1GOUA

Ribonuclease binase (g specific endonuclease) unliganded form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
109
structure length
109
Chain Sequence
AVINTFDGVADYLIRYKRLPNDYITKSQASALGWVASKGDLAEVAPGKSIGGDVFSNREGRLPSAGSRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE
publication title The Structure of Substrate-Free Microbial Ribonuclease Binase and of its Complexes with 3'Gmp and Sulfate Ions
pubmed doi rcsb
source organism Bacillus intermedius
molecule tags Hydrolase
total genus 25
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gouA00
1B27A 1LOYA 1TRQA 3AGNA 2KF4A 1LRAA 1GSPA 1B2ZA 1AY7A 7RNTA 4J5KA 2F4YA 1RGEA 1RLSA 1TTOA 1B2UA 1BOXA 3BU4A 1BSBA 3RNTA 3AHSA 1BAOA 1FUSA 3URPA 1B20A 2BIRA 1IYYA 2RNTA 1B3SA 1BIRA 1RGKA 1RGHA 2HOHA 1FW7A 1PY3A 1LNIA 1GMQA 1RNBA 1I0XA 3AGOA 1UCLA 9RNTA 1A2PA 3KCHA 3AHWA 1T2IA 2KAAA 1YNVX 1RNTA 1BRIA 2KF6A 1RSNA 1BNFA 5GSPA 1G02A 3WHOA 5HOHA 1I2GA 5RNTA 2KF3A 1YVSA 1I0VA 2SARA 1I3IA 1MGWA 1RGAA 1RDSA 2AADA 1BNEA 1C54A 1RN4A 4BIRA 7GSPA 1B2MA 1CH0A 6RNTA 1FYSA 1BRJA 3D4AA 1RTUA 1BSCA 1BGSA 1B21A 1RHLA 4J5GA 1BNSA 1B2SA 1HZ1A 1BSAA 1I8VA 1I2FA 1FZUA 3D5GA 1UCKA 1I2EA 1RGGA 1BUJA 1ZGXA 2F5WA 3A5EA 1MGRA 3GSPA 1BRNL 1JBTA 1BVIA 2BU4A 1HYFA 1RCKA 1UCJA 3BIRA 1BRHA 1RCLA 6GSPA 4RNTA 1GOVA 1BRGA 2RBIA 1RGFA 1Q9EA 3HOHA 3SYUA 4GHOA 1RGCA 1T2HA 1BNRA 5BIRA 5BU4A 3WR2A 1X1YA 1I70A 3D5IA 1BRSA 4BU4A 2KF5A 4HOHA 1BNIA 1BSEA 1RGLA 3DGYA 1SARA 1X1UA 1AQZA 1GMPA 8RNTA 1GOUA 1PYLA 1B2XA 1DE3A 1BNJA 1JBSA 1I3FA 2GSPA 2AAEA 1X1XA 1LOVA 1YGWA 1DETA 1BNGA 3DH2A 1BRKA 2F5MA 2F56A 1BU4A 1UCIA 2C4BA 1GOYA 1GMRA 1RN1A 1BSDA 1LOWA 3Q3FA 1FUTA 1RMSA 2ZA4A 4HAAA 1TRPA 1R4YA 1JBRA 1BANA 4GSPA 1X1WA
chains in the Genus database with same CATH superfamily
1GD4A 1NB5I 2XFTA 3GZBA 1JB2A 2KF4A 1LRAA 3G6E3 4HM2B 3HIIA 3JUNA 4EYCA 1E97A 1RRLA 2GBXB 2CG0A 2O9UX 4J5KA 4O3VA 4X2OA 2OQEC 4BTXA 1VQ73 2Y73A 2Y74A 1TJDA 3NBJA 5EVHA 5AEWB 3G0KA 1YJ93 1BOXA 3BU4A 2Z7AA 1GY5A 3BNEA 4FMCA 3X3YA 4AEQA 2BIRA 1IYYA 1JNQA 1JKGB 3F8XA 1BIRA 1IV9A 1E3VA 1TUHA 2L4VA 3FGYA 4N6MA 2E2VA 2RSXA 5IG5A 4K61A 3MG1A 3DGLA 1UDII 3ALAA 1KC84 1DMNA 2F99A 3AHWA 3KCHA 1W2B2 1T2IA 2W6JH 2XRXB 1YGEA 3FG3A 3KKGA 4N6V0 1RNTA 1IT7A 1BRIA 2CFDA 2GU1A 2KF6A 3G4S3 5KP1A 1YJW3 1JN5B 5RNTA 1UI8A 3CU3A 3OV4A 1Q7Y4 2CKFB 1IQ8A 1BNEA 1TP6A 3WMDA 2ML5A 1NDOB 3VSYA 1C54A 2IYJA 5D81A 1VQK3 7GSPA 1JKGA 1K41A 1GY6A 3O8YA 1B21A 4N6UA 3LOYA 4J5GA 1BSAA 3EQQB 1I2FA 5JBSA 2CWVA 4EC6A 4XDWA 1RN7A 3OXAA 4MEIA 1RGGA 4AKYA 1IVUA 1AR0A 2LQVA 3STDA 1QAFA 1GYBA 2F5WA 2F86B 3MPHA 1MGRA 2Z77A 3GSPA 3PXMA 5AIFA 4RBNA 1QJGA 2MC8A 5CF1A 5IG4A 3SOAA 4HM7B 1W5ZA 4HYZA 1BVIA 1RCKA 1D6YA 2A15A 1UCJA 3GZYB 3BIRA 1JN5A 4R4KA 2IMJA 3LT9A 3NQYA 1A90A 3KSED 1QVF2 6GSPA 3FH1A 4RNTA 1BRGA 5FGOA 1MNLA 3G8ZA 1NNVA 1Q864 4O02B 1FGMA 1RGCA 5LC6A 3KN4A 1BNRA 3I0YA 3X41A 3CCS3 1VQ63 4WFOA 1MOLA 1IQXA 1X1YA 1I70A 5TGNA 2H0HA 4CJNA 2Z76A 2K3DA 3FSDA 4HOHA 4L8OA 1BNIA 3D3LA 1N5PA 4J8TA 3DGYA 5IEOA 1SARA 1M1K4 4EXRA 2C10A 1GMPA 4PEJA 3NXJA 1B2XA 3CPOA 1BNJA 2W9PA 4FMBA 3RGAA 3X42A 5AIGA 1Q814 5CF2A 1ROVA 4BTWA 2FXTA 1L5GB 5EQLA 2BMRB 2I9WA 3D9RA 2MF7A 2KCDA 2J8XB 1IDPA 1JB4A 2D42A 1O7PB 4K90B 3D79A 1JZOA 3H51A 1HKXA 3U97A 4OVMA 1W6CA 5ELUA 1FGOA 3ZG0A 4CDLA 1ZS7A 1M1XB 1LQMB 4MMXB 1V58A 4N6TA 3FLJA 3LTCA 3JVCA 1LOWA 3FCSB 4WYKB 5JPUA 1OACA 2CWUA 4HAAA 2HMMB 4HM6B 2C11A 5M1AA 1NJI4 2BT3A 2CX0A 3K0ZA 3OWUA 4L8PA 4GSPA 1X1WA 4LYLB 1LOYA 1TRQA 3LYGA 3NV0B 3WODG 4K1VA 3VGNA 1GSPA 1OF5A 3MSOA 5IENA 1AVKA 5AYSC 1RJOA 1VQ53 5LC7A 5STDA 1LNHA 1W00A 1RLSA 3DUKA 1O7GB 2H0GA 3DMCA 4WWUC 1VZZA 1BSBA 3MG2A 3EHCA 2CWTA 2OWPA 5FW5A 1RKYA 1ULJB 1DMMA 4HVNA 5IEPA 1VQP3 2OTJ3 1TU5A 3AMOB 1A67A 1RGHA 2HOHA 3MWZA 1K28A 2QA43 2FNQA 3LTAA 3TDGA 1I0XA 2BMQB 1RNBA 1OHPA 3AGOA 3LT8A 3FF0A 4IPBA 4G1MB 3ZFZA 3CC23 1A2PA 4LEHA 1WQLB 1FGRA 3UNLA 5M18A 1F8NA 3DGNA 3ECFA 3NV0A 5AIIA 3ZG5A 2YFLB 1N5HA 3SOYA 1RSNA 1BNFA 1ROAA 3EN8A 3F14A 4R9KA 4ILFA 1DVCA 7STDA 3LXUX 1JZDA 1LQGC 1MGWA 5BXQA 1RGAA 1RDSA 2SBLA 3BLZA 3BNDA 1W01A 4NPBA 4CPKA 4H3UA 1FA3A 5HGRA 3OWYA 2OTL3 1B2MA 6RNTA 4BL2A 4IIAA 1Y4KA 3FG1A 3SEDA 1AV4A 1BGSA 2XGNA 3M8CA 3AMOA 1BNSA 3QK9A 1T5YA 2CFKA 1FZUA 3F8HA 5KP4A 3MKIA 4XDVA 4K1UA 3A5EA 3FG4A 1OH0A 4HKVB 2CIUA 1UUWB 2RGQA 5BVBA 3K63A 2BU4A 1Q40B 2CHCA 4LSOA 1KD14 1TIJA 1BRHA 1UUGB 1O7NB 3EF8A 4I5QA 3I553 1DMQA 3PS8A 1SJWA 2K54A 1FGQA 2P0XA 3HOHA 3LTBA 5G1KA 1IVXA 1VQQA 1W7CA 4N3VA 1RRHA 4JF8A 1N8QA 1A2VA 4NREA 1O7HB 1BRSA 1WTHA 3NBRA 2B24B 3CPW2 3ER7A 1RGLA 3RDEA 3B8LA 3SX1A 3DZLA 1PYLA 1DE3A 3SXXA 4NHFA 2YX9A 2JDIH 3KZTA 3U1WA 2GSPA 3EC9A 2ZL8A 1J2BA 5A0OB 1UW1A 2AAEA 3KE7A 2P0MA 1JB5A 1X1XA 3JUQA 4FMDA 4HM3B 8CHOA 1DETA 2Z6BA 3X3ZA 3DH2A 3JUOA 1BRKA 3T8UA 2R41A 1VQ43 3X40A 4R80A 1OGXA 3DM8A 1EEJA 1UCIA 3WA3A 2C4BA 2HMOB 1BUQA 3FKAA 1GMRA 2HMKB 1QAKA 1KQS2 1RN1A 3CMA3 1VQM3 4R1KA 3V99A 1K9M4 1JV2B 3Q3FA 1FUTA 2ZA4A 3EB8A 4MMZB 3CD63 1W2ZA 1R4CA 1EKMA 1W6YA 1R4YA 3JUPA 3N54B 1CYUA 1FUWA 2IUKA 2E2TA 2RFRA 4FCMA 1WMOA 1B27A 1MWRA 1NU3A 2KRTA 3AGNA 3NM7A 1A2KA 1EG9B 1LXEA 2H0IA 2IY2A 1B2ZA 1DVDA 3HX8A 1VQ83 3PCRA 7RNTA 2W03A 1EQKA 4EV5A 2P05A 2F4YA 1RGEA 3UL6A 1TTOA 3JUMA 1K734 2XH9A 2W56B 4WP5A 2O3OA 1FUSA 1B20A 3CCJ3 2GBWB 1W02A 2WGOA 1CEWI 3Q90A 4KFEA 2LYXA 3S67A 3V92A 1ULIB 1FW7A 3WOFB 6STDA 4MMYB 1LNIA 3N9HA 3EN1B 1PU4A 2CFWA 1UCLA 2CG1A 3Q2PA 5DREA 3HIGA 3MYTA 2STDA 4O8SA 3WOEB 1OHOA 4HM0B 3EBYA 4R9LA 2PNCA 2XSHB 1ZO2A 1G02A 1GS3A 3L0RA 4LMIA 3SLUA 2KF3A 3KFQC 1STFI 2SARA 2W56A 1OGZA 3NHXA 2AADA 1WMNA 2GEYA 4BIRA 4N6OB 3N8BA 1FYSA 1S5AA 3D4AA 3FZWA 1BSCA 3GWRA 4BU4A 2BO9B 2V1LA 4CCVA 1B2SA 1QALA 3CCQ3 1OCVA 4N6NB 4LZIA 3D5GA 4EW5A 1UCKA 4WYKA 1EUIC 2BNGA 2R4IA 3UJMA 3G713 5AYRB 1TFKA 3PYJA 4RZMA 1KSIA 1YJN3 1DYUA 3F40A 2F98A 4FCJA 4OUQA 1BRNL 4STDA 1LVNA 1HYFA 2QIYA 4EBGA 2K0MA 2YFJB 1YVBI 4I4KA 4HBRA 3UL5A 5G2GA 3E99A 4U13A 1RGFA 3DXOA 4XB5A 3WA2X 4BTYA 3SYUA 4L7KA 2QEX3 4HZBB 3S27A 4Q53A 1YI23 3RGRA 5BIRA 3WR2A 4HM1B 3J7Yd 4DKIA 3I563 3LTDA 2KF5A 3PCSA 2JQ5A 2CC3A 3Q1CA 3CME3 1X1UA 1AQZA 2GEXA 1K8A4 3NM2A 3HI7A 3UB1A 1ZX2A 8RNTA 1O7MB 3PGBA 2OQEA 4AKZA 3CCE3 1UUVB 3CCM3 2INXA 1JBSA 2RCDA 5I97A 2ZDJA 1I3FA 1MWSA 3EJVA 4WHAA 3MG3A 1OUNA 1Q824 4XBXA 1SQWA 1D6ZA 1LOVA 1M9GA 3CCV3 4IT7A 4O2HA 5CK6A 1KWIA 1OHSA 2XF3A 3IJEB 4HM4B 5CXOA 5IERA 2F5MA 2XFSA 4TX4A 3LMLA 3MHEA 1GOYA 3K5TA 2M7OA 1BSDA 1W4NA 1IV7A 2XR8B 5ELJA 3K7CA 3EX9A 1Z1SA 1JBRA 2BHMA 2WGQA 1BANA 1T3BA 3F7SA 5EEOA 1N9JA 1OPYA 3KIIA 3LH4A 3LZAA 2ZHXB 1G0TA 3EBTA 3IMAB 4HM5B 1G96A 4KZ1A 5KP3A 5IG3A 4LGQA 1S723 2E2UA 3T8NA 3FF2A 3HK4A 4HM8B 4FCZA 1AY7A 3QRDA 1Q40A 4XBTA 2P38A 1NO3A 3X3XA 1UGHI 2YFIB 1B2UA 1ASKA 2GU3A 5IG0A 2HMLB 3VF1A 3RNTA 3AHSA 1BAOA 3URPA 1UGIA 2QGUA 4RNZA 4RNYA 2RNTA 5M19A 3CC73 1B3SA 4HZ9B 1VQL3 1RGKA 3CNMA 1MWUA 2CH9A 3NX0A 1PY3A 2GXFA 2HMNB 3F9SA 3B4OA 3HZPA 1GMQA 1AVLA 4KT3B 4H61A 2OCTA 9RNTA 2CFLA 3OX9A 3BNBA 3CCU3 1JJ22 3CCL3 1FGTA 1IVVA 1D6UA 1LOXA 2UUGC 4QWTA 2KAAA 1YNVX 3H3HA 1QMAA 2CW9A 4KVHA 1IVWA 5CLKA 5GSPA 2HMJB 3GAXA 5D83A 3WHOA 2L1SA 1I2GA 3WDGB 5HOHA 1YVSA 1I0VA 1MWTA 1I3IA 2WOHA 1TFOA 3B4PA 4FR9A 1N8R4 3ROBA 4BL3A 1V57A 1N9EA 4J9AA 2WO0A 4MJDA 1RN4A 2W9QA 1VQN3 1CH0A 2CX1A 1BRJA 1U5OA 1RTUA 3SVAA 1HU9A 1WNHA 1Q42A 1RHLA 1I8VA 1HZ1A 1E3RA 2ML6A 1YIT3 1I2EA 1BUJA 1W6GA 1ZGXA 1VQO3 3GZXB 1IQYA 1O7WB 4XM4A 2OOVA 1OF5B 4FMAA 1JBTA 1SIHA 1SPUA 1CYVA 4XBYA 3NQZA 4EV2A 4X2HA 1ISKA 2KXGA 3BNCA 2OOVC 1RCLA 3CXC2 1UI7A 3K9MC 1GOVA 2RBIA 3G16A 1Q9EA 3KSPA 4GHOA 1IT8A 1GD3A 1T2HA 2PZVA 2UGIA 1NB3I 2XGLA 1WMPA 3DGOA 5BU4A 1C7HA 4JRFA 3CCR3 1Q7HA 2B1XB 2UX0A 2IUJA 3D5IA 1QVG2 1IU7A 2W0QA 4HJLB 1V74A 4ORLA 5IF6A 2CFGA 5AI1A 3NBBA 5IW9A 1BSEA 1YIJ3 1VQ93 3GRDA 3CNXA 5DRVA 3CC43 1U8CB 3OW22 1GOUA 1JRQA 3A76A 3S28A 2XSOB 2CK3H 3PZWA 3S29A 3GZRA 3T0UA 2D1WA 3OWSA 1GY7A 4ZM8A 1M904 2FGTA 4OK0A 5D82A 3S5CA 5AEUB 1NWWA 4GB5A 2BMOB 3B7CA 5G1LA 1YGWA 2W04A 1BNGA 3IPTA 4KFFA 3NUVA 5AIHA 1CQSA 3DGMA 3EE1A 4GL6A 5JPPA 1IK3A 2F56A 1BU4A 2XEPA 3F7XA 1STDA 1SIIA 2P09A 1YHQ3 3DY5A 2W2CA 2Q07A 1EA2A 1PFPA 2IA7A 4KFDA 1RMSA 4N6LA 1TRPA 2WOFA 1US1A 3BB9A 3V98A
chains in the Genus database with same CATH topology
1B27A 1LOYA 1TRQA 3AGNA 2KF4A 1LRAA 1GSPA 1B2ZA 1AY7A 7RNTA 4J5KA 2F4YA 1RGEA 1RLSA 1TTOA 1B2UA 1BOXA 3BU4A 1BSBA 3RNTA 3AHSA 1BAOA 1FUSA 3URPA 1B20A 2BIRA 1IYYA 2RNTA 1B3SA 1BIRA 1RGKA 1RGHA 2HOHA 1FW7A 1PY3A 1LNIA 1GMQA 1RNBA 1I0XA 3AGOA 1UCLA 9RNTA 1A2PA 3KCHA 3AHWA 1T2IA 2KAAA 1YNVX 1RNTA 1BRIA 2KF6A 1RSNA 1BNFA 5GSPA 1G02A 3WHOA 5HOHA 1I2GA 5RNTA 2KF3A 1YVSA 1I0VA 2SARA 1I3IA 1MGWA 1RGAA 1RDSA 2AADA 1BNEA 1C54A 1RN4A 4BIRA 7GSPA 1B2MA 1CH0A 6RNTA 1FYSA 1BRJA 3D4AA 1RTUA 1BSCA 1BGSA 1B21A 1RHLA 4J5GA 1BNSA 1B2SA 1HZ1A 1BSAA 1I8VA 1I2FA 1FZUA 3D5GA 1UCKA 1I2EA 1RGGA 1BUJA 1ZGXA 2F5WA 3A5EA 1MGRA 3GSPA 1BRNL 1JBTA 1BVIA 2BU4A 1HYFA 1RCKA 1UCJA 3BIRA 1BRHA 1RCLA 6GSPA 4RNTA 1GOVA 1BRGA 2RBIA 1RGFA 1Q9EA 3HOHA 3SYUA 4GHOA 1RGCA 1T2HA 1BNRA 5BIRA 5BU4A 3WR2A 1X1YA 1I70A 3D5IA 1BRSA 4BU4A 2KF5A 4HOHA 1BNIA 1BSEA 1RGLA 3DGYA 1SARA 1X1UA 1AQZA 1GMPA 8RNTA 1GOUA 1PYLA 1B2XA 1DE3A 1BNJA 1JBSA 1I3FA 2GSPA 2AAEA 1X1XA 1LOVA 1YGWA 1DETA 1BNGA 3DH2A 1BRKA 2F5MA 2F56A 1BU4A 1UCIA 2C4BA 1GOYA 1GMRA 1RN1A 1BSDA 1LOWA 3Q3FA 1FUTA 1RMSA 2ZA4A 4HAAA 1TRPA 1R4YA 1JBRA 1BANA 4GSPA 1X1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B27 A;  1LOY A;  1TRQ A;  3AGN A;  2KF4 A;  1LRA A;  1GSP A;  1B2Z A;  1AY7 A;  7RNT A;  4J5K A;  2F4Y A;  1RGE A;  1RLS A;  1TTO A;  1B2U A;  1BOX A;  3BU4 A;  1BSB A;  3RNT A;  3AHS A;  1BAO A;  1FUS A;  3URP A;  1B20 A;  2BIR A;  1IYY A;  2RNT A;  1B3S A;  1BIR A;  1RGK A;  1RGH A;  2HOH A;  1FW7 A;  1PY3 A;  1LNI A;  1GMQ A;  1RNB A;  1I0X A;  3AGO A;  1UCL A;  9RNT A;  1A2P A;  3KCH A;  3AHW A;  1T2I A;  2KAA A;  1YNV X;  1RNT A;  1BRI A;  2KF6 A;  1RSN A;  1BNF A;  5GSP A;  1G02 A;  3WHO A;  5HOH A;  1I2G A;  5RNT A;  2KF3 A;  1YVS A;  1I0V A;  2SAR A;  1I3I A;  1MGW A;  1RGA A;  1RDS A;  2AAD A;  1BNE A;  1C54 A;  1RN4 A;  4BIR A;  7GSP A;  1B2M A;  1CH0 A;  6RNT A;  1FYS A;  1BRJ A;  3D4A A;  1RTU A;  1BSC A;  1BGS A;  1B21 A;  1RHL A;  4J5G A;  1BNS A;  1B2S A;  1HZ1 A;  1BSA A;  1I8V A;  1I2F A;  1FZU A;  3D5G A;  1UCK A;  1I2E A;  1RGG A;  1BUJ A;  1ZGX A;  2F5W A;  3A5E A;  1MGR A;  3GSP A;  1BRN L;  1JBT A;  1BVI A;  2BU4 A;  1HYF A;  1RCK A;  1UCJ A;  3BIR A;  1BRH A;  1RCL A;  6GSP A;  4RNT A;  1GOV A;  1BRG A;  2RBI A;  1RGF A;  1Q9E A;  3HOH A;  3SYU A;  4GHO A;  1RGC A;  1T2H A;  1BNR A;  5BIR A;  5BU4 A;  3WR2 A;  1X1Y A;  1I70 A;  3D5I A;  1BRS A;  4BU4 A;  2KF5 A;  4HOH A;  1BNI A;  1BSE A;  1RGL A;  3DGY A;  1SAR A;  1X1U A;  1AQZ A;  1GMP A;  8RNT A;  1GOU A;  1PYL A;  1B2X A;  1DE3 A;  1BNJ A;  1JBS A;  1I3F A;  2GSP A;  2AAE A;  1X1X A;  1LOV A;  1YGW A;  1DET A;  1BNG A;  3DH2 A;  1BRK A;  2F5M A;  2F56 A;  1BU4 A;  1UCI A;  2C4B A;  1GOY A;  1GMR A;  1RN1 A;  1BSD A;  1LOW A;  3Q3F A;  1FUT A;  1RMS A;  2ZA4 A;  4HAA A;  1TRP A;  1R4Y A;  1JBR A;  1BAN A;  4GSP A;  1X1W A; 
#chains in the Genus database with same CATH topology
 1GD4 A;  1NB5 I;  2XFT A;  3GZB A;  1JB2 A;  2KF4 A;  1LRA A;  3G6E 3;  4HM2 B;  3HII A;  3JUN A;  4EYC A;  1E97 A;  1RRL A;  2GBX B;  2CG0 A;  2O9U X;  4J5K A;  4O3V A;  4X2O A;  2OQE C;  4BTX A;  1VQ7 3;  2Y73 A;  2Y74 A;  1TJD A;  3NBJ A;  5EVH A;  5AEW B;  3G0K A;  1YJ9 3;  1BOX A;  3BU4 A;  2Z7A A;  1GY5 A;  3BNE A;  4FMC A;  3X3Y A;  4AEQ A;  2BIR A;  1IYY A;  1JNQ A;  1JKG B;  3F8X A;  1BIR A;  1IV9 A;  1E3V A;  1TUH A;  2L4V A;  3FGY A;  4N6M A;  2E2V A;  2RSX A;  5IG5 A;  4K61 A;  3MG1 A;  3DGL A;  1UDI I;  3ALA A;  1KC8 4;  1DMN A;  2F99 A;  3AHW A;  3KCH A;  1W2B 2;  1T2I A;  2W6J H;  2XRX B;  1YGE A;  3FG3 A;  3KKG A;  4N6V 0;  1RNT A;  1IT7 A;  1BRI A;  2CFD A;  2GU1 A;  2KF6 A;  3G4S 3;  5KP1 A;  1YJW 3;  1JN5 B;  5RNT A;  1UI8 A;  3CU3 A;  3OV4 A;  1Q7Y 4;  2CKF B;  1IQ8 A;  1BNE A;  1TP6 A;  3WMD A;  2ML5 A;  1NDO B;  3VSY A;  1C54 A;  2IYJ A;  5D81 A;  1VQK 3;  7GSP A;  1JKG A;  1K41 A;  1GY6 A;  3O8Y A;  1B21 A;  4N6U A;  3LOY A;  4J5G A;  1BSA A;  3EQQ B;  1I2F A;  5JBS A;  2CWV A;  4EC6 A;  4XDW A;  1RN7 A;  3OXA A;  4MEI A;  1RGG A;  4AKY A;  1IVU A;  1AR0 A;  2LQV A;  3STD A;  1QAF A;  1GYB A;  2F5W A;  2F86 B;  3MPH A;  1MGR A;  2Z77 A;  3GSP A;  3PXM A;  5AIF A;  4RBN A;  1QJG A;  2MC8 A;  5CF1 A;  5IG4 A;  3SOA A;  4HM7 B;  1W5Z A;  4HYZ A;  1BVI A;  1RCK A;  1D6Y A;  2A15 A;  1UCJ A;  3GZY B;  3BIR A;  1JN5 A;  4R4K A;  2IMJ A;  3LT9 A;  3NQY A;  1A90 A;  3KSE D;  1QVF 2;  6GSP A;  3FH1 A;  4RNT A;  1BRG A;  5FGO A;  1MNL A;  3G8Z A;  1NNV A;  1Q86 4;  4O02 B;  1FGM A;  1RGC A;  5LC6 A;  3KN4 A;  1BNR A;  3I0Y A;  3X41 A;  3CCS 3;  1VQ6 3;  4WFO A;  1MOL A;  1IQX A;  1X1Y A;  1I70 A;  5TGN A;  2H0H A;  4CJN A;  2Z76 A;  2K3D A;  3FSD A;  4HOH A;  4L8O A;  1BNI A;  3D3L A;  1N5P A;  4J8T A;  3DGY A;  5IEO A;  1SAR A;  1M1K 4;  4EXR A;  2C10 A;  1GMP A;  4PEJ A;  3NXJ A;  1B2X A;  3CPO A;  1BNJ A;  2W9P A;  4FMB A;  3RGA A;  3X42 A;  5AIG A;  1Q81 4;  5CF2 A;  1ROV A;  4BTW A;  2FXT A;  1L5G B;  5EQL A;  2BMR B;  2I9W A;  3D9R A;  2MF7 A;  2KCD A;  2J8X B;  1IDP A;  1JB4 A;  2D42 A;  1O7P B;  4K90 B;  3D79 A;  1JZO A;  3H51 A;  1HKX A;  3U97 A;  4OVM A;  1W6C A;  5ELU A;  1FGO A;  3ZG0 A;  4CDL A;  1ZS7 A;  1M1X B;  1LQM B;  4MMX B;  1V58 A;  4N6T A;  3FLJ A;  3LTC A;  3JVC A;  1LOW A;  3FCS B;  4WYK B;  5JPU A;  1OAC A;  2CWU A;  4HAA A;  2HMM B;  4HM6 B;  2C11 A;  5M1A A;  1NJI 4;  2BT3 A;  2CX0 A;  3K0Z A;  3OWU A;  4L8P A;  4GSP A;  1X1W A;  4LYL B;  1LOY A;  1TRQ A;  3LYG A;  3NV0 B;  3WOD G;  4K1V A;  3VGN A;  1GSP A;  1OF5 A;  3MSO A;  5IEN A;  1AVK A;  5AYS C;  1RJO A;  1VQ5 3;  5LC7 A;  5STD A;  1LNH A;  1W00 A;  1RLS A;  3DUK A;  1O7G B;  2H0G A;  3DMC A;  4WWU C;  1VZZ A;  1BSB A;  3MG2 A;  3EHC A;  2CWT A;  2OWP A;  5FW5 A;  1RKY A;  1ULJ B;  1DMM A;  4HVN A;  5IEP A;  1VQP 3;  2OTJ 3;  1TU5 A;  3AMO B;  1A67 A;  1RGH A;  2HOH A;  3MWZ A;  1K28 A;  2QA4 3;  2FNQ A;  3LTA A;  3TDG A;  1I0X A;  2BMQ B;  1RNB A;  1OHP A;  3AGO A;  3LT8 A;  3FF0 A;  4IPB A;  4G1M B;  3ZFZ A;  3CC2 3;  1A2P A;  4LEH A;  1WQL B;  1FGR A;  3UNL A;  5M18 A;  1F8N A;  3DGN A;  3ECF A;  3NV0 A;  5AII A;  3ZG5 A;  2YFL B;  1N5H A;  3SOY A;  1RSN A;  1BNF A;  1ROA A;  3EN8 A;  3F14 A;  4R9K A;  4ILF A;  1DVC A;  7STD A;  3LXU X;  1JZD A;  1LQG C;  1MGW A;  5BXQ A;  1RGA A;  1RDS A;  2SBL A;  3BLZ A;  3BND A;  1W01 A;  4NPB A;  4CPK A;  4H3U A;  1FA3 A;  5HGR A;  3OWY A;  2OTL 3;  1B2M A;  6RNT A;  4BL2 A;  4IIA A;  1Y4K A;  3FG1 A;  3SED A;  1AV4 A;  1BGS A;  2XGN A;  3M8C A;  3AMO A;  1BNS A;  3QK9 A;  1T5Y A;  2CFK A;  1FZU A;  3F8H A;  5KP4 A;  3MKI A;  4XDV A;  4K1U A;  3A5E A;  3FG4 A;  1OH0 A;  4HKV B;  2CIU A;  1UUW B;  2RGQ A;  5BVB A;  3K63 A;  2BU4 A;  1Q40 B;  2CHC A;  4LSO A;  1KD1 4;  1TIJ A;  1BRH A;  1UUG B;  1O7N B;  3EF8 A;  4I5Q A;  3I55 3;  1DMQ A;  3PS8 A;  1SJW A;  2K54 A;  1FGQ A;  2P0X A;  3HOH A;  3LTB A;  5G1K A;  1IVX A;  1VQQ A;  1W7C A;  4N3V A;  1RRH A;  4JF8 A;  1N8Q A;  1A2V A;  4NRE A;  1O7H B;  1BRS A;  1WTH A;  3NBR A;  2B24 B;  3CPW 2;  3ER7 A;  1RGL A;  3RDE A;  3B8L A;  3SX1 A;  3DZL A;  1PYL A;  1DE3 A;  3SXX A;  4NHF A;  2YX9 A;  2JDI H;  3KZT A;  3U1W A;  2GSP A;  3EC9 A;  2ZL8 A;  1J2B A;  5A0O B;  1UW1 A;  2AAE A;  3KE7 A;  2P0M A;  1JB5 A;  1X1X A;  3JUQ A;  4FMD A;  4HM3 B;  8CHO A;  1DET A;  2Z6B A;  3X3Z A;  3DH2 A;  3JUO A;  1BRK A;  3T8U A;  2R41 A;  1VQ4 3;  3X40 A;  4R80 A;  1OGX A;  3DM8 A;  1EEJ A;  1UCI A;  3WA3 A;  2C4B A;  2HMO B;  1BUQ A;  3FKA A;  1GMR A;  2HMK B;  1QAK A;  1KQS 2;  1RN1 A;  3CMA 3;  1VQM 3;  4R1K A;  3V99 A;  1K9M 4;  1JV2 B;  3Q3F A;  1FUT A;  2ZA4 A;  3EB8 A;  4MMZ B;  3CD6 3;  1W2Z A;  1R4C A;  1EKM A;  1W6Y A;  1R4Y A;  3JUP A;  3N54 B;  1CYU A;  1FUW A;  2IUK A;  2E2T A;  2RFR A;  4FCM A;  1WMO A;  1B27 A;  1MWR A;  1NU3 A;  2KRT A;  3AGN A;  3NM7 A;  1A2K A;  1EG9 B;  1LXE A;  2H0I A;  2IY2 A;  1B2Z A;  1DVD A;  3HX8 A;  1VQ8 3;  3PCR A;  7RNT A;  2W03 A;  1EQK A;  4EV5 A;  2P05 A;  2F4Y A;  1RGE A;  3UL6 A;  1TTO A;  3JUM A;  1K73 4;  2XH9 A;  2W56 B;  4WP5 A;  2O3O A;  1FUS A;  1B20 A;  3CCJ 3;  2GBW B;  1W02 A;  2WGO A;  1CEW I;  3Q90 A;  4KFE A;  2LYX A;  3S67 A;  3V92 A;  1ULI B;  1FW7 A;  3WOF B;  6STD A;  4MMY B;  1LNI A;  3N9H A;  3EN1 B;  1PU4 A;  2CFW A;  1UCL A;  2CG1 A;  3Q2P A;  5DRE A;  3HIG A;  3MYT A;  2STD A;  4O8S A;  3WOE B;  1OHO A;  4HM0 B;  3EBY A;  4R9L A;  2PNC A;  2XSH B;  1ZO2 A;  1G02 A;  1GS3 A;  3L0R A;  4LMI A;  3SLU A;  2KF3 A;  3KFQ C;  1STF I;  2SAR A;  2W56 A;  1OGZ A;  3NHX A;  2AAD A;  1WMN A;  2GEY A;  4BIR A;  4N6O B;  3N8B A;  1FYS A;  1S5A A;  3D4A A;  3FZW A;  1BSC A;  3GWR A;  4BU4 A;  2BO9 B;  2V1L A;  4CCV A;  1B2S A;  1QAL A;  3CCQ 3;  1OCV A;  4N6N B;  4LZI A;  3D5G A;  4EW5 A;  1UCK A;  4WYK A;  1EUI C;  2BNG A;  2R4I A;  3UJM A;  3G71 3;  5AYR B;  1TFK A;  3PYJ A;  4RZM A;  1KSI A;  1YJN 3;  1DYU A;  3F40 A;  2F98 A;  4FCJ A;  4OUQ A;  1BRN L;  4STD A;  1LVN A;  1HYF A;  2QIY A;  4EBG A;  2K0M A;  2YFJ B;  1YVB I;  4I4K A;  4HBR A;  3UL5 A;  5G2G A;  3E99 A;  4U13 A;  1RGF A;  3DXO A;  4XB5 A;  3WA2 X;  4BTY A;  3SYU A;  4L7K A;  2QEX 3;  4HZB B;  3S27 A;  4Q53 A;  1YI2 3;  3RGR A;  5BIR A;  3WR2 A;  4HM1 B;  3J7Y d;  4DKI A;  3I56 3;  3LTD A;  2KF5 A;  3PCS A;  2JQ5 A;  2CC3 A;  3Q1C A;  3CME 3;  1X1U A;  1AQZ A;  2GEX A;  1K8A 4;  3NM2 A;  3HI7 A;  3UB1 A;  1ZX2 A;  8RNT A;  1O7M B;  3PGB A;  2OQE A;  4AKZ A;  3CCE 3;  1UUV B;  3CCM 3;  2INX A;  1JBS A;  2RCD A;  5I97 A;  2ZDJ A;  1I3F A;  1MWS A;  3EJV A;  4WHA A;  3MG3 A;  1OUN A;  1Q82 4;  4XBX A;  1SQW A;  1D6Z A;  1LOV A;  1M9G A;  3CCV 3;  4IT7 A;  4O2H A;  5CK6 A;  1KWI A;  1OHS A;  2XF3 A;  3IJE B;  4HM4 B;  5CXO A;  5IER A;  2F5M A;  2XFS A;  4TX4 A;  3LML A;  3MHE A;  1GOY A;  3K5T A;  2M7O A;  1BSD A;  1W4N A;  1IV7 A;  2XR8 B;  5ELJ A;  3K7C A;  3EX9 A;  1Z1S A;  1JBR A;  2BHM A;  2WGQ A;  1BAN A;  1T3B A;  3F7S A;  5EEO A;  1N9J A;  1OPY A;  3KII A;  3LH4 A;  3LZA A;  2ZHX B;  1G0T A;  3EBT A;  3IMA B;  4HM5 B;  1G96 A;  4KZ1 A;  5KP3 A;  5IG3 A;  4LGQ A;  1S72 3;  2E2U A;  3T8N A;  3FF2 A;  3HK4 A;  4HM8 B;  4FCZ A;  1AY7 A;  3QRD A;  1Q40 A;  4XBT A;  2P38 A;  1NO3 A;  3X3X A;  1UGH I;  2YFI B;  1B2U A;  1ASK A;  2GU3 A;  5IG0 A;  2HML B;  3VF1 A;  3RNT A;  3AHS A;  1BAO A;  3URP A;  1UGI A;  2QGU A;  4RNZ A;  4RNY A;  2RNT A;  5M19 A;  3CC7 3;  1B3S A;  4HZ9 B;  1VQL 3;  1RGK A;  3CNM A;  1MWU A;  2CH9 A;  3NX0 A;  1PY3 A;  2GXF A;  2HMN B;  3F9S A;  3B4O A;  3HZP A;  1GMQ A;  1AVL A;  4KT3 B;  4H61 A;  2OCT A;  9RNT A;  2CFL A;  3OX9 A;  3BNB A;  3CCU 3;  1JJ2 2;  3CCL 3;  1FGT A;  1IVV A;  1D6U A;  1LOX A;  2UUG C;  4QWT A;  2KAA A;  1YNV X;  3H3H A;  1QMA A;  2CW9 A;  4KVH A;  1IVW A;  5CLK A;  5GSP A;  2HMJ B;  3GAX A;  5D83 A;  3WHO A;  2L1S A;  1I2G A;  3WDG B;  5HOH A;  1YVS A;  1I0V A;  1MWT A;  1I3I A;  2WOH A;  1TFO A;  3B4P A;  4FR9 A;  1N8R 4;  3ROB A;  4BL3 A;  1V57 A;  1N9E A;  4J9A A;  2WO0 A;  4MJD A;  1RN4 A;  2W9Q A;  1VQN 3;  1CH0 A;  2CX1 A;  1BRJ A;  1U5O A;  1RTU A;  3SVA A;  1HU9 A;  1WNH A;  1Q42 A;  1RHL A;  1I8V A;  1HZ1 A;  1E3R A;  2ML6 A;  1YIT 3;  1I2E A;  1BUJ A;  1W6G A;  1ZGX A;  1VQO 3;  3GZX B;  1IQY A;  1O7W B;  4XM4 A;  2OOV A;  1OF5 B;  4FMA A;  1JBT A;  1SIH A;  1SPU A;  1CYV A;  4XBY A;  3NQZ A;  4EV2 A;  4X2H A;  1ISK A;  2KXG A;  3BNC A;  2OOV C;  1RCL A;  3CXC 2;  1UI7 A;  3K9M C;  1GOV A;  2RBI A;  3G16 A;  1Q9E A;  3KSP A;  4GHO A;  1IT8 A;  1GD3 A;  1T2H A;  2PZV A;  2UGI A;  1NB3 I;  2XGL A;  1WMP A;  3DGO A;  5BU4 A;  1C7H A;  4JRF A;  3CCR 3;  1Q7H A;  2B1X B;  2UX0 A;  2IUJ A;  3D5I A;  1QVG 2;  1IU7 A;  2W0Q A;  4HJL B;  1V74 A;  4ORL A;  5IF6 A;  2CFG A;  5AI1 A;  3NBB A;  5IW9 A;  1BSE A;  1YIJ 3;  1VQ9 3;  3GRD A;  3CNX A;  5DRV A;  3CC4 3;  1U8C B;  3OW2 2;  1GOU A;  1JRQ A;  3A76 A;  3S28 A;  2XSO B;  2CK3 H;  3PZW A;  3S29 A;  3GZR A;  3T0U A;  2D1W A;  3OWS A;  1GY7 A;  4ZM8 A;  1M90 4;  2FGT A;  4OK0 A;  5D82 A;  3S5C A;  5AEU B;  1NWW A;  4GB5 A;  2BMO B;  3B7C A;  5G1L A;  1YGW A;  2W04 A;  1BNG A;  3IPT A;  4KFF A;  3NUV A;  5AIH A;  1CQS A;  3DGM A;  3EE1 A;  4GL6 A;  5JPP A;  1IK3 A;  2F56 A;  1BU4 A;  2XEP A;  3F7X A;  1STD A;  1SII A;  2P09 A;  1YHQ 3;  3DY5 A;  2W2C A;  2Q07 A;  1EA2 A;  1PFP A;  2IA7 A;  4KFD A;  1RMS A;  4N6L A;  1TRP A;  2WOF A;  1US1 A;  3BB9 A;  3V98 A; 
#chains in the Genus database with same CATH homology
 1B27 A;  1LOY A;  1TRQ A;  3AGN A;  2KF4 A;  1LRA A;  1GSP A;  1B2Z A;  1AY7 A;  7RNT A;  4J5K A;  2F4Y A;  1RGE A;  1RLS A;  1TTO A;  1B2U A;  1BOX A;  3BU4 A;  1BSB A;  3RNT A;  3AHS A;  1BAO A;  1FUS A;  3URP A;  1B20 A;  2BIR A;  1IYY A;  2RNT A;  1B3S A;  1BIR A;  1RGK A;  1RGH A;  2HOH A;  1FW7 A;  1PY3 A;  1LNI A;  1GMQ A;  1RNB A;  1I0X A;  3AGO A;  1UCL A;  9RNT A;  1A2P A;  3KCH A;  3AHW A;  1T2I A;  2KAA A;  1YNV X;  1RNT A;  1BRI A;  2KF6 A;  1RSN A;  1BNF A;  5GSP A;  1G02 A;  3WHO A;  5HOH A;  1I2G A;  5RNT A;  2KF3 A;  1YVS A;  1I0V A;  2SAR A;  1I3I A;  1MGW A;  1RGA A;  1RDS A;  2AAD A;  1BNE A;  1C54 A;  1RN4 A;  4BIR A;  7GSP A;  1B2M A;  1CH0 A;  6RNT A;  1FYS A;  1BRJ A;  3D4A A;  1RTU A;  1BSC A;  1BGS A;  1B21 A;  1RHL A;  4J5G A;  1BNS A;  1B2S A;  1HZ1 A;  1BSA A;  1I8V A;  1I2F A;  1FZU A;  3D5G A;  1UCK A;  1I2E A;  1RGG A;  1BUJ A;  1ZGX A;  2F5W A;  3A5E A;  1MGR A;  3GSP A;  1BRN L;  1JBT A;  1BVI A;  2BU4 A;  1HYF A;  1RCK A;  1UCJ A;  3BIR A;  1BRH A;  1RCL A;  6GSP A;  4RNT A;  1GOV A;  1BRG A;  2RBI A;  1RGF A;  1Q9E A;  3HOH A;  3SYU A;  4GHO A;  1RGC A;  1T2H A;  1BNR A;  5BIR A;  5BU4 A;  3WR2 A;  1X1Y A;  1I70 A;  3D5I A;  1BRS A;  4BU4 A;  2KF5 A;  4HOH A;  1BNI A;  1BSE A;  1RGL A;  3DGY A;  1SAR A;  1X1U A;  1AQZ A;  1GMP A;  8RNT A;  1GOU A;  1PYL A;  1B2X A;  1DE3 A;  1BNJ A;  1JBS A;  1I3F A;  2GSP A;  2AAE A;  1X1X A;  1LOV A;  1YGW A;  1DET A;  1BNG A;  3DH2 A;  1BRK A;  2F5M A;  2F56 A;  1BU4 A;  1UCI A;  2C4B A;  1GOY A;  1GMR A;  1RN1 A;  1BSD A;  1LOW A;  3Q3F A;  1FUT A;  1RMS A;  2ZA4 A;  4HAA A;  1TRP A;  1R4Y A;  1JBR A;  1BAN A;  4GSP A;  1X1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...