1GOUA

Ribonuclease binase (g specific endonuclease) unliganded form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
109
structure length
109
Chain Sequence
AVINTFDGVADYLIRYKRLPNDYITKSQASALGWVASKGDLAEVAPGKSIGGDVFSNREGRLPSAGSRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Substrate-Free Microbial Ribonuclease Binase and of its Complexes with 3'Gmp and Sulfate Ions
pubmed doi rcsb
source organism Bacillus intermedius
molecule tags Hydrolase
molecule keywords RIBONUCLEASE
total genus 25
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gouA00
1BRKA 4HOHA 1LRAA 2GSPA 2F56A 1I2EA 1ZGXA 1I0VA 1RGEA 2AAEA 1GOUA 1GMQA 1BOXA 1BANA 1G02A 4J5GA 1BRJA 1BNRA 1BVIA 1MGRA 2F5WA 1BSBA 1DETA 1YNVX 5BU4A 2RNTA 7RNTA 3SYUA 1PYLA 1RGLA 3KCHA 1AY7A 2RBIA 3Q3FA 1BNGA 5RNTA 4HAAA 7GSPA 1FZUA 3RNTA 1UCLA 1X1WA 3A5EA 5GSPA 6GSPA 1TTOA 1B3SA 4BIRA 3AGNA 2BIRA 1RNTA 1BRHA 3BU4A 1RSNA 3HOHA 1RNBA 4BU4A 1I2FA 1B2UA 1MGWA 1GMPA 1RN1A 1RN4A 3AGOA 1I8VA 1B2XA 1SARA 3AHSA 4GHOA 1I70A 2BU4A 2KF5A 3D4AA 1C54A 1X1YA 1RGFA 1R4YA 2F4YA 1I3FA 1RGGA 1BAOA 1RMSA 1HYFA 1B2SA 2KF6A 1B2ZA 1BRIA 1RGCA 1UCKA 1AQZA 1DE3A 1X1XA 1GOVA 2HOHA 1RTUA 1UCIA 2SARA 1RGHA 1RCLA 1TRQA 5HOHA 2KF3A 1X1UA 5BIRA 1GMRA 1JBRA 2KAAA 1FYSA 1Q9EA 2F5MA 1JBSA 1I3IA 1BU4A 1T2HA 3GSPA 1FUTA 1BRGA 1RGAA 1YVSA 1BNEA 1T2IA 1BSAA 4RNTA 1RGKA 1BNFA 1BRSA 1PY3A 1B27A 1JBTA 1TRPA 1FUSA 1A2PA 1BNIA 1BUJA 3URPA 1I0XA 8RNTA 1RHLA 2KF4A 1BNJA 3WR2A 1RCKA 1RLSA 2AADA 3AHWA 1GSPA 6RNTA 1IYYA 4GSPA 1B20A 1BNSA 1LOYA 3DH2A 3DGYA 1GOYA 4J5KA 3D5GA 1I2GA 1LNIA 3D5IA 1HZ1A 1YGWA 9RNTA 1BGSA 3WHOA 1UCJA 3BIRA 1FW7A 1BSDA 1BIRA 1BSEA 2ZA4A 1RDSA 1LOWA 1BRNL 1B2MA 1LOVA 1B21A 2C4BA 1CH0A 1BSCA
chains in the Genus database with same CATH superfamily
1BRKA 2W56B 1OACA 3WOEB 3SVAA 3PGBA 2XR8B 1OHOA 1W6CA 1W6GA 1I0VA 2BO9B 1GS3A 1GMQA 4N6V0 3PCRA 1G02A 2WGQA 3CCQ3 1BVIA 2GU1A 1YNVX 3DMCA 1STFI 3DGMA 4JRFA 3HZPA 3KSED 3SOAA 3SYUA 1G96A 1PYLA 2QGUA 1IQYA 3U97A 1W4NA 2CFGA 2XSHB 1STDA 4FMAA 1JZDA 2BMOB 2MF7A 1FGQA 1TJDA 3WA3A 1UW1A 3FZWA 3T8UA 3V92A 1UCLA 2A15A 2GXFA 1US1A 1SJWA 1E3VA 1WMOA 3CNXA 4MEIA 5GSPA 1TTOA 5IENA 1TU5A 4KFDA 3S28A 4KT3B 1UGIA 3AGNA 4G1MB 2GBXB 3F14A 2B24B 3F8XA 4JF8A 3BU4A 1RSNA 3HOHA 1RNBA 2C10A 2W6JH 1B2UA 1GMPA 2K0MA 1WTHA 3E99A 1I8VA 3JUNA 1YIJ3 3IMAB 1IDPA 5AEUB 1B2XA 3JUOA 5FGOA 2QEX3 5FW5A 1LQMB 1NB5I 4WFOA 3LTBA 3D4AA 2R41A 4LYLB 3NXJA 1QAFA 2CHCA 1I3FA 2CG0A 1GY5A 1Q42A 2WGOA 1BAOA 3EN1B 1YHQ3 1N8R4 1TUHA 1FA3A 3MPHA 1HYFA 3SLUA 3DY5A 2KF6A 3FG4A 3K9MC 3S27A 3EF8A 1BRIA 4OK0A 5IG0A 1OHSA 2OWPA 1DE3A 3HI7A 1IK3A 1M1K4 2W56A 3SX1A 3LOYA 2D1WA 3EC9A 2XGNA 1UCIA 1EEJA 1RGHA 1RJOA 1QJGA 1FGTA 1RCLA 2XH9A 3KZTA 4L8PA 5AYRB 1KWIA 3SXXA 1IVWA 1T3BA 4AKZA 2KAAA 1FYSA 1K734 1JNQA 2HMLB 1Q9EA 1U5OA 2F86B 3NHXA 1VQN3 1PU4A 1A67A 1I3IA 1BU4A 2CW9A 4R4KA 4LZIA 1JRQA 2XRXB 3PS8A 3K5TA 2XGLA 1Q40B 5AI1A 1YIT3 3FF2A 2C11A 4MMZB 2B1XB 5G1LA 4BTXA 3LTCA 3F8HA 1T2IA 1O7WB 4HM7B 4WHAA 2YX9A 4MJDA 1JKGA 1BRSA 2WOFA 3UL5A 5JPPA 1FGMA 3D3LA 2BMQB 1AR0A 1BNIA 1O7NB 1Q7HA 1YJW3 1I0XA 1BUJA 1EQKA 4QWTA 2H0IA 3BNBA 4KVHA 3WR2A 5BXQA 2CH9A 2AADA 3NV0A 1DVCA 3AHWA 1GSPA 3BB9A 3OWYA 6RNTA 1IYYA 1LOYA 5A0OB 5DRVA 3D5IA 4BTYA 4ILFA 1BGSA 3OV4A 5EEOA 3WHOA 3BIRA 1OF5A 1JKGB 1EG9B 3DXOA 1LOWA 1W02A 2RGQA 3S5CA 2IUKA 3M8CA 5IEOA 6STDA 1NNVA 3G16A 4I5QA 1V74A 2MC8A 5CXOA 3HK4A 1A2KA 1S5AA 2QA43 3NBRA 4HOHA 1TFKA 2RCDA 1LXEA 1QAKA 1I2EA 2RFRA 3UB1A 2XSOB 5IG3A 3GZYB 4I4KA 5AIGA 2AAEA 3G6E3 4HM8B 1BOXA 1BANA 4NREA 1IVUA 3N8BA 4RBNA 5IERA 2Y73A 1MGRA 2F5WA 1OCVA 3EBYA 3LMLA 3TDGA 1OHPA 1DETA 1EKMA 1ROVA 2JDIH 3HIGA 5M1AA 2IUJA 3K7CA 3X3ZA 1U8CB 1AY7A 8CHOA 4FMBA 4HM0B 3SEDA 2RBIA 3Q3FA 1JB4A 1CYVA 1BNGA 3F7SA 3X41A 2E2TA 1GY7A 1Q40A 1X1WA 4DKIA 3J7Yd 5AIHA 5KP3A 2JQ5A 4CCVA 3CCL3 4BIRA 3KIIA 2HMJB 3GZBA 3DGLA 3DZLA 2W03A 4HM4B 3L0RA 4BU4A 2IA7A 1KD14 1CYUA 3GAXA 4FR9A 1MGWA 1RN1A 3AGOA 2KRTA 3IPTA 4HM6B 3N9HA 5ELUA 1W5ZA 2F99A 2KCDA 5AEWB 1ISKA 1SARA 1ZO2A 1NB3I 2HMNB 1SIIA 3B7CA 2CX1A 2CWTA 3NUVA 1C54A 3PYJA 1RGFA 1R4YA 2F4YA 3BNCA 1KQS2 1QVF2 4IPBA 1A2VA 4WYKA 1NO3A 1OGXA 1W7CA 3F9SA 4R9KA 1RMSA 2W0QA 3FCSB 3CC23 2W2CA 1B2SA 3CU3A 4LGQA 2W9PA 3T8NA 4EV2A 3FKAA 2FNQA 1K28A 3B8LA 3MKIA 3EN8A 1NDOB 1UCKA 3VSYA 2CFKA 2IY2A 1VQO3 1V58A 2ZL8A 4EW5A 4OVMA 1C7HA 1ULIB 3JUQA 3QRDA 3CCS3 3HIIA 1K9M4 1W6YA 4L7KA 5BIRA 1VQ93 3EE1A 1JBRA 3MYTA 4CPKA 1L5GB 1Q7Y4 5CK6A 1VZZA 3FGYA 3MG3A 5LC6A 1D6ZA 3ECFA 2P38A 1T2HA 2PZVA 3GSPA 1HKXA 3EJVA 3QK9A 4HM1B 3EQQB 3UJMA 2CWUA 1VQ73 3DUKA 1A90A 3KKGA 1ASKA 3G0KA 1BSAA 2GEYA 1MWTA 4J8TA 4KFEA 1OGZA 1ZS7A 2WO0A 4ORLA 3DGOA 2IMJA 3KFQC 1JBTA 4K1UA 1A2PA 1N5HA 3K0ZA 3F40A 1RHLA 2KF4A 1TP6A 1BNJA 5CF2A 1IT8A 3FG1A 1IVXA 2CIUA 1YI23 5AYSC 1RCKA 1YGEA 2CK3H 1TIJA 1EUIC 4GL6A 1BNSA 3DH2A 3DGYA 3LXUX 4J5KA 3SOYA 5CF1A 1LNHA 1N9EA 2E2UA 9RNTA 4O8SA 3CCR3 3LT8A 1RRLA 2HMMB 1GD3A 4STDA 2OQEA 1FW7A 2BT3A 5KP4A 2XFSA 3GZRA 3B4PA 4Q53A 3EX9A 3H51A 1B21A 2CKFB 1K41A 3CCM3 1F8NA 1LQGC 1WNHA 3MG1A 1CH0A 2M7OA 3GZXB 3CMA3 5LC7A 4N6UA 1O7HB 2HMOB 1GYBA 1LRAA 2GSPA 2F56A 2H0HA 2PNCA 1ULJB 1Y4KA 3VF1A 1YJN3 1GOUA 4HM3B 3NQZA 1BRJA 3OX9A 1ROAA 1JZOA 1BNRA 2O9UX 3WODG 5JBSA 3RGRA 5BU4A 3H3HA 1M904 1RRHA 2FXTA 5STDA 1W01A 7RNTA 1JN5B 1RGLA 3KCHA 3N54B 3Q1CA 2YFLB 4R80A 4N6OB 1N9JA 3CPOA 3MG2A 4WP5A 5RNTA 1IQ8A 3ROBA 1JB5A 2XEPA 4RNZA 7GSPA 2CC3A 6GSPA 4IT7A 1O7MB 1PFPA 1Q824 4O02B 3JUPA 4EXRA 3FH1A 2BIRA 1GD4A 4BTWA 5IF6A 3G713 1RNTA 1BRHA 4K1VA 1OPYA 2I9WA 4TX4A 1IVVA 3CPW2 3VGNA 3G4S3 3CME3 4XBXA 5HGRA 1MWSA 1KSIA 1N5PA 2LQVA 3FLJA 3CCU3 4PEJA 1D6YA 4HJLB 5IG5A 2ML6A 1JN5A 3EBTA 5TGNA 4GHOA 2OOVA 1VQ43 1UGHI 1AVLA 2CFWA 3JVCA 4GB5A 3OXAA 2BU4A 2KF5A 1X1YA 3Q2PA 3NQYA 1UI8A 2L1SA 2CWVA 1OUNA 3LYGA 4OUQA 3CC43 2L4VA 3D79A 4RNYA 4EC6A 1B2ZA 1LVNA 3CXC2 2OCTA 1RGCA 2GBWB 1X1XA 4IIAA 5D83A 1G0TA 1GOVA 2O3OA 2HOHA 1MNLA 1RTUA 1K8A4 4NPBA 1VQ63 1VQK3 3WOFB 1YJ93 4H61A 3UL6A 1NU3A 5HOHA 2KF3A 3I563 4NHFA 4J9AA 4LMIA 4EYCA 4EV5A 1VQQA 3DM8A 3F7XA 1DMMA 7STDA 2Z76A 4XM4A 2OOVC 1FUTA 4O3VA 2WOHA 5IW9A 3OWSA 3MWZA 1BRGA 3B4OA 2UUGC 4HVNA 1WMNA 1YVSA 1MWUA 1UUVB 3STDA 3PCSA 3KSPA 4FMCA 4RZMA 3MSOA 5G2GA 3JUMA 1PY3A 1TFOA 1B27A 1OH0A 5DREA 5BVBA 1FUSA 3URPA 2LYXA 3S67A 8RNTA 2Z6BA 4XBYA 3FSDA 4EBGA 1BUQA 5EVHA 1HU9A 1T5YA 2INXA 4FCMA 2ZDJA 1V57A 3NX0A 5G1KA 4GSPA 3MHEA 4X2OA 1GY6A 1GOYA 4HZBB 2W04A 1I2GA 1LNIA 1W2ZA 2BMRB 3G8ZA 1QVG2 1Q864 2ML5A 1UCJA 5EQLA 2OTJ3 3PXMA 1BIRA 2H0GA 1UDII 2ZA4A 3I0YA 4N6LA 5D81A 4K61A 1RDSA 3LZAA 1RKYA 1BRNL 2F98A 1NWWA 1O7PB 2YFJB 3GRDA 1B2MA 1LOVA 1M9GA 1CEWI 4LEHA 3CD63 2KXGA 4N6NB 1JB2A 2C4BA 3NM7A 4HBRA 3S29A 1VQP3 4KZ1A 2K3DA 3LTDA 4XDVA 2J8XB 2ZHXB 1ZGXA 1DYUA 4ZM8A 1N8QA 4R1KA 5CLKA 1RGEA 2RSXA 3CC73 3CCV3 4J5GA 2XF3A 3LH4A 5M19A 1BSBA 2RNTA 4FCZA 1DMNA 3U1WA 1ZX2A 3NBJA 4L8OA 4AEQA 3D9RA 1VQL3 1VQM3 1O7GB 3X42A 4HAAA 3A76A 3BNEA 1QMAA 1FZUA 3OWUA 4HZ9B 1FGOA 2IYJA 3A5EA 1SPUA 3RNTA 3OW22 3FG3A 1MOLA 4N3VA 1B3SA 5KP1A 2UGIA 4MMYB 3CCJ3 4HM2B 1AVKA 2CFDA 3WDGB 1FGRA 2P0XA 3I553 1I2FA 3ER7A 5M18A 1RN4A 1IU7A 4LSOA 1Q814 1YVBI 3BLZA 1VQ53 3RDEA 3LT9A 4N6TA 2P09A 1E97A 3AHSA 3DGNA 1I70A 1EA2A 1S723 1IQXA 1JV2B 1UUWB 4FCJA 2OQEC 3CNMA 1W2B2 2R4IA 2FGTA 3ALAA 1RGGA 2GEXA 1SIHA 1DVDA 2E2VA 3FF0A 2BNGA 3X40A 4U13A 5ELJA 1KC84 2Q07A 1D6UA 5D82A 3ZG5A 3KN4A 1Z1SA 1NJI4 2OTL3 4HYZA 1QALA 1AQZA 3PZWA 2CG1A 3WA2X 4HKVB 1M1XB 3EB8A 5AIFA 4BL2A 2CX0A 2CFLA 2SARA 1AV4A 3AMOA 2QIYA 3LTAA 1TRQA 1X1UA 1VQ83 1GMRA 2BHMA 3IJEB 4FMDA 3T0UA 2F5MA 1E3RA 1JBSA 2Y74A 3BNDA 4CJNA 2V1LA 1RN7A 5I97A 4X2HA 3V99A 1IV9A 1R4CA 2Z7AA 4WYKB 3KE7A 2P05A 1W00A 4MMXB 1UUGB 3GWRA 3NV0B 1DMQA 4XB5A 2K54A 1FUWA 1IT7A 1RGAA 3EHCA 1BNEA 5AIIA 4KFFA 4O2HA 4RNTA 1RGKA 1BNFA 1WQLB 3WMDA 4CDLA 3O8YA 3ZG0A 4AKYA 5IEPA 4H3UA 1LOXA 1TRPA 2D42A 1OF5B 1SQWA 2W9QA 4BL3A 2P0MA 1WMPA 3CCE3 3K63A 2SBLA 3UNLA 5JPUA 1J2BA 1CQSA 1RLSA 3NM2A 3V98A 2HMKB 1B20A 2Z77A 3Q90A 4XDWA 4N6MA 2XFTA 1IV7A 4K90B 3D5GA 4WWUC 2GU3A 1HZ1A 1YGWA 2UX0A 4HM5B 3RGAA 3NBBA 3X3XA 1MWRA 1BSDA 2STDA 1BSEA 1UI7A 2YFIB 5IG4A 3AMOB 3X3YA 3HX8A 3ZFZA 1JJ22 4R9LA 4XBTA 1BSCA
chains in the Genus database with same CATH topology
1BRKA 4HOHA 1LRAA 2GSPA 2F56A 1I2EA 1ZGXA 1I0VA 1RGEA 2AAEA 1GOUA 1GMQA 1BOXA 1BANA 1G02A 4J5GA 1BRJA 1BNRA 1BVIA 1MGRA 2F5WA 1BSBA 1DETA 1YNVX 5BU4A 2RNTA 7RNTA 3SYUA 1PYLA 1RGLA 3KCHA 1AY7A 2RBIA 3Q3FA 1BNGA 5RNTA 4HAAA 7GSPA 1FZUA 3RNTA 1UCLA 1X1WA 3A5EA 5GSPA 6GSPA 1TTOA 1B3SA 4BIRA 3AGNA 2BIRA 1RNTA 1BRHA 3BU4A 1RSNA 3HOHA 1RNBA 4BU4A 1I2FA 1B2UA 1MGWA 1GMPA 1RN1A 1RN4A 3AGOA 1I8VA 1B2XA 1SARA 3AHSA 4GHOA 1I70A 2BU4A 2KF5A 3D4AA 1C54A 1X1YA 1RGFA 1R4YA 2F4YA 1I3FA 1RGGA 1BAOA 1RMSA 1HYFA 1B2SA 2KF6A 1B2ZA 1BRIA 1RGCA 1UCKA 1AQZA 1DE3A 1X1XA 1GOVA 2HOHA 1RTUA 1UCIA 2SARA 1RGHA 1RCLA 1TRQA 5HOHA 2KF3A 1X1UA 5BIRA 1GMRA 1JBRA 2KAAA 1FYSA 1Q9EA 2F5MA 1JBSA 1I3IA 1BU4A 1T2HA 3GSPA 1FUTA 1BRGA 1RGAA 1YVSA 1BNEA 1T2IA 1BSAA 4RNTA 1RGKA 1BNFA 1BRSA 1PY3A 1B27A 1JBTA 1TRPA 1FUSA 1A2PA 1BNIA 1BUJA 3URPA 1I0XA 8RNTA 1RHLA 2KF4A 1BNJA 3WR2A 1RCKA 1RLSA 2AADA 3AHWA 1GSPA 6RNTA 1IYYA 4GSPA 1B20A 1BNSA 1LOYA 3DH2A 3DGYA 1GOYA 4J5KA 3D5GA 1I2GA 1LNIA 3D5IA 1HZ1A 1YGWA 9RNTA 1BGSA 3WHOA 1UCJA 3BIRA 1FW7A 1BSDA 1BIRA 1BSEA 2ZA4A 1RDSA 1LOWA 1BRNL 1B2MA 1LOVA 1B21A 2C4BA 1CH0A 1BSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRK A;  4HOH A;  1LRA A;  2GSP A;  2F56 A;  1I2E A;  1ZGX A;  1I0V A;  1RGE A;  2AAE A;  1GOU A;  1GMQ A;  1BOX A;  1BAN A;  1G02 A;  4J5G A;  1BRJ A;  1BNR A;  1BVI A;  1MGR A;  2F5W A;  1BSB A;  1DET A;  1YNV X;  5BU4 A;  2RNT A;  7RNT A;  3SYU A;  1PYL A;  1RGL A;  3KCH A;  1AY7 A;  2RBI A;  3Q3F A;  1BNG A;  5RNT A;  4HAA A;  7GSP A;  1FZU A;  3RNT A;  1UCL A;  1X1W A;  3A5E A;  5GSP A;  6GSP A;  1TTO A;  1B3S A;  4BIR A;  3AGN A;  2BIR A;  1RNT A;  1BRH A;  3BU4 A;  1RSN A;  3HOH A;  1RNB A;  4BU4 A;  1I2F A;  1B2U A;  1MGW A;  1GMP A;  1RN1 A;  1RN4 A;  3AGO A;  1I8V A;  1B2X A;  1SAR A;  3AHS A;  4GHO A;  1I70 A;  2BU4 A;  2KF5 A;  3D4A A;  1C54 A;  1X1Y A;  1RGF A;  1R4Y A;  2F4Y A;  1I3F A;  1RGG A;  1BAO A;  1RMS A;  1HYF A;  1B2S A;  2KF6 A;  1B2Z A;  1BRI A;  1RGC A;  1UCK A;  1AQZ A;  1DE3 A;  1X1X A;  1GOV A;  2HOH A;  1RTU A;  1UCI A;  2SAR A;  1RGH A;  1RCL A;  1TRQ A;  5HOH A;  2KF3 A;  1X1U A;  5BIR A;  1GMR A;  1JBR A;  2KAA A;  1FYS A;  1Q9E A;  2F5M A;  1JBS A;  1I3I A;  1BU4 A;  1T2H A;  3GSP A;  1FUT A;  1BRG A;  1RGA A;  1YVS A;  1BNE A;  1T2I A;  1BSA A;  4RNT A;  1RGK A;  1BNF A;  1BRS A;  1PY3 A;  1B27 A;  1JBT A;  1TRP A;  1FUS A;  1A2P A;  1BNI A;  1BUJ A;  3URP A;  1I0X A;  8RNT A;  1RHL A;  2KF4 A;  1BNJ A;  3WR2 A;  1RCK A;  1RLS A;  2AAD A;  3AHW A;  1GSP A;  6RNT A;  1IYY A;  4GSP A;  1B20 A;  1BNS A;  1LOY A;  3DH2 A;  3DGY A;  1GOY A;  4J5K A;  3D5G A;  1I2G A;  1LNI A;  3D5I A;  1HZ1 A;  1YGW A;  9RNT A;  1BGS A;  3WHO A;  1UCJ A;  3BIR A;  1FW7 A;  1BSD A;  1BIR A;  1BSE A;  2ZA4 A;  1RDS A;  1LOW A;  1BRN L;  1B2M A;  1LOV A;  1B21 A;  2C4B A;  1CH0 A;  1BSC A; 
#chains in the Genus database with same CATH topology
 1BRK A;  2W56 B;  1OAC A;  3WOE B;  3SVA A;  3PGB A;  2XR8 B;  1OHO A;  1W6C A;  1W6G A;  1I0V A;  2BO9 B;  1GS3 A;  1GMQ A;  4N6V 0;  3PCR A;  1G02 A;  2WGQ A;  3CCQ 3;  1BVI A;  2GU1 A;  1YNV X;  3DMC A;  1STF I;  3DGM A;  4JRF A;  3HZP A;  3KSE D;  3SOA A;  3SYU A;  1G96 A;  1PYL A;  2QGU A;  1IQY A;  3U97 A;  1W4N A;  2CFG A;  2XSH B;  1STD A;  4FMA A;  1JZD A;  2BMO B;  2MF7 A;  1FGQ A;  1TJD A;  3WA3 A;  1UW1 A;  3FZW A;  3T8U A;  3V92 A;  1UCL A;  2A15 A;  2GXF A;  1US1 A;  1SJW A;  1E3V A;  1WMO A;  3CNX A;  4MEI A;  5GSP A;  1TTO A;  5IEN A;  1TU5 A;  4KFD A;  3S28 A;  4KT3 B;  1UGI A;  3AGN A;  4G1M B;  2GBX B;  3F14 A;  2B24 B;  3F8X A;  4JF8 A;  3BU4 A;  1RSN A;  3HOH A;  1RNB A;  2C10 A;  2W6J H;  1B2U A;  1GMP A;  2K0M A;  1WTH A;  3E99 A;  1I8V A;  3JUN A;  1YIJ 3;  3IMA B;  1IDP A;  5AEU B;  1B2X A;  3JUO A;  5FGO A;  2QEX 3;  5FW5 A;  1LQM B;  1NB5 I;  4WFO A;  3LTB A;  3D4A A;  2R41 A;  4LYL B;  3NXJ A;  1QAF A;  2CHC A;  1I3F A;  2CG0 A;  1GY5 A;  1Q42 A;  2WGO A;  1BAO A;  3EN1 B;  1YHQ 3;  1N8R 4;  1TUH A;  1FA3 A;  3MPH A;  1HYF A;  3SLU A;  3DY5 A;  2KF6 A;  3FG4 A;  3K9M C;  3S27 A;  3EF8 A;  1BRI A;  4OK0 A;  5IG0 A;  1OHS A;  2OWP A;  1DE3 A;  3HI7 A;  1IK3 A;  1M1K 4;  2W56 A;  3SX1 A;  3LOY A;  2D1W A;  3EC9 A;  2XGN A;  1UCI A;  1EEJ A;  1RGH A;  1RJO A;  1QJG A;  1FGT A;  1RCL A;  2XH9 A;  3KZT A;  4L8P A;  5AYR B;  1KWI A;  3SXX A;  1IVW A;  1T3B A;  4AKZ A;  2KAA A;  1FYS A;  1K73 4;  1JNQ A;  2HML B;  1Q9E A;  1U5O A;  2F86 B;  3NHX A;  1VQN 3;  1PU4 A;  1A67 A;  1I3I A;  1BU4 A;  2CW9 A;  4R4K A;  4LZI A;  1JRQ A;  2XRX B;  3PS8 A;  3K5T A;  2XGL A;  1Q40 B;  5AI1 A;  1YIT 3;  3FF2 A;  2C11 A;  4MMZ B;  2B1X B;  5G1L A;  4BTX A;  3LTC A;  3F8H A;  1T2I A;  1O7W B;  4HM7 B;  4WHA A;  2YX9 A;  4MJD A;  1JKG A;  1BRS A;  2WOF A;  3UL5 A;  5JPP A;  1FGM A;  3D3L A;  2BMQ B;  1AR0 A;  1BNI A;  1O7N B;  1Q7H A;  1YJW 3;  1I0X A;  1BUJ A;  1EQK A;  4QWT A;  2H0I A;  3BNB A;  4KVH A;  3WR2 A;  5BXQ A;  2CH9 A;  2AAD A;  3NV0 A;  1DVC A;  3AHW A;  1GSP A;  3BB9 A;  3OWY A;  6RNT A;  1IYY A;  1LOY A;  5A0O B;  5DRV A;  3D5I A;  4BTY A;  4ILF A;  1BGS A;  3OV4 A;  5EEO A;  3WHO A;  3BIR A;  1OF5 A;  1JKG B;  1EG9 B;  3DXO A;  1LOW A;  1W02 A;  2RGQ A;  3S5C A;  2IUK A;  3M8C A;  5IEO A;  6STD A;  1NNV A;  3G16 A;  4I5Q A;  1V74 A;  2MC8 A;  5CXO A;  3HK4 A;  1A2K A;  1S5A A;  2QA4 3;  3NBR A;  4HOH A;  1TFK A;  2RCD A;  1LXE A;  1QAK A;  1I2E A;  2RFR A;  3UB1 A;  2XSO B;  5IG3 A;  3GZY B;  4I4K A;  5AIG A;  2AAE A;  3G6E 3;  4HM8 B;  1BOX A;  1BAN A;  4NRE A;  1IVU A;  3N8B A;  4RBN A;  5IER A;  2Y73 A;  1MGR A;  2F5W A;  1OCV A;  3EBY A;  3LML A;  3TDG A;  1OHP A;  1DET A;  1EKM A;  1ROV A;  2JDI H;  3HIG A;  5M1A A;  2IUJ A;  3K7C A;  3X3Z A;  1U8C B;  1AY7 A;  8CHO A;  4FMB A;  4HM0 B;  3SED A;  2RBI A;  3Q3F A;  1JB4 A;  1CYV A;  1BNG A;  3F7S A;  3X41 A;  2E2T A;  1GY7 A;  1Q40 A;  1X1W A;  4DKI A;  3J7Y d;  5AIH A;  5KP3 A;  2JQ5 A;  4CCV A;  3CCL 3;  4BIR A;  3KII A;  2HMJ B;  3GZB A;  3DGL A;  3DZL A;  2W03 A;  4HM4 B;  3L0R A;  4BU4 A;  2IA7 A;  1KD1 4;  1CYU A;  3GAX A;  4FR9 A;  1MGW A;  1RN1 A;  3AGO A;  2KRT A;  3IPT A;  4HM6 B;  3N9H A;  5ELU A;  1W5Z A;  2F99 A;  2KCD A;  5AEW B;  1ISK A;  1SAR A;  1ZO2 A;  1NB3 I;  2HMN B;  1SII A;  3B7C A;  2CX1 A;  2CWT A;  3NUV A;  1C54 A;  3PYJ A;  1RGF A;  1R4Y A;  2F4Y A;  3BNC A;  1KQS 2;  1QVF 2;  4IPB A;  1A2V A;  4WYK A;  1NO3 A;  1OGX A;  1W7C A;  3F9S A;  4R9K A;  1RMS A;  2W0Q A;  3FCS B;  3CC2 3;  2W2C A;  1B2S A;  3CU3 A;  4LGQ A;  2W9P A;  3T8N A;  4EV2 A;  3FKA A;  2FNQ A;  1K28 A;  3B8L A;  3MKI A;  3EN8 A;  1NDO B;  1UCK A;  3VSY A;  2CFK A;  2IY2 A;  1VQO 3;  1V58 A;  2ZL8 A;  4EW5 A;  4OVM A;  1C7H A;  1ULI B;  3JUQ A;  3QRD A;  3CCS 3;  3HII A;  1K9M 4;  1W6Y A;  4L7K A;  5BIR A;  1VQ9 3;  3EE1 A;  1JBR A;  3MYT A;  4CPK A;  1L5G B;  1Q7Y 4;  5CK6 A;  1VZZ A;  3FGY A;  3MG3 A;  5LC6 A;  1D6Z A;  3ECF A;  2P38 A;  1T2H A;  2PZV A;  3GSP A;  1HKX A;  3EJV A;  3QK9 A;  4HM1 B;  3EQQ B;  3UJM A;  2CWU A;  1VQ7 3;  3DUK A;  1A90 A;  3KKG A;  1ASK A;  3G0K A;  1BSA A;  2GEY A;  1MWT A;  4J8T A;  4KFE A;  1OGZ A;  1ZS7 A;  2WO0 A;  4ORL A;  3DGO A;  2IMJ A;  3KFQ C;  1JBT A;  4K1U A;  1A2P A;  1N5H A;  3K0Z A;  3F40 A;  1RHL A;  2KF4 A;  1TP6 A;  1BNJ A;  5CF2 A;  1IT8 A;  3FG1 A;  1IVX A;  2CIU A;  1YI2 3;  5AYS C;  1RCK A;  1YGE A;  2CK3 H;  1TIJ A;  1EUI C;  4GL6 A;  1BNS A;  3DH2 A;  3DGY A;  3LXU X;  4J5K A;  3SOY A;  5CF1 A;  1LNH A;  1N9E A;  2E2U A;  9RNT A;  4O8S A;  3CCR 3;  3LT8 A;  1RRL A;  2HMM B;  1GD3 A;  4STD A;  2OQE A;  1FW7 A;  2BT3 A;  5KP4 A;  2XFS A;  3GZR A;  3B4P A;  4Q53 A;  3EX9 A;  3H51 A;  1B21 A;  2CKF B;  1K41 A;  3CCM 3;  1F8N A;  1LQG C;  1WNH A;  3MG1 A;  1CH0 A;  2M7O A;  3GZX B;  3CMA 3;  5LC7 A;  4N6U A;  1O7H B;  2HMO B;  1GYB A;  1LRA A;  2GSP A;  2F56 A;  2H0H A;  2PNC A;  1ULJ B;  1Y4K A;  3VF1 A;  1YJN 3;  1GOU A;  4HM3 B;  3NQZ A;  1BRJ A;  3OX9 A;  1ROA A;  1JZO A;  1BNR A;  2O9U X;  3WOD G;  5JBS A;  3RGR A;  5BU4 A;  3H3H A;  1M90 4;  1RRH A;  2FXT A;  5STD A;  1W01 A;  7RNT A;  1JN5 B;  1RGL A;  3KCH A;  3N54 B;  3Q1C A;  2YFL B;  4R80 A;  4N6O B;  1N9J A;  3CPO A;  3MG2 A;  4WP5 A;  5RNT A;  1IQ8 A;  3ROB A;  1JB5 A;  2XEP A;  4RNZ A;  7GSP A;  2CC3 A;  6GSP A;  4IT7 A;  1O7M B;  1PFP A;  1Q82 4;  4O02 B;  3JUP A;  4EXR A;  3FH1 A;  2BIR A;  1GD4 A;  4BTW A;  5IF6 A;  3G71 3;  1RNT A;  1BRH A;  4K1V A;  1OPY A;  2I9W A;  4TX4 A;  1IVV A;  3CPW 2;  3VGN A;  3G4S 3;  3CME 3;  4XBX A;  5HGR A;  1MWS A;  1KSI A;  1N5P A;  2LQV A;  3FLJ A;  3CCU 3;  4PEJ A;  1D6Y A;  4HJL B;  5IG5 A;  2ML6 A;  1JN5 A;  3EBT A;  5TGN A;  4GHO A;  2OOV A;  1VQ4 3;  1UGH I;  1AVL A;  2CFW A;  3JVC A;  4GB5 A;  3OXA A;  2BU4 A;  2KF5 A;  1X1Y A;  3Q2P A;  3NQY A;  1UI8 A;  2L1S A;  2CWV A;  1OUN A;  3LYG A;  4OUQ A;  3CC4 3;  2L4V A;  3D79 A;  4RNY A;  4EC6 A;  1B2Z A;  1LVN A;  3CXC 2;  2OCT A;  1RGC A;  2GBW B;  1X1X A;  4IIA A;  5D83 A;  1G0T A;  1GOV A;  2O3O A;  2HOH A;  1MNL A;  1RTU A;  1K8A 4;  4NPB A;  1VQ6 3;  1VQK 3;  3WOF B;  1YJ9 3;  4H61 A;  3UL6 A;  1NU3 A;  5HOH A;  2KF3 A;  3I56 3;  4NHF A;  4J9A A;  4LMI A;  4EYC A;  4EV5 A;  1VQQ A;  3DM8 A;  3F7X A;  1DMM A;  7STD A;  2Z76 A;  4XM4 A;  2OOV C;  1FUT A;  4O3V A;  2WOH A;  5IW9 A;  3OWS A;  3MWZ A;  1BRG A;  3B4O A;  2UUG C;  4HVN A;  1WMN A;  1YVS A;  1MWU A;  1UUV B;  3STD A;  3PCS A;  3KSP A;  4FMC A;  4RZM A;  3MSO A;  5G2G A;  3JUM A;  1PY3 A;  1TFO A;  1B27 A;  1OH0 A;  5DRE A;  5BVB A;  1FUS A;  3URP A;  2LYX A;  3S67 A;  8RNT A;  2Z6B A;  4XBY A;  3FSD A;  4EBG A;  1BUQ A;  5EVH A;  1HU9 A;  1T5Y A;  2INX A;  4FCM A;  2ZDJ A;  1V57 A;  3NX0 A;  5G1K A;  4GSP A;  3MHE A;  4X2O A;  1GY6 A;  1GOY A;  4HZB B;  2W04 A;  1I2G A;  1LNI A;  1W2Z A;  2BMR B;  3G8Z A;  1QVG 2;  1Q86 4;  2ML5 A;  1UCJ A;  5EQL A;  2OTJ 3;  3PXM A;  1BIR A;  2H0G A;  1UDI I;  2ZA4 A;  3I0Y A;  4N6L A;  5D81 A;  4K61 A;  1RDS A;  3LZA A;  1RKY A;  1BRN L;  2F98 A;  1NWW A;  1O7P B;  2YFJ B;  3GRD A;  1B2M A;  1LOV A;  1M9G A;  1CEW I;  4LEH A;  3CD6 3;  2KXG A;  4N6N B;  1JB2 A;  2C4B A;  3NM7 A;  4HBR A;  3S29 A;  1VQP 3;  4KZ1 A;  2K3D A;  3LTD A;  4XDV A;  2J8X B;  2ZHX B;  1ZGX A;  1DYU A;  4ZM8 A;  1N8Q A;  4R1K A;  5CLK A;  1RGE A;  2RSX A;  3CC7 3;  3CCV 3;  4J5G A;  2XF3 A;  3LH4 A;  5M19 A;  1BSB A;  2RNT A;  4FCZ A;  1DMN A;  3U1W A;  1ZX2 A;  3NBJ A;  4L8O A;  4AEQ A;  3D9R A;  1VQL 3;  1VQM 3;  1O7G B;  3X42 A;  4HAA A;  3A76 A;  3BNE A;  1QMA A;  1FZU A;  3OWU A;  4HZ9 B;  1FGO A;  2IYJ A;  3A5E A;  1SPU A;  3RNT A;  3OW2 2;  3FG3 A;  1MOL A;  4N3V A;  1B3S A;  5KP1 A;  2UGI A;  4MMY B;  3CCJ 3;  4HM2 B;  1AVK A;  2CFD A;  3WDG B;  1FGR A;  2P0X A;  3I55 3;  1I2F A;  3ER7 A;  5M18 A;  1RN4 A;  1IU7 A;  4LSO A;  1Q81 4;  1YVB I;  3BLZ A;  1VQ5 3;  3RDE A;  3LT9 A;  4N6T A;  2P09 A;  1E97 A;  3AHS A;  3DGN A;  1I70 A;  1EA2 A;  1S72 3;  1IQX A;  1JV2 B;  1UUW B;  4FCJ A;  2OQE C;  3CNM A;  1W2B 2;  2R4I A;  2FGT A;  3ALA A;  1RGG A;  2GEX A;  1SIH A;  1DVD A;  2E2V A;  3FF0 A;  2BNG A;  3X40 A;  4U13 A;  5ELJ A;  1KC8 4;  2Q07 A;  1D6U A;  5D82 A;  3ZG5 A;  3KN4 A;  1Z1S A;  1NJI 4;  2OTL 3;  4HYZ A;  1QAL A;  1AQZ A;  3PZW A;  2CG1 A;  3WA2 X;  4HKV B;  1M1X B;  3EB8 A;  5AIF A;  4BL2 A;  2CX0 A;  2CFL A;  2SAR A;  1AV4 A;  3AMO A;  2QIY A;  3LTA A;  1TRQ A;  1X1U A;  1VQ8 3;  1GMR A;  2BHM A;  3IJE B;  4FMD A;  3T0U A;  2F5M A;  1E3R A;  1JBS A;  2Y74 A;  3BND A;  4CJN A;  2V1L A;  1RN7 A;  5I97 A;  4X2H A;  3V99 A;  1IV9 A;  1R4C A;  2Z7A A;  4WYK B;  3KE7 A;  2P05 A;  1W00 A;  4MMX B;  1UUG B;  3GWR A;  3NV0 B;  1DMQ A;  4XB5 A;  2K54 A;  1FUW A;  1IT7 A;  1RGA A;  3EHC A;  1BNE A;  5AII A;  4KFF A;  4O2H A;  4RNT A;  1RGK A;  1BNF A;  1WQL B;  3WMD A;  4CDL A;  3O8Y A;  3ZG0 A;  4AKY A;  5IEP A;  4H3U A;  1LOX A;  1TRP A;  2D42 A;  1OF5 B;  1SQW A;  2W9Q A;  4BL3 A;  2P0M A;  1WMP A;  3CCE 3;  3K63 A;  2SBL A;  3UNL A;  5JPU A;  1J2B A;  1CQS A;  1RLS A;  3NM2 A;  3V98 A;  2HMK B;  1B20 A;  2Z77 A;  3Q90 A;  4XDW A;  4N6M A;  2XFT A;  1IV7 A;  4K90 B;  3D5G A;  4WWU C;  2GU3 A;  1HZ1 A;  1YGW A;  2UX0 A;  4HM5 B;  3RGA A;  3NBB A;  3X3X A;  1MWR A;  1BSD A;  2STD A;  1BSE A;  1UI7 A;  2YFI B;  5IG4 A;  3AMO B;  3X3Y A;  3HX8 A;  3ZFZ A;  1JJ2 2;  4R9L A;  4XBT A;  1BSC A; 
#chains in the Genus database with same CATH homology
 1BRK A;  4HOH A;  1LRA A;  2GSP A;  2F56 A;  1I2E A;  1ZGX A;  1I0V A;  1RGE A;  2AAE A;  1GOU A;  1GMQ A;  1BOX A;  1BAN A;  1G02 A;  4J5G A;  1BRJ A;  1BNR A;  1BVI A;  1MGR A;  2F5W A;  1BSB A;  1DET A;  1YNV X;  5BU4 A;  2RNT A;  7RNT A;  3SYU A;  1PYL A;  1RGL A;  3KCH A;  1AY7 A;  2RBI A;  3Q3F A;  1BNG A;  5RNT A;  4HAA A;  7GSP A;  1FZU A;  3RNT A;  1UCL A;  1X1W A;  3A5E A;  5GSP A;  6GSP A;  1TTO A;  1B3S A;  4BIR A;  3AGN A;  2BIR A;  1RNT A;  1BRH A;  3BU4 A;  1RSN A;  3HOH A;  1RNB A;  4BU4 A;  1I2F A;  1B2U A;  1MGW A;  1GMP A;  1RN1 A;  1RN4 A;  3AGO A;  1I8V A;  1B2X A;  1SAR A;  3AHS A;  4GHO A;  1I70 A;  2BU4 A;  2KF5 A;  3D4A A;  1C54 A;  1X1Y A;  1RGF A;  1R4Y A;  2F4Y A;  1I3F A;  1RGG A;  1BAO A;  1RMS A;  1HYF A;  1B2S A;  2KF6 A;  1B2Z A;  1BRI A;  1RGC A;  1UCK A;  1AQZ A;  1DE3 A;  1X1X A;  1GOV A;  2HOH A;  1RTU A;  1UCI A;  2SAR A;  1RGH A;  1RCL A;  1TRQ A;  5HOH A;  2KF3 A;  1X1U A;  5BIR A;  1GMR A;  1JBR A;  2KAA A;  1FYS A;  1Q9E A;  2F5M A;  1JBS A;  1I3I A;  1BU4 A;  1T2H A;  3GSP A;  1FUT A;  1BRG A;  1RGA A;  1YVS A;  1BNE A;  1T2I A;  1BSA A;  4RNT A;  1RGK A;  1BNF A;  1BRS A;  1PY3 A;  1B27 A;  1JBT A;  1TRP A;  1FUS A;  1A2P A;  1BNI A;  1BUJ A;  3URP A;  1I0X A;  8RNT A;  1RHL A;  2KF4 A;  1BNJ A;  3WR2 A;  1RCK A;  1RLS A;  2AAD A;  3AHW A;  1GSP A;  6RNT A;  1IYY A;  4GSP A;  1B20 A;  1BNS A;  1LOY A;  3DH2 A;  3DGY A;  1GOY A;  4J5K A;  3D5G A;  1I2G A;  1LNI A;  3D5I A;  1HZ1 A;  1YGW A;  9RNT A;  1BGS A;  3WHO A;  1UCJ A;  3BIR A;  1FW7 A;  1BSD A;  1BIR A;  1BSE A;  2ZA4 A;  1RDS A;  1LOW A;  1BRN L;  1B2M A;  1LOV A;  1B21 A;  2C4B A;  1CH0 A;  1BSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...