1GOUA

Ribonuclease binase (g specific endonuclease) unliganded form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
109
structure length
109
Chain Sequence
b'AVINTFDGVADYLIRYKRLPNDYITKSQASALGWVASKGDLAEVAPGKSIGGDVFSNREGRLPSAGSRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE
publication title The Structure of Substrate-Free Microbial Ribonuclease Binase and of its Complexes with 3'Gmp and Sulfate Ions
pubmed doi rcsb
source organism Bacillus intermedius
molecule tags Hydrolase
total genus 25
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gouA00
4HAAA 1BRNL 1I8VA 2F4YA 1X1UA 1FZUA 6RNTA 1HYFA 1X1XA 4RNTA 1BSEA 1GSPA 1BRSA 3BU4A 1A2PA 1BANA 1GMQA 1I2EA 1UCJA 4HOHA 1I0VA 1BNJA 1YNVX 1BNGA 1BSAA 2AAEA 1BSCA 1I70A 4GSPA 1UCLA 1RMSA 3AGOA 1LOYA 3SYUA 2C4BA 3BIRA 1GOYA 1R4YA 1BNIA 1JBTA 1I3IA 1JBSA 1IYYA 1BGSA 1PYLA 1BRHA 3D5GA 1FUSA 1LRAA 2GSPA 1BRIA 1I2FA 1AQZA 1MGRA 1RHLA 1YGWA 1TRPA 1BVIA 3GSPA 1BNSA 1UCKA 3AHWA 1BAOA 1DETA 3URPA 1B2XA 1RGEA 3D5IA 3D4AA 1BSBA 1I3FA 1Q9EA 3RNTA 1FYSA 1RGHA 1GOUA 8RNTA 1RSNA 1B2MA 2HOHA 1GMRA 1BNRA 9RNTA 1LOWA 1LNIA 1RCLA 2BIRA 1FW7A 3HOHA 1HZ1A 1FUTA 7GSPA 1RNBA 1RGAA 3WR2A 1GMPA 1BUJA 3Q3FA 4J5KA 1B20A 1TTOA 1BIRA 1RGGA 2BU4A 4BIRA 1B2ZA 1RDSA 5HOHA 1BRKA 1LOVA 1RGKA 1UCIA 3A5EA 4BU4A 3DH2A 2KF3A 5RNTA 1X1WA 2AADA 3KCHA 3WHOA 1BSDA 1RN4A 1MGWA 1CH0A 1RGCA 1DE3A 1TRQA 1BNFA 1BU4A 5BIRA 3AGNA 2ZA4A 2KF6A 2RNTA 1BOXA 1BRJA 5BU4A 1I0XA 1RTUA 1B2SA 1T2HA 2RBIA 1B21A 1I2GA 1RCKA 1C54A 2F5WA 1ZGXA 1RGFA 2F5MA 1X1YA 5GSPA 3AHSA 1SARA 1T2IA 1B3SA 3DGYA 2KF4A 2KF5A 1JBRA 1PY3A 7RNTA 4GHOA 1AY7A 1RN1A 4J5GA 2F56A 1BNEA 1RGLA 1BRGA 1B2UA 1G02A 1RLSA 1RNTA 1B27A 2KAAA 2SARA 1YVSA 1GOVA 6GSPA
chains in the Genus database with same CATH superfamily
3OWSA 1GS3A 4DKIA 1A90A 1OUNA 1X1UA 2CWUA 3K9MC 3CCE3 4FCMA 7STDA 3PCSA 1F8NA 1YJ93 3JVCA 5CK6A 3NV0A 3CU3A 3WDGB 1LQMB 1IQXA 3BU4A 1OCVA 1BANA 1TJDA 5CF2A 1N5PA 1UCJA 5AEWB 2WO0A 1TFKA 3EC9A 1DMNA 1LVNA 1VZZA 2CFGA 2IYJA 1I0VA 3H51A 3M8CA 1YJW3 2RFRA 4TX4A 1BNJA 5CXOA 1WTHA 1VQQA 1BNGA 3HIGA 4EBGA 3K5TA 2QA43 2AAEA 1BSCA 5CF1A 3V99A 1JJ22 2P05A 2CFLA 4QWTA 4O2HA 1D6UA 1YGEA 3KZTA 1JKGB 1JBTA 3KE7A 5AIHA 1W6GA 2YFIB 3MHEA 3RGRA 5AYRB 3ECFA 4HZBB 3N54B 2IA7A 1PYLA 4CPKA 5KP1A 1BRIA 1KSIA 1AQZA 1MGRA 3AMOA 1Z1SA 1GY7A 1YGWA 3BNBA 4WP5A 1BNSA 3ZG5A 5IG3A 4KFFA 1DETA 3SOYA 3NM7A 1RGEA 1BSBA 1I3FA 1Q9EA 1TUHA 2ML5A 4KT3B 1FYSA 3FSDA 4EYCA 1U5OA 1FUWA 1IQ8A 3WA3A 2OWPA 5HGRA 2XGLA 3FG4A 5IW9A 4WYKB 1DVDA 4LGQA 1RCLA 3F9SA 3HOHA 2XRXB 1LOXA 2H0IA 5ELJA 1KQS2 1CQSA 3SLUA 2CHCA 5IEOA 1FGRA 1GY5A 3WR2A 4RNZA 4HM5B 3MSOA 3Q3FA 4HM3B 4HYZA 4J5KA 2KCDA 2ML6A 3IMAB 3T0UA 1ZX2A 3HZPA 3WOFB 1US1A 6STDA 1IVWA 3LTAA 4XBTA 1IT8A 5AYSC 3DM8A 3CNXA 1HU9A 1O7HB 3BB9A 1OHPA 1AVKA 3B8LA 3G16A 4J9AA 5IG5A 1VQ63 3LMLA 3GWRA 2WGQA 3G713 3EJVA 3F14A 1QAKA 2HMOB 1JZDA 1VQ53 3GZXB 2FGTA 2GU1A 3WHOA 1BSDA 1MOLA 1NB3I 1RN4A 3Q1CA 1UW1A 1CH0A 2CX0A 3J7Yd 1TRQA 1DE3A 3G6E3 4IT7A 1BU4A 3X40A 1O7WB 2PNCA 2RNTA 4N6TA 1V74A 1KD14 3LT8A 3CCJ3 3OWUA 1B21A 3JUMA 1RCKA 2Z6BA 2GEXA 3N9HA 3OXAA 4NHFA 1QMAA 5LC6A 1O7PB 3S27A 3MPHA 4GL6A 1GY6A 1NU3A 3T8NA 4JRFA 1K28A 1K9M4 1VQ43 3NQZA 4L7KA 3DGMA 1LXEA 3KFQC 2I9WA 4KFDA 3AHSA 1SARA 3MYTA 1CEWI 2CIUA 1PY3A 1V57A 2BMQB 4LZIA 3E99A 3LTCA 3NV0B 1EA2A 1AY7A 1RN1A 2GXFA 4L8PA 1Q42A 1BNEA 3U97A 2W9PA 3ALAA 1BRGA 2W56A 1G02A 1RNTA 2L4VA 1WMNA 2BNGA 2R4IA 4HM2B 2W04A 3CME3 1I8VA 1QJGA 2F4YA 2ZDJA 1Q864 1A67A 1EG9B 1HYFA 2LYXA 1SIHA 4RNTA 3CPW2 1BSEA 1GSPA 4MEIA 1N8R4 2HMJB 2P0XA 4JF8A 4LSOA 3CC73 1RN7A 5KP4A 1NB5I 4RZMA 1RKYA 1NNVA 4FMBA 1IVVA 2KRTA 3U1WA 4N3VA 1YNVX 1EKMA 1BSAA 3AMOB 3CCM3 3MG3A 1UCLA 1RMSA 3KIIA 2Q07A 3G0KA 4HBRA 3SYUA 1D6YA 3GZRA 2CK3H 1VQO3 1DVCA 1EEJA 1GOYA 1R4YA 3BIRA 3KSED 3B4OA 2IUKA 5D81A 2BMOB 4BTYA 2O9UX 2CFKA 1BRHA 3D5GA 3FH1A 4K1UA 1FUSA 4MJDA 5FGOA 3Q2PA 3G4S3 4N6NB 3NX0A 1RHLA 4J8TA 1TRPA 5JPPA 1GD4A 1G0TA 1ASKA 3GSPA 3BNCA 2E2UA 1UCKA 3AHWA 3DGLA 3OW22 1B2XA 2BO9B 3D9RA 4KZ1A 2QEX3 1L5GB 3D4AA 2HMNB 1ULIB 1Q7HA 1W7CA 1WNHA 1AVLA 3I0YA 3RNTA 1RGHA 1GOUA 8RNTA 1JV2B 1RSNA 2GU3A 4XB5A 1GMRA 1TU5A 1IK3A 5M18A 1LOWA 2K54A 1WQLB 4L8OA 1JB2A 2ZL8A 2BIRA 2F86B 3F8XA 1V58A 1FW7A 3K7CA 1W2B2 2OCTA 3I553 3HX8A 3FGYA 3VGNA 3X3YA 2F99A 3ZG0A 1TFOA 2XH9A 4FMDA 3DZLA 4X2HA 1CYVA 1STDA 1GMPA 1G96A 4FR9A 3WMDA 1BUJA 3DGNA 1W2ZA 1TTOA 3DUKA 1O7GB 4FCZA 2BU4A 3UB1A 3VF1A 4IPBA 4CJNA 1M904 5HOHA 1T3BA 3QK9A 2LQVA 1UCIA 1PU4A 1VQM3 4LMIA 1ULJB 2BMRB 4BU4A 2HMMB 3DH2A 3OWYA 2INXA 1JN5A 2KF3A 3F8HA 2AADA 3KCHA 1N8QA 4O02B 3S28A 4NREA 2RSXA 3NBBA 3JUNA 1BUQA 1RGCA 2HMLB 2O3OA 1GYBA 3ROBA 2F98A 1PFPA 1UI7A 4EV5A 2OQEC 2OOVC 4I5QA 2KF6A 1DMQA 3CPOA 3HIIA 2Y74A 4HM6B 3PYJA 3LTBA 5BU4A 1YVBI 1VQ83 1VQL3 3WOEB 4ZM8A 2RBIA 1SPUA 3K0ZA 1YJN3 2W56B 2XFSA 3PXMA 1RRHA 3MKIA 4O8SA 2CG1A 5IEPA 4WFOA 4HKVB 1IU7A 1T5YA 2J8XB 2D42A 1VQ93 4GB5A 1YIJ3 1NWWA 1Y4KA 1B3SA 1LQGC 2KF4A 2KF5A 4NPBA 3DGOA 4MMXB 4N6LA 7RNTA 1NJI4 2CWVA 1IDPA 2W03A 3IJEB 4R9KA 1M1K4 4J5GA 2F56A 4K1VA 2STDA 4BL3A 1UDII 1AV4A 4FMCA 1B27A 3NHXA 4MMZB 1ZGXA 1GOVA 5AI1A 1IQYA 1OACA 1N5HA 4HAAA 2H0HA 4AKZA 2B24B 3BNEA 2IY2A 4HM8B 5CLKA 3D79A 3DY5A 3GZYB 4N6OB 3NQYA 1Q40B 4HM4B 4PEJA 3NBJA 1OHOA 2SBLA 3D3LA 4ORLA 1W01A 1FGOA 1SJWA 2L1SA 3G8ZA 2CKFB 2WOFA 1Q7Y4 3FF2A 2UUGC 2Y73A 4RBNA 3CXC2 4CCVA 1I70A 3IPTA 2P38A 2GBWB 5ELUA 1UI8A 3EX9A 2B1XB 2Z77A 1OF5A 1UGIA 1LOYA 4GSPA 5EVHA 4AKYA 5IERA 3TDGA 1Q814 3FCSB 2C4BA 4FCJA 3F7SA 5AEUB 2MF7A 3V92A 3JUQA 4HM7B 5M19A 4XM4A 3GAXA 2IMJA 1I3IA 3DXOA 4EXRA 1W6YA 4K61A 2MC8A 1IYYA 4I4KA 2IUJA 3CD63 3MG1A 2P0MA 4K90B 4XDWA 1A2KA 5I97A 2BHMA 3Q90A 3CCU3 2GSPA 1J2BA 2E2VA 4XDVA 1R4CA 1O7NB 1BVIA 2RGQA 2BT3A 1OHSA 1FGTA 2XR8B 3X3XA 2W9QA 2H0GA 3CNMA 4OVMA 3LYGA 3FKAA 3I563 2C11A 2YX9A 3GZBA 2HOHA 5G1KA 1SQWA 1FGMA 1N9JA 2OTJ3 1KC84 1LNIA 2Z76A 4KFEA 1HKXA 2RCDA 1OH0A 3S5CA 1E3VA 4HVNA 1FUTA 2K3DA 1Q40A 3UL6A 2CH9A 3VSYA 1RNBA 1JN5B 1FGQA 4N6MA 1FA3A 3DMCA 2OTL3 1NO3A 1S723 5DRVA 3BNDA 3RDEA 3CC23 1DMMA 3EN8A 3CCS3 1BIRA 3F40A 1ZS7A 1W5ZA 2A15A 3NXJA 1VQK3 1LOVA 2PZVA 3A5EA 3F7XA 3CCR3 2UGIA 2WOHA 4OK0A 5RNTA 4MMYB 1CYUA 1YHQ3 2JDIH 1X1WA 1ZO2A 4Q53A 3OX9A 3V98A 3UJMA 1W02A 1B2MA 3EN1B 5AIGA 2CX1A 1W4NA 5LC7A 1W6CA 5BIRA 2ZA4A 3T8UA 1JB4A 4XBXA 1BRJA 1I0XA 1M1XB 1U8CB 1EQKA 1STFI 1T2HA 3B4PA 1I2GA 3LZAA 4HM1B 4LEHA 3UNLA 4BL2A 4EW5A 2V1LA 3HK4A 2F5WA 1M9GA 3KKGA 1JB5A 1D6ZA 3K63A 3FG3A 4R9LA 1O7MB 3H3HA 1RGFA 3SEDA 5GSPA 5STDA 1VQP3 3DGYA 4CDLA 1JBRA 3PCRA 1RJOA 4GHOA 3HI7A 1MWRA 1RGLA 2GBXB 3NM2A 2CC3A 1B2UA 2CFWA 2FNQA 5EEOA 2SARA 2W6JH 2XGNA 6GSPA 1E3RA 3O8YA 1BRNL 1DYUA 1FZUA 1UGHI 3EBYA 3S29A 4AEQA 6RNTA 4H61A 1X1XA 2D1WA 1OF5B 3X42A 3SX1A 3EE1A 2WGOA 1BRSA 1MNLA 1QALA 3B7CA 1A2PA 2XSHB 3PGBA 8CHOA 1QVG2 1GMQA 1I2EA 1IVUA 4IIAA 1EUIC 3SXXA 4HOHA 1OGZA 2CW9A 3FF0A 4EV2A 4G1MB 1YI23 3CMA3 3AGOA 3WODG 2XEPA 5JBSA 1BNIA 1S5AA 2QIYA 1JBSA 1BGSA 1ROVA 4HM0B 1UUWB 3CCL3 1WMOA 2K0MA 1LRAA 5BXQA 1I2FA 3STDA 1GD3A 5JPUA 1TP6A 4LYLB 4R80A 1W00A 1BAOA 2XF3A 3URPA 1JKGA 2FXTA 3D5IA 3LTDA 3QRDA 3PZWA 3KSPA 4N6V0 5EQLA 1QVF2 4OUQA 1C7HA 4RNYA 4BTWA 1K41A 3ER7A 1K734 1BNRA 4ILFA 3UL5A 9RNTA 1OPYA 1IV9A 4WWUC 1RRLA 3N8BA 2CG0A 3X3ZA 1HZ1A 2W0QA 1N9EA 2C10A 3LH4A 1JNQA 1IV7A 2UX0A 1NDOB 4HJLB 5G1LA 7GSPA 1WMPA 1RGAA 3SOAA 3PS8A 1LNHA 5IF6A 3LOYA 1ROAA 3NUVA 3EQQB 4STDA 3CC43 3X41A 2GEYA 1MWUA 1B20A 2XFTA 1ISKA 1RGGA 3JUPA 4WYKA 1JZOA 4BIRA 1TIJA 1B2ZA 1RDSA 3JUOA 3NBRA 2OOVA 1BRKA 3EB8A 2OQEA 4HZ9B 4BTXA 3LXUX 3CCV3 1RGKA 2R41A 3S67A 5D82A 1VQN3 3RGAA 4R1KA 5IG0A 3EHCA 3OV4A 1Q824 5DREA 5D83A 5A0OB 2Z7AA 5AIIA 1JRQA 4XBYA 5FW5A 4FMAA 4R4KA 1MWTA 1VQ73 1MGWA 2W2CA 2CFDA 2ZHXB 1YIT3 4KVHA 1BNFA 2YFJB 2E2TA 3AGNA 1BOXA 2KXGA 3FG1A 3SVAA 3FLJA 3A76A 1RTUA 3L0RA 1UUGB 1B2SA 1SIIA 3FZWA 3MWZA 4N6UA 4EC6A 3LT9A 4X2OA 3CCQ3 5KP3A 4U13A 5IENA 5AIFA 1C54A 1K8A4 2QGUA 1IVXA 2JQ5A 1IT7A 1E97A 1MWSA 2CWTA 2P09A 2XSOB 5G2GA 1QAFA 2F5MA 1X1YA 3EF8A 4H3UA 3WA2X 1T2IA 1KWIA 4O3VA 1UUVB 3GRDA 5IG4A 1A2VA 3KN4A 4WHAA 3MG2A 2M7OA 3BLZA 3ZFZA 1AR0A 2HMKB 2YFLB 5BVBA 1RLSA 2KAAA 1OGXA 1YVSA 3EBTA 5M1AA 5TGNA
chains in the Genus database with same CATH topology
4HAAA 1BRNL 1I8VA 2F4YA 1X1UA 1FZUA 6RNTA 1HYFA 1X1XA 4RNTA 1BSEA 1GSPA 1BRSA 3BU4A 1A2PA 1BANA 1GMQA 1I2EA 1UCJA 4HOHA 1I0VA 1BNJA 1YNVX 1BNGA 1BSAA 2AAEA 1BSCA 1I70A 4GSPA 1UCLA 1RMSA 3AGOA 1LOYA 3SYUA 2C4BA 3BIRA 1GOYA 1R4YA 1BNIA 1JBTA 1I3IA 1JBSA 1IYYA 1BGSA 1PYLA 1BRHA 3D5GA 1FUSA 1LRAA 2GSPA 1BRIA 1I2FA 1AQZA 1MGRA 1RHLA 1YGWA 1TRPA 1BVIA 3GSPA 1BNSA 1UCKA 3AHWA 1BAOA 1DETA 3URPA 1B2XA 1RGEA 3D5IA 3D4AA 1BSBA 1I3FA 1Q9EA 3RNTA 1FYSA 1RGHA 1GOUA 8RNTA 1RSNA 1B2MA 2HOHA 1GMRA 1BNRA 9RNTA 1LOWA 1LNIA 1RCLA 2BIRA 1FW7A 3HOHA 1HZ1A 1FUTA 7GSPA 1RNBA 1RGAA 3WR2A 1GMPA 1BUJA 3Q3FA 4J5KA 1B20A 1TTOA 1BIRA 1RGGA 2BU4A 4BIRA 1B2ZA 1RDSA 5HOHA 1BRKA 1LOVA 1RGKA 1UCIA 3A5EA 4BU4A 3DH2A 2KF3A 5RNTA 1X1WA 2AADA 3KCHA 3WHOA 1BSDA 1RN4A 1MGWA 1CH0A 1RGCA 1DE3A 1TRQA 1BNFA 1BU4A 5BIRA 3AGNA 2ZA4A 2KF6A 2RNTA 1BOXA 1BRJA 5BU4A 1I0XA 1RTUA 1B2SA 1T2HA 2RBIA 1B21A 1I2GA 1RCKA 1C54A 2F5WA 1ZGXA 1RGFA 2F5MA 1X1YA 5GSPA 3AHSA 1SARA 1T2IA 1B3SA 3DGYA 2KF4A 2KF5A 1JBRA 1PY3A 7RNTA 4GHOA 1AY7A 1RN1A 4J5GA 2F56A 1BNEA 1RGLA 1BRGA 1B2UA 1G02A 1RLSA 1RNTA 1B27A 2KAAA 2SARA 1YVSA 1GOVA 6GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAA A;  1BRN L;  1I8V A;  2F4Y A;  1X1U A;  1FZU A;  6RNT A;  1HYF A;  1X1X A;  4RNT A;  1BSE A;  1GSP A;  1BRS A;  3BU4 A;  1A2P A;  1BAN A;  1GMQ A;  1I2E A;  1UCJ A;  4HOH A;  1I0V A;  1BNJ A;  1YNV X;  1BNG A;  1BSA A;  2AAE A;  1BSC A;  1I70 A;  4GSP A;  1UCL A;  1RMS A;  3AGO A;  1LOY A;  3SYU A;  2C4B A;  3BIR A;  1GOY A;  1R4Y A;  1BNI A;  1JBT A;  1I3I A;  1JBS A;  1IYY A;  1BGS A;  1PYL A;  1BRH A;  3D5G A;  1FUS A;  1LRA A;  2GSP A;  1BRI A;  1I2F A;  1AQZ A;  1MGR A;  1RHL A;  1YGW A;  1TRP A;  1BVI A;  3GSP A;  1BNS A;  1UCK A;  3AHW A;  1BAO A;  1DET A;  3URP A;  1B2X A;  1RGE A;  3D5I A;  3D4A A;  1BSB A;  1I3F A;  1Q9E A;  3RNT A;  1FYS A;  1RGH A;  1GOU A;  8RNT A;  1RSN A;  1B2M A;  2HOH A;  1GMR A;  1BNR A;  9RNT A;  1LOW A;  1LNI A;  1RCL A;  2BIR A;  1FW7 A;  3HOH A;  1HZ1 A;  1FUT A;  7GSP A;  1RNB A;  1RGA A;  3WR2 A;  1GMP A;  1BUJ A;  3Q3F A;  4J5K A;  1B20 A;  1TTO A;  1BIR A;  1RGG A;  2BU4 A;  4BIR A;  1B2Z A;  1RDS A;  5HOH A;  1BRK A;  1LOV A;  1RGK A;  1UCI A;  3A5E A;  4BU4 A;  3DH2 A;  2KF3 A;  5RNT A;  1X1W A;  2AAD A;  3KCH A;  3WHO A;  1BSD A;  1RN4 A;  1MGW A;  1CH0 A;  1RGC A;  1DE3 A;  1TRQ A;  1BNF A;  1BU4 A;  5BIR A;  3AGN A;  2ZA4 A;  2KF6 A;  2RNT A;  1BOX A;  1BRJ A;  5BU4 A;  1I0X A;  1RTU A;  1B2S A;  1T2H A;  2RBI A;  1B21 A;  1I2G A;  1RCK A;  1C54 A;  2F5W A;  1ZGX A;  1RGF A;  2F5M A;  1X1Y A;  5GSP A;  3AHS A;  1SAR A;  1T2I A;  1B3S A;  3DGY A;  2KF4 A;  2KF5 A;  1JBR A;  1PY3 A;  7RNT A;  4GHO A;  1AY7 A;  1RN1 A;  4J5G A;  2F56 A;  1BNE A;  1RGL A;  1BRG A;  1B2U A;  1G02 A;  1RLS A;  1RNT A;  1B27 A;  2KAA A;  2SAR A;  1YVS A;  1GOV A;  6GSP A; 
#chains in the Genus database with same CATH topology
 3OWS A;  1GS3 A;  4DKI A;  1A90 A;  1OUN A;  1X1U A;  2CWU A;  3K9M C;  3CCE 3;  4FCM A;  7STD A;  3PCS A;  1F8N A;  1YJ9 3;  3JVC A;  5CK6 A;  3NV0 A;  3CU3 A;  3WDG B;  1LQM B;  1IQX A;  3BU4 A;  1OCV A;  1BAN A;  1TJD A;  5CF2 A;  1N5P A;  1UCJ A;  5AEW B;  2WO0 A;  1TFK A;  3EC9 A;  1DMN A;  1LVN A;  1VZZ A;  2CFG A;  2IYJ A;  1I0V A;  3H51 A;  3M8C A;  1YJW 3;  2RFR A;  4TX4 A;  1BNJ A;  5CXO A;  1WTH A;  1VQQ A;  1BNG A;  3HIG A;  4EBG A;  3K5T A;  2QA4 3;  2AAE A;  1BSC A;  5CF1 A;  3V99 A;  1JJ2 2;  2P05 A;  2CFL A;  4QWT A;  4O2H A;  1D6U A;  1YGE A;  3KZT A;  1JKG B;  1JBT A;  3KE7 A;  5AIH A;  1W6G A;  2YFI B;  3MHE A;  3RGR A;  5AYR B;  3ECF A;  4HZB B;  3N54 B;  2IA7 A;  1PYL A;  4CPK A;  5KP1 A;  1BRI A;  1KSI A;  1AQZ A;  1MGR A;  3AMO A;  1Z1S A;  1GY7 A;  1YGW A;  3BNB A;  4WP5 A;  1BNS A;  3ZG5 A;  5IG3 A;  4KFF A;  1DET A;  3SOY A;  3NM7 A;  1RGE A;  1BSB A;  1I3F A;  1Q9E A;  1TUH A;  2ML5 A;  4KT3 B;  1FYS A;  3FSD A;  4EYC A;  1U5O A;  1FUW A;  1IQ8 A;  3WA3 A;  2OWP A;  5HGR A;  2XGL A;  3FG4 A;  5IW9 A;  4WYK B;  1DVD A;  4LGQ A;  1RCL A;  3F9S A;  3HOH A;  2XRX B;  1LOX A;  2H0I A;  5ELJ A;  1KQS 2;  1CQS A;  3SLU A;  2CHC A;  5IEO A;  1FGR A;  1GY5 A;  3WR2 A;  4RNZ A;  4HM5 B;  3MSO A;  3Q3F A;  4HM3 B;  4HYZ A;  4J5K A;  2KCD A;  2ML6 A;  3IMA B;  3T0U A;  1ZX2 A;  3HZP A;  3WOF B;  1US1 A;  6STD A;  1IVW A;  3LTA A;  4XBT A;  1IT8 A;  5AYS C;  3DM8 A;  3CNX A;  1HU9 A;  1O7H B;  3BB9 A;  1OHP A;  1AVK A;  3B8L A;  3G16 A;  4J9A A;  5IG5 A;  1VQ6 3;  3LML A;  3GWR A;  2WGQ A;  3G71 3;  3EJV A;  3F14 A;  1QAK A;  2HMO B;  1JZD A;  1VQ5 3;  3GZX B;  2FGT A;  2GU1 A;  3WHO A;  1BSD A;  1MOL A;  1NB3 I;  1RN4 A;  3Q1C A;  1UW1 A;  1CH0 A;  2CX0 A;  3J7Y d;  1TRQ A;  1DE3 A;  3G6E 3;  4IT7 A;  1BU4 A;  3X40 A;  1O7W B;  2PNC A;  2RNT A;  4N6T A;  1V74 A;  1KD1 4;  3LT8 A;  3CCJ 3;  3OWU A;  1B21 A;  3JUM A;  1RCK A;  2Z6B A;  2GEX A;  3N9H A;  3OXA A;  4NHF A;  1QMA A;  5LC6 A;  1O7P B;  3S27 A;  3MPH A;  4GL6 A;  1GY6 A;  1NU3 A;  3T8N A;  4JRF A;  1K28 A;  1K9M 4;  1VQ4 3;  3NQZ A;  4L7K A;  3DGM A;  1LXE A;  3KFQ C;  2I9W A;  4KFD A;  3AHS A;  1SAR A;  3MYT A;  1CEW I;  2CIU A;  1PY3 A;  1V57 A;  2BMQ B;  4LZI A;  3E99 A;  3LTC A;  3NV0 B;  1EA2 A;  1AY7 A;  1RN1 A;  2GXF A;  4L8P A;  1Q42 A;  1BNE A;  3U97 A;  2W9P A;  3ALA A;  1BRG A;  2W56 A;  1G02 A;  1RNT A;  2L4V A;  1WMN A;  2BNG A;  2R4I A;  4HM2 B;  2W04 A;  3CME 3;  1I8V A;  1QJG A;  2F4Y A;  2ZDJ A;  1Q86 4;  1A67 A;  1EG9 B;  1HYF A;  2LYX A;  1SIH A;  4RNT A;  3CPW 2;  1BSE A;  1GSP A;  4MEI A;  1N8R 4;  2HMJ B;  2P0X A;  4JF8 A;  4LSO A;  3CC7 3;  1RN7 A;  5KP4 A;  1NB5 I;  4RZM A;  1RKY A;  1NNV A;  4FMB A;  1IVV A;  2KRT A;  3U1W A;  4N3V A;  1YNV X;  1EKM A;  1BSA A;  3AMO B;  3CCM 3;  3MG3 A;  1UCL A;  1RMS A;  3KII A;  2Q07 A;  3G0K A;  4HBR A;  3SYU A;  1D6Y A;  3GZR A;  2CK3 H;  1VQO 3;  1DVC A;  1EEJ A;  1GOY A;  1R4Y A;  3BIR A;  3KSE D;  3B4O A;  2IUK A;  5D81 A;  2BMO B;  4BTY A;  2O9U X;  2CFK A;  1BRH A;  3D5G A;  3FH1 A;  4K1U A;  1FUS A;  4MJD A;  5FGO A;  3Q2P A;  3G4S 3;  4N6N B;  3NX0 A;  1RHL A;  4J8T A;  1TRP A;  5JPP A;  1GD4 A;  1G0T A;  1ASK A;  3GSP A;  3BNC A;  2E2U A;  1UCK A;  3AHW A;  3DGL A;  3OW2 2;  1B2X A;  2BO9 B;  3D9R A;  4KZ1 A;  2QEX 3;  1L5G B;  3D4A A;  2HMN B;  1ULI B;  1Q7H A;  1W7C A;  1WNH A;  1AVL A;  3I0Y A;  3RNT A;  1RGH A;  1GOU A;  8RNT A;  1JV2 B;  1RSN A;  2GU3 A;  4XB5 A;  1GMR A;  1TU5 A;  1IK3 A;  5M18 A;  1LOW A;  2K54 A;  1WQL B;  4L8O A;  1JB2 A;  2ZL8 A;  2BIR A;  2F86 B;  3F8X A;  1V58 A;  1FW7 A;  3K7C A;  1W2B 2;  2OCT A;  3I55 3;  3HX8 A;  3FGY A;  3VGN A;  3X3Y A;  2F99 A;  3ZG0 A;  1TFO A;  2XH9 A;  4FMD A;  3DZL A;  4X2H A;  1CYV A;  1STD A;  1GMP A;  1G96 A;  4FR9 A;  3WMD A;  1BUJ A;  3DGN A;  1W2Z A;  1TTO A;  3DUK A;  1O7G B;  4FCZ A;  2BU4 A;  3UB1 A;  3VF1 A;  4IPB A;  4CJN A;  1M90 4;  5HOH A;  1T3B A;  3QK9 A;  2LQV A;  1UCI A;  1PU4 A;  1VQM 3;  4LMI A;  1ULJ B;  2BMR B;  4BU4 A;  2HMM B;  3DH2 A;  3OWY A;  2INX A;  1JN5 A;  2KF3 A;  3F8H A;  2AAD A;  3KCH A;  1N8Q A;  4O02 B;  3S28 A;  4NRE A;  2RSX A;  3NBB A;  3JUN A;  1BUQ A;  1RGC A;  2HML B;  2O3O A;  1GYB A;  3ROB A;  2F98 A;  1PFP A;  1UI7 A;  4EV5 A;  2OQE C;  2OOV C;  4I5Q A;  2KF6 A;  1DMQ A;  3CPO A;  3HII A;  2Y74 A;  4HM6 B;  3PYJ A;  3LTB A;  5BU4 A;  1YVB I;  1VQ8 3;  1VQL 3;  3WOE B;  4ZM8 A;  2RBI A;  1SPU A;  3K0Z A;  1YJN 3;  2W56 B;  2XFS A;  3PXM A;  1RRH A;  3MKI A;  4O8S A;  2CG1 A;  5IEP A;  4WFO A;  4HKV B;  1IU7 A;  1T5Y A;  2J8X B;  2D42 A;  1VQ9 3;  4GB5 A;  1YIJ 3;  1NWW A;  1Y4K A;  1B3S A;  1LQG C;  2KF4 A;  2KF5 A;  4NPB A;  3DGO A;  4MMX B;  4N6L A;  7RNT A;  1NJI 4;  2CWV A;  1IDP A;  2W03 A;  3IJE B;  4R9K A;  1M1K 4;  4J5G A;  2F56 A;  4K1V A;  2STD A;  4BL3 A;  1UDI I;  1AV4 A;  4FMC A;  1B27 A;  3NHX A;  4MMZ B;  1ZGX A;  1GOV A;  5AI1 A;  1IQY A;  1OAC A;  1N5H A;  4HAA A;  2H0H A;  4AKZ A;  2B24 B;  3BNE A;  2IY2 A;  4HM8 B;  5CLK A;  3D79 A;  3DY5 A;  3GZY B;  4N6O B;  3NQY A;  1Q40 B;  4HM4 B;  4PEJ A;  3NBJ A;  1OHO A;  2SBL A;  3D3L A;  4ORL A;  1W01 A;  1FGO A;  1SJW A;  2L1S A;  3G8Z A;  2CKF B;  2WOF A;  1Q7Y 4;  3FF2 A;  2UUG C;  2Y73 A;  4RBN A;  3CXC 2;  4CCV A;  1I70 A;  3IPT A;  2P38 A;  2GBW B;  5ELU A;  1UI8 A;  3EX9 A;  2B1X B;  2Z77 A;  1OF5 A;  1UGI A;  1LOY A;  4GSP A;  5EVH A;  4AKY A;  5IER A;  3TDG A;  1Q81 4;  3FCS B;  2C4B A;  4FCJ A;  3F7S A;  5AEU B;  2MF7 A;  3V92 A;  3JUQ A;  4HM7 B;  5M19 A;  4XM4 A;  3GAX A;  2IMJ A;  1I3I A;  3DXO A;  4EXR A;  1W6Y A;  4K61 A;  2MC8 A;  1IYY A;  4I4K A;  2IUJ A;  3CD6 3;  3MG1 A;  2P0M A;  4K90 B;  4XDW A;  1A2K A;  5I97 A;  2BHM A;  3Q90 A;  3CCU 3;  2GSP A;  1J2B A;  2E2V A;  4XDV A;  1R4C A;  1O7N B;  1BVI A;  2RGQ A;  2BT3 A;  1OHS A;  1FGT A;  2XR8 B;  3X3X A;  2W9Q A;  2H0G A;  3CNM A;  4OVM A;  3LYG A;  3FKA A;  3I56 3;  2C11 A;  2YX9 A;  3GZB A;  2HOH A;  5G1K A;  1SQW A;  1FGM A;  1N9J A;  2OTJ 3;  1KC8 4;  1LNI A;  2Z76 A;  4KFE A;  1HKX A;  2RCD A;  1OH0 A;  3S5C A;  1E3V A;  4HVN A;  1FUT A;  2K3D A;  1Q40 A;  3UL6 A;  2CH9 A;  3VSY A;  1RNB A;  1JN5 B;  1FGQ A;  4N6M A;  1FA3 A;  3DMC A;  2OTL 3;  1NO3 A;  1S72 3;  5DRV A;  3BND A;  3RDE A;  3CC2 3;  1DMM A;  3EN8 A;  3CCS 3;  1BIR A;  3F40 A;  1ZS7 A;  1W5Z A;  2A15 A;  3NXJ A;  1VQK 3;  1LOV A;  2PZV A;  3A5E A;  3F7X A;  3CCR 3;  2UGI A;  2WOH A;  4OK0 A;  5RNT A;  4MMY B;  1CYU A;  1YHQ 3;  2JDI H;  1X1W A;  1ZO2 A;  4Q53 A;  3OX9 A;  3V98 A;  3UJM A;  1W02 A;  1B2M A;  3EN1 B;  5AIG A;  2CX1 A;  1W4N A;  5LC7 A;  1W6C A;  5BIR A;  2ZA4 A;  3T8U A;  1JB4 A;  4XBX A;  1BRJ A;  1I0X A;  1M1X B;  1U8C B;  1EQK A;  1STF I;  1T2H A;  3B4P A;  1I2G A;  3LZA A;  4HM1 B;  4LEH A;  3UNL A;  4BL2 A;  4EW5 A;  2V1L A;  3HK4 A;  2F5W A;  1M9G A;  3KKG A;  1JB5 A;  1D6Z A;  3K63 A;  3FG3 A;  4R9L A;  1O7M B;  3H3H A;  1RGF A;  3SED A;  5GSP A;  5STD A;  1VQP 3;  3DGY A;  4CDL A;  1JBR A;  3PCR A;  1RJO A;  4GHO A;  3HI7 A;  1MWR A;  1RGL A;  2GBX B;  3NM2 A;  2CC3 A;  1B2U A;  2CFW A;  2FNQ A;  5EEO A;  2SAR A;  2W6J H;  2XGN A;  6GSP A;  1E3R A;  3O8Y A;  1BRN L;  1DYU A;  1FZU A;  1UGH I;  3EBY A;  3S29 A;  4AEQ A;  6RNT A;  4H61 A;  1X1X A;  2D1W A;  1OF5 B;  3X42 A;  3SX1 A;  3EE1 A;  2WGO A;  1BRS A;  1MNL A;  1QAL A;  3B7C A;  1A2P A;  2XSH B;  3PGB A;  8CHO A;  1QVG 2;  1GMQ A;  1I2E A;  1IVU A;  4IIA A;  1EUI C;  3SXX A;  4HOH A;  1OGZ A;  2CW9 A;  3FF0 A;  4EV2 A;  4G1M B;  1YI2 3;  3CMA 3;  3AGO A;  3WOD G;  2XEP A;  5JBS A;  1BNI A;  1S5A A;  2QIY A;  1JBS A;  1BGS A;  1ROV A;  4HM0 B;  1UUW B;  3CCL 3;  1WMO A;  2K0M A;  1LRA A;  5BXQ A;  1I2F A;  3STD A;  1GD3 A;  5JPU A;  1TP6 A;  4LYL B;  4R80 A;  1W00 A;  1BAO A;  2XF3 A;  3URP A;  1JKG A;  2FXT A;  3D5I A;  3LTD A;  3QRD A;  3PZW A;  3KSP A;  4N6V 0;  5EQL A;  1QVF 2;  4OUQ A;  1C7H A;  4RNY A;  4BTW A;  1K41 A;  3ER7 A;  1K73 4;  1BNR A;  4ILF A;  3UL5 A;  9RNT A;  1OPY A;  1IV9 A;  4WWU C;  1RRL A;  3N8B A;  2CG0 A;  3X3Z A;  1HZ1 A;  2W0Q A;  1N9E A;  2C10 A;  3LH4 A;  1JNQ A;  1IV7 A;  2UX0 A;  1NDO B;  4HJL B;  5G1L A;  7GSP A;  1WMP A;  1RGA A;  3SOA A;  3PS8 A;  1LNH A;  5IF6 A;  3LOY A;  1ROA A;  3NUV A;  3EQQ B;  4STD A;  3CC4 3;  3X41 A;  2GEY A;  1MWU A;  1B20 A;  2XFT A;  1ISK A;  1RGG A;  3JUP A;  4WYK A;  1JZO A;  4BIR A;  1TIJ A;  1B2Z A;  1RDS A;  3JUO A;  3NBR A;  2OOV A;  1BRK A;  3EB8 A;  2OQE A;  4HZ9 B;  4BTX A;  3LXU X;  3CCV 3;  1RGK A;  2R41 A;  3S67 A;  5D82 A;  1VQN 3;  3RGA A;  4R1K A;  5IG0 A;  3EHC A;  3OV4 A;  1Q82 4;  5DRE A;  5D83 A;  5A0O B;  2Z7A A;  5AII A;  1JRQ A;  4XBY A;  5FW5 A;  4FMA A;  4R4K A;  1MWT A;  1VQ7 3;  1MGW A;  2W2C A;  2CFD A;  2ZHX B;  1YIT 3;  4KVH A;  1BNF A;  2YFJ B;  2E2T A;  3AGN A;  1BOX A;  2KXG A;  3FG1 A;  3SVA A;  3FLJ A;  3A76 A;  1RTU A;  3L0R A;  1UUG B;  1B2S A;  1SII A;  3FZW A;  3MWZ A;  4N6U A;  4EC6 A;  3LT9 A;  4X2O A;  3CCQ 3;  5KP3 A;  4U13 A;  5IEN A;  5AIF A;  1C54 A;  1K8A 4;  2QGU A;  1IVX A;  2JQ5 A;  1IT7 A;  1E97 A;  1MWS A;  2CWT A;  2P09 A;  2XSO B;  5G2G A;  1QAF A;  2F5M A;  1X1Y A;  3EF8 A;  4H3U A;  3WA2 X;  1T2I A;  1KWI A;  4O3V A;  1UUV B;  3GRD A;  5IG4 A;  1A2V A;  3KN4 A;  4WHA A;  3MG2 A;  2M7O A;  3BLZ A;  3ZFZ A;  1AR0 A;  2HMK B;  2YFL B;  5BVB A;  1RLS A;  2KAA A;  1OGX A;  1YVS A;  3EBT A;  5M1A A;  5TGN A; 
#chains in the Genus database with same CATH homology
 4HAA A;  1BRN L;  1I8V A;  2F4Y A;  1X1U A;  1FZU A;  6RNT A;  1HYF A;  1X1X A;  4RNT A;  1BSE A;  1GSP A;  1BRS A;  3BU4 A;  1A2P A;  1BAN A;  1GMQ A;  1I2E A;  1UCJ A;  4HOH A;  1I0V A;  1BNJ A;  1YNV X;  1BNG A;  1BSA A;  2AAE A;  1BSC A;  1I70 A;  4GSP A;  1UCL A;  1RMS A;  3AGO A;  1LOY A;  3SYU A;  2C4B A;  3BIR A;  1GOY A;  1R4Y A;  1BNI A;  1JBT A;  1I3I A;  1JBS A;  1IYY A;  1BGS A;  1PYL A;  1BRH A;  3D5G A;  1FUS A;  1LRA A;  2GSP A;  1BRI A;  1I2F A;  1AQZ A;  1MGR A;  1RHL A;  1YGW A;  1TRP A;  1BVI A;  3GSP A;  1BNS A;  1UCK A;  3AHW A;  1BAO A;  1DET A;  3URP A;  1B2X A;  1RGE A;  3D5I A;  3D4A A;  1BSB A;  1I3F A;  1Q9E A;  3RNT A;  1FYS A;  1RGH A;  1GOU A;  8RNT A;  1RSN A;  1B2M A;  2HOH A;  1GMR A;  1BNR A;  9RNT A;  1LOW A;  1LNI A;  1RCL A;  2BIR A;  1FW7 A;  3HOH A;  1HZ1 A;  1FUT A;  7GSP A;  1RNB A;  1RGA A;  3WR2 A;  1GMP A;  1BUJ A;  3Q3F A;  4J5K A;  1B20 A;  1TTO A;  1BIR A;  1RGG A;  2BU4 A;  4BIR A;  1B2Z A;  1RDS A;  5HOH A;  1BRK A;  1LOV A;  1RGK A;  1UCI A;  3A5E A;  4BU4 A;  3DH2 A;  2KF3 A;  5RNT A;  1X1W A;  2AAD A;  3KCH A;  3WHO A;  1BSD A;  1RN4 A;  1MGW A;  1CH0 A;  1RGC A;  1DE3 A;  1TRQ A;  1BNF A;  1BU4 A;  5BIR A;  3AGN A;  2ZA4 A;  2KF6 A;  2RNT A;  1BOX A;  1BRJ A;  5BU4 A;  1I0X A;  1RTU A;  1B2S A;  1T2H A;  2RBI A;  1B21 A;  1I2G A;  1RCK A;  1C54 A;  2F5W A;  1ZGX A;  1RGF A;  2F5M A;  1X1Y A;  5GSP A;  3AHS A;  1SAR A;  1T2I A;  1B3S A;  3DGY A;  2KF4 A;  2KF5 A;  1JBR A;  1PY3 A;  7RNT A;  4GHO A;  1AY7 A;  1RN1 A;  4J5G A;  2F56 A;  1BNE A;  1RGL A;  1BRG A;  1B2U A;  1G02 A;  1RLS A;  1RNT A;  1B27 A;  2KAA A;  2SAR A;  1YVS A;  1GOV A;  6GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...