2SARA

Determination and restrained least-squares refinement of the crystal structures of ribonuclease sa and its complex with 3'-guanylic acid at 1.8 angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (endoribonuclease)
molecule keywords RIBONUCLEASE SA
publication title Determination and restrained least-squares refinement of the structures of ribonuclease Sa and its complex with 3'-guanylic acid at 1.8 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1990-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2sarA00
1BNSA 1BSCA 1RN4A 1TRPA 1BNEA 1B2SA 1B2UA 1GOUA 3GSPA 1X1WA 1I70A 1BNRA 1BRHA 1UCKA 1R4YA 1GOVA 2RBIA 1RGGA 5BU4A 1AQZA 4BIRA 1RSNA 1GMRA 1UCJA 1FUTA 1LOVA 1X1YA 1BNGA 2F56A 1IYYA 1JBRA 1BSDA 1T2IA 1RCKA 3D4AA 1BGSA 1BNFA 3AGNA 4J5KA 1BSEA 4RNTA 1BIRA 1I3IA 5BIRA 1B27A 1LRAA 3DH2A 3SYUA 1RGEA 1SARA 1RCLA 3HOHA 2AADA 5RNTA 4BU4A 1BNJA 5HOHA 8RNTA 1C54A 3AGOA 1LOYA 1RN1A 1B2MA 1RGKA 1I0XA 1JBTA 9RNTA 3RNTA 1MGWA 1TTOA 1G02A 1UCIA 2BIRA 2KF5A 5GSPA 1X1UA 1BANA 1FYSA 3BU4A 1X1XA 1FUSA 1BUJA 1TRQA 1BSBA 1RDSA 1RHLA 1PYLA 2BU4A 1T2HA 1MGRA 1B2ZA 1AY7A 2RNTA 1BRNL 1DE3A 4HOHA 2ZA4A 2KAAA 1B3SA 1FZUA 1A2PA 1BRSA 1I3FA 1GMPA 1YGWA 1Q9EA 2KF4A 1I0VA 3KCHA 1BSAA 1JBSA 1HYFA 1LOWA 1RMSA 3D5IA 1BU4A 1UCLA 1B2XA 1I2GA 1RGHA 1DETA 4GSPA 1CH0A 1BRJA 2C4BA 2AAEA 1RGFA 1FW7A 2F4YA 3Q3FA 4HAAA 1RGAA 3A5EA 6RNTA 3DGYA 2F5WA 1RTUA 3AHSA 1YVSA 1ZGXA 2HOHA 2KF3A 1B21A 2KF6A 1I2FA 1I8VA 1RGLA 4J5GA 1BRIA 4GHOA 1BAOA 1BNIA 1YNVX 3BIRA 1PY3A 1I2EA 1RGCA 1B20A 1BVIA 1HZ1A 1GOYA 2F5MA 1RNBA 7GSPA 1BRGA 1LNIA 2GSPA 3WHOA 1GSPA 1GMQA 1BRKA 2SARA 1RNTA 1RLSA 7RNTA 1BOXA 3URPA 3WR2A 3D5GA 3AHWA 6GSPA
chains in the Genus database with same CATH superfamily
1BNSA 1WQLB 2PNCA 1W00A 3NBRA 4FCMA 4U13A 1B2SA 1GOUA 1LNHA 1TJDA 3K9MC 3PXMA 1BRHA 2WO0A 4HBRA 1OGXA 5AI1A 1OH0A 2WOHA 3LYGA 1O7HB 5D83A 1FGMA 1W6CA 2WGOA 3NM2A 5BU4A 2I9WA 1RSNA 3NBJA 3ZG0A 1GMRA 1FUTA 1X1YA 3LT8A 4XBXA 1BNGA 1IYYA 1STDA 4FR9A 3EJVA 1T2IA 3H51A 4FCZA 4R80A 2KXGA 1BNFA 1OGZA 1QVF2 3CPW2 1T5YA 2D42A 1A2VA 3GZBA 3PCSA 5IERA 1B27A 1HKXA 1LRAA 1CQSA 2HMKB 1M1K4 3KFQC 5D81A 1JN5A 1M904 1FGTA 1MWUA 3FZWA 4KFEA 1TIJA 3S67A 3PS8A 1UI7A 4BU4A 1MWRA 3CCM3 1G0TA 3ROBA 3AGOA 2F99A 5LC7A 2Z6BA 3SX1A 4GL6A 1DVDA 2GBWB 4L8OA 4MMYB 2CK3H 1Q40B 3K0ZA 1YGEA 3RNTA 1A67A 1TTOA 3B7CA 2A15A 3HIIA 1N8QA 1UCIA 2RSXA 2BIRA 5GSPA 1Q814 1E97A 1FYSA 3BU4A 1FUSA 1QJGA 2D1WA 4J8TA 4IPBA 3QK9A 4RZMA 5DREA 2HMOB 4RNYA 3TDGA 1M1XB 1BUQA 2UX0A 3NXJA 2RNTA 2IUKA 1BRNL 1UW1A 1DE3A 3ECFA 3JVCA 1TFKA 2KAAA 3EE1A 3CCU3 4HM3B 1FZUA 2O3OA 1BRSA 5ELUA 1GMPA 1D6ZA 3X40A 1EQKA 1BSAA 1JBSA 3OW22 3LOYA 3MYTA 2OOVA 1YJW3 2WGQA 5BVBA 1FA3A 3DGLA 4KFFA 4LYLB 3MHEA 3OWYA 1CH0A 1ROAA 3LXUX 2C4BA 2AAEA 3AMOB 4N6OB 4Q53A 3QRDA 4BL3A 3PYJA 3Q3FA 3OX9A 2XFTA 3NQYA 4HAAA 3G6E3 2OCTA 1Q40A 3DGYA 2GBXB 3U97A 1RTUA 4O2HA 2XGLA 5M18A 2PZVA 3X3XA 3S28A 4H3UA 5IG3A 3CCQ3 2IYJA 4HKVB 1DYUA 1KQS2 1NDOB 4GB5A 4R9KA 1W6YA 3DM8A 3IMAB 1BRIA 4GHOA 1BAOA 1CYVA 1S723 1YNVX 2CG0A 2CW9A 2CX0A 2YX9A 4LGQA 1WMOA 2ZDJA 1W5ZA 1UGIA 3A76A 1UUWB 1HZ1A 2F5MA 2GSPA 3SOYA 3WHOA 2B24B 1C7HA 1GMQA 1JB4A 1RNTA 3WR2A 3OWSA 3GZRA 5IEPA 4EV2A 2BNGA 3HK4A 3J7Yd 3NHXA 1A90A 5ELJA 1GY6A 3WMDA 1BNEA 1B2UA 2ZHXB 4I4KA 5CF2A 3PGBA 5AYRB 1UCKA 2QIYA 1HU9A 1NB3I 1O7NB 3JUNA 3NUVA 1TU5A 1IVVA 3F14A 2MF7A 1LOXA 3EHCA 1ZS7A 1Q7Y4 2W6JH 1RKYA 1VQ53 3LTAA 1MOLA 1UUGB 3G0KA 2W2CA 1TP6A 3KKGA 2FNQA 5KP1A 4OVMA 1BSDA 2XSOB 1O7WB 1RCKA 1N5PA 3D4AA 3DY5A 3BB9A 4J5KA 4KT3B 1BSEA 1OHSA 3SOAA 3OV4A 1N5HA 4ZM8A 5BIRA 1YIJ3 4J9AA 1WMPA 2R4IA 2CX1A 3M8CA 3DH2A 2H0GA 1LQGC 1GY7A 1RCLA 3HOHA 4XDWA 2AADA 2OWPA 3BNBA 1UDII 3KIIA 1UI8A 4FMDA 6STDA 3DGNA 4ILFA 3U1WA 1LOYA 1RN1A 2OTJ3 1CYUA 3Q2PA 3MKIA 1WNHA 1AVLA 2CHCA 2L4VA 2Z76A 2HMJB 4XM4A 3I563 1MGWA 3LH4A 2C10A 2W56A 1GS3A 1W01A 2WOFA 3Q90A 2KF5A 1X1UA 3GWRA 4HZ9B 4N3VA 1S5AA 3F9SA 3O8YA 1V74A 1X1XA 3FSDA 1EUIC 1BUJA 1OHPA 1BSBA 1TRQA 3LTCA 2BU4A 4WFOA 3G8ZA 2Z77A 3GRDA 1MGRA 3FKAA 1YJN3 4CCVA 2CFDA 4HZBB 3CXC2 2ZA4A 2CWVA 3EBYA 3D79A 2XRXB 5CLKA 1V57A 4EW5A 3JUQA 1LVNA 3DUKA 3KCHA 3EN8A 4WP5A 4HM1B 1OCVA 2YFIB 2HMNB 4PEJA 3CCE3 1BU4A 1B2XA 2JDIH 3MWZA 3FF0A 4EC6A 3BNCA 4GSPA 1JJ22 3WA3A 1JNQA 1BRJA 1DMQA 1W2ZA 1YVBI 2ML6A 3FH1A 3OXAA 4OUQA 5FW5A 2QA43 1SIIA 1AR0A 4IT7A 1RGFA 3KSPA 3CC73 5KP3A 1E3VA 4HM8B 1NU3A 3DGOA 3A5EA 6RNTA 3L0RA 2KCDA 2IMJA 5TGNA 5IG0A 1K8A4 2KF3A 3T8UA 2KF6A 3I553 5AEWB 1SQWA 3B4PA 3EB8A 5IEOA 2BO9B 3VF1A 1U8CB 3KSED 3F8HA 4QWTA 1UGHI 1BNIA 5BXQA 3GZXB 1IU7A 1Q42A 1RGCA 3T0UA 3CMA3 3LZAA 2C11A 1GOYA 4TX4A 7GSPA 1BRGA 5AIFA 1JZOA 1K41A 1LNIA 2CKFB 1WMNA 2K3DA 5HGRA 2E2TA 3UJMA 2IA7A 1VQK3 1BRKA 1EG9B 2M7OA 3IJEB 1NWWA 1VQ43 5EQLA 1BOXA 1YI23 3B8LA 3D5GA 3RGRA 4KZ1A 3LTDA 4N6MA 3AHWA 6GSPA 4K90B 4H61A 4MMXB 3CCL3 3LTBA 3EBTA 1W6GA 4R4KA 3MPHA 3GSPA 1TRPA 5DRVA 3SVAA 1QMAA 1JRQA 1ULIB 1X1WA 2XSHB 5M1AA 3EX9A 1VQP3 1U5OA 1BNRA 1R4YA 2W9PA 3KN4A 3NX0A 1FUWA 3K7CA 4MMZB 1GOVA 1UUVB 3G16A 3N8BA 3UL6A 1VQM3 1RGGA 1JB5A 3CU3A 3F7XA 1QALA 1UCJA 1W2B2 4WYKA 3T8NA 4L8PA 5IF6A 3WDGB 5JBSA 1W02A 1DMNA 3X41A 1JB2A 2ZL8A 1BGSA 1Q824 1YIT3 4RNTA 1I3IA 4MEIA 1IVUA 1JV2B 4HYZA 4L7KA 2Y73A 1VQN3 4EBGA 5A0OB 4LEHA 3SYUA 1RGEA 2BT3A 4LMIA 2E2UA 3ALAA 5AIIA 1F8NA 1ULJB 1BNJA 2JQ5A 2W56B 5HOHA 1C54A 5AYSC 1SPUA 2XH9A 1E3RA 1OF5B 1RJOA 2XR8B 3KZTA 4MJDA 2SBLA 3OWUA 1RGKA 1JBTA 9RNTA 1Y4KA 1IQXA 3ER7A 5IENA 3B4OA 3CC23 2GU1A 3JUMA 2UUGC 3FG4A 4DKIA 1PU4A 2J8XB 3BLZA 5JPPA 4O02B 4JRFA 1RDSA 1RN7A 1RHLA 3E99A 4BTWA 3NM7A 4LSOA 1T2HA 3CNMA 3WA2X 1AY7A 1TUHA 3D3LA 1KC84 2FGTA 1DMMA 2RGQA 4X2HA 3RDEA 1B3SA 1GD4A 3SEDA 4KVHA 4N6UA 2BMRB 2R41A 1A2PA 1IVWA 1I3FA 1VQQA 1A2KA 1YGWA 1ZO2A 3F7SA 2CFGA 4ORLA 3G713 1Q864 2GXFA 4HM4B 1MWSA 3IPTA 3V99A 1QVG2 2XEPA 1HYFA 1LOWA 1LXEA 1NO3A 3X42A 1FGOA 2CFKA 3PCRA 1UCLA 5G1LA 1I2GA 3WOEB 1VZZA 1FGQA 1EA2A 1QAFA 1RGHA 1V58A 2P0XA 2E2VA 3HI7A 3KE7A 4FMAA 4AEQA 1ISKA 1SIHA 3UB1A 3CCR3 4XB5A 3F8XA 1OHOA 3FLJA 1OF5A 1FW7A 3NBBA 1TFOA 2STDA 4BL2A 3ZFZA 2XGNA 3X3YA 3X3ZA 1RGAA 5EEOA 4EXRA 3NQZA 3AHSA 5STDA 1YVSA 1ZGXA 4N6NB 5CXOA 1US1A 2HOHA 2W04A 4KFDA 1VQ83 4K61A 1O7MB 4O3VA 1T3BA 2F86B 2XF3A 1N8R4 3S29A 3SXXA 3FGYA 1MWTA 1RGLA 2GEYA 1JKGA 3V92A 4RBNA 1PY3A 1I2EA 2P0MA 4HM2B 1W4NA 1BVIA 4WHAA 1IDPA 4EV5A 3GZYB 4N6LA 4BTXA 4BTYA 1GD3A 2GU3A 2W03A 3S27A 1IQYA 3CPOA 1GSPA 3BNEA 4O8SA 3EF8A 3NV0A 3VSYA 1O7GB 2SARA 3MG2A 7RNTA 1L5GB 3URPA 3S5CA 7STDA 1MNLA 2HMMB 2BMOB 4N6TA 4XDVA 2B1XB 3RGAA 1VQO3 1JZDA 1BSCA 1RN4A 5EVHA 1WTHA 5I97A 2CH9A 1VQ63 3Q1CA 1VQL3 1I70A 1LQMB 1RRLA 4WYKB 2W9QA 2CFLA 3DGMA 1Q7HA 2Y74A 4LZIA 1GY5A 3FF2A 2RBIA 4STDA 1IV9A 5G1KA 3CNXA 1YHQ3 2F98A 3UNLA 3CD63 3LT9A 4G1MB 1AQZA 1ROVA 4NREA 4BIRA 2CC3A 3BNDA 3V98A 4CPKA 1LOVA 3WODG 2H0HA 3FG1A 1K9M4 2F56A 4CDLA 1JBRA 3DZLA 4RNZA 8CHOA 1IT7A 1OACA 5IW9A 5AIHA 3AGNA 1IT8A 1OUNA 1ASKA 1BIRA 1AV4A 2ML5A 3H3HA 4HM5B 1VQ73 2K54A 3MG3A 1SARA 5D82A 2GEXA 3I0YA 2CG1A 3STDA 5RNTA 2P05A 3SLUA 4AKZA 8RNTA 1K734 2YFJB 2UGIA 1J2BA 5JPUA 1FGRA 2Q07A 1B2MA 1N9EA 1I0XA 2HMLB 3CME3 5IG4A 2LYXA 2XFSA 2INXA 1G02A 1PFPA 2IUJA 2IY2A 4FCJA 1BANA 1NB5I 2BHMA 1N9JA 1KSIA 1OPYA 1PYLA 1D6YA 4FMCA 3VGNA 4X2OA 3K63A 3HZPA 1B2ZA 5AIGA 2CIUA 1IK3A 1YJ93 1D6UA 2OQEA 3FCSB 4HOHA 3N54B 1K28A 2OOVC 2W0QA 1KD14 3HIGA 4HM0B 5FGOA 2MC8A 2Z7AA 2V1LA 1Z1SA 3FG3A 1Q9EA 2QGUA 4JF8A 3JUPA 2KF4A 1EKMA 1I0VA 4K1UA 2OTL3 4NPBA 1ZX2A 2FXTA 3EQQB 1EEJA 1NNVA 4XBTA 4XBYA 3CCJ3 1RMSA 3DMCA 1RRHA 3D5IA 4HJLB 3N9HA 5G2GA 4R9LA 1GYBA 2QEX3 1DETA 1VQ93 4HVNA 4EYCA 3EN1B 3LMLA 4R1KA 2LQVA 3PZWA 2H0IA 4AKYA 4OK0A 5LC6A 1KWIA 2F4YA 2OQEC 3WOFB 3MG1A 3UL5A 1IVXA 5IG5A 2K0MA 2RCDA 2CWTA 2F5WA 1R4CA 1JKGB 1AVKA 3GAXA 4HM6B 3HX8A 1B21A 1CEWI 2KRTA 3DXOA 3AMOA 1NJI4 1QAKA 4N6V0 3JUOA 5KP4A 5CK6A 1I2FA 1W7CA 2L1SA 2P38A 1I8VA 2YFLB 4FMBA 4HM7B 3ZG5A 1M9GA 4IIAA 4J5GA 3F40A 3K5TA 3MSOA 3CCV3 2BMQB 3BIRA 3NV0B 1DVCA 4NHFA 5CF1A 3CC43 1B20A 5AEUB 1SJWA 2RFRA 1RNBA 1G96A 1IQ8A 2O9UX 3CCS3 1O7PB 1JN5B 3D9RA 4CJNA 2CFWA 4WWUC 4I5QA 2CWUA 4K1VA 1RLSA 3EC9A 1IV7A 5M19A 3G4S3 1STFI 2P09A
chains in the Genus database with same CATH topology
1BNSA 1BSCA 1RN4A 1TRPA 1BNEA 1B2SA 1B2UA 1GOUA 3GSPA 1X1WA 1I70A 1BNRA 1BRHA 1UCKA 1R4YA 1GOVA 2RBIA 1RGGA 5BU4A 1AQZA 4BIRA 1RSNA 1GMRA 1UCJA 1FUTA 1LOVA 1X1YA 1BNGA 2F56A 1IYYA 1JBRA 1BSDA 1T2IA 1RCKA 3D4AA 1BGSA 1BNFA 3AGNA 4J5KA 1BSEA 4RNTA 1BIRA 1I3IA 5BIRA 1B27A 1LRAA 3DH2A 3SYUA 1RGEA 1SARA 1RCLA 3HOHA 2AADA 5RNTA 4BU4A 1BNJA 5HOHA 8RNTA 1C54A 3AGOA 1LOYA 1RN1A 1B2MA 1RGKA 1I0XA 1JBTA 9RNTA 3RNTA 1MGWA 1TTOA 1G02A 1UCIA 2BIRA 2KF5A 5GSPA 1X1UA 1BANA 1FYSA 3BU4A 1X1XA 1FUSA 1BUJA 1TRQA 1BSBA 1RDSA 1RHLA 1PYLA 2BU4A 1T2HA 1MGRA 1B2ZA 1AY7A 2RNTA 1BRNL 1DE3A 4HOHA 2ZA4A 2KAAA 1B3SA 1FZUA 1A2PA 1BRSA 1I3FA 1GMPA 1YGWA 1Q9EA 2KF4A 1I0VA 3KCHA 1BSAA 1JBSA 1HYFA 1LOWA 1RMSA 3D5IA 1BU4A 1UCLA 1B2XA 1I2GA 1RGHA 1DETA 4GSPA 1CH0A 1BRJA 2C4BA 2AAEA 1RGFA 1FW7A 2F4YA 3Q3FA 4HAAA 1RGAA 3A5EA 6RNTA 3DGYA 2F5WA 1RTUA 3AHSA 1YVSA 1ZGXA 2HOHA 2KF3A 1B21A 2KF6A 1I2FA 1I8VA 1RGLA 4J5GA 1BRIA 4GHOA 1BAOA 1BNIA 1YNVX 3BIRA 1PY3A 1I2EA 1RGCA 1B20A 1BVIA 1HZ1A 1GOYA 2F5MA 1RNBA 7GSPA 1BRGA 1LNIA 2GSPA 3WHOA 1GSPA 1GMQA 1BRKA 2SARA 1RNTA 1RLSA 7RNTA 1BOXA 3URPA 3WR2A 3D5GA 3AHWA 6GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNS A;  1BSC A;  1RN4 A;  1TRP A;  1BNE A;  1B2S A;  1B2U A;  1GOU A;  3GSP A;  1X1W A;  1I70 A;  1BNR A;  1BRH A;  1UCK A;  1R4Y A;  1GOV A;  2RBI A;  1RGG A;  5BU4 A;  1AQZ A;  4BIR A;  1RSN A;  1GMR A;  1UCJ A;  1FUT A;  1LOV A;  1X1Y A;  1BNG A;  2F56 A;  1IYY A;  1JBR A;  1BSD A;  1T2I A;  1RCK A;  3D4A A;  1BGS A;  1BNF A;  3AGN A;  4J5K A;  1BSE A;  4RNT A;  1BIR A;  1I3I A;  5BIR A;  1B27 A;  1LRA A;  3DH2 A;  3SYU A;  1RGE A;  1SAR A;  1RCL A;  3HOH A;  2AAD A;  5RNT A;  4BU4 A;  1BNJ A;  5HOH A;  8RNT A;  1C54 A;  3AGO A;  1LOY A;  1RN1 A;  1B2M A;  1RGK A;  1I0X A;  1JBT A;  9RNT A;  3RNT A;  1MGW A;  1TTO A;  1G02 A;  1UCI A;  2BIR A;  2KF5 A;  5GSP A;  1X1U A;  1BAN A;  1FYS A;  3BU4 A;  1X1X A;  1FUS A;  1BUJ A;  1TRQ A;  1BSB A;  1RDS A;  1RHL A;  1PYL A;  2BU4 A;  1T2H A;  1MGR A;  1B2Z A;  1AY7 A;  2RNT A;  1BRN L;  1DE3 A;  4HOH A;  2ZA4 A;  2KAA A;  1B3S A;  1FZU A;  1A2P A;  1BRS A;  1I3F A;  1GMP A;  1YGW A;  1Q9E A;  2KF4 A;  1I0V A;  3KCH A;  1BSA A;  1JBS A;  1HYF A;  1LOW A;  1RMS A;  3D5I A;  1BU4 A;  1UCL A;  1B2X A;  1I2G A;  1RGH A;  1DET A;  4GSP A;  1CH0 A;  1BRJ A;  2C4B A;  2AAE A;  1RGF A;  1FW7 A;  2F4Y A;  3Q3F A;  4HAA A;  1RGA A;  3A5E A;  6RNT A;  3DGY A;  2F5W A;  1RTU A;  3AHS A;  1YVS A;  1ZGX A;  2HOH A;  2KF3 A;  1B21 A;  2KF6 A;  1I2F A;  1I8V A;  1RGL A;  4J5G A;  1BRI A;  4GHO A;  1BAO A;  1BNI A;  1YNV X;  3BIR A;  1PY3 A;  1I2E A;  1RGC A;  1B20 A;  1BVI A;  1HZ1 A;  1GOY A;  2F5M A;  1RNB A;  7GSP A;  1BRG A;  1LNI A;  2GSP A;  3WHO A;  1GSP A;  1GMQ A;  1BRK A;  2SAR A;  1RNT A;  1RLS A;  7RNT A;  1BOX A;  3URP A;  3WR2 A;  3D5G A;  3AHW A;  6GSP A; 
#chains in the Genus database with same CATH topology
 1BNS A;  1WQL B;  2PNC A;  1W00 A;  3NBR A;  4FCM A;  4U13 A;  1B2S A;  1GOU A;  1LNH A;  1TJD A;  3K9M C;  3PXM A;  1BRH A;  2WO0 A;  4HBR A;  1OGX A;  5AI1 A;  1OH0 A;  2WOH A;  3LYG A;  1O7H B;  5D83 A;  1FGM A;  1W6C A;  2WGO A;  3NM2 A;  5BU4 A;  2I9W A;  1RSN A;  3NBJ A;  3ZG0 A;  1GMR A;  1FUT A;  1X1Y A;  3LT8 A;  4XBX A;  1BNG A;  1IYY A;  1STD A;  4FR9 A;  3EJV A;  1T2I A;  3H51 A;  4FCZ A;  4R80 A;  2KXG A;  1BNF A;  1OGZ A;  1QVF 2;  3CPW 2;  1T5Y A;  2D42 A;  1A2V A;  3GZB A;  3PCS A;  5IER A;  1B27 A;  1HKX A;  1LRA A;  1CQS A;  2HMK B;  1M1K 4;  3KFQ C;  5D81 A;  1JN5 A;  1M90 4;  1FGT A;  1MWU A;  3FZW A;  4KFE A;  1TIJ A;  3S67 A;  3PS8 A;  1UI7 A;  4BU4 A;  1MWR A;  3CCM 3;  1G0T A;  3ROB A;  3AGO A;  2F99 A;  5LC7 A;  2Z6B A;  3SX1 A;  4GL6 A;  1DVD A;  2GBW B;  4L8O A;  4MMY B;  2CK3 H;  1Q40 B;  3K0Z A;  1YGE A;  3RNT A;  1A67 A;  1TTO A;  3B7C A;  2A15 A;  3HII A;  1N8Q A;  1UCI A;  2RSX A;  2BIR A;  5GSP A;  1Q81 4;  1E97 A;  1FYS A;  3BU4 A;  1FUS A;  1QJG A;  2D1W A;  4J8T A;  4IPB A;  3QK9 A;  4RZM A;  5DRE A;  2HMO B;  4RNY A;  3TDG A;  1M1X B;  1BUQ A;  2UX0 A;  3NXJ A;  2RNT A;  2IUK A;  1BRN L;  1UW1 A;  1DE3 A;  3ECF A;  3JVC A;  1TFK A;  2KAA A;  3EE1 A;  3CCU 3;  4HM3 B;  1FZU A;  2O3O A;  1BRS A;  5ELU A;  1GMP A;  1D6Z A;  3X40 A;  1EQK A;  1BSA A;  1JBS A;  3OW2 2;  3LOY A;  3MYT A;  2OOV A;  1YJW 3;  2WGQ A;  5BVB A;  1FA3 A;  3DGL A;  4KFF A;  4LYL B;  3MHE A;  3OWY A;  1CH0 A;  1ROA A;  3LXU X;  2C4B A;  2AAE A;  3AMO B;  4N6O B;  4Q53 A;  3QRD A;  4BL3 A;  3PYJ A;  3Q3F A;  3OX9 A;  2XFT A;  3NQY A;  4HAA A;  3G6E 3;  2OCT A;  1Q40 A;  3DGY A;  2GBX B;  3U97 A;  1RTU A;  4O2H A;  2XGL A;  5M18 A;  2PZV A;  3X3X A;  3S28 A;  4H3U A;  5IG3 A;  3CCQ 3;  2IYJ A;  4HKV B;  1DYU A;  1KQS 2;  1NDO B;  4GB5 A;  4R9K A;  1W6Y A;  3DM8 A;  3IMA B;  1BRI A;  4GHO A;  1BAO A;  1CYV A;  1S72 3;  1YNV X;  2CG0 A;  2CW9 A;  2CX0 A;  2YX9 A;  4LGQ A;  1WMO A;  2ZDJ A;  1W5Z A;  1UGI A;  3A76 A;  1UUW B;  1HZ1 A;  2F5M A;  2GSP A;  3SOY A;  3WHO A;  2B24 B;  1C7H A;  1GMQ A;  1JB4 A;  1RNT A;  3WR2 A;  3OWS A;  3GZR A;  5IEP A;  4EV2 A;  2BNG A;  3HK4 A;  3J7Y d;  3NHX A;  1A90 A;  5ELJ A;  1GY6 A;  3WMD A;  1BNE A;  1B2U A;  2ZHX B;  4I4K A;  5CF2 A;  3PGB A;  5AYR B;  1UCK A;  2QIY A;  1HU9 A;  1NB3 I;  1O7N B;  3JUN A;  3NUV A;  1TU5 A;  1IVV A;  3F14 A;  2MF7 A;  1LOX A;  3EHC A;  1ZS7 A;  1Q7Y 4;  2W6J H;  1RKY A;  1VQ5 3;  3LTA A;  1MOL A;  1UUG B;  3G0K A;  2W2C A;  1TP6 A;  3KKG A;  2FNQ A;  5KP1 A;  4OVM A;  1BSD A;  2XSO B;  1O7W B;  1RCK A;  1N5P A;  3D4A A;  3DY5 A;  3BB9 A;  4J5K A;  4KT3 B;  1BSE A;  1OHS A;  3SOA A;  3OV4 A;  1N5H A;  4ZM8 A;  5BIR A;  1YIJ 3;  4J9A A;  1WMP A;  2R4I A;  2CX1 A;  3M8C A;  3DH2 A;  2H0G A;  1LQG C;  1GY7 A;  1RCL A;  3HOH A;  4XDW A;  2AAD A;  2OWP A;  3BNB A;  1UDI I;  3KII A;  1UI8 A;  4FMD A;  6STD A;  3DGN A;  4ILF A;  3U1W A;  1LOY A;  1RN1 A;  2OTJ 3;  1CYU A;  3Q2P A;  3MKI A;  1WNH A;  1AVL A;  2CHC A;  2L4V A;  2Z76 A;  2HMJ B;  4XM4 A;  3I56 3;  1MGW A;  3LH4 A;  2C10 A;  2W56 A;  1GS3 A;  1W01 A;  2WOF A;  3Q90 A;  2KF5 A;  1X1U A;  3GWR A;  4HZ9 B;  4N3V A;  1S5A A;  3F9S A;  3O8Y A;  1V74 A;  1X1X A;  3FSD A;  1EUI C;  1BUJ A;  1OHP A;  1BSB A;  1TRQ A;  3LTC A;  2BU4 A;  4WFO A;  3G8Z A;  2Z77 A;  3GRD A;  1MGR A;  3FKA A;  1YJN 3;  4CCV A;  2CFD A;  4HZB B;  3CXC 2;  2ZA4 A;  2CWV A;  3EBY A;  3D79 A;  2XRX B;  5CLK A;  1V57 A;  4EW5 A;  3JUQ A;  1LVN A;  3DUK A;  3KCH A;  3EN8 A;  4WP5 A;  4HM1 B;  1OCV A;  2YFI B;  2HMN B;  4PEJ A;  3CCE 3;  1BU4 A;  1B2X A;  2JDI H;  3MWZ A;  3FF0 A;  4EC6 A;  3BNC A;  4GSP A;  1JJ2 2;  3WA3 A;  1JNQ A;  1BRJ A;  1DMQ A;  1W2Z A;  1YVB I;  2ML6 A;  3FH1 A;  3OXA A;  4OUQ A;  5FW5 A;  2QA4 3;  1SII A;  1AR0 A;  4IT7 A;  1RGF A;  3KSP A;  3CC7 3;  5KP3 A;  1E3V A;  4HM8 B;  1NU3 A;  3DGO A;  3A5E A;  6RNT A;  3L0R A;  2KCD A;  2IMJ A;  5TGN A;  5IG0 A;  1K8A 4;  2KF3 A;  3T8U A;  2KF6 A;  3I55 3;  5AEW B;  1SQW A;  3B4P A;  3EB8 A;  5IEO A;  2BO9 B;  3VF1 A;  1U8C B;  3KSE D;  3F8H A;  4QWT A;  1UGH I;  1BNI A;  5BXQ A;  3GZX B;  1IU7 A;  1Q42 A;  1RGC A;  3T0U A;  3CMA 3;  3LZA A;  2C11 A;  1GOY A;  4TX4 A;  7GSP A;  1BRG A;  5AIF A;  1JZO A;  1K41 A;  1LNI A;  2CKF B;  1WMN A;  2K3D A;  5HGR A;  2E2T A;  3UJM A;  2IA7 A;  1VQK 3;  1BRK A;  1EG9 B;  2M7O A;  3IJE B;  1NWW A;  1VQ4 3;  5EQL A;  1BOX A;  1YI2 3;  3B8L A;  3D5G A;  3RGR A;  4KZ1 A;  3LTD A;  4N6M A;  3AHW A;  6GSP A;  4K90 B;  4H61 A;  4MMX B;  3CCL 3;  3LTB A;  3EBT A;  1W6G A;  4R4K A;  3MPH A;  3GSP A;  1TRP A;  5DRV A;  3SVA A;  1QMA A;  1JRQ A;  1ULI B;  1X1W A;  2XSH B;  5M1A A;  3EX9 A;  1VQP 3;  1U5O A;  1BNR A;  1R4Y A;  2W9P A;  3KN4 A;  3NX0 A;  1FUW A;  3K7C A;  4MMZ B;  1GOV A;  1UUV B;  3G16 A;  3N8B A;  3UL6 A;  1VQM 3;  1RGG A;  1JB5 A;  3CU3 A;  3F7X A;  1QAL A;  1UCJ A;  1W2B 2;  4WYK A;  3T8N A;  4L8P A;  5IF6 A;  3WDG B;  5JBS A;  1W02 A;  1DMN A;  3X41 A;  1JB2 A;  2ZL8 A;  1BGS A;  1Q82 4;  1YIT 3;  4RNT A;  1I3I A;  4MEI A;  1IVU A;  1JV2 B;  4HYZ A;  4L7K A;  2Y73 A;  1VQN 3;  4EBG A;  5A0O B;  4LEH A;  3SYU A;  1RGE A;  2BT3 A;  4LMI A;  2E2U A;  3ALA A;  5AII A;  1F8N A;  1ULJ B;  1BNJ A;  2JQ5 A;  2W56 B;  5HOH A;  1C54 A;  5AYS C;  1SPU A;  2XH9 A;  1E3R A;  1OF5 B;  1RJO A;  2XR8 B;  3KZT A;  4MJD A;  2SBL A;  3OWU A;  1RGK A;  1JBT A;  9RNT A;  1Y4K A;  1IQX A;  3ER7 A;  5IEN A;  3B4O A;  3CC2 3;  2GU1 A;  3JUM A;  2UUG C;  3FG4 A;  4DKI A;  1PU4 A;  2J8X B;  3BLZ A;  5JPP A;  4O02 B;  4JRF A;  1RDS A;  1RN7 A;  1RHL A;  3E99 A;  4BTW A;  3NM7 A;  4LSO A;  1T2H A;  3CNM A;  3WA2 X;  1AY7 A;  1TUH A;  3D3L A;  1KC8 4;  2FGT A;  1DMM A;  2RGQ A;  4X2H A;  3RDE A;  1B3S A;  1GD4 A;  3SED A;  4KVH A;  4N6U A;  2BMR B;  2R41 A;  1A2P A;  1IVW A;  1I3F A;  1VQQ A;  1A2K A;  1YGW A;  1ZO2 A;  3F7S A;  2CFG A;  4ORL A;  3G71 3;  1Q86 4;  2GXF A;  4HM4 B;  1MWS A;  3IPT A;  3V99 A;  1QVG 2;  2XEP A;  1HYF A;  1LOW A;  1LXE A;  1NO3 A;  3X42 A;  1FGO A;  2CFK A;  3PCR A;  1UCL A;  5G1L A;  1I2G A;  3WOE B;  1VZZ A;  1FGQ A;  1EA2 A;  1QAF A;  1RGH A;  1V58 A;  2P0X A;  2E2V A;  3HI7 A;  3KE7 A;  4FMA A;  4AEQ A;  1ISK A;  1SIH A;  3UB1 A;  3CCR 3;  4XB5 A;  3F8X A;  1OHO A;  3FLJ A;  1OF5 A;  1FW7 A;  3NBB A;  1TFO A;  2STD A;  4BL2 A;  3ZFZ A;  2XGN A;  3X3Y A;  3X3Z A;  1RGA A;  5EEO A;  4EXR A;  3NQZ A;  3AHS A;  5STD A;  1YVS A;  1ZGX A;  4N6N B;  5CXO A;  1US1 A;  2HOH A;  2W04 A;  4KFD A;  1VQ8 3;  4K61 A;  1O7M B;  4O3V A;  1T3B A;  2F86 B;  2XF3 A;  1N8R 4;  3S29 A;  3SXX A;  3FGY A;  1MWT A;  1RGL A;  2GEY A;  1JKG A;  3V92 A;  4RBN A;  1PY3 A;  1I2E A;  2P0M A;  4HM2 B;  1W4N A;  1BVI A;  4WHA A;  1IDP A;  4EV5 A;  3GZY B;  4N6L A;  4BTX A;  4BTY A;  1GD3 A;  2GU3 A;  2W03 A;  3S27 A;  1IQY A;  3CPO A;  1GSP A;  3BNE A;  4O8S A;  3EF8 A;  3NV0 A;  3VSY A;  1O7G B;  2SAR A;  3MG2 A;  7RNT A;  1L5G B;  3URP A;  3S5C A;  7STD A;  1MNL A;  2HMM B;  2BMO B;  4N6T A;  4XDV A;  2B1X B;  3RGA A;  1VQO 3;  1JZD A;  1BSC A;  1RN4 A;  5EVH A;  1WTH A;  5I97 A;  2CH9 A;  1VQ6 3;  3Q1C A;  1VQL 3;  1I70 A;  1LQM B;  1RRL A;  4WYK B;  2W9Q A;  2CFL A;  3DGM A;  1Q7H A;  2Y74 A;  4LZI A;  1GY5 A;  3FF2 A;  2RBI A;  4STD A;  1IV9 A;  5G1K A;  3CNX A;  1YHQ 3;  2F98 A;  3UNL A;  3CD6 3;  3LT9 A;  4G1M B;  1AQZ A;  1ROV A;  4NRE A;  4BIR A;  2CC3 A;  3BND A;  3V98 A;  4CPK A;  1LOV A;  3WOD G;  2H0H A;  3FG1 A;  1K9M 4;  2F56 A;  4CDL A;  1JBR A;  3DZL A;  4RNZ A;  8CHO A;  1IT7 A;  1OAC A;  5IW9 A;  5AIH A;  3AGN A;  1IT8 A;  1OUN A;  1ASK A;  1BIR A;  1AV4 A;  2ML5 A;  3H3H A;  4HM5 B;  1VQ7 3;  2K54 A;  3MG3 A;  1SAR A;  5D82 A;  2GEX A;  3I0Y A;  2CG1 A;  3STD A;  5RNT A;  2P05 A;  3SLU A;  4AKZ A;  8RNT A;  1K73 4;  2YFJ B;  2UGI A;  1J2B A;  5JPU A;  1FGR A;  2Q07 A;  1B2M A;  1N9E A;  1I0X A;  2HML B;  3CME 3;  5IG4 A;  2LYX A;  2XFS A;  2INX A;  1G02 A;  1PFP A;  2IUJ A;  2IY2 A;  4FCJ A;  1BAN A;  1NB5 I;  2BHM A;  1N9J A;  1KSI A;  1OPY A;  1PYL A;  1D6Y A;  4FMC A;  3VGN A;  4X2O A;  3K63 A;  3HZP A;  1B2Z A;  5AIG A;  2CIU A;  1IK3 A;  1YJ9 3;  1D6U A;  2OQE A;  3FCS B;  4HOH A;  3N54 B;  1K28 A;  2OOV C;  2W0Q A;  1KD1 4;  3HIG A;  4HM0 B;  5FGO A;  2MC8 A;  2Z7A A;  2V1L A;  1Z1S A;  3FG3 A;  1Q9E A;  2QGU A;  4JF8 A;  3JUP A;  2KF4 A;  1EKM A;  1I0V A;  4K1U A;  2OTL 3;  4NPB A;  1ZX2 A;  2FXT A;  3EQQ B;  1EEJ A;  1NNV A;  4XBT A;  4XBY A;  3CCJ 3;  1RMS A;  3DMC A;  1RRH A;  3D5I A;  4HJL B;  3N9H A;  5G2G A;  4R9L A;  1GYB A;  2QEX 3;  1DET A;  1VQ9 3;  4HVN A;  4EYC A;  3EN1 B;  3LML A;  4R1K A;  2LQV A;  3PZW A;  2H0I A;  4AKY A;  4OK0 A;  5LC6 A;  1KWI A;  2F4Y A;  2OQE C;  3WOF B;  3MG1 A;  3UL5 A;  1IVX A;  5IG5 A;  2K0M A;  2RCD A;  2CWT A;  2F5W A;  1R4C A;  1JKG B;  1AVK A;  3GAX A;  4HM6 B;  3HX8 A;  1B21 A;  1CEW I;  2KRT A;  3DXO A;  3AMO A;  1NJI 4;  1QAK A;  4N6V 0;  3JUO A;  5KP4 A;  5CK6 A;  1I2F A;  1W7C A;  2L1S A;  2P38 A;  1I8V A;  2YFL B;  4FMB A;  4HM7 B;  3ZG5 A;  1M9G A;  4IIA A;  4J5G A;  3F40 A;  3K5T A;  3MSO A;  3CCV 3;  2BMQ B;  3BIR A;  3NV0 B;  1DVC A;  4NHF A;  5CF1 A;  3CC4 3;  1B20 A;  5AEU B;  1SJW A;  2RFR A;  1RNB A;  1G96 A;  1IQ8 A;  2O9U X;  3CCS 3;  1O7P B;  1JN5 B;  3D9R A;  4CJN A;  2CFW A;  4WWU C;  4I5Q A;  2CWU A;  4K1V A;  1RLS A;  3EC9 A;  1IV7 A;  5M19 A;  3G4S 3;  1STF I;  2P09 A; 
#chains in the Genus database with same CATH homology
 1BNS A;  1BSC A;  1RN4 A;  1TRP A;  1BNE A;  1B2S A;  1B2U A;  1GOU A;  3GSP A;  1X1W A;  1I70 A;  1BNR A;  1BRH A;  1UCK A;  1R4Y A;  1GOV A;  2RBI A;  1RGG A;  5BU4 A;  1AQZ A;  4BIR A;  1RSN A;  1GMR A;  1UCJ A;  1FUT A;  1LOV A;  1X1Y A;  1BNG A;  2F56 A;  1IYY A;  1JBR A;  1BSD A;  1T2I A;  1RCK A;  3D4A A;  1BGS A;  1BNF A;  3AGN A;  4J5K A;  1BSE A;  4RNT A;  1BIR A;  1I3I A;  5BIR A;  1B27 A;  1LRA A;  3DH2 A;  3SYU A;  1RGE A;  1SAR A;  1RCL A;  3HOH A;  2AAD A;  5RNT A;  4BU4 A;  1BNJ A;  5HOH A;  8RNT A;  1C54 A;  3AGO A;  1LOY A;  1RN1 A;  1B2M A;  1RGK A;  1I0X A;  1JBT A;  9RNT A;  3RNT A;  1MGW A;  1TTO A;  1G02 A;  1UCI A;  2BIR A;  2KF5 A;  5GSP A;  1X1U A;  1BAN A;  1FYS A;  3BU4 A;  1X1X A;  1FUS A;  1BUJ A;  1TRQ A;  1BSB A;  1RDS A;  1RHL A;  1PYL A;  2BU4 A;  1T2H A;  1MGR A;  1B2Z A;  1AY7 A;  2RNT A;  1BRN L;  1DE3 A;  4HOH A;  2ZA4 A;  2KAA A;  1B3S A;  1FZU A;  1A2P A;  1BRS A;  1I3F A;  1GMP A;  1YGW A;  1Q9E A;  2KF4 A;  1I0V A;  3KCH A;  1BSA A;  1JBS A;  1HYF A;  1LOW A;  1RMS A;  3D5I A;  1BU4 A;  1UCL A;  1B2X A;  1I2G A;  1RGH A;  1DET A;  4GSP A;  1CH0 A;  1BRJ A;  2C4B A;  2AAE A;  1RGF A;  1FW7 A;  2F4Y A;  3Q3F A;  4HAA A;  1RGA A;  3A5E A;  6RNT A;  3DGY A;  2F5W A;  1RTU A;  3AHS A;  1YVS A;  1ZGX A;  2HOH A;  2KF3 A;  1B21 A;  2KF6 A;  1I2F A;  1I8V A;  1RGL A;  4J5G A;  1BRI A;  4GHO A;  1BAO A;  1BNI A;  1YNV X;  3BIR A;  1PY3 A;  1I2E A;  1RGC A;  1B20 A;  1BVI A;  1HZ1 A;  1GOY A;  2F5M A;  1RNB A;  7GSP A;  1BRG A;  1LNI A;  2GSP A;  3WHO A;  1GSP A;  1GMQ A;  1BRK A;  2SAR A;  1RNT A;  1RLS A;  7RNT A;  1BOX A;  3URP A;  3WR2 A;  3D5G A;  3AHW A;  6GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...