3V98 A;  4HZ9 B;  2H0H A;  1RCL A;  3D79 A;  3SED A;  4RNY A;  1STD A;  4WHA A;  1B2M A;  2YFL B;  1IQ8 A;  3V92 A;  5RNT A;  2HMM B;  2Z7A A;  4IT7 A;  1BNS A;  3F7X A;  1GMP A;  3B7C A;  1MWS A;  1RGK A;  3I55 3;  4AKY A;  2H0I A;  1DET A;  4ZM8 A;  2CC3 A;  4HM5 B;  3NBJ A;  3N8B A;  3U1W A;  1RNT A;  1SII A;  2BNG A;  4EV5 A;  3STD A;  1HU9 A;  2PZV A;  4L8P A;  1EEJ A;  2CIU A;  1WTH A;  2IUK A;  1YJN 3;  4WP5 A;  1TRP A;  1D6Y A;  1FYS A;  2P0M A;  3CU3 A;  4EC6 A;  1K28 A;  1ISK A;  6RNT A;  2ZA4 A;  4N3V A;  5BIR A;  1UCJ A;  1X1Y A;  1RGL A;  3FG3 A;  4HM2 B;  3DGM A;  1GMQ A;  2W9P A;  5CXO A;  4RNT A;  5IER A;  3KZT A;  4XBX A;  5KP1 A;  1N8R 4;  1CYU A;  5AIH A;  1GYB A;  5AIF A;  5I97 A;  3F7S A;  2QA4 3;  1EG9 B;  1S72 3;  1DMN A;  1DVC A;  1OGX A;  2R41 A;  3N9H A;  1GY6 A;  2E2U A;  2ML5 A;  4OK0 A;  3A5E A;  4AEQ A;  1EA2 A;  3KFQ C;  4R1K A;  3BNC A;  2W04 A;  3DXO A;  3UJM A;  1VQ6 3;  4WYK B;  3M8C A;  1F8N A;  1I2F A;  1Q7H A;  1O7M B;  4LSO A;  3CPO A;  2ML6 A;  3X3Y A;  3LOY A;  1GY5 A;  2BHM A;  2P05 A;  2KCD A;  3BNE A;  3CCQ 3;  2ZL8 A;  1B21 A;  2CW9 A;  1GD4 A;  1VQP 3;  2Z76 A;  3NM2 A;  3S27 A;  1OPY A;  3UNL A;  3DGN A;  3CCE 3;  1UDI I;  1RN7 A;  1U5O A;  1JB5 A;  1Q9E A;  3RNT A;  1Q86 4;  1ZO2 A;  4GL6 A;  4HOH A;  1ZGX A;  5CK6 A;  1BRK A;  1BSC A;  8CHO A;  3DUK A;  2D1W A;  4WFO A;  1RGG A;  5EVH A;  4BTX A;  5BU4 A;  2O3O A;  2RNT A;  1GOY A;  3EF8 A;  4N6L A;  1DE3 A;  3T8U A;  3Q90 A;  4HM7 B;  1TTO A;  3UL5 A;  2XR8 B;  1J2B A;  1B2X A;  1VQN 3;  4FR9 A;  2CKF B;  3X40 A;  3EB8 A;  3BLZ A;  1JKG B;  3FG1 A;  3E99 A;  2C4B A;  1BSA A;  5FGO A;  5ELU A;  1IT8 A;  2QEX 3;  1RRH A;  2XRX B;  4X2H A;  3V99 A;  1YJW 3;  3G4S 3;  3L0R A;  1I8V A;  1FGT A;  3LTC A;  1M9G A;  1FW7 A;  4O3V A;  1RGC A;  1LOX A;  3IMA B;  3ZG5 A;  1IVW A;  2KXG A;  2XFS A;  3LYG A;  4HM4 B;  3Q1C A;  3PS8 A;  3K7C A;  3OV4 A;  5HOH A;  1FUW A;  1OHS A;  2K3D A;  1FGQ A;  2GEX A;  3PCR A;  3HII A;  1HZ1 A;  5M19 A;  3UB1 A;  4ORL A;  4MEI A;  4EV2 A;  1RCK A;  2OQE A;  5DRE A;  1K41 A;  3MWZ A;  1BRI A;  1BNE A;  2BIR A;  3KKG A;  1UI7 A;  3WR2 A;  3ZFZ A;  1YJ9 3;  1IV7 A;  2GU3 A;  4EYC A;  2CK3 H;  4CDL A;  3OWS A;  4OUQ A;  5KP4 A;  1Q40 B;  3FSD A;  1RSN A;  2HML B;  1JB2 A;  3LML A;  1YI2 3;  1R4Y A;  2CH9 A;  3PXM A;  1B27 A;  4H61 A;  1VQQ A;  3SVA A;  1Q81 4;  1M90 4;  2OTJ 3;  2GU1 A;  2IYJ A;  1MGW A;  1NB5 I;  1YHQ 3;  2CFW A;  1BNJ A;  1A90 A;  4MMX B;  2B1X B;  2XH9 A;  3AMO A;  4I5Q A;  4AKZ A;  4N6O B;  2O9U X;  3OWY A;  3JUQ A;  3GZB A;  1ULI B;  1BNF A;  1YNV X;  1YIT 3;  1W00 A;  4FCJ A;  4K1U A;  3B8L A;  3BU4 A;  1K8A 4;  1PU4 A;  2GBX B;  3WA2 X;  1BRH A;  1TFO A;  1BSB A;  5BXQ A;  2L4V A;  5G1L A;  1ULJ B;  2IMJ A;  3MKI A;  2JDI H;  2WGO A;  2F98 A;  5IEN A;  1NWW A;  3G8Z A;  1IVV A;  1I2E A;  1RRL A;  2ZDJ A;  5DRV A;  3MSO A;  4XBY A;  2ZHX B;  3MYT A;  2HMO B;  4HYZ A;  3RDE A;  3G0K A;  1OCV A;  2KRT A;  4J9A A;  1JN5 A;  1OF5 A;  3QK9 A;  4L8O A;  3CCR 3;  1K73 4;  1O7G B;  2YFI B;  3JUO A;  1B2U A;  1TJD A;  3EN8 A;  1BNG A;  1OHO A;  1BUJ A;  5IG4 A;  4FMD A;  3CC4 3;  2UUG C;  3T8N A;  1VZZ A;  1W6Y A;  1A2P A;  1S5A A;  4QWT A;  4O8S A;  1MGR A;  1W7C A;  1M1X B;  4PEJ A;  1KC8 4;  4ILF A;  3CCV 3;  3JUN A;  1I0X A;  3DGY A;  2CFL A;  3GZY B;  1DYU A;  2P09 A;  1JKG A;  3NBB A;  3G6E 3;  1RGF A;  7STD A;  3MG3 A;  1LNH A;  4XB5 A;  3T0U A;  2CG1 A;  2MC8 A;  1I3I A;  3CD6 3;  4GHO A;  4O02 B;  1RGH A;  3S67 A;  1JZO A;  3LZA A;  1RTU A;  2L1S A;  1GSP A;  1WMO A;  2W9Q A;  2CG0 A;  3I0Y A;  3JVC A;  4JRF A;  1RN4 A;  5IG3 A;  1UCK A;  1NDO B;  4KFD A;  1YVS A;  2XSO B;  4BIR A;  3WOF B;  1JV2 B;  3FCS B;  3FH1 A;  5G1K A;  3LTA A;  1RKY A;  1GMR A;  1GS3 A;  2IA7 A;  3IJE B;  1W2Z A;  1BRJ A;  4R80 A;  2OOV C;  5BVB A;  1VQ7 3;  2WOF A;  1WMP A;  1AV4 A;  3LTD A;  1VQ9 3;  3B4P A;  2QGU A;  1Q42 A;  3K9M C;  1CQS A;  1E3V A;  2RBI A;  3X3Z A;  3BND A;  4K61 A;  4FMC A;  2F5W A;  4R9L A;  5CF2 A;  1TRQ A;  2RFR A;  1SAR A;  1X1W A;  1G0T A;  2Y74 A;  4BU4 A;  1ZX2 A;  3DM8 A;  3D4A A;  1NNV A;  1AVL A;  2LQV A;  3F8H A;  1LNI A;  3KSP A;  4IPB A;  1ASK A;  1FUT A;  4STD A;  1SPU A;  2KF6 A;  1UUW B;  1W6G A;  2CFG A;  4HM8 B;  5HGR A;  1BRG A;  1G96 A;  3FF0 A;  3CPW 2;  5AYS C;  1UW1 A;  5IG5 A;  1NU3 A;  2Q07 A;  4KFF A;  1LQM B;  1OUN A;  4HM0 B;  2Z6B A;  4I4K A;  3SXX A;  1AY7 A;  1AQZ A;  1U8C B;  2XGL A;  4N6M A;  1QAK A;  1GOU A;  3EE1 A;  1W02 A;  3NBR A;  1IQY A;  3CCL 3;  2W56 A;  1BRN L;  1JZD A;  5IG0 A;  3LTB A;  1BOX A;  1WQL B;  3X42 A;  1KSI A;  4JF8 A;  3PZW A;  1IDP A;  2RSX A;  2W0Q A;  3X3X A;  4N6T A;  3BB9 A;  2QIY A;  1FUS A; 
#chains in the Genus database with same CATH homology
 1RN1 A;  1T2H A;  2BU4 A;  1BNS A;  1GMP A;  1RGK A;  1DET A;  1BNF A;  1BNI A;  1YNV X;  1JBR A;  1RNT A;  1BSE A;  9RNT A;  3BU4 A;  1T2I A;  1BRH A;  1BSB A;  1RDS A;  4J5G A;  3SYU A;  1LOY A;  2HOH A;  1TRP A;  1BAO A;  1FYS A;  1I2E A;  6RNT A;  1BSD A;  2ZA4 A;  5BIR A;  1UCJ A;  1X1Y A;  1RGL A;  3AGO A;  1LOV A;  1GMQ A;  4HAA A;  4RNT A;  1BU4 A;  3BIR A;  2F56 A;  1JBT A;  1B2U A;  3HOH A;  1RMS A;  1X1U A;  1BNG A;  3A5E A;  1BUJ A;  2AAD A;  3AGN A;  2KF3 A;  1UCI A;  1I2F A;  1A2P A;  1MGR A;  1BVI A;  1BRS A;  1BAN A;  1B21 A;  1I0X A;  3DGY A;  1RGA A;  3DH2 A;  1B20 A;  1RGF A;  1I2G A;  1Q9E A;  3RNT A;  1RNB A;  1BNR A;  4HOH A;  1YGW A;  1ZGX A;  1BRK A;  1BSC A;  3D5I A;  1I3I A;  4GHO A;  1RGG A;  2GSP A;  1RGH A;  5BU4 A;  2RNT A;  1GOY A;  1RTU A;  1DE3 A;  1GSP A;  1RLS A;  1RN4 A;  7GSP A;  1TTO A;  1UCK A;  5GSP A;  1YVS A;  1B2X A;  4BIR A;  1JBS A;  3Q3F A;  1B3S A;  1GMR A;  1CH0 A;  2C4B A;  1BRJ A;  1BSA A;  1I70 A;  1C54 A;  8RNT A;  1RGE A;  1G02 A;  1GOV A;  1LOW A;  1B2S A;  1I8V A;  2RBI A;  1FW7 A;  1HYF A;  2F5W A;  1RGC A;  1TRQ A;  1UCL A;  1RHL A;  1SAR A;  1X1W A;  1BGS A;  1X1X A;  5HOH A;  4BU4 A;  2KAA A;  3D4A A;  1IYY A;  1LNI A;  1FZU A;  1FUT A;  7RNT A;  1HZ1 A;  1B2Z A;  2F5M A;  3KCH A;  1PYL A;  2KF6 A;  2AAE A;  3URP A;  1RCK A;  2KF4 A;  2F4Y A;  3AHW A;  1BRG A;  6GSP A;  2KF5 A;  4GSP A;  1BRI A;  1BNE A;  2BIR A;  2SAR A;  3WR2 A;  1PY3 A;  1RSN A;  1AY7 A;  1AQZ A;  4J5K A;  1GOU A;  1I3F A;  1LRA A;  1R4Y A;  1I0V A;  1B27 A;  1RCL A;  1B2M A;  1BRN L;  3WHO A;  1BOX A;  1MGW A;  3GSP A;  1BIR A;  1BNJ A;  5RNT A;  3AHS A;  1FUS A;  3D5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...