1GOUA

Ribonuclease binase (g specific endonuclease) unliganded form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
109
structure length
109
Chain Sequence
AVINTFDGVADYLIRYKRLPNDYITKSQASALGWVASKGDLAEVAPGKSIGGDVFSNREGRLPSAGSRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE
publication title The Structure of Substrate-Free Microbial Ribonuclease Binase and of its Complexes with 3'Gmp and Sulfate Ions
pubmed doi rcsb
source organism Bacillus intermedius
total genus 25
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gouA00
3WHOA 1TRPA 1GOYA 1RLSA 1RNBA 1HYFA 1Q9EA 5BU4A 1LOYA 1FW7A 1X1YA 1BOXA 1RGFA 9RNTA 1RCKA 5BIRA 1B2MA 1CH0A 2KF5A 1BNFA 4BU4A 2KF3A 2KF6A 5HOHA 3SYUA 1BNEA 1UCIA 3A5EA 1SARA 2GSPA 3AHWA 1BNRA 4J5KA 1BANA 1BSBA 1GMRA 1JBRA 1I70A 1B2UA 1I0XA 1BRKA 3AGNA 1BRHA 4HOHA 1IYYA 3WR2A 4GSPA 1MGRA 1FUTA 2F5WA 3GSPA 4J5GA 1UCLA 7RNTA 1BSAA 5GSPA 1RN1A 3D5IA 3HOHA 1FZUA 1BNSA 2SARA 1DE3A 1BVIA 1YVSA 5RNTA 1TTOA 1DETA 2F5MA 1BU4A 1RGEA 1RGAA 2RNTA 4BIRA 6RNTA 1I8VA 1I2FA 2BU4A 3D5GA 3AGOA 1BRNL 3Q3FA 2AADA 1BNGA 1BSDA 7GSPA 1BUJA 2BIRA 4GHOA 1BSCA 1JBSA 1UCKA 1BNIA 1RDSA 3AHSA 2RBIA 1A2PA 1B2XA 1X1UA 1LRAA 1TRQA 1RHLA 1PYLA 1BAOA 1GMPA 1I3IA 1BRIA 1RGKA 1RCLA 3RNTA 1LNIA 1RTUA 1X1XA 1LOWA 1B27A 3DH2A 4HAAA 1C54A 1RGGA 2HOHA 1HZ1A 1BRJA 1R4YA 1AY7A 3D4AA 2AAEA 1LOVA 1BRSA 2F4YA 1FUSA 3BU4A 1RNTA 1BIRA 1I2EA 1B2ZA 1RGHA 1FYSA 1I3FA 2KF4A 1BRGA 8RNTA 1B3SA 1RN4A 1GMQA 1YNVX 3URPA 6GSPA 1X1WA 1B21A 1B2SA 1G02A 1RGLA 1AQZA 1T2HA 1RMSA 3DGYA 1T2IA 1I0VA 4RNTA 1BNJA 1BGSA 1RGCA 2ZA4A 1BSEA 1YGWA 2F56A 1GOUA 1PY3A 1B20A 1RSNA 2KAAA 1MGWA 1GSPA 1ZGXA 1JBTA 3KCHA 1UCJA 1GOVA 1I2GA 2C4BA 3BIRA
chains in the Genus database with same CATH superfamily
3IJEB 5IEOA 1HYFA 3DGNA 1X1YA 2P38A 1RGFA 2PNCA 3MKIA 1EKMA 1ZO2A 4N6NB 1B2MA 3PGBA 2B24B 1PFPA 4OVMA 2KF5A 3G713 3CCJ3 1VZZA 3N54B 4O2HA 5CXOA 3SYUA 1ZS7A 2F98A 1UCIA 1ZX2A 4KFEA 1GY5A 3A5EA 1SARA 4N6UA 5TGNA 5KP4A 4J5KA 1VQL3 3NQZA 1IV9A 3EF8A 5KP3A 4H61A 3Q2PA 2WOHA 1I0XA 3AGNA 3VF1A 1FGQA 4HZBB 4KFDA 3B4PA 1E3RA 1Z1SA 3DGLA 1WMNA 1WQLB 3CCR3 2L1SA 1JB4A 1MGRA 1FUTA 3CC73 2CHCA 3GSPA 1RKYA 1K41A 3H3HA 1YJW3 3DZLA 1LNHA 4RZMA 3EN8A 1O7NB 3CXC2 5LC7A 4WP5A 5G2GA 3CCU3 1FA3A 1UUVB 1Q824 3CME3 5RNTA 3OX9A 1GY7A 1QJGA 1JNQA 3LOYA 4CPKA 1W00A 2F5MA 1VQO3 1QALA 3D9RA 4BTWA 3JUMA 3MPHA 1RGAA 4BIRA 2CX1A 1US1A 1I8VA 1W6CA 2BU4A 3LTDA 2ZL8A 1OPYA 2CIUA 3PS8A 1BRNL 2CWVA 5IERA 4CJNA 4FMBA 1BNIA 1RDSA 1OF5A 3JUQA 3ALAA 1FGOA 3OV4A 1VQK3 1A2PA 1JZOA 3WDGB 1X1UA 2RCDA 4R9KA 1LRAA 1T3BA 1GD4A 1W2ZA 1QVG2 1OCVA 5IG3A 2I9WA 4JF8A 1LXEA 1N5HA 3EB8A 3OWYA 1GMPA 3ZFZA 1UI7A 3X3ZA 3SEDA 2GU3A 1OUNA 4R1KA 1LNIA 2IY2A 1RTUA 3FZWA 1W01A 3NBRA 3EBYA 3IMAB 1MNLA 3CNMA 1YJN3 1IQ8A 4QWTA 3DH2A 1C54A 2UX0A 3KZTA 1N8R4 3CPOA 1OGXA 1R4YA 2JDIH 2E2VA 3D4AA 4N6V0 2AAEA 4AKZA 3U1WA 1BRSA 2ML6A 1OGZA 3BU4A 5AEUB 5CK6A 4BL3A 3NBJA 1SJWA 3BNCA 4GL6A 5ELJA 2FNQA 2B1XB 3FG3A 3HIGA 3DUKA 3G4S3 2GBWB 3N9HA 1RN4A 3MG1A 1GMQA 2ZDJA 4XDWA 5IG0A 3T0UA 1GY6A 2WO0A 3NXJA 3URPA 1W4NA 3T8UA 4R9LA 2M7OA 3GZBA 4XBXA 4MEIA 5IENA 2QA43 3JUNA 4FCMA 4XBTA 1BSEA 2F56A 1PU4A 5DRVA 1B20A 1RSNA 3SVAA 1VQN3 2KAAA 1CYUA 3LT9A 1GSPA 2Z77A 4IIAA 5AEWB 1JBTA 4EYCA 3LTAA 5IG5A 2JQ5A 4FMDA 3B4OA 3SOAA 1JN5A 1E97A 3CMA3 2MF7A 4MMYB 5BU4A 2P0XA 1FW7A 1BOXA 2W03A 4CCVA 2W56A 4FCJA 1IVUA 2J8XB 2OQEC 5BIRA 1YI23 1A67A 1A90A 2KRTA 1LVNA 1BNFA 4HM5B 1DMNA 5EQLA 2D42A 3BLZA 1V57A 3CCE3 3OWSA 1W6YA 2GSPA 3VSYA 4LGQA 2KCDA 3DXOA 1STDA 1Y4KA 4FMCA 1D6UA 1BUQA 3CC43 3SXXA 2GXFA 2ZHXB 1OHSA 3K9MC 3V99A 3WR2A 3FF2A 1JZDA 4GSPA 4HM8B 1IU7A 3F7XA 1EG9B 1OHOA 2SBLA 4G1MB 2F5WA 1WMOA 4AKYA 1TFKA 1D6YA 7RNTA 1BSAA 1IVVA 2HMOB 2YFIB 5GSPA 4ORLA 2CG1A 2XR8B 3I553 3I563 3D5IA 2XFTA 3AMOA 1BNSA 4L8OA 4MMXB 1YVSA 2RGQA 1A2VA 5DREA 5EVHA 1RN7A 4FR9A 1BU4A 3V92A 1U5OA 3F9SA 3PYJA 1Q40B 1N9JA 8CHOA 2RNTA 3FG1A 3DGMA 1VQ43 3WODG 1BNGA 1K9M4 2GEXA 3PXMA 7GSPA 1VQ53 1N5PA 3LXUX 1UCKA 2H0IA 1O7GB 2RBIA 2WGQA 3NV0B 3RDEA 3RGAA 2CFKA 1B2XA 4LYLB 4WYKA 1UI8A 4HM6B 2BHMA 1RHLA 4N6LA 1F8NA 3CD63 2XF3A 1SQWA 1Q7Y4 1Q864 1TP6A 2BT3A 2Z76A 1AR0A 3NHXA 1V58A 2F86B 4RNZA 3B8LA 1EEJA 3UJMA 3CCL3 4OUQA 1YJ93 3FKAA 1TU5A 3FG4A 4R80A 1NB5I 1DVDA 3GRDA 6STDA 1IK3A 3WA3A 1VQM3 2XEPA 2WOFA 4X2OA 1LOVA 2W2CA 1FUSA 4X2HA 1RNTA 2FGTA 4EV5A 1VQ83 2KXGA 1JKGA 4FMAA 3LH4A 2IYJA 1FYSA 4HYZA 2CKFB 1I3FA 1TFOA 1W02A 2W9QA 5IG4A 5IF6A 1BRGA 1E3VA 3GAXA 3LZAA 2HMJB 3LYGA 5BXQA 2CFGA 1JJ22 5AYSC 1U8CB 3A76A 3ECFA 1B21A 1B2SA 3LTBA 4GB5A 4HM0B 4JRFA 4WHAA 2OQEA 1IVWA 4OK0A 4U13A 1BNJA 1KC84 1RGCA 3DMCA 3ZG5A 1LOXA 4HM2B 2MC8A 1KWIA 1MGWA 3K63A 4LEHA 5AI1A 3Q90A 3EJVA 1SPUA 2C10A 3KE7A 3GWRA 5LC6A 4ILFA 3ER7A 1LQGC 3KN4A 1RRLA 3BIRA 3EBTA 4I4KA 3WHOA 5FW5A 1RLSA 1RNBA 1NDOB 1MWUA 1KSIA 1Q9EA 2RSXA 3MG2A 4XBYA 1VQP3 3EQQB 4HM7B 5JBSA 2H0HA 5G1LA 1YIJ3 1JV2B 1YIT3 4HJLB 3UL5A 3HK4A 2O3OA 1SIIA 4WWUC 2QGUA 4EC6A 1IQYA 3U97A 4BU4A 2KF3A 4FCZA 5HOHA 1OACA 1CYVA 3AHWA 1BNRA 2STDA 1BANA 3SLUA 3D79A 1BSBA 1YHQ3 1JBRA 1I70A 2K0MA 3BNBA 1B2UA 3F40A 1BRKA 4XDVA 4DKIA 2HMLB 1BRHA 1AVKA 3CC23 1IYYA 4LMIA 5I97A 4K1UA 1VQ63 2W0QA 4K90B 2H0GA 3MHEA 4PEJA 4J5GA 3GZYB 1UCLA 2CW9A 3BNEA 2IUKA 5D81A 2YFLB 1RN1A 4ZM8A 3EX9A 2OTJ3 3MYTA 2SARA 3F8XA 1RRHA 1CQSA 1N8QA 1G96A 3JUPA 2OOVC 1NB3I 2CFDA 3I0YA 4LZIA 1QAFA 3F8HA 1AV4A 3HIIA 3T8NA 2YFJB 1S723 4XB5A 2CX0A 4N6OB 3CPW2 6RNTA 2W6JH 3MG3A 1QAKA 2CK3H 5FGOA 1GD3A 1RJOA 2P09A 4NREA 3DGOA 1L5GB 4KZ1A 4IPBA 2P05A 1BUJA 1ULJB 2BIRA 5BVBA 2FXTA 4GHOA 4EBGA 2CH9A 4O8SA 2YX9A 3AHSA 2W04A 5JPPA 1AVLA 3WA2X 1FGRA 1BAOA 3UL6A 1I3IA 2Q07A 4KFFA 2QEX3 1BRIA 1RGKA 2IUJA 4HZ9B 3FSDA 5STDA 3S67A 1JB2A 3RNTA 1R4CA 3LTCA 5CLKA 1IVXA 5AYRB 3ROBA 1S5AA 3BB9A 1G0TA 1B27A 4HAAA 3L0RA 1M1XB 1Q7HA 1RGGA 2XGNA 4XM4A 2HOHA 2Y74A 3FGYA 4MMZB 5JPUA 1HZ1A 2HMMB 1NNVA 3IPTA 5A0OB 3OWUA 5EEOA 2CWUA 2F4YA 4EW5A 4O02B 1OF5B 1VQQA 2O9UX 3FCSB 1I2EA 1EUIC 7STDA 1B2ZA 3WMDA 5HGRA 3CU3A 3X41A 1WNHA 2C11A 4CDLA 1B3SA 1ULIB 2CFWA 5CF1A 2E2UA 5AIHA 3EE1A 3B7CA 4K61A 2XFSA 4HM1B 1UGHI 2XGLA 4HKVB 6GSPA 1JRQA 1AQZA 1T2HA 1V74A 4BL2A 2BMQB 1T2IA 1I0VA 1EA2A 1DVCA 1WMPA 3PCRA 5AIGA 3S28A 2OWPA 1O7WB 4NHFA 2OCTA 2L4VA 3QRDA 3PZWA 5AIFA 3S29A 2K54A 3F14A 3DY5A 2LYXA 1NJI4 2UGIA 4I5QA 1FGTA 1ISKA 1TJDA 4TX4A 1M1K4 1GOVA 2XSHB 2C4BA 3O8YA 3SOYA 2A15A 1W7CA 1MWTA 2IA7A 2K3DA 4LSOA 1TRPA 1GOYA 3G6E3 4IT7A 4O3VA 1LOYA 3OXAA 3G0KA 9RNTA 2F99A 3GZXB 4J9AA 1RCKA 2CG0A 1Q814 4N3VA 3K5TA 2W9PA 1CH0A 3MSOA 1NU3A 2ML5A 3KFQC 1YGEA 1STFI 1M9GA 3MWZA 4NPBA 4Q53A 2KF6A 3RGRA 1BNEA 1A2KA 1OHPA 1Q40A 5AIIA 2BMRB 2XH9A 2OOVA 1KQS2 1GMRA 3GZRA 3M8CA 3Q1CA 3S27A 1QVF2 3EC9A 1TUHA 4HOHA 1TIJA 3CCV3 5KP1A 3FLJA 3TDGA 2R41A 4HM4B 3SX1A 4WFOA 3OW22 3K7CA 1JN5B 5M19A 1K28A 3NUVA 3NV0A 1NO3A 3LT8A 2QIYA 1SIHA 4KVHA 1K8A4 3HOHA 1FZUA 2INXA 2W56B 3G16A 1DE3A 1BVIA 5M18A 3ZG0A 3WOEB 2XRXB 4AEQA 1TTOA 5D83A 1DETA 1IT8A 1K734 2HMKB 1FUWA 2BNGA 2UUGC 1RGEA 4HVNA 4STDA 3CCM3 1J2BA 2E2TA 4R4KA 3JUOA 3X42A 1I2FA 1YVBI 4J8TA 3D5GA 3E99A 2BO9B 3AGOA 3Q3FA 2AADA 1M904 1BSDA 2RFRA 1DMQA 2LQVA 3KSPA 3J7Yd 3V98A 1IV7A 1BSCA 1JBSA 1IQXA 2GBXB 3FH1A 1JB5A 2WGOA 4N6TA 1T5YA 1UGIA 1UUGB 1O7MB 3KIIA 1O7PB 3WOFB 1QMAA 2P0MA 1TRQA 3AMOB 3X3YA 2CWTA 2Z6BA 1PYLA 3EHCA 3VGNA 2PZVA 2XSOB 3JVCA 1MWRA 3HI7A 1VQ73 3CNXA 1RCLA 3NX0A 4EV2A 2CFLA 1HKXA 1DYUA 1IT7A 3QK9A 1X1XA 1LOWA 1D6ZA 2BMOB 1KD14 1ROAA 5G1KA 1ASKA 2CC3A 1OH0A 4KT3B 1UW1A 1BRJA 1AY7A 5CF2A 1ROVA 4H3UA 3NQYA 1N9EA 3NM7A 1UDII 3N8BA 3H51A 3F7SA 4HBRA 2HMNB 3CCQ3 1WTHA 1IDPA 4HM3B 1GS3A 1W5ZA 3UB1A 1BIRA 1HU9A 5IEPA 3D3LA 4WYKB 1CEWI 3KSED 1LQMB 1MOLA 1RGHA 2R4IA 1NWWA 2IMJA 2KF4A 3UNLA 2GEYA 3NBBA 3S5CA 4RNYA 8RNTA 4K1VA 4RBNA 3STDA 1YNVX 4EXRA 3K0ZA 3PCSA 4L8PA 1X1WA 4N6MA 5ELUA 1G02A 1RGLA 3FF0A 3DGYA 1RMSA 3EN1B 3HZPA 1W6GA 4MJDA 5D82A 3X40A 1EQKA 3BNDA 4RNTA 1BGSA 2Y73A 3X3XA 3KKGA 1C7HA 2ZA4A 1YGWA 1GOUA 3LMLA 1PY3A 1MWSA 1Q42A 1DMMA 2V1LA 3G8ZA 3CCS3 5M1AA 5IW9A 2D1WA 1ZGXA 1UUWB 1VQ93 3KCHA 2GU1A 3HX8A 1UCJA 2OTL3 4L7KA 1I2GA 1FGMA 1JKGB 1O7HB 3DM8A 3NM2A 4BTYA 4BTXA 1W2B2 2Z7AA 1GYBA
chains in the Genus database with same CATH topology
3WHOA 1TRPA 1GOYA 1RLSA 1RNBA 1HYFA 1Q9EA 5BU4A 1LOYA 1FW7A 1X1YA 1BOXA 1RGFA 9RNTA 1RCKA 5BIRA 1B2MA 1CH0A 2KF5A 1BNFA 4BU4A 2KF3A 2KF6A 5HOHA 3SYUA 1BNEA 1UCIA 3A5EA 1SARA 2GSPA 3AHWA 1BNRA 4J5KA 1BANA 1BSBA 1GMRA 1JBRA 1I70A 1B2UA 1I0XA 1BRKA 3AGNA 1BRHA 4HOHA 1IYYA 3WR2A 4GSPA 1MGRA 1FUTA 2F5WA 3GSPA 4J5GA 1UCLA 7RNTA 1BSAA 5GSPA 1RN1A 3D5IA 3HOHA 1FZUA 1BNSA 2SARA 1DE3A 1BVIA 1YVSA 5RNTA 1TTOA 1DETA 2F5MA 1BU4A 1RGEA 1RGAA 2RNTA 4BIRA 6RNTA 1I8VA 1I2FA 2BU4A 3D5GA 3AGOA 1BRNL 3Q3FA 2AADA 1BNGA 1BSDA 7GSPA 1BUJA 2BIRA 4GHOA 1BSCA 1JBSA 1UCKA 1BNIA 1RDSA 3AHSA 2RBIA 1A2PA 1B2XA 1X1UA 1LRAA 1TRQA 1RHLA 1PYLA 1BAOA 1GMPA 1I3IA 1BRIA 1RGKA 1RCLA 3RNTA 1LNIA 1RTUA 1X1XA 1LOWA 1B27A 3DH2A 4HAAA 1C54A 1RGGA 2HOHA 1HZ1A 1BRJA 1R4YA 1AY7A 3D4AA 2AAEA 1LOVA 1BRSA 2F4YA 1FUSA 3BU4A 1RNTA 1BIRA 1I2EA 1B2ZA 1RGHA 1FYSA 1I3FA 2KF4A 1BRGA 8RNTA 1B3SA 1RN4A 1GMQA 1YNVX 3URPA 6GSPA 1X1WA 1B21A 1B2SA 1G02A 1RGLA 1AQZA 1T2HA 1RMSA 3DGYA 1T2IA 1I0VA 4RNTA 1BNJA 1BGSA 1RGCA 2ZA4A 1BSEA 1YGWA 2F56A 1GOUA 1PY3A 1B20A 1RSNA 2KAAA 1MGWA 1GSPA 1ZGXA 1JBTA 3KCHA 1UCJA 1GOVA 1I2GA 2C4BA 3BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHO A;  1TRP A;  1GOY A;  1RLS A;  1RNB A;  1HYF A;  1Q9E A;  5BU4 A;  1LOY A;  1FW7 A;  1X1Y A;  1BOX A;  1RGF A;  9RNT A;  1RCK A;  5BIR A;  1B2M A;  1CH0 A;  2KF5 A;  1BNF A;  4BU4 A;  2KF3 A;  2KF6 A;  5HOH A;  3SYU A;  1BNE A;  1UCI A;  3A5E A;  1SAR A;  2GSP A;  3AHW A;  1BNR A;  4J5K A;  1BAN A;  1BSB A;  1GMR A;  1JBR A;  1I70 A;  1B2U A;  1I0X A;  1BRK A;  3AGN A;  1BRH A;  4HOH A;  1IYY A;  3WR2 A;  4GSP A;  1MGR A;  1FUT A;  2F5W A;  3GSP A;  4J5G A;  1UCL A;  7RNT A;  1BSA A;  5GSP A;  1RN1 A;  3D5I A;  3HOH A;  1FZU A;  1BNS A;  2SAR A;  1DE3 A;  1BVI A;  1YVS A;  5RNT A;  1TTO A;  1DET A;  2F5M A;  1BU4 A;  1RGE A;  1RGA A;  2RNT A;  4BIR A;  6RNT A;  1I8V A;  1I2F A;  2BU4 A;  3D5G A;  3AGO A;  1BRN L;  3Q3F A;  2AAD A;  1BNG A;  1BSD A;  7GSP A;  1BUJ A;  2BIR A;  4GHO A;  1BSC A;  1JBS A;  1UCK A;  1BNI A;  1RDS A;  3AHS A;  2RBI A;  1A2P A;  1B2X A;  1X1U A;  1LRA A;  1TRQ A;  1RHL A;  1PYL A;  1BAO A;  1GMP A;  1I3I A;  1BRI A;  1RGK A;  1RCL A;  3RNT A;  1LNI A;  1RTU A;  1X1X A;  1LOW A;  1B27 A;  3DH2 A;  4HAA A;  1C54 A;  1RGG A;  2HOH A;  1HZ1 A;  1BRJ A;  1R4Y A;  1AY7 A;  3D4A A;  2AAE A;  1LOV A;  1BRS A;  2F4Y A;  1FUS A;  3BU4 A;  1RNT A;  1BIR A;  1I2E A;  1B2Z A;  1RGH A;  1FYS A;  1I3F A;  2KF4 A;  1BRG A;  8RNT A;  1B3S A;  1RN4 A;  1GMQ A;  1YNV X;  3URP A;  6GSP A;  1X1W A;  1B21 A;  1B2S A;  1G02 A;  1RGL A;  1AQZ A;  1T2H A;  1RMS A;  3DGY A;  1T2I A;  1I0V A;  4RNT A;  1BNJ A;  1BGS A;  1RGC A;  2ZA4 A;  1BSE A;  1YGW A;  2F56 A;  1GOU A;  1PY3 A;  1B20 A;  1RSN A;  2KAA A;  1MGW A;  1GSP A;  1ZGX A;  1JBT A;  3KCH A;  1UCJ A;  1GOV A;  1I2G A;  2C4B A;  3BIR A; 
#chains in the Genus database with same CATH topology
 3IJE B;  5IEO A;  1HYF A;  3DGN A;  1X1Y A;  2P38 A;  1RGF A;  2PNC A;  3MKI A;  1EKM A;  1ZO2 A;  4N6N B;  1B2M A;  3PGB A;  2B24 B;  1PFP A;  4OVM A;  2KF5 A;  3G71 3;  3CCJ 3;  1VZZ A;  3N54 B;  4O2H A;  5CXO A;  3SYU A;  1ZS7 A;  2F98 A;  1UCI A;  1ZX2 A;  4KFE A;  1GY5 A;  3A5E A;  1SAR A;  4N6U A;  5TGN A;  5KP4 A;  4J5K A;  1VQL 3;  3NQZ A;  1IV9 A;  3EF8 A;  5KP3 A;  4H61 A;  3Q2P A;  2WOH A;  1I0X A;  3AGN A;  3VF1 A;  1FGQ A;  4HZB B;  4KFD A;  3B4P A;  1E3R A;  1Z1S A;  3DGL A;  1WMN A;  1WQL B;  3CCR 3;  2L1S A;  1JB4 A;  1MGR A;  1FUT A;  3CC7 3;  2CHC A;  3GSP A;  1RKY A;  1K41 A;  3H3H A;  1YJW 3;  3DZL A;  1LNH A;  4RZM A;  3EN8 A;  1O7N B;  3CXC 2;  5LC7 A;  4WP5 A;  5G2G A;  3CCU 3;  1FA3 A;  1UUV B;  1Q82 4;  3CME 3;  5RNT A;  3OX9 A;  1GY7 A;  1QJG A;  1JNQ A;  3LOY A;  4CPK A;  1W00 A;  2F5M A;  1VQO 3;  1QAL A;  3D9R A;  4BTW A;  3JUM A;  3MPH A;  1RGA A;  4BIR A;  2CX1 A;  1US1 A;  1I8V A;  1W6C A;  2BU4 A;  3LTD A;  2ZL8 A;  1OPY A;  2CIU A;  3PS8 A;  1BRN L;  2CWV A;  5IER A;  4CJN A;  4FMB A;  1BNI A;  1RDS A;  1OF5 A;  3JUQ A;  3ALA A;  1FGO A;  3OV4 A;  1VQK 3;  1A2P A;  1JZO A;  3WDG B;  1X1U A;  2RCD A;  4R9K A;  1LRA A;  1T3B A;  1GD4 A;  1W2Z A;  1QVG 2;  1OCV A;  5IG3 A;  2I9W A;  4JF8 A;  1LXE A;  1N5H A;  3EB8 A;  3OWY A;  1GMP A;  3ZFZ A;  1UI7 A;  3X3Z A;  3SED A;  2GU3 A;  1OUN A;  4R1K A;  1LNI A;  2IY2 A;  1RTU A;  3FZW A;  1W01 A;  3NBR A;  3EBY A;  3IMA B;  1MNL A;  3CNM A;  1YJN 3;  1IQ8 A;  4QWT A;  3DH2 A;  1C54 A;  2UX0 A;  3KZT A;  1N8R 4;  3CPO A;  1OGX A;  1R4Y A;  2JDI H;  2E2V A;  3D4A A;  4N6V 0;  2AAE A;  4AKZ A;  3U1W A;  1BRS A;  2ML6 A;  1OGZ A;  3BU4 A;  5AEU B;  5CK6 A;  4BL3 A;  3NBJ A;  1SJW A;  3BNC A;  4GL6 A;  5ELJ A;  2FNQ A;  2B1X B;  3FG3 A;  3HIG A;  3DUK A;  3G4S 3;  2GBW B;  3N9H A;  1RN4 A;  3MG1 A;  1GMQ A;  2ZDJ A;  4XDW A;  5IG0 A;  3T0U A;  1GY6 A;  2WO0 A;  3NXJ A;  3URP A;  1W4N A;  3T8U A;  4R9L A;  2M7O A;  3GZB A;  4XBX A;  4MEI A;  5IEN A;  2QA4 3;  3JUN A;  4FCM A;  4XBT A;  1BSE A;  2F56 A;  1PU4 A;  5DRV A;  1B20 A;  1RSN A;  3SVA A;  1VQN 3;  2KAA A;  1CYU A;  3LT9 A;  1GSP A;  2Z77 A;  4IIA A;  5AEW B;  1JBT A;  4EYC A;  3LTA A;  5IG5 A;  2JQ5 A;  4FMD A;  3B4O A;  3SOA A;  1JN5 A;  1E97 A;  3CMA 3;  2MF7 A;  4MMY B;  5BU4 A;  2P0X A;  1FW7 A;  1BOX A;  2W03 A;  4CCV A;  2W56 A;  4FCJ A;  1IVU A;  2J8X B;  2OQE C;  5BIR A;  1YI2 3;  1A67 A;  1A90 A;  2KRT A;  1LVN A;  1BNF A;  4HM5 B;  1DMN A;  5EQL A;  2D42 A;  3BLZ A;  1V57 A;  3CCE 3;  3OWS A;  1W6Y A;  2GSP A;  3VSY A;  4LGQ A;  2KCD A;  3DXO A;  1STD A;  1Y4K A;  4FMC A;  1D6U A;  1BUQ A;  3CC4 3;  3SXX A;  2GXF A;  2ZHX B;  1OHS A;  3K9M C;  3V99 A;  3WR2 A;  3FF2 A;  1JZD A;  4GSP A;  4HM8 B;  1IU7 A;  3F7X A;  1EG9 B;  1OHO A;  2SBL A;  4G1M B;  2F5W A;  1WMO A;  4AKY A;  1TFK A;  1D6Y A;  7RNT A;  1BSA A;  1IVV A;  2HMO B;  2YFI B;  5GSP A;  4ORL A;  2CG1 A;  2XR8 B;  3I55 3;  3I56 3;  3D5I A;  2XFT A;  3AMO A;  1BNS A;  4L8O A;  4MMX B;  1YVS A;  2RGQ A;  1A2V A;  5DRE A;  5EVH A;  1RN7 A;  4FR9 A;  1BU4 A;  3V92 A;  1U5O A;  3F9S A;  3PYJ A;  1Q40 B;  1N9J A;  8CHO A;  2RNT A;  3FG1 A;  3DGM A;  1VQ4 3;  3WOD G;  1BNG A;  1K9M 4;  2GEX A;  3PXM A;  7GSP A;  1VQ5 3;  1N5P A;  3LXU X;  1UCK A;  2H0I A;  1O7G B;  2RBI A;  2WGQ A;  3NV0 B;  3RDE A;  3RGA A;  2CFK A;  1B2X A;  4LYL B;  4WYK A;  1UI8 A;  4HM6 B;  2BHM A;  1RHL A;  4N6L A;  1F8N A;  3CD6 3;  2XF3 A;  1SQW A;  1Q7Y 4;  1Q86 4;  1TP6 A;  2BT3 A;  2Z76 A;  1AR0 A;  3NHX A;  1V58 A;  2F86 B;  4RNZ A;  3B8L A;  1EEJ A;  3UJM A;  3CCL 3;  4OUQ A;  1YJ9 3;  3FKA A;  1TU5 A;  3FG4 A;  4R80 A;  1NB5 I;  1DVD A;  3GRD A;  6STD A;  1IK3 A;  3WA3 A;  1VQM 3;  2XEP A;  2WOF A;  4X2O A;  1LOV A;  2W2C A;  1FUS A;  4X2H A;  1RNT A;  2FGT A;  4EV5 A;  1VQ8 3;  2KXG A;  1JKG A;  4FMA A;  3LH4 A;  2IYJ A;  1FYS A;  4HYZ A;  2CKF B;  1I3F A;  1TFO A;  1W02 A;  2W9Q A;  5IG4 A;  5IF6 A;  1BRG A;  1E3V A;  3GAX A;  3LZA A;  2HMJ B;  3LYG A;  5BXQ A;  2CFG A;  1JJ2 2;  5AYS C;  1U8C B;  3A76 A;  3ECF A;  1B21 A;  1B2S A;  3LTB A;  4GB5 A;  4HM0 B;  4JRF A;  4WHA A;  2OQE A;  1IVW A;  4OK0 A;  4U13 A;  1BNJ A;  1KC8 4;  1RGC A;  3DMC A;  3ZG5 A;  1LOX A;  4HM2 B;  2MC8 A;  1KWI A;  1MGW A;  3K63 A;  4LEH A;  5AI1 A;  3Q90 A;  3EJV A;  1SPU A;  2C10 A;  3KE7 A;  3GWR A;  5LC6 A;  4ILF A;  3ER7 A;  1LQG C;  3KN4 A;  1RRL A;  3BIR A;  3EBT A;  4I4K A;  3WHO A;  5FW5 A;  1RLS A;  1RNB A;  1NDO B;  1MWU A;  1KSI A;  1Q9E A;  2RSX A;  3MG2 A;  4XBY A;  1VQP 3;  3EQQ B;  4HM7 B;  5JBS A;  2H0H A;  5G1L A;  1YIJ 3;  1JV2 B;  1YIT 3;  4HJL B;  3UL5 A;  3HK4 A;  2O3O A;  1SII A;  4WWU C;  2QGU A;  4EC6 A;  1IQY A;  3U97 A;  4BU4 A;  2KF3 A;  4FCZ A;  5HOH A;  1OAC A;  1CYV A;  3AHW A;  1BNR A;  2STD A;  1BAN A;  3SLU A;  3D79 A;  1BSB A;  1YHQ 3;  1JBR A;  1I70 A;  2K0M A;  3BNB A;  1B2U A;  3F40 A;  1BRK A;  4XDV A;  4DKI A;  2HML B;  1BRH A;  1AVK A;  3CC2 3;  1IYY A;  4LMI A;  5I97 A;  4K1U A;  1VQ6 3;  2W0Q A;  4K90 B;  2H0G A;  3MHE A;  4PEJ A;  4J5G A;  3GZY B;  1UCL A;  2CW9 A;  3BNE A;  2IUK A;  5D81 A;  2YFL B;  1RN1 A;  4ZM8 A;  3EX9 A;  2OTJ 3;  3MYT A;  2SAR A;  3F8X A;  1RRH A;  1CQS A;  1N8Q A;  1G96 A;  3JUP A;  2OOV C;  1NB3 I;  2CFD A;  3I0Y A;  4LZI A;  1QAF A;  3F8H A;  1AV4 A;  3HII A;  3T8N A;  2YFJ B;  1S72 3;  4XB5 A;  2CX0 A;  4N6O B;  3CPW 2;  6RNT A;  2W6J H;  3MG3 A;  1QAK A;  2CK3 H;  5FGO A;  1GD3 A;  1RJO A;  2P09 A;  4NRE A;  3DGO A;  1L5G B;  4KZ1 A;  4IPB A;  2P05 A;  1BUJ A;  1ULJ B;  2BIR A;  5BVB A;  2FXT A;  4GHO A;  4EBG A;  2CH9 A;  4O8S A;  2YX9 A;  3AHS A;  2W04 A;  5JPP A;  1AVL A;  3WA2 X;  1FGR A;  1BAO A;  3UL6 A;  1I3I A;  2Q07 A;  4KFF A;  2QEX 3;  1BRI A;  1RGK A;  2IUJ A;  4HZ9 B;  3FSD A;  5STD A;  3S67 A;  1JB2 A;  3RNT A;  1R4C A;  3LTC A;  5CLK A;  1IVX A;  5AYR B;  3ROB A;  1S5A A;  3BB9 A;  1G0T A;  1B27 A;  4HAA A;  3L0R A;  1M1X B;  1Q7H A;  1RGG A;  2XGN A;  4XM4 A;  2HOH A;  2Y74 A;  3FGY A;  4MMZ B;  5JPU A;  1HZ1 A;  2HMM B;  1NNV A;  3IPT A;  5A0O B;  3OWU A;  5EEO A;  2CWU A;  2F4Y A;  4EW5 A;  4O02 B;  1OF5 B;  1VQQ A;  2O9U X;  3FCS B;  1I2E A;  1EUI C;  7STD A;  1B2Z A;  3WMD A;  5HGR A;  3CU3 A;  3X41 A;  1WNH A;  2C11 A;  4CDL A;  1B3S A;  1ULI B;  2CFW A;  5CF1 A;  2E2U A;  5AIH A;  3EE1 A;  3B7C A;  4K61 A;  2XFS A;  4HM1 B;  1UGH I;  2XGL A;  4HKV B;  6GSP A;  1JRQ A;  1AQZ A;  1T2H A;  1V74 A;  4BL2 A;  2BMQ B;  1T2I A;  1I0V A;  1EA2 A;  1DVC A;  1WMP A;  3PCR A;  5AIG A;  3S28 A;  2OWP A;  1O7W B;  4NHF A;  2OCT A;  2L4V A;  3QRD A;  3PZW A;  5AIF A;  3S29 A;  2K54 A;  3F14 A;  3DY5 A;  2LYX A;  1NJI 4;  2UGI A;  4I5Q A;  1FGT A;  1ISK A;  1TJD A;  4TX4 A;  1M1K 4;  1GOV A;  2XSH B;  2C4B A;  3O8Y A;  3SOY A;  2A15 A;  1W7C A;  1MWT A;  2IA7 A;  2K3D A;  4LSO A;  1TRP A;  1GOY A;  3G6E 3;  4IT7 A;  4O3V A;  1LOY A;  3OXA A;  3G0K A;  9RNT A;  2F99 A;  3GZX B;  4J9A A;  1RCK A;  2CG0 A;  1Q81 4;  4N3V A;  3K5T A;  2W9P A;  1CH0 A;  3MSO A;  1NU3 A;  2ML5 A;  3KFQ C;  1YGE A;  1STF I;  1M9G A;  3MWZ A;  4NPB A;  4Q53 A;  2KF6 A;  3RGR A;  1BNE A;  1A2K A;  1OHP A;  1Q40 A;  5AII A;  2BMR B;  2XH9 A;  2OOV A;  1KQS 2;  1GMR A;  3GZR A;  3M8C A;  3Q1C A;  3S27 A;  1QVF 2;  3EC9 A;  1TUH A;  4HOH A;  1TIJ A;  3CCV 3;  5KP1 A;  3FLJ A;  3TDG A;  2R41 A;  4HM4 B;  3SX1 A;  4WFO A;  3OW2 2;  3K7C A;  1JN5 B;  5M19 A;  1K28 A;  3NUV A;  3NV0 A;  1NO3 A;  3LT8 A;  2QIY A;  1SIH A;  4KVH A;  1K8A 4;  3HOH A;  1FZU A;  2INX A;  2W56 B;  3G16 A;  1DE3 A;  1BVI A;  5M18 A;  3ZG0 A;  3WOE B;  2XRX B;  4AEQ A;  1TTO A;  5D83 A;  1DET A;  1IT8 A;  1K73 4;  2HMK B;  1FUW A;  2BNG A;  2UUG C;  1RGE A;  4HVN A;  4STD A;  3CCM 3;  1J2B A;  2E2T A;  4R4K A;  3JUO A;  3X42 A;  1I2F A;  1YVB I;  4J8T A;  3D5G A;  3E99 A;  2BO9 B;  3AGO A;  3Q3F A;  2AAD A;  1M90 4;  1BSD A;  2RFR A;  1DMQ A;  2LQV A;  3KSP A;  3J7Y d;  3V98 A;  1IV7 A;  1BSC A;  1JBS A;  1IQX A;  2GBX B;  3FH1 A;  1JB5 A;  2WGO A;  4N6T A;  1T5Y A;  1UGI A;  1UUG B;  1O7M B;  3KII A;  1O7P B;  3WOF B;  1QMA A;  2P0M A;  1TRQ A;  3AMO B;  3X3Y A;  2CWT A;  2Z6B A;  1PYL A;  3EHC A;  3VGN A;  2PZV A;  2XSO B;  3JVC A;  1MWR A;  3HI7 A;  1VQ7 3;  3CNX A;  1RCL A;  3NX0 A;  4EV2 A;  2CFL A;  1HKX A;  1DYU A;  1IT7 A;  3QK9 A;  1X1X A;  1LOW A;  1D6Z A;  2BMO B;  1KD1 4;  1ROA A;  5G1K A;  1ASK A;  2CC3 A;  1OH0 A;  4KT3 B;  1UW1 A;  1BRJ A;  1AY7 A;  5CF2 A;  1ROV A;  4H3U A;  3NQY A;  1N9E A;  3NM7 A;  1UDI I;  3N8B A;  3H51 A;  3F7S A;  4HBR A;  2HMN B;  3CCQ 3;  1WTH A;  1IDP A;  4HM3 B;  1GS3 A;  1W5Z A;  3UB1 A;  1BIR A;  1HU9 A;  5IEP A;  3D3L A;  4WYK B;  1CEW I;  3KSE D;  1LQM B;  1MOL A;  1RGH A;  2R4I A;  1NWW A;  2IMJ A;  2KF4 A;  3UNL A;  2GEY A;  3NBB A;  3S5C A;  4RNY A;  8RNT A;  4K1V A;  4RBN A;  3STD A;  1YNV X;  4EXR A;  3K0Z A;  3PCS A;  4L8P A;  1X1W A;  4N6M A;  5ELU A;  1G02 A;  1RGL A;  3FF0 A;  3DGY A;  1RMS A;  3EN1 B;  3HZP A;  1W6G A;  4MJD A;  5D82 A;  3X40 A;  1EQK A;  3BND A;  4RNT A;  1BGS A;  2Y73 A;  3X3X A;  3KKG A;  1C7H A;  2ZA4 A;  1YGW A;  1GOU A;  3LML A;  1PY3 A;  1MWS A;  1Q42 A;  1DMM A;  2V1L A;  3G8Z A;  3CCS 3;  5M1A A;  5IW9 A;  2D1W A;  1ZGX A;  1UUW B;  1VQ9 3;  3KCH A;  2GU1 A;  3HX8 A;  1UCJ A;  2OTL 3;  4L7K A;  1I2G A;  1FGM A;  1JKG B;  1O7H B;  3DM8 A;  3NM2 A;  4BTY A;  4BTX A;  1W2B 2;  2Z7A A;  1GYB A; 
#chains in the Genus database with same CATH homology
 3WHO A;  1TRP A;  1GOY A;  1RLS A;  1RNB A;  1HYF A;  1Q9E A;  5BU4 A;  1LOY A;  1FW7 A;  1X1Y A;  1BOX A;  1RGF A;  9RNT A;  1RCK A;  5BIR A;  1B2M A;  1CH0 A;  2KF5 A;  1BNF A;  4BU4 A;  2KF3 A;  2KF6 A;  5HOH A;  3SYU A;  1BNE A;  1UCI A;  3A5E A;  1SAR A;  2GSP A;  3AHW A;  1BNR A;  4J5K A;  1BAN A;  1BSB A;  1GMR A;  1JBR A;  1I70 A;  1B2U A;  1I0X A;  1BRK A;  3AGN A;  1BRH A;  4HOH A;  1IYY A;  3WR2 A;  4GSP A;  1MGR A;  1FUT A;  2F5W A;  3GSP A;  4J5G A;  1UCL A;  7RNT A;  1BSA A;  5GSP A;  1RN1 A;  3D5I A;  3HOH A;  1FZU A;  1BNS A;  2SAR A;  1DE3 A;  1BVI A;  1YVS A;  5RNT A;  1TTO A;  1DET A;  2F5M A;  1BU4 A;  1RGE A;  1RGA A;  2RNT A;  4BIR A;  6RNT A;  1I8V A;  1I2F A;  2BU4 A;  3D5G A;  3AGO A;  1BRN L;  3Q3F A;  2AAD A;  1BNG A;  1BSD A;  7GSP A;  1BUJ A;  2BIR A;  4GHO A;  1BSC A;  1JBS A;  1UCK A;  1BNI A;  1RDS A;  3AHS A;  2RBI A;  1A2P A;  1B2X A;  1X1U A;  1LRA A;  1TRQ A;  1RHL A;  1PYL A;  1BAO A;  1GMP A;  1I3I A;  1BRI A;  1RGK A;  1RCL A;  3RNT A;  1LNI A;  1RTU A;  1X1X A;  1LOW A;  1B27 A;  3DH2 A;  4HAA A;  1C54 A;  1RGG A;  2HOH A;  1HZ1 A;  1BRJ A;  1R4Y A;  1AY7 A;  3D4A A;  2AAE A;  1LOV A;  1BRS A;  2F4Y A;  1FUS A;  3BU4 A;  1RNT A;  1BIR A;  1I2E A;  1B2Z A;  1RGH A;  1FYS A;  1I3F A;  2KF4 A;  1BRG A;  8RNT A;  1B3S A;  1RN4 A;  1GMQ A;  1YNV X;  3URP A;  6GSP A;  1X1W A;  1B21 A;  1B2S A;  1G02 A;  1RGL A;  1AQZ A;  1T2H A;  1RMS A;  3DGY A;  1T2I A;  1I0V A;  4RNT A;  1BNJ A;  1BGS A;  1RGC A;  2ZA4 A;  1BSE A;  1YGW A;  2F56 A;  1GOU A;  1PY3 A;  1B20 A;  1RSN A;  2KAA A;  1MGW A;  1GSP A;  1ZGX A;  1JBT A;  3KCH A;  1UCJ A;  1GOV A;  1I2G A;  2C4B A;  3BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...